WorldWideScience

Sample records for c region

  1. DNA barcode regions for differentiating Cattleya walkeriana and C. loddigesii

    Directory of Open Access Journals (Sweden)

    Hernando Rivera-Jiménez

    2017-05-01

    Full Text Available Growers appreciate Cattleya walkeriana and C. loddigesii due to striking shape and rarity. Thus, this study aimed to evaluate the feasibility of DNA barcode regions, namely ITS1, ITS2 and rpoC1, to discriminate between C. walkeriana and C. loddigesii species. DNA barcode regions were successfully amplified using primers designed to amplify plants. We also included sequences from public databases in order to test if these regions were able to discriminate C. walkeriana and C. loddigesii from other Cattleya species. These regions, and their combinations, demonstrated that the ITS1+ITS2 had the highest average interspecific distance (11.1%, followed by rpoC1 (1.06%. For species discrimination, ITS1+ITS2 provided the best results. The combined data set of ITS1+ITS2+rpoC1 also discriminated both species, but did not result in higher rates of discrimination. These results indicate that ITS region is the best option for molecular identification of these two species and from some other species of this genus.

  2. Spirastrellolide B: the synthesis of southern (C9-C25) region.

    Science.gov (United States)

    Chandrasekhar, Srivari; Rambabu, Chegondi; Reddy, Annareddy Syamprasad

    2008-10-02

    A combination of "chiron" and "asymmetric" approaches is utilized to construct the southern (C 9-C 25) region of marine natural product spirastrellolide B. The key functionalities are derived from d-glucose and Sharpless asymmetric epoxidation and dihydroxylation.

  3. Variability or conservation of hepatitis C virus hypervariable region 1 ...

    Indian Academy of Sciences (India)

    Unknown

    The hypervariable region 1 (HVR1) of the E2 protein of hepatitis C virus (HCV) is highly heterogeneous in its primary sequence and is responsible for significant inter- and intra-individual variation of the infecting virus, which may represent an important pathogenetic mechanism leading to immune escape and persistent ...

  4. Hepatitis C virus infection in the Maghreb region.

    Science.gov (United States)

    Ezzikouri, Sayeh; Pineau, Pascal; Benjelloun, Soumaya

    2013-09-01

    Hepatitis C is a global health problem with a worldwide prevalence of about 3% (around 170 million people). Hepatitis C virus (HCV) is major concern in the Maghreb countries, Algeria, Libya, Mauritania, Morocco, and Tunisia, but no detailed description of its epidemiology in the region is available. In the present review, a systematic search was undertaken covering HCV data available in peer-reviewed databases as well as institutional reports and regional conference meeting abstracts from the Maghreb countries. Reports written in English and French were included in this analysis. Estimates of national and regional prevalence of HCV infection (based on anti-HCV antibody) and of the size of patient populations were performed. In addition, the molecular features of the circulating viral strains in the region are discussed. A substantial proportion, 1.2-1.9% of the Maghreb inhabitants, have anti-HCV antibodies. Genotype 1b predominates among viral strains in all countries except in Libya, where genotype 4 is dominant as in neighboring Egypt. This epidemiological situation is of significant concern, and requires urgent, broad, and active intervention for the prevention and control of HCV. More specifically, the application of state-of-the-art hygiene procedures and rigorous controls in medical disciplines such as hemodialysis, transfusion, endoscopic procedures, and dentistry is necessary to reduce significantly the number of new infections in the region. Copyright © 2013 Wiley Periodicals, Inc.

  5. What do urbanized regions contribute to the global C balance?

    Science.gov (United States)

    Jenkins, J.; Riemann, R.; Groffman, P.; Pouyat, R.; Grove, J. M.; Nowak, D.; Birdsey, R.

    2001-05-01

    Urbanized land (i.e. "developed" land) covers 98.3 million acres in the United States, and the acreage in this category increased by 25% between 1982 and 1997, based on statistics from the 1997 USDA Natural Resource Inventory (this "developed" category includes "large urban built-up areas," "small urban built-up areas," and "rural transportation land"). Despite this large and growing land base, studies using land-based approaches to quantify land-atmosphere C exchange in the US have overlooked urbanized areas as potential contributors to national and global C cycles. From an inventory of vegetation on "nonforest" (predominantly urbanized) land in and around Baltimore, MD conducted in 1999 by the USDA Forest Service Forest Inventory and Analysis (FIA) program, we found that annual wood production and tree biomass values on nonforest land were approximately 22% and 25%, respectively, of corresponding values on land classified as forest. We estimate that vegetation on nonforest land in Maryland currently stores 25.9 x 106 Mg C, while urban soils in Maryland store an additional 119 x 106 Mg C. Annual gross C sequestration in vegetation on nonforest land in Maryland is approximately 0.6 x 106 Mg C yr-1. Extrapolating this result to the northeastern US, we estimate that vegetation on developed land in the northeastern US currently stores 280.2 x 106 Mg C, with an additional 1372 x 106 Mg C stored in developed soils. Vegetation on developed land in the northeastern US sequesters 14.5 x 106 Mg C annually. Extrapolating further to the rest of the United States, we suggest that vegetation on developed land could store an additional 0.03 to 0.04 Pg C yr-1 in the US, which could be as much as 10% of the existing "missing" North American terrestrial sink of 0.35 to 0.90 Pg C yr-1. We recognize, of course, that substantial regional variability is likely to exist in ratios of nonforest: forest wood production and nonforest: forest land area. Additional research on the dynamics of

  6. Epidemiology of hepetitis C infection, ERHA/HSE Eastern region.

    LENUS (Irish Health Repository)

    Meara, M O

    2007-02-01

    Hepatitis C became statutorily notifiable in Ireland on 1 January 2004. Prior to 2004, only hepatitis A and hepatitis B were notifiable as distinct types of hepatitis. A third category notifiable under the Infectious Diseases Regulations 1981 was "viral hepatitis unspecified". The majority of cases notified under this heading were thought to be due to infection with hepatitis C Virus (HCV). Between January 1 2004 and December 31 2005, the Department of Public Health HSE Eastern Region, received notification of 2,014 cases of HCV infection (2004, 941 cases, 2005 1,073 cases). This report outlines basic demographic details on cases notified and comments on missing data. Peak age band at notification for males and females is in the 25-29 year old age group where 538 (26.7%) were notified. Thirty cases notified (1.5%) were under 15 years of age. Drug misuse has been confirmed as a risk factor for 1247 (61.9%) of cases notified, and may be a risk factor in a large percentage of the reminder where risk factor data are unknown. Problems with completeness of notification have been identified. Enhanced surveillance of all hepatitis C infections is a prerequisite for future service planning.

  7. Structural differences between C-terminal regions of tropomyosin isoforms

    Directory of Open Access Journals (Sweden)

    Małgorzata Śliwińska

    2013-10-01

    Full Text Available Tropomyosins are actin-binding regulatory proteins which overlap end-to-end along the filament. High resolution structures of the overlap regions were determined for muscle and non-muscle tropomyosins in the absence of actin. Conformations of the junction regions bound to actin are unknown. In this work, orientation of the overlap on actin alone and on actin–myosin complex was evaluated by measuring FRET distances between a donor (AEDANS attached to tropomyosin and an acceptor (DABMI bound to actin’s Cys374. Donor was attached to the Cys residue introduced by site-directed mutagenesis near the C-terminal half of the overlap. The recombinant alpha-tropomyosin isoforms used in this study – skeletal muscle skTM, non-muscle TM2 and TM5a, and chimeric TM1b9a had various amino acid sequences of the N- and C-termini involved in the end-to-end overlap. The donor-acceptor distances calculated for each isoform varied between 36.4 Å and 48.1 Å. Rigor binding of myosin S1 increased the apparent FRET distances of skTM and TM2, but decreased the distances separating TM5a and TM1b9a from actin. The results show that isoform-specific sequences of the end-to-end overlaps determine orientations and dynamics of tropomyosin isoforms on actin. This can be important for specificity of tropomyosin in the regulation of actin filament diverse functions.

  8. Coastal Change Analysis Program (C-CAP) Regional Land Cover Data and Change Data

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The NOAA Coastal Change Analysis Program (C-CAP) produces national standardized land cover and change products for the coastal regions of the U.S. C-CAP products...

  9. NOAA's Coastal Change Analysis Program (C-CAP) 2001 Regional Land Cover Data - Coastal United States

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The NOAA Coastal Change Analysis Program (C-CAP) produces national standardized land cover and change products for the coastal regions of the U.S. C-CAP products...

  10. NOAA's Coastal Change Analysis Program (C-CAP) 1985 Regional Land Cover Data - Coastal United States

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The NOAA Coastal Change Analysis Program (C-CAP) produces national standardized land cover and change products for the coastal regions of the U.S. C-CAP products...

  11. NOAA's Coastal Change Analysis Program (C-CAP) 2006 Regional Land Cover Data - Coastal United States

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The NOAA Coastal Change Analysis Program (C-CAP) produces national standardized land cover and change products for the coastal regions of the U.S. C-CAP products...

  12. NOAA's Coastal Change Analysis Program (C-CAP) 1996 Regional Land Cover Data - Coastal United States

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The NOAA Coastal Change Analysis Program (C-CAP) produces national standardized land cover and change products for the coastal regions of the U.S. C-CAP products...

  13. NOAA's Coastal Change Analysis Program (C-CAP) 2010 Regional Land Cover Data - Coastal United States

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The NOAA Coastal Change Analysis Program (C-CAP) produces national standardized land cover and change products for the coastal regions of the U.S. C-CAP products...

  14. NOAA's Coastal Change Analysis Program (C-CAP) 1975 Regional Land Cover Data - Coastal United States

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The NOAA Coastal Change Analysis Program (C-CAP) produces national standardized land cover and change products for the coastal regions of the U.S. C-CAP products...

  15. NOAA's Coastal Change Analysis Program (C-CAP) 2016 Regional Land Cover Data - Coastal United States

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The NOAA Coastal Change Analysis Program (C-CAP) produces national standardized land cover and change products for the coastal regions of the U.S. C-CAP products...

  16. What does leaf wax δD from a mixed C3/C4 vegetation region tell us?

    Science.gov (United States)

    Wang, Yiming V.; Larsen, Thomas; Leduc, Guillaume; Andersen, Nils; Blanz, Thomas; Schneider, Ralph R.

    2013-06-01

    Hydrogen isotope values (δD) of sedimentary terrestrial leaf wax such as n-alkanes or n-acids have been used to map and understand past changes in rainfall amount in the tropics because δD of precipitation is commonly assumed as the first order controlling factor of leaf wax δD. Plant functional types and their photosynthetic pathways can also affect leaf wax δD but these biological effects are rarely taken into account in paleo studies relying on this rainfall proxy. To investigate how biological effects may influence δD values we here present a 37,000-year old record of δD and stable carbon isotopes (δ13C) measured on four n-alkanes (n-C27, n-C29, n-C31, n-C33) from a marine sediment core collected off the Zambezi River mouth. Our paleo δ13C records suggest that each individual n-alkanes had different C3/C4 proportional contributions. n-C29 was mostly derived from a C3 dicots (trees, shrubs and forbs) dominant vegetation throughout the entire record. In contrast, the longer chain n-C33 and n-C31 were mostly contributed by C4 grasses during the Glacial period but shifted to a mixture of C4 grasses and C3 dicots during the Holocene. Strong correlations between δD and δ13C values of n-C33 (correlation coefficient R2 = 0.75, n = 58) and n-C31 (R2 = 0.48, n = 58) suggest that their δD values were strongly influenced by changes in the relative contributions of C3/C4 plant types in contrast to n-C29 (R2 = 0.07, n = 58). Within regions with variable C3/C4 input, we conclude that δD values of n-C29 are the most reliable and unbiased indicator for past changes in rainfall, and that δD and δ13C values of n-C31 and n-C33 are sensitive to C3/C4 vegetation changes. Our results demonstrate that a robust interpretation of palaeohydrological data using n-alkane δD requires additional knowledge of regional vegetation changes from which n-alkanes are synthesized, and that the combination of δD and δ13C values of multiple n-alkanes can help to differentiate

  17. The effect of mutations in the AmpC promoter region on β-lactam ...

    African Journals Online (AJOL)

    Analysis of the ampC promoter and attenuator regions of the isolate showed that the isolate had mutations in the promoter region and this included insertions of nucleotides in ... The insertion of an extra nucleotide in the spacer region between the -10 and -35 boxes affects the resistance of bacteria to β-lactam antibiotics.

  18. A Novel Mutation in the Promoter Region of the β-Globin Gene: HBB: c.-127G > C.

    Science.gov (United States)

    Bilgen, Turker; Canatan, Duran; Delibas, Serpil; Keser, Ibrahim

    2016-08-01

    Novel β-globin gene mutations are still occasionally being reported, especially when evaluating milder phenotypes. We report here a novel putative mutation in the promoter region of the β-globin gene and assess its clinical implications. A family, parents and four siblings, with hematological and clinical features suspected of being β-globin gene mutation(s), were involved in this study. In addition to hematological and clinical evaluations of the whole family, molecular analyses of the β-globin gene were performed by direct sequencing. Sequencing of the β-globin gene revealed a novel genomic alteration in the regulatory region of the gene. This novel genomic alteration was defined as HBB: c.-127G > C according to the Human Genome Variation Society (HGVS) nomenclature. Two siblings were found to be carriers of the HBB: c.-127G > C mutation, while the other two siblings were carriers of the codon 8 (-AA) (HBB: c.25_26delAA) deletion of the β-globin gene. The mother was a compound heterozygote for the codon 8 and HBB: c.-127G > C mutations. Based on hematological and clinical evaluations, we conclude that this novel β-globin gene promoter region change would be associated with a mild phenotype of β-thalassemia (β-thal).

  19. Cytochrome P450c17α 5'-untranslated region *T/C polymorphism in ...

    Indian Academy of Sciences (India)

    Administrator

    Estrogen plays a role in the pathogenesis of endometriosis. The CYP17 gene codes for the cytochrome P450c17α enzyme that is involved in the estrogen biosynthesis. We aimed to investigate if CYP17 polymorphism could be used as marker to predict the susceptibility of endometriosis. Women were divided into two ...

  20. Sheep wool δ13C reveals no effect of grazing on the C3/C4 ratio of vegetation in the inner Mongolia-Mongolia border region grasslands.

    Science.gov (United States)

    Auerswald, Karl; Wittmer, Max H O M; Tungalag, Radnaakhand; Bai, Yongfei; Schnyder, Hans

    2012-01-01

    We tested whether the abundance of C(4) vegetation in grasslands of the Mongolian plateau is influenced by grazing conditions. The analysis exploited the politically originated contrast that exists between Mongolia (low stocking rate, transhumant system) and the district of Inner Mongolia, China (high stocking rate, sedentary system). We estimated the proportion of C(4) carbon (P(C4)) in grazed vegetation from the relative carbon isotope ratio (δ(13)C) of sheep wool sampled from 298 annual shearings originating from 1996 to 2007. Annual stocking rates varying over time and between the districts of both countries were taken from regional statistics. The P(C4) pattern within the 0.7 million km(2) sampling area was geostatistically analyzed and related to stocking rates and temperature gradients. For similar climatic conditions, P(C4) was the same in both countries. Further, a unique relationship was found between P(C4) and July temperature on both sides of the border, which explained 71% of the pattern. Stocking rate and grazing system had no significant influences on present-day C(3)/C(4) abundance ratio. This finding suggests that recent changes in the C(3)/C(4) ratio of these grasslands are mainly a consequence of regional warming, not overgrazing.

  1. Sheep wool δ13C reveals no effect of grazing on the C3/C4 ratio of vegetation in the inner Mongolia-Mongolia border region grasslands.

    Directory of Open Access Journals (Sweden)

    Karl Auerswald

    Full Text Available We tested whether the abundance of C(4 vegetation in grasslands of the Mongolian plateau is influenced by grazing conditions. The analysis exploited the politically originated contrast that exists between Mongolia (low stocking rate, transhumant system and the district of Inner Mongolia, China (high stocking rate, sedentary system. We estimated the proportion of C(4 carbon (P(C4 in grazed vegetation from the relative carbon isotope ratio (δ(13C of sheep wool sampled from 298 annual shearings originating from 1996 to 2007. Annual stocking rates varying over time and between the districts of both countries were taken from regional statistics. The P(C4 pattern within the 0.7 million km(2 sampling area was geostatistically analyzed and related to stocking rates and temperature gradients. For similar climatic conditions, P(C4 was the same in both countries. Further, a unique relationship was found between P(C4 and July temperature on both sides of the border, which explained 71% of the pattern. Stocking rate and grazing system had no significant influences on present-day C(3/C(4 abundance ratio. This finding suggests that recent changes in the C(3/C(4 ratio of these grasslands are mainly a consequence of regional warming, not overgrazing.

  2. Physical mapping of the E/C and grc regions of the rat major histocompatibility complex.

    Science.gov (United States)

    Yuan, X J; Salgar, S K; Hassett, A L; McHugh, K P; Kunz, H W; Gill, T J

    1996-01-01

    Alignment of class I-hybridizing cosmids from an R21 (AlBlDlEugrc+) genomic DNA library gave two contigs: one [150 kilobases (kb)] encompassed the E/C region, or a large part thereof, and the other (110 kb) contained the grc region which has genes influencing resistance to chemical carcinogens (rcc), fertility (ft), and growth (dw-3). Amplification of gene sequences in the four cosmids in the E/C region using Eu-specific and LW2 (RT1.C)-specific primers showed that each cosmid contained both Eu-like and C-like genes. They are clearly different but closely associated, and they show some variation from the prototypic E (Eu) and C (LW2) genes, respectively. Comparison of DNA from grc+ and grc- strains of rats showed that the deletion in the grc- strains was approximately 50 kb, and that it was located on two of the three cosmids in the grc-region contig. The use of specific class I probes showed that the grc region contained tandemly duplicated RT1.O-RT1.N genes and that the RT.BM1 loci lay outside of the grc region. Neither contig reacted with probes specific for class II, TNFA, Hsp70, or RT1.M genes. The data presented here and the previous data in the literature (summarized in Gill et al. 1995) suggest that the gene order in the major histocompatibility complex (MHC) and MHC-linked region of the rat is: A-E/C-grc-M.

  3. Molecular characterization of HIV-1 subtype C gp-120 regions potentially involved in virus adaptive mechanisms.

    Directory of Open Access Journals (Sweden)

    Alessandra Cenci

    Full Text Available The role of variable regions of HIV-1 gp120 in immune escape of HIV has been investigated. However, there is scant information on how conserved gp120 regions contribute to virus escaping. Here we have studied how molecular sequence characteristics of conserved C3, C4 and V3 regions of clade C HIV-1 gp120 that are involved in HIV entry and are target of the immune response, are modulated during the disease course. We found an increase of "shifting" putative N-glycosylation sites (PNGSs in the α2 helix (in C3 and in C4 and an increase of sites under positive selection pressure in the α2 helix during the chronic stage of disease. These sites are close to CD4 and to co-receptor binding sites. We also found a negative correlation between electric charges of C3 and V4 during the late stage of disease counteracted by a positive correlation of electric charges of α2 helix and V5 during the same stage. These data allow us to hypothesize possible mechanisms of virus escape involving constant and variable regions of gp120. In particular, new mutations, including new PNGSs occurring near the CD4 and CCR5 binding sites could potentially affect receptor binding affinity and shield the virus from the immune response.

  4. Measurements of C{sub 1}-C{sub 4} carbonyls at forested regions in Mexico

    Energy Technology Data Exchange (ETDEWEB)

    Ceron Breton, J.B.; Padilla, H.; Belmont, R.; Torres, M.C.; Moya, M.; Baez, A.P. [Centro de Ciencias de la Atmosfera, Universidad Nacional Autonoma de Mexico, UNAM, Mexico, D.F. (Mexico)

    2005-04-01

    Measurements of formaldehyde, acetaldehyde, acetone, propionaldehyde and butyraldehyde concentrations were made at five different forested regions in Mexico. One set of two simultaneous samplings was performed at two sites located in the Mexico State, one semi rural area (Temascaltepec), and the other, a forested area (Rancho Viejo). A second set of two simultaneous samplings were made in southern Veracruz State, in one rural area (Monte Pio) and inside a tropical rainforest (at the Biology Station of the University of Mexico). Finally, one sampling was performed in the Sierra of Puebla State (Cuetzalan). Propionaldehyde and butyraldehyde were nor reported because their concentrations were always below or near the detection limit of the technique. The highest concentrations were found from 7:00 to 11:00 and from 11:00 to 19:00 h in all the sampling sites. Arithmetic mean concentrations of acetone were the highest observed among the detected carbonyl compounds in almost all sites, ranging from 0.5 to 8.4 {mu}g m{sup -}3. Arithmetic mean concentrations of formaldehyde and acetaldehyde ranged from 0.83 to 6 {mu}g m{sup -}3 and 0.53 to 4.7 {mu}g m{sup -}3, respectively. The Spearman's correlations between formaldehyde and acetone, and between acetaldehyde and acetone were statistically significant at p<0.05 in almost all sites. A significant correlation (p<0.05) between formaldehyde and acetaldehyde was observed in Mexico State at Rancho Viejo and Temascaltepec. The mean ratio HCHO/CH{sub 3}CHO of concentrations was 1.83 and 1.31 in the forested area of Rancho Viejo, first and second sampling periods, respectively; 1.71 and 1.62 in the semi rural area of Temascaltepec, first and second sampling periods respectively; 1.70 in Cuetzalan; 2.90 in the rural area of Monte Pio; and 1.61 in the Biology Station tropical rainforest. These values show a greater influence of atmospheric pollutants transported from sites with anthropogenic activities, because HCHO/CH{sub 3}CHO

  5. Structural and Functional Characterization of the C-terminal Transmembrane Region of NBCe1-A*

    Science.gov (United States)

    Zhu, Quansheng; Kao, Liyo; Azimov, Rustam; Abuladze, Natalia; Newman, Debra; Pushkin, Alexander; Liu, Weixin; Chang, Connie; Kurtz, Ira

    2010-01-01

    NBCe1-A and AE1 both belong to the SLC4 HCO3− transporter family. The two transporters share 40% sequence homology in the C-terminal transmembrane region. In this study, we performed extensive substituted cysteine-scanning mutagenesis analysis of the C-terminal region of NBCe1-A covering amino acids Ala800–Lys967. Location of the introduced cysteines was determined by whole cell labeling with a membrane-permeant biotin maleimide and a membrane-impermeant 2-((5(6)-tetramethylrhodamine)carboxylamino) ethyl methanethiosulfonate (MTS-TAMRA) cysteine-reactive reagent. The results show that the extracellular surface of the NBCe1-A C-terminal transmembrane region is minimally exposed to aqueous media with Met858 accessible to both biotin maleimide and TAMRA and Thr926–Ala929 only to TAMRA labeling. The intracellular surface contains a highly exposed (Met813–Gly828) region and a cryptic (Met887–Arg904) connecting loop. The lipid/aqueous interface of the last transmembrane segment is at Asp960. Our data clearly determined that the C terminus of NBCe1-A contains 5 transmembrane segments with greater average size compared with AE1. Functional assays revealed only two residues in the region of Pro868–Leu967 (a functionally important region in AE1) that are highly sensitive to cysteine substitution. Our findings suggest that the C-terminal transmembrane region of NBCe1-A is tightly folded with unique structural and functional features that differ from AE1. PMID:20837482

  6. Site scale wetness classification of tundra regions with C-band SAR satellite data

    DEFF Research Database (Denmark)

    Widhalm, Barbara; Bartsch, Annett; Siewert, Matthias Benjamin

    2016-01-01

    A representative and consistent wetland map for the circumpolar region is required for a range of applications including modelling of permafrost properties as well as upscaling of carbon pools and fluxes. Synthetic Aperture Radar (SAR) data has been shown to be suitable for wetland mapping, espec...... resolution C-band SAR based wetness level map can be derived for tundra regions where no scattering due to tree trunks hampers the applied methodology....

  7. Regional increases in [{sup 11}C]flumazenil binding after epilepsy surgery

    Energy Technology Data Exchange (ETDEWEB)

    Savic, I. [Huddinge Hospital, Dept. of Neurology (Sweden); Blomqvist, G. [Karolinska Hospital, Dept. of Clinical Neurophysiology, Stockholm (Sweden); Halldin, C. [Karolinska Hospital, Dept. of Psychiatry, Stockholm (Sweden); Litton, J.E. [Karolinska Hospital, Dept. of Psychology, Stockholm (Sweden); Gulyas, B. [Karolinska Institute, Div. of Human Brain Research (Sweden)

    1998-05-01

    Introduction - Animal experiments suggest that epileptic seizures alter the expression of mRNA for neuro-receptors. PET measurements with [{sup 11}C]flumazenil show that patients with partial seizures have a reduced density of benzodiazepine (BZ) receptors in the epileptogenic regions (ER) and some of the target areas for seizure activity, the so called projection areas. Recent data suggest that the degree of BZ receptor reduction in ER is correlated to seizure frequency. We therefore hypothesized that seizure activity can alter the BZ receptor binding, and that some of these changes could normalize when the seizures disappeared. Methods - In 4 patients whose seizures were generated by mesial temporal lobe structures, BZ receptor density was measured with [{sup 11}C]flumazenil PET before, and 1 year after the epilepsy surgery and cessation of seizures. By use of a computerized anatomical brain atlas the same regions were analyzed in both PET scans, and the results related to data from 7 healthy controls. Results - Presurgical PET scans showed reductions in BZ receptor density in the epileptogenic regions and some of its primary projection areas. Other cortical regions had normal values. Postsurgically, the calculated BZ receptor density normalized (29{+-}17% increase) in several of the affected projection areas, whereas the values in other cortical regions remained unaltered. Conclusion - Regional reductions in BZ receptor density may be dynamic and related to seizures. The present preliminary observations encourage further studies on seizure-related changes in regional receptor binding in humans. (au) 41 refs.

  8. An intermediate region in C-terminal of phosphoprotein is required ...

    African Journals Online (AJOL)

    GREGORY

    2011-12-16

    Dec 16, 2011 ... replication or binds to assembled NP (NP-RNA or NPNC) to transcribe genome to produce the sub- genomic mRNAs. ... interactive region of P to NPNC was located within C-terminal half of P between amino acids 224 to 279. .... were grown at 37°C in LB broth until the culture reached A600 of about 0.6 to ...

  9. The relationship of regional hemoglobin A1c testing and amputation rate among patients with diabetes.

    Science.gov (United States)

    Newhall, Karina A; Bekelis, Kimon; Suckow, Bjoern D; Gottlieb, Daniel J; Farber, Adrienne E; Goodney, Philip P; Skinner, Jonathan S

    2017-04-01

    Objective The risk of leg amputation among patients with diabetes has declined over the past decade, while use of preventative measures-such as hemoglobin A1c monitoring-has increased. However, the relationship between hemoglobin A1c testing and amputation risk remains unclear. Methods We examined annual rates of hemoglobin A1c testing and major leg amputation among Medicare patients with diabetes from 2003 to 2012 across 306 hospital referral regions. We created linear regression models to study associations between hemoglobin A1c testing and lower extremity amputation. Results From 2003 to 2012, the proportion of patients who received hemoglobin A1c testing increased 10% (74% to 84%), while their rate of lower extremity amputation decreased 50% (430 to 232/100,000 beneficiaries). Regional hemoglobin A1c testing weakly correlated with crude amputation rate in both years (2003 R = -0.20, 2012 R = -0.21), and further weakened with adjustment for age, sex, and disability status (2003 R = -0.11, 2012 R = -0.17). In a multivariable model of 2012 amputation rates, hemoglobin A1c testing was not a significant predictor. Conclusion Lower extremity amputation among patients with diabetes nearly halved over the past decade but only weakly correlated with hemoglobin A1c testing throughout the study period. Better metrics are needed to understand the relationship between preventative care and amputation.

  10. Sheep Wool δ13C Reveals No Effect of Grazing on the C3/C4 Ratio of Vegetation in the Inner Mongolia–Mongolia Border Region Grasslands

    Science.gov (United States)

    Auerswald, Karl; Wittmer, Max H.O.M.; Tungalag, Radnaakhand; Bai, Yongfei; Schnyder, Hans

    2012-01-01

    We tested whether the abundance of C4 vegetation in grasslands of the Mongolian plateau is influenced by grazing conditions. The analysis exploited the politically originated contrast that exists between Mongolia (low stocking rate, transhumant system) and the district of Inner Mongolia, China (high stocking rate, sedentary system). We estimated the proportion of C4 carbon (PC4) in grazed vegetation from the relative carbon isotope ratio (δ13C) of sheep wool sampled from 298 annual shearings originating from 1996 to 2007. Annual stocking rates varying over time and between the districts of both countries were taken from regional statistics. The PC4 pattern within the 0.7 million km2 sampling area was geostatistically analyzed and related to stocking rates and temperature gradients. For similar climatic conditions, PC4 was the same in both countries. Further, a unique relationship was found between PC4 and July temperature on both sides of the border, which explained 71% of the pattern. Stocking rate and grazing system had no significant influences on present-day C3/C4 abundance ratio. This finding suggests that recent changes in the C3/C4 ratio of these grasslands are mainly a consequence of regional warming, not overgrazing. PMID:23029090

  11. The Hsp60C gene in the 25F cytogenetic region in Drosophila ...

    Indian Academy of Sciences (India)

    Earlier studies have shown that of the four genes (Hsp60A, Hsp60B, Hsp60C, Hsp60D genes) predicted to encode the conserved Hsp60 family chaperones in Drosophila melanogaster, the Hsp60A gene (at the 10A polytene region) is expressed in all cell types of the organism and is essential from early embryonic stages, ...

  12. What the soil reveals: potential total ecosystem C stores of the Pacific Northwest region, USA.

    Science.gov (United States)

    Peter S. Homann; Mark Harmon; Suzanne Remillard; Erica A.H. Smithwick

    2005-01-01

    How much organic C can a region naturally store in its ecosystems? How can this be determined, when land management has altered the vegetation of the landscape substantially? The answers may lie in the soil: this study synthesized the spatial distribution of soil properties derived from the state soils geographic database with empirical measurements of old-growth...

  13. SPANX-B and SPANX-C (Xq27 region) gene dosage analysis in ...

    Indian Academy of Sciences (India)

    SPANX-B and SPANX-C (Xq27 region) gene dosage analysis in Down's syndrome subjects with undescended testes. Michele Salemi Corrado Romano Concetta Barone Francesco Calí Filippo Caraci Carmelo Romano Cataldo Scavuzzo Francesco Scillato Maria Grazia Salluzzo Maria Piccione Manuela Martines Giovanni ...

  14. Exploring spatially adjacent TFBS-clustered regions with Hi-C data.

    Science.gov (United States)

    Chen, Hebing; Jiang, Shuai; Zhang, Zhuo; Li, Hao; Lu, Yiming; Bo, Xiaochen

    2017-09-01

    Transcription factor binding sites (TFBSs) are clustered in the human genome, forming the TFBS-clustered regions that regulate gene transcription, which requires dynamic chromatin configurations between promoters and distal regulatory elements. Here, we propose a regulatory model called spatially adjacent TFBS-clustered regions (SATs), in which TFBS-clustered regions are connected by spatial proximity as identified by high-resolution Hi-C data. TFBS-clustered regions forming SATs appeared less frequently in gene promoters than did isolated TFBS-clustered regions, whereas SATs as a whole appeared more frequently. These observations indicate that multiple distal TFBS-clustered regions combined to form SATs to regulate genes. Further examination confirmed that a substantial portion of genes regulated by SATs were located between the paired TFBS-clustered regions instead of the downstream. We reconstructed the chromosomal conformation of the H1 human embryonic stem cell line using the ShRec3D algorithm and proposed the SAT regulatory model. ylu.phd@gmail.com or boxc@bmi.ac.cn. Supplementary data are available at Bioinformatics online.

  15. [Effects of human disturbance on soil aggregates content and their organic C stability in Karst regions].

    Science.gov (United States)

    Wei, Ya-wei; Su, Yi-rong; Chen, Xiang-bi; He, Xun-yang; Qin, Wen-geng; Wei, Guo-fu

    2011-04-01

    Taking the primary forest land (PF), natural restoration land (NR), grazing grassland burned annually in winter (GB), and maize-sweet potato cropland (MS) in Karst regions of Northwest Guangxi as test objects, this paper studied the soil aggregates content and their organic C stability in the four ecosystems under different human disturbance patterns. The soil water-stable aggregates (>0.25 mm) content in PF, NR, and GB accounted for more than 70%, while that in MS was only 37%. The destruction rate of soil aggregates structure in the four ecosystems decreased in the sequence of MS (54.9%) > GB (23.2%) > NR (9.8%) and PF (9.6%), with significant differences among them (Psoil aggregate organic C decreased after an initial increase and kept stable after 20 days, and increased with decreasing aggregate size. In the same size aggregates, the mineralization rate of organic C in the four ecosystems increased in the sequence of MS soil organic C was 1.7% - 3.8%, being significantly higher than that in NR, GB, and MS. The cumulative mineralization amount of soil organic C had the same change trend with the mineralization rate. The contents of soil organic C and aggregate organic C were significantly positively correlated with the mineralization rate and cumulative mineralization amount of organic C, respectively, and significantly negatively correlated with the mineralization ratio of organic C.

  16. Multiple TL-like loci in the grc-G/C region of the rat.

    Science.gov (United States)

    Kirisits, M J; Sawai, H; Kunz, H W; Gill, T J

    1994-01-01

    The grc-G/C region of the rat is homologous to the Q/TL region of the mouse, and deletions in this region are associated with fetal mortality, developmental defects, and decreased resistance to cancer. Several cosmids spanning approximately 45 kilobases of this region were analyzed for their class I loci, using a mouse general class I probe (pAG64c), grc-specific probes (pGRC1.4, pGRC1.7), and four probes derived from the TL-like locus RT1.N1. The results showed that TL-like genes other than RT1.N1 exist in the rat: a duplicated gene, RT1.N2, was identified, sequenced, and shown to be 99.3% similar to RT1.N1; and a third TL-like gene, RT1.N3, was isolated from a cDNA library, sequenced, and shown to be 92.8% similar to RT1.N1. These observations suggest that the rat TL-like loci are duplicated and that there is more than one cluster of these duplicated genes. The TL-like genes are transcribed predominantly in the thymus, except in grc- strains, and their level of transcription increases during fetal life and reaches its maximum at birth. Finally, a cosmid that appears to identify the end of the deletion in grc- strains was identified.

  17. Eastern region represents a worrying cluster of active hepatitis C in Algeria in 2012.

    Science.gov (United States)

    Bensalem, Aïcha; Selmani, Karima; Hihi, Narjes; Bencherifa, Nesrine; Mostefaoui, Fatma; Kerioui, Cherif; Pineau, Pascal; Debzi, Nabil; Berkane, Saadi

    2016-08-01

    Algeria is the largest country of Africa, peopled with populations living a range of traditional/rural and modern/urban lifestyles. The variations of prevalence of chronic active hepatitis care poorly known on the Algerian territory. We conducted a retrospective survey on all patients (n = 998) referred to our institution in 2012 and confirmed by us for an active hepatitis C. Half of the hepatitis C virus (HCV) isolates were genotyped. Forty Algerian regions out of the 48 were represented in our study. Three geographical clusters (Aïn-Temouchent/SidiBelAbbes, Algiers, and a large Eastern region) with an excess of active hepatitis C were observed. Patients coming from the Eastern cluster (Batna, Khenchela, Oum el Bouaghi, and Tebessa) were strongly over-represented (49% of cases, OR = 14.5, P < 0.0001). The hallmarks of Eastern region were an excess of women (65% vs. 46% in the remaining population, P < 0.0001) and the almost exclusive presence of HCV genotype 1 (93% vs. 63%, P = 0.0001). The core of the epidemics was apparently located in Khenchela (odds ratio = 24.6, P < 0.0001). This situation is plausibly connected with nosocomial transmission or traditional practices as scarification (Hijama), piercing or tattooing, very lively in this region. Distinct hepatitis C epidemics are currently affecting Algerian population. The most worrying situation is observed in rural regions located east of Algeria. J. Med. Virol. 88:1394-1403, 2016. © 2016 Wiley Periodicals, Inc. © 2016 Wiley Periodicals, Inc.

  18. The C-terminal region of E1A: a molecular tool for cellular cartography.

    Science.gov (United States)

    Yousef, Ahmed F; Fonseca, Gregory J; Cohen, Michael J; Mymryk, Joe S

    2012-04-01

    The adenovirus E1A proteins function via protein-protein interactions. By making many connections with the cellular protein network, individual modules of this virally encoded hub reprogram numerous aspects of cell function and behavior. Although many of these interactions have been thoroughly studied, those mediated by the C-terminal region of E1A are less well understood. This review focuses on how this region of E1A affects cell cycle progression, apoptosis, senescence, transformation, and conversion of cells to an epithelial state through interactions with CTBP1/2, DYRK1A/B, FOXK1/2, and importin-α. Furthermore, novel potential pathways that the C-terminus of E1A influences through these connections with the cellular interaction network are discussed.

  19. Determining spatial chromatin organization of large genomic regions using 5C technology.

    Science.gov (United States)

    van Berkum, Nynke L; Dekker, Job

    2009-01-01

    Spatial organization of chromatin plays an important role at multiple levels of genome regulation. On a global scale, its function is evident in processes like metaphase and chromosome segregation. On a detailed level, long-range interactions between regulatory elements and promoters are essential for proper gene regulation. Microscopic techniques like FISH can detect chromatin contacts, although the resolution is generally low making detection of enhancer-promoter interaction difficult. The 3C methodology allows for high-resolution analysis of chromatin interactions. 3C is now widely used and has revealed that long-range looping interactions between genomic elements are widespread. However, studying chromatin interactions in large genomic regions by 3C is very labor intensive. This limitation is overcome by the 5C technology. 5C is an adaptation of 3C, in which the concurrent use of thousands of primers permits the simultaneous detection of millions of chromatin contacts. The design of the 5C primers is critical because this will determine which and how many chromatin interactions will be examined in the assay. Starting material for 5C is a 3C template. To make a 3C template, chromatin interactions in living cells are cross-linked using formaldehyde. Next, chromatin is digested and subsequently ligated under conditions favoring ligation events between cross-linked fragments. This yields a genome-wide 3C library of ligation products representing all chromatin interactions in vivo. 5C then employs multiplex ligation-mediated amplification to detect, in a single assay, up to millions of unique ligation products present in the 3C library. The resulting 5C library can be analyzed by microarray analysis or deep sequencing. The observed abundance of a 5C product is a measure of the interaction frequency between the two corresponding chromatin fragments. The power of the 5C technique described in this chapter is the high-throughput, high-resolution, and quantitative way

  20. NOAA's Coastal Change Analysis Program (C-CAP) 1992 to 2001 Regional Land Cover Change Data - Coastal United States

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The NOAA Coastal Change Analysis Program (C-CAP) produces national standardized land cover and change products for the coastal regions of the U.S. C-CAP products...

  1. NOAA's Coastal Change Analysis Program (C-CAP) 1985 to 2006 Regional Land Cover Change Data - Coastal United States

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The NOAA Coastal Change Analysis Program (C-CAP) produces national standardized land cover and change products for the coastal regions of the U.S. C-CAP products...

  2. NOAA's Coastal Change Analysis Program (C-CAP) 2001 to 2005 Regional Land Cover Change Data - Hawaii

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The NOAA Coastal Change Analysis Program (C-CAP) produces national standardized land cover and change products for the coastal regions of the U.S. C-CAP products...

  3. NOAA's Coastal Change Analysis Program (C-CAP) 2001 to 2016 Regional Land Cover Change Data - Coastal United States

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The NOAA Coastal Change Analysis Program (C-CAP) produces national standardized land cover and change products for the coastal regions of the U.S. C-CAP products...

  4. NOAA's Coastal Change Analysis Program (C-CAP) 1996 to 2006 Regional Land Cover Change Data - Coastal United States

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The NOAA Coastal Change Analysis Program (C-CAP) produces national standardized land cover and change products for the coastal regions of the U.S. C-CAP products...

  5. NOAA's Coastal Change Analysis Program (C-CAP) 1975 to 2006 Regional Land Cover Change Data - Coastal United States

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The NOAA Coastal Change Analysis Program (C-CAP) produces national standardized land cover and change products for the coastal regions of the U.S. C-CAP products...

  6. NOAA's Coastal Change Analysis Program (C-CAP) 1975 to 2001 Regional Land Cover Change Data - Coastal United States

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The NOAA Coastal Change Analysis Program (C-CAP) produces national standardized land cover and change products for the coastal regions of the U.S. C-CAP products...

  7. NOAA's Coastal Change Analysis Program (C-CAP) 2010 to 2016 Regional Land Cover Change Data - Coastal United States

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The NOAA Coastal Change Analysis Program (C-CAP) produces national standardized land cover and change products for the coastal regions of the U.S. C-CAP products...

  8. NOAA's Coastal Change Analysis Program (C-CAP) 2001 to 2010 Regional Land Cover Change Data - Coastal United States

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The NOAA Coastal Change Analysis Program (C-CAP) produces national standardized land cover and change products for the coastal regions of the U.S. C-CAP products...

  9. NOAA's Coastal Change Analysis Program (C-CAP) 1996 to 2010 Regional Land Cover Change Data - Coastal United States

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The NOAA Coastal Change Analysis Program (C-CAP) produces national standardized land cover and change products for the coastal regions of the U.S. C-CAP products...

  10. NOAA's Coastal Change Analysis Program (C-CAP) 1975 to 1985 Regional Land Cover Change Data - Coastal United States

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The NOAA Coastal Change Analysis Program (C-CAP) produces national standardized land cover and change products for the coastal regions of the U.S. C-CAP products...

  11. NOAA's Coastal Change Analysis Program (C-CAP) 1985 to 2010 Regional Land Cover Change Data - Coastal United States

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The NOAA Coastal Change Analysis Program (C-CAP) produces national standardized land cover and change products for the coastal regions of the U.S. C-CAP products...

  12. NOAA's Coastal Change Analysis Program (C-CAP) 1992 to 2006 Regional Land Cover Change Data - Coastal United States

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The NOAA Coastal Change Analysis Program (C-CAP) produces national standardized land cover and change products for the coastal regions of the U.S. C-CAP products...

  13. NOAA's Coastal Change Analysis Program (C-CAP) 1975 to 1996 Regional Land Cover Change Data - Coastal United States

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The NOAA Coastal Change Analysis Program (C-CAP) produces national standardized land cover and change products for the coastal regions of the U.S. C-CAP products...

  14. NOAA's Coastal Change Analysis Program (C-CAP) 1996 to 2016 Regional Land Cover Change Data - Coastal United States

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The NOAA Coastal Change Analysis Program (C-CAP) produces national standardized land cover and change products for the coastal regions of the U.S. C-CAP products...

  15. NOAA's Coastal Change Analysis Program (C-CAP) 1975 to 2010 Regional Land Cover Change Data - Coastal United States

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The NOAA Coastal Change Analysis Program (C-CAP) produces national standardized land cover and change products for the coastal regions of the U.S. C-CAP products...

  16. NOAA's Coastal Change Analysis Program (C-CAP) 2001 to 2006 Regional Land Cover Change Data - Coastal United States

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The NOAA Coastal Change Analysis Program (C-CAP) produces national standardized land cover and change products for the coastal regions of the U.S. C-CAP products...

  17. NOAA's Coastal Change Analysis Program (C-CAP) 1992 to 1996 Regional Land Cover Change Data - Coastal United States

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The NOAA Coastal Change Analysis Program (C-CAP) produces national standardized land cover and change products for the coastal regions of the U.S. C-CAP products...

  18. NOAA's Coastal Change Analysis Program (C-CAP) 1992 to 2010 Regional Land Cover Change Data - Coastal United States

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The NOAA Coastal Change Analysis Program (C-CAP) produces national standardized land cover and change products for the coastal regions of the U.S. C-CAP products...

  19. NOAA's Coastal Change Analysis Program (C-CAP) 1975 to 2016 Regional Land Cover Change Data - Coastal United States

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The NOAA Coastal Change Analysis Program (C-CAP) produces national standardized land cover and change products for the coastal regions of the U.S. C-CAP products...

  20. NOAA's Coastal Change Analysis Program (C-CAP) 1996 to 2001 Regional Land Cover Change Data - Coastal United States

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The NOAA Coastal Change Analysis Program (C-CAP) produces national standardized land cover and change products for the coastal regions of the U.S. C-CAP products...

  1. NOAA's Coastal Change Analysis Program (C-CAP) 2006 to 2010 Regional Land Cover Change Data - Coastal United States

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The NOAA Coastal Change Analysis Program (C-CAP) produces national standardized land cover and change products for the coastal regions of the U.S. C-CAP products...

  2. NOAA's Coastal Change Analysis Program (C-CAP) 1992 to 2001 Regional Land Cover Change Data - Hawaii

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The NOAA Coastal Change Analysis Program (C-CAP) produces national standardized land cover and change products for the coastal regions of the U.S. C-CAP products...

  3. NOAA's Coastal Change Analysis Program (C-CAP) 1985 to 2016 Regional Land Cover Change Data - Coastal United States

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The NOAA Coastal Change Analysis Program (C-CAP) produces national standardized land cover and change products for the coastal regions of the U.S. C-CAP products...

  4. NOAA's Coastal Change Analysis Program (C-CAP) 1985 to 1996 Regional Land Cover Change Data - Coastal United States

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The NOAA Coastal Change Analysis Program (C-CAP) produces national standardized land cover and change products for the coastal regions of the U.S. C-CAP products...

  5. NOAA's Coastal Change Analysis Program (C-CAP) 1985 to 2001 Regional Land Cover Change Data - Coastal United States

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The NOAA Coastal Change Analysis Program (C-CAP) produces national standardized land cover and change products for the coastal regions of the U.S. C-CAP products...

  6. Coastal Change Analysis Program (C-CAP) 2015/2016 Regional Land Cover Data - Contiguous United States

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NOAA's Coastal Change Analysis Program (C-CAP) produces national standardized land cover and land change information for the coastal regions of the U.S. C-CAP...

  7. NOAA's Coastal Change Analysis Program (C-CAP) 2006 to 2016 Regional Land Cover Change Data - Coastal United States

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The NOAA Coastal Change Analysis Program (C-CAP) produces national standardized land cover and change products for the coastal regions of the U.S. C-CAP products...

  8. Electronic Bands of ScC in the Region 620 - 720 NM

    Science.gov (United States)

    Chen, Chiao-Wei; Merer, Anthony; Hsu, Yen-Chu

    2016-06-01

    ScC molecules have been observed by laser-induced fluorescence, following the reaction of laser-ablated scandium metal with acetylene under supersonic jet-cooled conditions. Rotational analyses have been carried out for about 40 bands of Sc{}12C and Sc{}13C in the region 14000 - 16000 cm-1. Two lower states are found, with Ω = 3/2 and 5/2, indicating that the ground state is ^4Π_i or ^2Δ. As yet we cannot distinguish between these alternatives, but note that the ground state of the isoelectronic YC molecule is ^4Π_i. The ground state bond length in ScC is 1.95{}_5 Å, and the vibrational frequency is 712 cm-1. At least eight electronic transitions occur in the region studied, the majority obeying the selection rule ΔΩ = +1. Rotational perturbations are widespread, consistent with a high density of excited electronic states. B. Simard, P.A. Hackett and W.J. Balfour, Chem. Phys. Lett., 230, 103 (1994).

  9. Synthesis and regional mouse brain distribution of [11C]nisoxetine, a norepinephrine uptake inhibitor.

    Science.gov (United States)

    Haka, M S; Kilbourn, M R

    1989-01-01

    Nisoxetine, a selective and high affinity (IC50 = 1 nM) inhibitor of NE reuptake, has been radiolabeled in high specific activity (greater than 600 Ci/mmol) by the alkylation of the nor-methyl precursor with [11C]CH3I. Synthetic yields are good (40-60% from [11C]methyl iodide, corrected for decay, 20 min synthesis), with the product purified by HPLC. In vivo studies of regional brain distribution in CD-1 mice show uptake and retention of tracer in the cortex, striatum, hypothalamus and thalamus, with the highest levels in the hypothalamus and cortex. Specific binding in the cortex and hypothalamus can be reduced by preadministration of 7 mg/kg i.v. unlabeled nisoxetine. The possible value of [11C]nisoxetine as a PET imaging agent is discussed.

  10. Hi-C Observations of an Active Region Corona, and Investigation of the Underlying Magnetic Structure

    Science.gov (United States)

    Tiwari, S. K.; Alexander, C. E.; Winebarger, A.; Moore, R. L.

    2014-01-01

    The solar corona is much hotter (>=10(exp 6) K) than its surface (approx 6000 K), puzzling astrophysicists for several decades. Active region (AR) corona is again hotter than the quiet Sun (QS) corona by a factor of 4-10. The most widely accepted mechanism that could heat the active region corona is the energy release by current dissipation via reconnection of braided magnetic field structure, first proposed by E. N. Parker three decades ago. The first observational evidence for this mechanism has only recently been presented by Cirtain et al. by using High-resolution Coronal Imager (Hi-C) observations of an AR corona at a spatial resolution of 0.2 arcsec, which is required to resolve the coronal loops, and was not available before the rocket flight of Hi-C in July 2012. The Hi-C project is led by NASA/MSFC. In the case of the QS, work done by convection/granulation on the inter-granular feet of the coronal field lines translates into the heat observed in the corona. In the case of the AR, as here, there could be flux emergence, cancellation/submergence, or shear flows generating large stress and tension in coronal field loops which is released as heat in the corona. We are currently investigating the changes taking place in photospheric feet of the magnetic field involved with brightenings in the Hi-C AR corona. For this purpose, we are also using SDO/AIA data of +/- 2 hours around the 5 minutes Hi-C flight. In the present talk, I will first summarize some of the results of the Hi-C observations and then present some results from our recent analysis on what photospheric processes feed the magnetic energy that dissipates into heat in coronal loops.

  11. Magnetic Structure of Sites of Braiding in Hi-C Active Region

    Science.gov (United States)

    Tiwari, S. K.; Alexander, C. E.; Winebarger, A.; Moore, R. L.

    2014-01-01

    High-resolution Coronal Imager (Hi-C) observations of an active region (AR) corona, at a spatial resolution of 0.2 arcsec, have offered the first direct evidence of field lines braiding, which could deliver sufficient energy to heat the AR corona by current dissipation via magnetic reconnection, a proposal given by Parker three decades ago. The energy required to heat the corona must be transported from the photosphere along the field lines. The mechanism that drives the energy transport to the corona is not yet fully understood. To investigate simultaneous magnetic and intensity structure in and around the AR in detail, we use SDO/HMI+AIA data of + / - 2 hours around the 5 minute Hi-C flight. In the case of the QS, work done by convection/granulation on the inter-granular feet of the coronal field lines probably translates into the heat observed in the corona. In the case of the AR, as here, there could be flux emergence, cancellation/submergence, or shear flows generating large stress and tension in coronal field loops which is released as heat in the corona. However, to the best of our knowledge, there is no observational evidence available to these processes. We investigate the changes taking place in the photospheric feet of the magnetic field involved with brightenings in the Hi-C AR corona. Using HMI 45s magnetograms of four hours we find that, out of the two Hi-C sub-regions where the braiding of field lines were recently detected, flux emergence takes place in one region and flux cancellation in the other. The field in these sub-regions are highly sheared and have apparent high speed plasma flows at their feet. Therefore, shearing flows plausibly power much of the coronal and transition region heating in these areas of the AR. In addition, the presence of large flux emergence/cancellation strongly suggests that the work done by these processes on the pre-existing field also drives much of the observed heating.

  12. [Disordered regions in C-domain structure of influenza virus M1 protein].

    Science.gov (United States)

    Ksenofontov, A L; Dobrov, E N; Fedorova, N V; Radiukhin, V A; Badun, G A; Arutiunian, A M; Bogacheva, E N; Baratova, L A

    2011-01-01

    Influenza virus matrix M1 protein is one of the main structural components of the virion performing also many different functions in infected cell. X-ray analysis data with 2.08 angstrom resolution were obtained only for the N-terminal part of M1 protein molecule (residues 2-158) but not for its C-terminal domain (159-252). In the present work M1 protein of A/Puerto Rico/8/34 (H1N1) virus strain in acidic solution was investigated with the help of tritium bombardment. Tritium label incorporation into M1 protein domains preferentially labeled the C-domain and inter-domain loops. Analytical centrifugation and dynamic light scattering experiments demonstrated increased hydrodynamic parameters (diameter) that may be explained by low degree of M1 structural organization. Computational analysis of M1 protein by intrinsic disorder predictions methods also demonstrated the presence of unfolded regions mostly in the C-domain and inter-domain loops. It is suggested, that influenza virus M1 polyfunctionality in infected cell is determined by its tertiary structure plasticity which in its turn results from the presence of unstructured regions.

  13. The role of the humoral immune response in the molecular evolution of the envelope C2, V3 and C3 regions in chronically HIV-2 infected patients

    Directory of Open Access Journals (Sweden)

    Novo Carlos

    2008-09-01

    Full Text Available Abstract Background This study was designed to investigate, for the first time, the short-term molecular evolution of the HIV-2 C2, V3 and C3 envelope regions and its association with the immune response. Clonal sequences of the env C2V3C3 region were obtained from a cohort of eighteen HIV-2 chronically infected patients followed prospectively during 2–4 years. Genetic diversity, divergence, positive selection and glycosylation in the C2V3C3 region were analysed as a function of the number of CD4+ T cells and the anti-C2V3C3 IgG and IgA antibody reactivity Results The mean intra-host nucleotide diversity was 2.1% (SD, 1.1%, increasing along the course of infection in most patients. Diversity at the amino acid level was significantly lower for the V3 region and higher for the C2 region. The average divergence rate was 0.014 substitutions/site/year, which is similar to that reported in chronic HIV-1 infection. The number and position of positively selected sites was highly variable, except for codons 267 and 270 in C2 that were under strong and persistent positive selection in most patients. N-glycosylation sites located in C2 and V3 were conserved in all patients along the course of infection. Intra-host variation of C2V3C3-specific IgG response over time was inversely associated with the variation in nucleotide and amino acid diversity of the C2V3C3 region. Variation of the C2V3C3-specific IgA response was inversely associated with variation in the number of N-glycosylation sites. Conclusion The evolutionary dynamics of HIV-2 envelope during chronic aviremic infection is similar to HIV-1 implying that the virus should be actively replicating in cellular compartments. Convergent evolution of N-glycosylation in C2 and V3, and the limited diversification of V3, indicates that there are important functional constraints to the potential diversity of the HIV-2 envelope. C2V3C3-specific IgG antibodies are effective at reducing viral population size

  14. 49 CFR Appendix C to Part 241 - Geographical Boundaries of FRA's Regions and Addresses of FRA's Regional Headquarters

    Science.gov (United States)

    2010-10-01

    ... to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION, DEPARTMENT OF TRANSPORTATION UNITED... consists of New Mexico, Oklahoma, Arkansas, Louisiana and Texas. The mailing address of the Regional...

  15. Acute phencyclidine administration induces c-Fos-immunoreactivity in interneurons in cortical and subcortical regions.

    Science.gov (United States)

    Hervig, Mona E; Thomsen, Morten S; Kalló, Imre; Mikkelsen, Jens D

    2016-10-15

    Dysfunction of N-Methyl-d-aspartate receptors (NMDARs) is believed to underlie some of the symptoms in schizophrenia, and non-competitive NMDAR antagonists (including phencyclidine (PCP)) are widely used as pharmacological schizophrenia models. Furthermore, mounting evidence suggests that impaired γ-aminobutyric acid (GABA) neurotransmission contributes to the cognitive deficits in schizophrenia. Thus alterations in GABAergic interneurons have been observed in schizophrenia patients and animal models. Acute systemic administration of PCP increases levels of c-Fos in several cortical and subcortical areas, but whether such induction occurs in specific populations of GABAergic interneuron subtypes still remains to be established. We performed an immunohistochemical analysis of the PCP-induced c-Fos-immunoreactivity (IR) in parvalbumin (PV) and calbindin (CB) interneuron subtypes in the cortex and thalamus of rats. A single dose of PCP (10mg/kg, s.c.) significantly increased total number of c-Fos-IR in: (1) the prelimbic, infralimbic, anterior cingulate, ventrolateral orbital, motor, somatosensory and retrosplenial cortices as well as the nucleus accumbens (NAc), field CA1 of the hippocampus (CA1) field of hippocampus and mediodorsal thalamus (MD); (2) PV-IR cells in the ventrolateral orbitofrontal and retrosplenial cortices and CA1 field of hippocampus; and (3) CB-IR cells in the motor cortex. Overall, our data indicate that PCP activates a wide range of cortical and subcortical brain regions and that a substantial part of this activation is present in GABAergic interneurons in certain regions. This suggests that the psychotomimetic effect of PCP may be mediated via GABAergic interneurons. Copyright © 2016 IBRO. Published by Elsevier Ltd. All rights reserved.

  16. Characterization of the Salmonella typhimurium pagC/pagD chromosomal region.

    Science.gov (United States)

    Gunn, J S; Alpuche-Aranda, C M; Loomis, W P; Belden, W J; Miller, S I

    1995-01-01

    The PhoP/PhoQ two-component system regulates Salmonella typhimurium genes that are essential to bacterial virulence and survival within macrophages. The best characterized of these PhoP-activated genes (pag) is pagC, which encodes a 188-amino-acid envelope protein (W. S. Pulkkinen and S. I. Miller, J. Bacteriol. 173:86-93, 1991). We here report the identification of four genes (pagD, envE, msgA, and envF) located 5' to pagC. Each gene is transcribed from its own promoter, two of which (msgA and pagD) were defined by primer extension analysis. Three of these genes (pagD, envE, and envF) are predicted to encode envelope proteins. The pagD gene is transcribed in a direction opposite from that of and adjacent to pagC and is positively regulated by PhoP/PhoQ. Transposon insertions within pagD and msgA attenuate bacterial virulence and survival within macrophages; however, deletion of pagD has no effect on virulence. The product of the envF gene is predicted to be a lipoprotein on the basis of the presence of a consensus lipid attachment site. The low G + C content of these genes and the homology of msgA to Shigella plasmid DNA suggest that this region may have been acquired by horizontal transmission. PMID:7665482

  17. Process Model for Studying Regional 13C Stable Isotope Exchange between Vegetation and Atmosphere

    Science.gov (United States)

    Chen, J. M.; Chen, B.; Huang, L.; Tans, P.; Worthy, D.; Ishizawa, M.; Chan, D.

    2007-12-01

    The variation of the stable isotope 13CO2 in the air in exchange with land ecosystems results from fractionation processes in both plants and soil during photosynthesis and respiration. Its diurnal and seasonal variations therefore contain information on the carbon cycle. We developed a model (BEPS-iso) to simulate its exchange between vegetation and the atmosphere. To be useful for regional carbon cycle studies, the model has the following characteristics: (i) it considers the turbulent mixing in the vertical profile from the soil surface to the top of the planetary boundary layer (PBL); (ii) it scales individual leaf photosynthetic discrimination to the whole canopy through the separation of sunlit and shaded leaf groups; (iii) through simulating leaf-level photosynthetic processes, it has the capacity to mechanistically examine isotope discrimination resulting from meteorological forcings, such as radiation, precipitation and humidity; and (iv) through complete modeling of radiation, energy and water fluxes, it also simulates soil moisture and temperature needed for estimating ecosystem respiration and the 13C signal from the soil. After validation using flask data acquired at 20 m level on a tower near Fraserdale, Ontario, Canada, during intensive campaigns (1998-2000), the model has been used for several purposes: (i) to investigate the diurnal and seasonal variations in the disequilibrium in 13C fractionation between ecosystem respiration and photosynthesis, which is an important step in using 13C measurements to separate these carbon cycle components; (ii) to quantify the 13C rectification in the PBL, which differs significantly from CO2 rectification because of the diurnal and seasonal disequilibriums; and (iii) to model the 13C spatial and temporal variations over the global land surface for the purpose of CO2 inversion using 13C as an additional constraint.

  18. The spt5 C-terminal region recruits yeast 3' RNA cleavage factor I.

    Science.gov (United States)

    Mayer, Andreas; Schreieck, Amelie; Lidschreiber, Michael; Leike, Kristin; Martin, Dietmar E; Cramer, Patrick

    2012-04-01

    During transcription elongation, RNA polymerase II (Pol II) binds the general elongation factor Spt5. Spt5 contains a repetitive C-terminal region (CTR) that is required for cotranscriptional recruitment of the Paf1 complex (D. L. Lindstrom et al., Mol. Cell. Biol. 23:1368-1378, 2003; Z. Zhang, J. Fu, and D. S. Gilmour, Genes Dev. 19:1572-1580, 2005). Here we report a new role of the Spt5 CTR in the recruitment of 3' RNA-processing factors. Chromatin immunoprecipitation (ChIP) revealed that the Spt5 CTR is required for normal recruitment of pre-mRNA cleavage factor I (CFI) to the 3' ends of Saccharomyces cerevisiae genes. RNA contributes to CFI recruitment, as RNase treatment prior to ChIP further decreases CFI ChIP signals. Genome-wide ChIP profiling detected occupancy peaks of CFI subunits around 100 nucleotides downstream of the polyadenylation (pA) sites of genes. CFI recruitment to this defined region may result from simultaneous binding to the Spt5 CTR, to nascent RNA containing the pA sequence, and to the elongating Pol II isoform that is phosphorylated at serine 2 (S2) residues in its C-terminal domain (CTD). Consistent with this model, the CTR interacts with CFI in vitro but is not required for pA site recognition and transcription termination in vivo.

  19. Kinematics of the active region of the quasar 3C 345

    Science.gov (United States)

    Matveyenko, L. I.; Sivakon', S. S.

    2013-08-01

    The fine structure of the quasar 3C 345 in polarized emission at 7 mm and 2 cm has been investigated. The kinematics is shown to correspond to an anticentrifuge: the thermal plasma of the surrounding space accretes onto the disk, flows to the center, and is ejected in the form of a rotating bipolar outflow that carries away the excess angular momentum as it accumulates. The bipolar outflow consists of a high-velocity central jet surrounded by a low-velocity component. The low-velocity flows are the rotating hollow tubes ejected from the peripheral part of the disk with a diameter ˜Ø1 = 2.2 pc and from the region Ø2 = 1 pc. The high-velocity jet with a diameter Ø3 = 0.2 pc is ejected from the central part of the disk, while the remnant falls onto the forming central body. The ejection velocity of the high-velocity flow is v ⩾ 0.06 c. At a distance up to ˜1 pc, the jet accelerates to an apparent velocity v ˜ 8 c. Further out, uniform motion is observed within ˜2 pc following which deceleration occurs. The jet structure corresponding to a conical diverging helix with an increasing pitch is determined by gasdynamic instability. The counterjet structure is a mirror reflection of the nearby part of the jet. The brightness temperature of the fragment of the high-velocity flow at the exit from the counterjet nozzle is T b ≈ (1012-1013) K. The disk inclined at an angle of 60° to the plane of the sky shadows the jet ejector region. Ring currents observed in the tangential directions as parallel chains of components are excited in the rotating flows. The magnetic fields of the rotating bipolar outflow and the disk are aligned and oriented along the rotation axis. The translational motions of the jet and counterjet are parallel and antiparallel to the magnetic field, which determines their acceleration or deceleration. The quasar core is surrounded by a thermal plasma. The sizes of the HII region reach ˜30 pc. The electron density decreases with increasing

  20. Consequences of Global Warming of 1.5 ?C and 2 ?C for Regional Temperature and Precipitation Changes in the Contiguous United States

    OpenAIRE

    Karmalkar, Ambarish V.; Bradley, Raymond S.

    2017-01-01

    The differential warming of land and ocean leads to many continental regions in the Northern Hemisphere warming at rates higher than the global mean temperature. Adaptation and conservation efforts will, therefore, benefit from understanding regional consequences of limiting the global mean temperature increase to well below 2°C above pre-industrial levels, a limit agreed upon at the United Nations Climate Summit in Paris in December 2015. Here, we analyze climate model simulations from the C...

  1. Vitamin C content and potential of makroalga in the Coastal Region of Cigebang, Cianjur, West Java

    Directory of Open Access Journals (Sweden)

    TIA SETIAWATI

    2017-03-01

    Full Text Available Abstract. Setiawati T, Nurzaman M, Mutaqin AZ, Budiono R, Abdiwijaya A. 2017. Vitamin C content and potential of makroalga in the Coastal Region of Cigebang, Cianjur, West Java. Pros Sem Nas Masy Biodiv Indon 3: 39-44. This research aims to know the content of vitamin C macroalgae and its potential for the community in coastal area Cigebang Cianjur, West Java province. The methods used in the study is a quantitative descriptive approach. Techniques of sampling survey method using macroalgae, vitamin C test with the method iodometry, and to know the potential of macroalgae according to the community is carried out by the methods of questionnaire. The results showed that there is a difference of vitamin C on seven types of macroalgae are found namely Boergesenia forbesii 0.0167 mg/mL, Codium edule 0.0191 mg/mL, Padina sanctae-crucis 0.0686 mg/mL, Chaetomorpha antennina 0.0129 mg/mL, Ulva lactuca 0.0191 mg/mL, Cladophoropsis sundanensis 0.0211 mg/mL, and Sargassum sp. 0.0959 mg/mL. of the highest content of vitamin C contained in Sargassum sp. and the lowest at Chaetomorpha antennina. Based on the knowledge of local people, macroalgae are potentially economically and mostly sold to support the life of the community. Some people offer it as foodstuffs such as dodol, urab, stir fry, and even can be consumed directly. Other potential communities know about the macroalgae, i.e. as food ingredients gelatin, cosmetic ingredients, such as batik shirt-making materials, and medicines.

  2. Consequences of Global Warming of 1.5 °C and 2 °C for Regional Temperature and Precipitation Changes in the Contiguous United States.

    Science.gov (United States)

    Karmalkar, Ambarish V; Bradley, Raymond S

    2017-01-01

    The differential warming of land and ocean leads to many continental regions in the Northern Hemisphere warming at rates higher than the global mean temperature. Adaptation and conservation efforts will, therefore, benefit from understanding regional consequences of limiting the global mean temperature increase to well below 2°C above pre-industrial levels, a limit agreed upon at the United Nations Climate Summit in Paris in December 2015. Here, we analyze climate model simulations from the Coupled Model Intercomparison Project Phase 5 (CMIP5) to determine the timing and magnitude of regional temperature and precipitation changes across the contiguous United States (US) for global warming of 1.5 and 2°C and highlight consensus and uncertainties in model projections and their implications for making decisions. The regional warming rates differ considerably across the contiguous US, but all regions are projected to reach 2°C about 10-20 years before the global mean temperature. Although there is uncertainty in the timing of exactly when the 1.5 and 2°C thresholds will be crossed regionally, over 80% of the models project at least 2°C warming by 2050 for all regions for the high emissions scenario. This threshold-based approach also highlights regional variations in the rate of warming across the US. The fastest warming region in the contiguous US is the Northeast, which is projected to warm by 3°C when global warming reaches 2°C. The signal-to-noise ratio calculations indicate that the regional warming estimates remain outside the envelope of uncertainty throughout the twenty-first century, making them potentially useful to planners. The regional precipitation projections for global warming of 1.5°C and 2°C are uncertain, but the eastern US is projected to experience wetter winters and the Great Plains and the Northwest US are projected to experience drier summers in the future. The impact of different scenarios on regional precipitation projections is

  3. Consequences of Global Warming of 1.5 °C and 2 °C for Regional Temperature and Precipitation Changes in the Contiguous United States.

    Directory of Open Access Journals (Sweden)

    Ambarish V Karmalkar

    Full Text Available The differential warming of land and ocean leads to many continental regions in the Northern Hemisphere warming at rates higher than the global mean temperature. Adaptation and conservation efforts will, therefore, benefit from understanding regional consequences of limiting the global mean temperature increase to well below 2°C above pre-industrial levels, a limit agreed upon at the United Nations Climate Summit in Paris in December 2015. Here, we analyze climate model simulations from the Coupled Model Intercomparison Project Phase 5 (CMIP5 to determine the timing and magnitude of regional temperature and precipitation changes across the contiguous United States (US for global warming of 1.5 and 2°C and highlight consensus and uncertainties in model projections and their implications for making decisions. The regional warming rates differ considerably across the contiguous US, but all regions are projected to reach 2°C about 10-20 years before the global mean temperature. Although there is uncertainty in the timing of exactly when the 1.5 and 2°C thresholds will be crossed regionally, over 80% of the models project at least 2°C warming by 2050 for all regions for the high emissions scenario. This threshold-based approach also highlights regional variations in the rate of warming across the US. The fastest warming region in the contiguous US is the Northeast, which is projected to warm by 3°C when global warming reaches 2°C. The signal-to-noise ratio calculations indicate that the regional warming estimates remain outside the envelope of uncertainty throughout the twenty-first century, making them potentially useful to planners. The regional precipitation projections for global warming of 1.5°C and 2°C are uncertain, but the eastern US is projected to experience wetter winters and the Great Plains and the Northwest US are projected to experience drier summers in the future. The impact of different scenarios on regional precipitation

  4. Consequences of Global Warming of 1.5 °C and 2 °C for Regional Temperature and Precipitation Changes in the Contiguous United States

    Science.gov (United States)

    Bradley, Raymond S.

    2017-01-01

    The differential warming of land and ocean leads to many continental regions in the Northern Hemisphere warming at rates higher than the global mean temperature. Adaptation and conservation efforts will, therefore, benefit from understanding regional consequences of limiting the global mean temperature increase to well below 2°C above pre-industrial levels, a limit agreed upon at the United Nations Climate Summit in Paris in December 2015. Here, we analyze climate model simulations from the Coupled Model Intercomparison Project Phase 5 (CMIP5) to determine the timing and magnitude of regional temperature and precipitation changes across the contiguous United States (US) for global warming of 1.5 and 2°C and highlight consensus and uncertainties in model projections and their implications for making decisions. The regional warming rates differ considerably across the contiguous US, but all regions are projected to reach 2°C about 10-20 years before the global mean temperature. Although there is uncertainty in the timing of exactly when the 1.5 and 2°C thresholds will be crossed regionally, over 80% of the models project at least 2°C warming by 2050 for all regions for the high emissions scenario. This threshold-based approach also highlights regional variations in the rate of warming across the US. The fastest warming region in the contiguous US is the Northeast, which is projected to warm by 3°C when global warming reaches 2°C. The signal-to-noise ratio calculations indicate that the regional warming estimates remain outside the envelope of uncertainty throughout the twenty-first century, making them potentially useful to planners. The regional precipitation projections for global warming of 1.5°C and 2°C are uncertain, but the eastern US is projected to experience wetter winters and the Great Plains and the Northwest US are projected to experience drier summers in the future. The impact of different scenarios on regional precipitation projections is

  5. Fourier Transform Absorption Spectroscopy of C_3 in the ν_3 Antisymmetric Stretch Mode Region

    Science.gov (United States)

    Vervloet, Michel; Martin-Drumel, Marie-Aline; Tokaryk, Dennis W.; Pirali, Olivier

    2017-06-01

    The C_3 molecule has been detected in a variety of astrophysical objects thanks to the well-known 4050 Å (A^1Π_u-X^1Σ ^+ _g) electronic transition as well as the two IR active modes of the electronic ground state: ν_2 (˜ 63.42 cm^{-1}) and ν_3 (˜ 2040.02 cm^{-1}). Previous laboratory data in the ν_3 region, obtained using diode laser spectroscopy and the photolysis of allene to produce C_3, permitted measurement of the fundamental (0,0,1)Σ-(0,0,0)Σ as well as the hot bands: (0,1,1)Π-(0,1,0)Π; (0,2,1)Σ-(0,2,0)Σ; (0,2,1)Δ-(0,2,0)Δ and provided insights on the anharmonicity of the (0,nν_2,1) vibrational pattern. We have recorded the absorption spectrum of C_3 in the 1800-2100 cm^{-1} region (at a resolution of 0.003 cm^{-1}) using the Bruker IFS 125 Fourier Transform spectrometer at the AILES beamline of Synchrotron SOLEIL. C_3 was produced in a DC discharge of methane heavily diluted in helium. The rovibrational temperature of C_3 produced in our discharge is noticeably higher than in Ref. [4], which allowed us to extend measurements to higher J values. More interestingly, we assigned new hot bands involving higher quanta of the ν_2 bending states: (0,nν_2,1) with n ranging from 0 to 5. Despite the absence of Q branches for these bands, which results in a possible ambiguous J-assignment of P and R lines, the large variety of data considered in this work, in addition to our experimental data and including observations of comet spectra, allows confident assignments. L. Gausset, G. Herzberg, A. Lagerqvist, B. Rosen, Astrophysical Journal, 45-81 (1965); T. F. Giesen et al., The Astrophysical Journal, 551, L181-L184 (2001) K. W. Hinkle, J. J. Keady, P. F. Bernath, Science, 241, 1319-1322 (1988) K. Kawaguchi et al., J. Chem. Phys., 91, 1953-1957 (1989)

  6. Regional Issue Identification and Assessment (RIIA): an analysis of the Mid-Range Projection Series C Scenario. Executive summary for Federal Region IV

    Energy Technology Data Exchange (ETDEWEB)

    Honea, B.; Hillsman, E.

    1979-10-01

    The Department of Energy (DOE) has hypothesized a number of alternate energy futures as part of its energy planning and analysis programs. In this report, which is part of DOE's Regional Issue Identification and Assessment (RIIA) Program, Oak Ridge National Laboratory examines how a proposed energy future called the Mid-Range Projection Series C Scenario would affect Federal Region IV (Alabama, Florida, Georgia, Kentucky, Mississippi, North Carolina, South Carolina, and Tennessee). This scenario, to be called the Series C Scenario, assumes a medium supply and a medium demand for fuel through 1990, and it incorporates the fuel switching provisions of the Energy Supply and Environmental Coordination Act. The report portrays the major regional environmental, human health and safety, socioeconomic, and institutional effects that might result from the implementation of the Series C Scenario.

  7. [11C]-(R)-PK11195 positron emission tomography in patients with complex regional pain syndrome

    Science.gov (United States)

    Jeon, So Yeon; Seo, Seongho; Lee, Jae Sung; Choi, Soo-Hee; Lee, Do-Hyeong; Jung, Ye-Ha; Song, Man-Kyu; Lee, Kyung-Jun; Kim, Yong Chul; Kwon, Hyun Woo; Im, Hyung-Jun; Lee, Dong Soo; Cheon, Gi Jeong; Kang, Do-Hyung

    2017-01-01

    Abstract Complex regional pain syndrome (CRPS) is characterized by severe and chronic pain, but the pathophysiology of this disease are not clearly understood. The primary aim of our case–control study was to explore neuroinflammation in patients with CRPS using positron emission tomography (PET), with an 18-kDa translocator protein specific radioligand [11C]-(R)-PK11195. [11C]-(R)-PK11195 PET scans were acquired for 11 patients with CRPS (30–55 years) and 12 control subjects (30–52 years). Parametric image of distribution volume ratio (DVR) for each participant was generated by applying a relative equilibrium-based graphical analysis. The DVR of [11C]-(R)-PK11195 in the caudate nucleus (t(21) = −3.209, P = 0.004), putamen (t(21) = −2.492, P = 0.022), nucleus accumbens (t(21) = −2.218, P = 0.040), and thalamus (t(21) = −2.395, P = 0.026) were significantly higher in CRPS patients than in healthy controls. Those of globus pallidus (t(21) = −2.045, P = 0.054) tended to be higher in CRPS patients than in healthy controls. In patients with CRPS, there was a positive correlation between the DVR of [11C]-(R)-PK11195 in the caudate nucleus and the pain score, the visual analog scale (r = 0.661, P = 0.026, R2 = 0.408) and affective subscales of McGill Pain Questionnaire (r = 0.604, P = 0.049, R2 = 0.364). We demonstrated that neuroinflammation of CRPS patients in basal ganglia. Our results suggest that microglial pathology can be an important pathophysiology of CRPS. Association between the level of caudate nucleus and pain severity indicated that neuroinflammation in this region might play a key role. These results may be essential for developing effective medical treatments. PMID:28072713

  8. Distribution of Hepatitis C Virus Genotypes in the South Marmara Region

    Directory of Open Access Journals (Sweden)

    Harun Agca

    2014-03-01

    Full Text Available Aim: Hepatitis C virus (HCV is an important caustive agent of hepatitis, cirrhosis and hepatocellular carcinoma both in our country and the world. Prognosis and response to treatment is related with the genotype of HCV which has six genotypes and over a hundred quasispecies. Knowing the HCV genotype is also important for epidemiological data. In this study we aimed to investigate the HCV genotypes of samples sent to Uludag University Hospital Microbiology Laboratory which is the reference centre in the South Marmara Region. Material and Method: This study was done retrospectively to analyse the HCV patients%u2019 sera sent to our laboratory between July 2010and December 2012 for HCV genotyping. Artus HCV QS-RGQ PCR kit (Qiagene,Hilden, Germany was used in Rotor-Gene Q (Qiagene, Hilden Germany for detection of HCV RNA. HCV RNA positive samples of patients%u2019 sera were were used for genotyping by the Linear Array HCV genotyping test (Roche, NJ, USA.Results: 214 (92.6 % of total 231 patients included in the study were genotype 1, one (0.4 % was genotype 2, nine (3.9 % were genotype 3 and, seven (3.4 % were found genotype 4. Three of genotype 3 patients were of foreign nationality, two were born abroad and one of the genotype 4 patients were born abroad. Discussion: Concordant with our country data the most frequent genotype was 1, genotype 2 was seen in patients especially related with foreign countries and genotype 4 was seen rare. The importance of genotype 1, which is seen more frequent in our country and region is; resistance to antiviral treatment and prolonged treatment duration in chronic hepatitis C patients.

  9. Probing the Radio Counterpart of Gamma-ray Flaring Region in 3C 84

    Directory of Open Access Journals (Sweden)

    Nagai Hiroshi

    2013-12-01

    Full Text Available The radio source 3C 84 associated with the radio/giant elliptical galaxy NGC 1275 is one of the best targets to probe the radio counterpart of the γ-ray emitting region. Although this source shows clear time variability in γ-ray bands, no clear correlation in radio light curve was found on the timescale of –ray variability. The location of the γ-ray flaring region has been an open question. In this proceeding, we firstly review our previous findings from radio observations. Next we present our new results based on the Very Long Baseline Array (VLBA data at 43 GHz. We discover the limb-brightened structure in the “restarted” jet associated with the 2005 radio outburst. In 1990s, the jet structure was rather ridge-brightening than limbbrightening, despite the observations were done with similar angular resolution. This indicates that the radio jet morphology in terms of the transverse structure has been indeed changed recently. This change in the morphology shows an interesting agreement with the time variation of the γ-ray flux density, i.e., the γ-ray flux density in 1990s was more than 7 times lower than the current one. We argue the possibility that the transition from ridge-brightening to limb-brightening is related to the γ-ray time variability.

  10. Specific identification of Western Atlantic Ocean scombrids using mitochondrial DNA cytochrome c oxidase subunit I (COI) gene region sequences

    National Research Council Canada - National Science Library

    Paine, Melissa A; McDowell, Jan R; Graves, John E

    2007-01-01

    .... The mitochondrial cytochrome c oxidase subunit I (COI) gene region was evaluated as a molecular marker for the specific identification of the 17 members of the family Scombridae common to the western Atlantic Ocean...

  11. Association of HLA-C and HCP5 gene regions with the clinical course of HIV-1 infection

    NARCIS (Netherlands)

    van Manen, Daniëlle; Kootstra, Neeltje A.; Boeser-Nunnink, Brigitte; Handulle, Muna Am; Vanʼt Wout, Angélique B.; Schuitemaker, Hanneke

    2009-01-01

    Background: Recently, a genome-wide association analysis revealed single-nucleotide polymorphisms (SNPs) in the gene regions of HLA-C and HCP5 to be associated with viral load at set point and SNPs in the RNF39/ZNRD1 gene region to be associated with HIV-1 disease course. Methods: We Studied whether

  12. Spatiotemporal Reconstruction of the Introduction of Hepatitis C Virus into Scotland and Its Subsequent Regional Transmission.

    Science.gov (United States)

    McNaughton, Anna L; Cameron, Iain Dugald; Wignall-Fleming, Elizabeth B; Biek, Roman; McLauchlan, John; Gunson, Rory N; Templeton, Kate; Tan, Harriet Mei-Lin; Leitch, E Carol McWilliam

    2015-11-01

    A more comprehensive understanding of hepatitis C virus (HCV) transmission dynamics could facilitate public health initiatives to reduce the prevalence of HCV in people who inject drugs. We aimed to determine how HCV sequences entered and spread throughout Scotland and to identify transmission hot spots. A Scottish data set with embedded demographic data was created by sequencing the NS5B of 125 genotype 1a (Gt1a) samples and 166 Gt3a samples and analyzed alongside sequences from public databases. Applying Bayesian inference methods, we reconstructed the global origin and local spatiotemporal dissemination of HCV in Scotland. Scottish sequences mainly formed discrete clusters interspersed between sequences from the rest of the world; the most recent common ancestors of these clusters dated to 1942 to 1952 (Gt1a) and 1926 to 1942 (Gt3a), coincident with global diversification and distribution. Extant Scottish sequences originated in Edinburgh (Gt1a) and Glasgow (Gt3a) in the 1970s, but both genotypes spread from Glasgow to other regions. The dominant Gt1a strain differed between Edinburgh (cluster 2 [C2]), Glasgow (C3), and Aberdeen (C4), whereas significant Gt3a strain specificity occurred only in Aberdeen. Specific clusters initially formed separate transmission zones in Glasgow that subsequently overlapped, occasioning city-wide cocirculation. Transmission hot spots were detected with 45% of samples from patients residing in just 9 of Glasgow's 57 postcode districts. HCV was introduced into Scotland in the 1940s, concomitant with its worldwide dispersal likely arising from global-scale historical events. Cluster-specific transmission hubs were identified in Glasgow, the key Scottish city implicated in HCV dissemination. This fine-scale spatiotemporal reconstruction improves understanding of HCV transmission dynamics in Scotland. HCV is a major health burden and the leading cause of hepatocellular carcinoma. Public health needle exchange and "treatment as

  13. Evolutionary and structural features of the C2, V3 and C3 envelope regions underlying the differences in HIV-1 and HIV-2 biology and infection.

    Directory of Open Access Journals (Sweden)

    Helena Barroso

    Full Text Available BACKGROUND: Unlike in HIV-1 infection, the majority of HIV-2 patients produce broadly reactive neutralizing antibodies, control viral replication and survive as elite controllers. The identification of the molecular, structural and evolutionary footprints underlying these very distinct immunological and clinical outcomes may lead to the development of new strategies for the prevention and treatment of HIV infection. METHODOLOGY/PRINCIPAL FINDINGS: We performed a side-by-side molecular, evolutionary and structural comparison of the C2, V3 and C3 envelope regions from HIV-1 and HIV-2. These regions contain major antigenic targets and are important for receptor binding. In HIV-2, these regions also have immune modulatory properties. We found that these regions are significantly more variable in HIV-1 than in HIV-2. Within each virus, C3 is the most entropic region followed by either C2 (HIV-2 or V3 (HIV-1. The C3 region is well exposed in the HIV-2 envelope and is under strong diversifying selection suggesting that, like in HIV-1, it may harbour neutralizing epitopes. Notably, however, extreme diversification of C2 and C3 seems to be deleterious for HIV-2 and prevent its transmission. Computer modelling simulations showed that in HIV-2 the V3 loop is much less exposed than C2 and C3 and has a retractile conformation due to a physical interaction with both C2 and C3. The concealed and conserved nature of V3 in the HIV-2 is consistent with its lack of immunodominancy in vivo and with its role in preventing immune activation. In contrast, HIV-1 had an extended and accessible V3 loop that is consistent with its immunodominant and neutralizing nature. CONCLUSIONS/SIGNIFICANCE: We identify significant structural and functional constrains to the diversification and evolution of C2, V3 and C3 in the HIV-2 envelope but not in HIV-1. These studies highlight fundamental differences in the biology and infection of HIV-1 and HIV-2 and in their mode of

  14. IMPACT OF DIELECTRIC PARAMETERS ON THE REFLECTIVITY OF 3C-SiC WAFERS WITH A ROUGH SURFACE MORPHOLOGY IN THE RESTSTRAHLEN REGION

    Energy Technology Data Exchange (ETDEWEB)

    J.A.A. Engelbrecht; E. Janzén; A. Henry; I.J. van Rooyen

    2014-04-01

    A layer-on-substrate model is used to obtain the infrared reflectance for 3C-SiC with a rough surface morphology. The effect of varying dielectric parameters of the “damaged layer” on the observed reflectivity of the 3C-SiC in the reststrahlen region is assessed. Different simulated reflectance spectra are obtained to those if the dielectric parameters of the “substrate” were varied. Most notable changes in the shape of the simulated reststrahlen peak are observed for changes in the high frequency dielectric constant, the phonon damping constant, the phonon frequencies and “thickness” of damaged surface layer.

  15. The C-terminal region of alpha-crystallin: involvement in protection against heat-induced denaturation

    Science.gov (United States)

    Takemoto, L.; Emmons, T.; Horwitz, J.; Spooner, B. S. (Principal Investigator)

    1993-01-01

    Recent studies have demonstrated that the alpha-crystallins can protect other proteins against heat-induced denaturation and aggregation. To determine the possible involvement of the C-terminal region in this activity, the alpha-crystallins were subjected to limited tryptic digestion, and the amount of cleavage from the N-terminal and C-terminal regions of the alpha-A and alpha-B crystallin chains was assessed using antisera specific for these regions. Limited tryptic digestion resulted in cleavage only from the C-terminal region of alpha-A crystallin. This trypsin-treated alpha-A crystallin preparation showed a decreased ability to protect proteins from heat-induced aggregation using an in vitro assay. Together, these results demonstrate that the C-terminal region of alpha-A crystallin is important for its ability to protect against heat-induced aggregation, which is consistent with the hypothesis that post-translational changes that are known to occur at the C-terminal region may have significant effects on the ability of alpha-A crystallin to protect against protein denaturation in vivo.

  16. Analysis of a DNA polymorphic region in the gtfB and gtfC genes of Streptococcus mutans.

    Science.gov (United States)

    Chia, J S; Lin, S W; Hsu, T Y; Chen, J Y; Kwan, H W; Yang, C S

    1993-04-01

    We have previously demonstrated the existence of DNA polymorphisms at the 5' coding regions of the gtfB and gtfC genes specifying the streptococcal glucosyltransferases (J.S. Chia, T.Y. Hsu, L.J. Teng, J.Y. Chen, L.J. Hahn, and C.S. Yang, Infect. Immun. 59:1656-1660, 1991). DNA sequence analysis by polymerase chain reaction and direct sequencing revealed that while several nucleotide changes were identified, accounting for the polymorphisms, the amino acids which they code for remain unchanged. The polymorphic region is located in a highly conserved amino terminus of the glucosyltransferases. A peptide of 19 amino acids from this region reversed the inhibiting activity of an antiserum raised against the proteins coded for by the gtfB and gtfC genes. The results suggest that the polymorphic region, varying in DNA but not in amino acid sequences, might specify some biological function.

  17. [Hepatitis C virus genotypes in a province of western Black-Sea region, Turkey].

    Science.gov (United States)

    Aktaş, Elif; Ogedey, Esra Deniz; Külah, Canan; Beğendik Cömert, Füsun

    2010-10-01

    Hepatitis C virus (HCV) is one of the significant causes of hepatitis, cirrhosis and hepatocellular carcinoma all throughout the world. There are six genotypes and more than 50 subtypes of HCV. HCV genotyping is of crucial importance in the determination of the treatment protocols and the follow-up of the clinical course since treatment success is low and the duration of treatment is longer in HCV genotype 1 infected cases. The aim of the present study was to evaluate the HCV genotype profiles of the patients with chronic hepatitis C in Zonguldak, providing the first data about HCV genotypes from western Black-Sea region, Turkey. The HCV genotypes of 44 patients (26 female, 18 male; age range: 29-89 years, mean age: 60.05 ± 10.81 years) with positive anti-HCV antibody and HCV-RNA results, admitted to the hospital between May 2007 and July 2009, were retrospectively evaluated and included in the study. Alanine aminotransferase (ALT) levels of the patients were between 8-160 IU/L (mean 63.99 ± 37.15 IU/L) and the aspartate aminotransferase (AST) levels were between 17-160 IU/L (mean 62.77 ± 36.75 IU/L). HCV antibody was determined by ELISA method (Abbott Laboratories, USA), and HCV-RNA was determined by two commercial real-time polymerase chain reaction systems [Cobas Taqman (Roche Diagnostic, USA) and Rotor-Gene 6000 (Corbett Research, USA)]. The genotyping was performed by a reverse hybridization based method, Versant® HCV Genotype Assay (LiPA) 2.0 (Bayer Health Care, Belgium). HCV genotypes could not be determined for 5 (11.4%) patients since HCV-RNA levels were low. Genotyping could be performed for 39 (88.6%) patients and 38 (97.4%) had genotype 1b and one (2.6%) patient had genotype 1a. In conclusion, in concordance with the other studies conducted in our country, genotype 1b was found to be the most prevalent genotype in patients from our region.

  18. 5' coding region of the follicular epithelium yolk polypeptide 2 cDNA in the moth, Plodia interpunctella, contains an extended coding region.

    Science.gov (United States)

    Shirk, P D; Perera, O P

    1998-01-01

    The 5' region of YP2 cDNA, a follicular epithelium yolk protein subunit in the moth, Plodia interpunctella, shows that the polypeptide contains an extended internal coding region. Partial cDNA clones for YP2 were isolated from a pharate adult female ovarian cDNA expression library in Lambda Zap II by screening with antigen selected YP2 antiserum. The 5' sequence of the YP2 transcript was determined by 5' RACE PCR of ovarian mRNA using YP2 sequence-specific nested primers. The combined cDNA and 5' RACE sequencing showed the YP2 transcript to be 1971 bp in length up to the poly(A) tail with a single open reading frame for a predicted polypeptide of 616 amino acids. Northern analysis showed a single YP2 transcript to be present in ovarian RNA that was approximately 2 kb in length. The predicted amino acid sequence for YP2 from P. interpunctella is most closely related to egg specific protein (ESP) from Bombyx mori and the partial YP2 sequence from Galleria mellonella. YP2 from P. interpunctella also is similar to vertebrate lipases and contains a conserved lipid binding region. However, the 5' coding region of YP2 from P. interpunctella contains an in-frame insert of approximately 438 bp that had replaced an approximately 270-bp region as compared with ESP from B. mori and YP2 of G. mellonella. This suggests that the insert occurred by a recombinational event internal to the YP2 structural gene of P. interpunctella.

  19. The C-Terminal Region of G72 Increases D-Amino Acid Oxidase Activity

    Directory of Open Access Journals (Sweden)

    Sunny Li-Yun Chang

    2013-12-01

    Full Text Available The schizophrenia-related protein G72 plays a unique role in the regulation of D-amino acid oxidase (DAO in great apes. Several psychiatric diseases, including schizophrenia and bipolar disorder, are linked to overexpression of DAO and G72. Whether G72 plays a positive or negative regulatory role in DAO activity, however, has been controversial. Exploring the molecular basis of the relationship between G72 and DAO is thus important to understand how G72 regulates DAO activity. We performed yeast two-hybrid experiments and determined enzymatic activity to identify potential sites in G72 involved in binding DAO. Our results demonstrate that residues 123–153 and 138–153 in the long isoform of G72 bind to DAO and enhance its activity by 22% and 32%, respectively. A docking exercise indicated that these G72 peptides can interact with loops in DAO that abut the entrance of the tunnel that substrate and cofactor must traverse to reach the active site. We propose that a unique gating mechanism underlies the ability of G72 to increase the activity of DAO. Because upregulation of DAO activity decreases d-serine levels, which may lead to psychiatric abnormalities, our results suggest a molecular mechanism involving interaction between DAO and the C-terminal region of G72 that can regulate N-methyl-d-aspartate receptor-mediated neurotransmission.

  20. Clustering of low usage codons in the translation initiation region of hepatitis C virus.

    Science.gov (United States)

    Zhou, Jian-hua; Su, Jun-hong; Chen, Hao-tai; Zhang, Jie; Ma, Li-na; Ding, Yao-zhong; Stipkovits, Laszlo; Szathmary, Susan; Pejsak, Zygmunt; Liu, Yong-sheng

    2013-08-01

    The adaptation of the overall codon usage pattern of hepatitis C virus (HCV) to that of human is estimated by the synonymous codon usage value (RSCU). The synonymous codon usage biases for the translation initiation region (TIR) of this virus are also analyzed by calculation of usage fluctuation of each synonymous codon along the TIR (the first 30 codon sites of the whole coding sequence of HCV). As for the overall codon usage pattern of HCV, this virus has a significant tendency to delete the codons with CpG or TpA dinucleotides. Turning to the adaptation of the overall codon usage of HCV to that of human, over half part of codons has a similar usage pattern between this virus and human, suggesting that the host cellular environment of the overall codon usage pattern influences the formation of codon usage for HCV. In addition, there is no obvious phenomenon that the codons with relatively low energy tend to be highly selected in the TIR of HCV, suggesting that the synonymous codon usage patterns for the TIR of HCV might be not affected by the secondary structure of nucleotide sequence, however, the formation of synonymous codons usage in the TIR of HCV is influenced by the overall codon usage patterns of human to some degree. Copyright © 2013 Elsevier B.V. All rights reserved.

  1. Translocation of an immunoglobulin kappa locus to a region 3' of an unrearranged c-myc oncogene enhances c-myc transcription.

    Science.gov (United States)

    Erikson, J; Nishikura, K; ar-Rushdi, A; Finan, J; Emanuel, B; Lenoir, G; Nowell, P C; Croce, C M

    1983-01-01

    We have studied somatic cell hybrids between mouse myeloma and JI Burkitt lymphoma cells carrying a t(2;8) chromosome translocation for the expression of human kappa chains. and for the presence and rearrangements of the human c-myc oncogene and kappa chain genes. Our results indicate that the c-myc oncogene is unrearranged and remains on the 8q+ chromosome of JI cells. Two rearranged C kappa genes were detected: the expressed allele on normal chromosome 2 and the excluded kappa allele that was translocated from chromosome 2 to the involved chromosome 8 (8q+). The distribution of V kappa and C kappa genes in hybrid clones retaining different human chromosomes indicated that C kappa is distal to V kappa on 2p and that the breakpoint in this Burkitt lymphoma is within the region carrying V kappa genes. High levels of transcripts of the c-myc gene were found when it resided on the 8q+ chromosome but not on the normal chromosome 8, demonstrating that translocation of a kappa locus to region distal to the c-myc oncogene enhances c-myc transcription. Images PMID:6424112

  2. Classication of Status of the Region on Java Island using C4.5, CHAID, and CART Methods

    Science.gov (United States)

    Syaraswati, R. A.; Slamet, I.; Winarno, B.

    2017-06-01

    The indicator of region economic success can be measured by economic growth, presented by value of Gross Regional Domestic Product (GRDP). Java island has the biggest GDP contribution toward the Indonesian government, but not all of the region gives equality contribution. The C4.5, CHAID, and CART methods can be used for classifying the status of the region with nonparametric approach. The C4.5 and CHAID methods are non-binary decision tree, meanwhile the CART methods is binary decision tree. The purposes of this paper are to know how the classification and to determine the factors that influence on classification of the region. The dependent variable is status of the region which is divided into four categories based on Klassen typology. The result shows factors that have the biggest contribution on classification of status of the region on Java island based on C4.5 method are economic growth rate, electricity, gas, and water sector, and area. The factors that have the biggest contribution based on CHAID method are growth rate, manufacturing sector, and electricity, gas, and water sector, while based on CART method are growth rate, manufacturing sector, and electricity, gas, and water sector.

  3. Foliar δ13C Showed No Altitudinal Trend in an Arid Region and Atmospheric Pressure Exerted a Negative Effect on Plant δ13C

    Directory of Open Access Journals (Sweden)

    Zixun Chen

    2017-07-01

    Full Text Available Previous studies have suggested foliar δ13C generally increases with altitude. However, some observations reported no changes or even decreased trends in foliar δ13C. We noted that all the studies in which δ13C increased with elevation were conducted in the human regions, whereas those investigations in which δ13C did not vary or decreased were conducted in areas with water stress. Thus, we proposed that the pattern of increasing δ13C with elevation is not a general one, and that δ13C may remain unchanged or decrease in plants grown in arid environments. To test the hypothesis, we sampled plants along altitude gradients on the shady and sunny slopes of Mount Tianshan characterized by arid and semiarid climates. The measurements of foliar δ13C showed no altitudinal trends for the plants grown on either of the slopes. Therefore, this study supported our hypothesis. In addition, the present study addressed the effect of atmospheric pressure on plant δ13C by accounting for the effects of temperature and precipitation on δ13C. This study found that the residual foliar δ13C increased with increasing altitude, suggesting that atmospheric pressure played a negative role in foliar δ13C.

  4. Photon-dominated region modeling of the [C I], [C II], and CO Line Emission From A Boundary In The Taurus molecular cloud

    Energy Technology Data Exchange (ETDEWEB)

    Orr, Matthew E. [Physics and Astronomy Department, University of Southern California, Los Angeles, CA 90089 (United States); Pineda, Jorge L.; Goldsmith, Paul F. [Jet Propulsion Laboratory, California Institute of Technology, 4800 Oak Grove Drive, Pasadena, CA 91109-8099 (United States)

    2014-11-01

    We present [C I] and [C II] observations of a linear edge region in the Taurus molecular cloud, and model this region as a cylindrically symmetric photon-dominated region (PDR) exposed to a low-intensity UV radiation field. The sharp, long profile of the linear edge makes it an ideal case to test PDR models and determine cloud parameters. We compare observations of the [C I], {sup 3} P {sub 1} → {sup 3} P {sub 0} (492 GHz), [C I] {sup 3} P {sub 2} → {sup 3} P {sub 1} (809 GHz), and [C II] {sup 2} P {sub 3/2} → {sup 2} P {sub 1/2} (1900 GHz) transitions, as well as the lowest rotational transitions of {sup 12}CO and {sup 13}CO, with line intensities produced by the RATRAN radiative transfer code from the results of the Meudon PDR code. We constrain the density structure of the cloud by fitting a cylindrical density function to visual extinction data. We study the effects of variation of the FUV field, {sup 12}C/{sup 13}C isotopic abundance ratio, sulfur depletion, cosmic ray ionization rate, and inclination of the filament relative to the sky-plane on the chemical network of the PDR model and resulting line emission. We also consider the role of suprathermal chemistry and density inhomogeneities. We find good agreement between the model and observations, and that the integrated line intensities can be explained by a PDR model with an external FUV field of 0.05 G {sub 0}, a low ratio of {sup 12}C to {sup 13}C ∼43, a highly depleted sulfur abundance (by a factor of at least 50), a cosmic ray ionization rate (3-6) × 10{sup –17} s{sup –1}, and without significant effects from inclination, clumping or suprathermal chemistry.

  5. Hepatitis C seroprevalence in an at-risk population in the southwest Madrid region of Spain.

    Science.gov (United States)

    Alonso López, Sonia; Agudo Fernández, Sandra; García Del Val, Antonia; Martínez Abad, Mercedes; López Hermosa Seseña, Paloma; Izquierdo, María Jesús; Núñez, Isabel; Berbel León, Susana; Visedo Campillo, Lourdes; Guisado Pérez, Cristina; Sánchez Lozano, Sandra; Mariño Pfeiffer, Isabel; García Bermúdez, Lourdes; Sánchez Jiménez, Francisco Javier; López Vega, Elena; Zambrano Álvarez, Jesús; Castro Pastor, M Luisa; Montes Ramírez, Guadalupe; Murillo, Cristina; Villafranca Ortega, Noelia; Ayuso Hernández, Isabel; Espejo, María; Lasala López, Pilar; Rodríguez Caravaca, Gil; Carrascosa Aguilar, Beatriz; Gutiérrez García, María Luisa; Fernández Rodríguez, Conrado

    2016-12-01

    The estimated seroprevalence of hepatitis C virus (HCV) in Spain is 1.7%, but is much higher in the at-risk population. The most efficient national screening strategy is unclear. To estimate the prevalence of HCV among the at-risk population seen in primary care (PC), and to determine their epidemiological profile. Cross-sectional descriptive prevalence study that included adult patients with risk factors for HCV infection seen in PC in the southwest Madrid region between 2010 and 2012. A total of 158 patients (men=51.3%), mean age 46 years (SD=16.6), were included. The most common risk factors were hypertransaminasaemia (44.3%) and major surgery (13.3%). Immigration, unsafe sexual practices, and tattoos or body piercing were more prevalent in patients younger than 45 years of age. Fifteen patients (9.5%) were positive for anti-HCV; 9 of these (5.7%) were HCV-ARN positive. Of the positive patients, 4 (44.4%) had significant fibrosis at diagnosis (F3-F4). Male patients had a higher rate of positive anti-HCV results (13.8 vs. 5.3%; P=.072), as did patients older than 45 years of age (12.8 vs. 6.3%; P=.167). Intravenous and intranasal drug use were associated with a higher rate of positive anti-HCV results (50 vs. 8.5%; P=.005 and 66.7 vs. 8.4%; P=.001, respectively). Patients with risk factors for HCV infection have high seroprevalence. Screening programmes must therefore be implemented to detect HCV infection in this population in PC. Copyright © 2016 Elsevier España, S.L.U., AEEH y AEG. All rights reserved.

  6. Temporal changes and regional differences in treatment uptake of hepatitis C therapy in EuroSIDA*

    Science.gov (United States)

    Grint, D; Peters, L; Schwarze-Zander, C; Beniowski, M; Pradier, C; Battegay, M; Jevtovic, D; Soriano, V; Lundgren, JD; Rockstroh, JK; Kirk, O; Mocroft, A

    2013-01-01

    Objectives All HIV/hepatitis C virus (HCV)-coinfected patients with chronic HCV infection and ≥ F2 fibrosis should be considered for HCV therapy. This study aimed to determine the rate of HCV treatment uptake among coinfected patients in Europe. Methods EuroSIDA patients with viraemic HCV infection were included in the study. Poisson regression was used to identify temporal changes and regional differences in HCV treatment uptake. Results A total of 1984 patients were included in the study, with a median follow-up time of 168 months [interquartile range (IQR) 121–204 months]. To date, 501 (25.3%) HIV/HCV-coinfected patients have received HCV therapy. Treatment incidence rose from 0.33 [95% confidence interval (CI) 0.16–0.50] per 100 person-years of follow-up (PYFU) in 1998 to 5.93 (95% CI 4.49–7.38) in 2007, falling to 3.78 (95% CI 2.50–5.07) in 2009. After adjustment, CD4 cell count > 350 cells/μL [incidence rate ratio (IRR) 1.33 (95% CI 1.06–1.67) vs. CD4 count 200−350 cells/μL] and ≥F2 liver fibrosis [IRR 1.60 (95% CI 1.14–2.25; P = 0.0065) vs. < F2 fibrosis] were predictors of anti-HCV treatment initiation. However, 22% of patients who remain untreated for HCV, with fibrosis data available, had ≥F2 fibrosis and should have been considered for treatment, while only 36% of treated patients had ≥F2 fibrosis. Conclusions Although treatment incidence for HCV has increased, there remain a large proportion of patients indicated for treatment who have yet to be treated. PMID:23869664

  7. Temporal changes and regional differences in treatment uptake of hepatitis C therapy in EuroSIDA.

    Science.gov (United States)

    Grint, D; Peters, L; Schwarze-Zander, C; Beniowski, M; Pradier, C; Battegay, M; Jevtovic, D; Soriano, V; Lundgren, J D; Rockstroh, J K; Kirk, O; Mocroft, A

    2013-11-01

    All HIV/hepatitis C virus (HCV)-coinfected patients with chronic HCV infection and ≥ F2 fibrosis should be considered for HCV therapy. This study aimed to determine the rate of HCV treatment uptake among coinfected patients in Europe. EuroSIDA patients with viraemic HCV infection were included in the study. Poisson regression was used to identify temporal changes and regional differences in HCV treatment uptake. A total of 1984 patients were included in the study, with a median follow-up time of 168 months [interquartile range (IQR) 121-204 months]. To date, 501 (25.3%) HIV/HCV-coinfected patients have received HCV therapy. Treatment incidence rose from 0.33 [95% confidence interval (CI) 0.16-0.50] per 100 person-years of follow-up (PYFU) in 1998 to 5.93 (95% CI 4.49-7.38) in 2007, falling to 3.78 (95% CI 2.50-5.07) in 2009. After adjustment, CD4 cell count > 350 cells/μL [incidence rate ratio (IRR) 1.33 (95% CI 1.06-1.67) vs. CD4 count 200-350 cells/μL] and ≥F2 liver fibrosis [IRR 1.60 (95% CI 1.14-2.25; P = 0.0065) vs. < F2 fibrosis] were predictors of anti-HCV treatment initiation. However, 22% of patients who remain untreated for HCV, with fibrosis data available, had ≥F2 fibrosis and should have been considered for treatment, while only 36% of treated patients had ≥F2 fibrosis. Although treatment incidence for HCV has increased, there remain a large proportion of patients indicated for treatment who have yet to be treated. © 2013 British HIV Association.

  8. Hepatitis C seroconversions in HIV infection across Europe: which regions and patient groups are affected?

    Science.gov (United States)

    Boesecke, Christoph; Grint, Daniel; Soriano, Vincent; Lundgren, Jens D; d'Arminio Monforte, Antonella; Mitsura, Victor M; Chentsova, Nelly; Hadziosmanovic, Vesnadarjan; Kirk, Ole; Mocroft, Amanda; Peters, Lars; Rockstroh, Jürgen K

    2015-11-01

    In the last decade, several outbreaks of sexually acquired acute hepatitis C (HCV) infection have been described in HIV-positive men who have sex with men (MSM). The aims of this study were to determine whether there has been an increase in the number of acute HCV infections in different parts of Europe. HCV seroconversion was defined as an HCV-antibody test change from negative to positive within the observation period in EuroSIDA. Binomial regression was performed to determine factors associated with being tested for HCV and HCV seroconversion. A total of 223 HCV seroconversions were observed from 16,188 tests [1.38% (95%CI 1.20-1.56)] among 5736 patients between 2002 and 2013. Overall the odds of acquiring HCV infection increased by 4% per year (OR 1.04 [95%CI 0.99-1.09]; P = 0.10). Overall 63.2% (141/223) of all seroconversions were seen among MSM. Similar patterns were observed across all European regions (P = 0.69, test for interaction) and HIV transmission risks groups (P = 0.69, test for interaction). In multivariate analysis, North, South and East Europe had higher odds of HCV seroconversion compared with Western Europe [OR 1.90 (1.28-2.81), 1.55 (0.99-2.45) and 1.86 (1.21-2.84); P = 0.0014, P = 0.058 and P = 0.0044 respectively]. Within EuroSIDA a significant increase in HCV seroconversions can be observed after accounting for increased levels of testing for HCV in recent years. This highlights the need for increased HCV prevention efforts among HIV-positive persons in Europe. © 2015 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.

  9. NQO1 C609T polymorphism correlated to colon cancer risk in farmers from western region of Inner Mongolia.

    Science.gov (United States)

    Su, Xiu-Lan; Yan, Mei-Rong; Yang, Ling

    2012-12-01

    To investigate the relationship between NAD(P)H:quinone oxidoreductase 1 (NQO1) C609T polymorphism and colon cancer risk in farmers from western region of Inner Mongolia. Polymerase chain reaction-restriction fragment length polymorphism (PCR-RFLP) was performed to analyze NQO1 C609T polymorphism from 160 healthy controls and 76 colon cancer patients. Among the colon cancer patients, the incidence of NQO1 T allele (53.29%) was significantly higher than it in control group (33.75%, Pwestern region of Inner Mongolia.

  10. A systematic review of Hepatitis C virus treatment uptake among people who inject drugs in the European Region

    DEFF Research Database (Denmark)

    Lazarus, Jeffrey V; Sperle, Ida; Maticic, Mojca

    2014-01-01

    if they presented original research findings about hepatitis C treatment uptake levels among people who reported injecting drugs currently or formerly, as well as those who reported using drugs currently or formerly (mode of consumption not specified). Treatment uptake data were extracted if uptake was measurable......BACKGROUND: Fifteen million adults in the World Health Organization European Region are estimated to have active hepatitis C infection. Intravenous drug use is a major hepatitis C transmission route in this region, and people who inject drugs (PWID) constitute a high-risk and high......-prevalence population. A systematic review was conducted to assess levels of hepatitis C treatment uptake among PWID in Europe. METHODS: Searches in MEDLINE and EMBASE were carried out for articles in any language published between 1 January 2000 and 31 December 2012. Articles were included in the review...

  11. Crystal structures reveal a thiol protease-like catalytic triad in the C-terminal region of Pasteurella multocida toxin.

    Science.gov (United States)

    Kitadokoro, Kengo; Kamitani, Shigeki; Miyazawa, Masayuki; Hanajima-Ozawa, Miyuki; Fukui, Aya; Miyake, Masami; Horiguchi, Yasuhiko

    2007-03-20

    Pasteurella multocida toxin (PMT), one of the virulence factors produced by the bacteria, exerts its toxicity by up-regulating various signaling cascades downstream of the heterotrimeric GTPases Gq and G12/13 in an unknown fashion. Here, we present the crystal structure of the C-terminal region (residues 575-1,285) of PMT, which carries an intracellularly active moiety. The overall structure of C-terminal region of PMT displays a Trojan horse-like shape, composed of three domains with a "feet"-,"body"-, and "head"-type arrangement, which were designated C1, C2, and C3 from the N to the C terminus, respectively. The C1 domain, showing marked similarity in steric structure to the N-terminal domain of Clostridium difficile toxin B, was found to lead the toxin molecule to the plasma membrane. The C3 domain possesses the Cys-His-Asp catalytic triad that is organized only when the Cys is released from a disulfide bond. The steric alignment of the triad corresponded well to that of papain or other enzymes carrying Cys-His-Asp. PMT toxicities on target cells were completely abrogated when one of the amino acids constituting the triad was mutated. Our results indicate that PMT is an enzyme toxin carrying the cysteine protease-like catalytic triad dependent on the redox state and functions on the cytoplasmic face of the plasma membrane of target cells.

  12. Scale dependence of open c anti c and b anti b production in the low x region

    Energy Technology Data Exchange (ETDEWEB)

    Oliveira, E.G. de [Universidade Federal de Santa Catarina, Departamento de Fisica, CFM, C.P. 476, Florianopolis, SC (Brazil); University of Durham, Institute for Particle Physics Phenomenology, Durham (United Kingdom); Martin, A.D. [University of Durham, Institute for Particle Physics Phenomenology, Durham (United Kingdom); Ryskin, M.G. [University of Durham, Institute for Particle Physics Phenomenology, Durham (United Kingdom); NRC Kurchatov Institute, Petersburg Nuclear Physics Institute, St. Petersburg (Russian Federation)

    2017-03-15

    The 'optimal' factorization scale μ{sub 0} is calculated for open heavy quark production. We find that the optimal value is μ{sub F} = μ{sub 0} ≅ 0.85√(p{sup 2}{sub T}+m{sub Q}{sup 2}); a choice which allows us to resum the double-logarithmic, (α{sub s} ln μ{sup 2}{sub F} ln (1/x)){sup n} corrections (enhanced at LHC energies by large values of ln(1/x)) and to move them into the incoming parton distributions, PDF (x, μ{sub 0}{sup 2}). Besides this result for the single inclusive cross section (corresponding to an observed heavy quark of transverse momentum p{sub T}), we also determined the scale for processes where the acoplanarity can be measured; that is, events where the azimuthal angle between the quark and the antiquark may be determined experimentally. Moreover, we discuss the important role played by the 2 → 2 subprocesses, gg → Q anti Q at NLO and higher orders. In summary, we achieve a better stability of the QCD calculations, so that the data on c anti c and b anti b production can be used to further constrain the gluons in the small x, relatively low scale, domain, where the uncertainties of the global analyses are large at present. (orig.)

  13. A novel sandwich hybridization method for selecting cDNAs from large genomic regions: Identification of cDNAs from the cloned genomic DNA spanning the XLRP locus

    Energy Technology Data Exchange (ETDEWEB)

    Yan, D.; McHenry, C.; Fujita, R. [Univ. of Michigan, Ann Arbor, MI (United States)] [and others

    1994-09-01

    We have developed an efficient hybridization-based cDNA-selection method. A sandwich of three species - single-stranded cDNA, tagged RNA derived from genomic DNA, and biotinylated RNA complementary to the tag - allows specific retention of hybrids on an avidin-matrix. Previously, using model experiments, we demonstrated highly specific and efficient selection of a retinal gene, NRL, from complex mixtures of cDNA clones, using a sub-library from a 5 kb NRL genomic clone. We have now applied this selection strategy to isolate cDNAs from human adult retina and fetal eye libraries, with the {open_quotes}genomic RNA{close_quotes} derived from two YAC clones (OTC-C and 55B) spanning the region of X-linked retinitis pigmentosa (XLRP) locus RP3 at Xp21.1. Effectiveness of the selection-method was monitored by enrichment of TCTEX-1L gene that maps within the 55B YAC. Of the 15 selected cDNA clones that hybridized to the 55B YAC DNA, five appear to the map to specific cosmid clones derived from the 55B YAC. Inserts in these selected cDNA clones range from 0.5 to 2.3 kb in size. Additional clones are now being isolated and characterized. This procedure should be independent of the size or complexity of genomic DNA being used for selection, allow for the isolation of full-length cDNAs, and may have wider application.

  14. City of Durham, N.C. Department of Public Works Awarded 2015 EPA Region 4 Rain Catcher Award

    Science.gov (United States)

    ATLANTA - The Environmental Protection Agency (EPA) recognized the City of Durham Department of Public Works with the regional 2015 EPA Rain Catcher Award in the Municipal Category for the Rain Catchers project in Durham, N.C. The award was given at

  15. Imaging regional metabolic changes in the ischemic rat heart in vivo using hyperpolarized(1-13C)Pyruvate

    DEFF Research Database (Denmark)

    Lauritzen, Mette Hauge; Magnusson, Peter; Laustsen, Christoffer

    2017-01-01

    We evaluated the use of hyperpolarized 13C magnetic resonance imaging (MRI) in an open-chest rat model of myocardial infarction to image regional changes in myocardial metabolism. In total, 10 rats were examined before and after 30 minutes of occlusion of the left anterior descending coronary art...

  16. TdaA Regulates Tropodithietic Acid Synthesis by Binding to the tdaC Promoter Region ▿ †

    OpenAIRE

    Geng, Haifeng; Belas, Robert

    2011-01-01

    Silicibacter sp. TM1040, a member of the marine Roseobacter clade, produces the antibiotic and quorum signaling molecule tropodithietic acid (TDA), encoded by tdaABCDEF. Here, we showed that an LysR-type transcriptional regulator, TdaA, is a positive regulator of tdaCDE gene expression and binds to the tdaC promoter region.

  17. APOE/C1/C4/C2 hepatic control region polymorphism influences plasma apoE and LDL cholesterol levels

    OpenAIRE

    Klos, Kathy; Shimmin, Lawrence; Ballantyne, Christie; Boerwinkle, Eric; Clark, Andrew; Coresh, Josef; Hanis, Craig; Liu, Kiang; Sayre, Scott; Hixson, James

    2008-01-01

    We characterized 102 kb of chromosome 19 containing the apolipoprotein (APO) E/C1/C4/C2 cluster and two flanking genes for common DNA variants associated with plasma low-density lipoprotein cholesterol (LDL-C) level. DNA variants were identified by comparing sequences of 48 haploid hybrid cell lines. We genotyped participants (1943 Whites and 2046 African-Americans) of the Coronary Artery Risk Development in Young Adults study for 115 variants. After controlling for the effects of the APOE ε2...

  18. Hybrid proteins of Cobra Venom Factor and cobra C3: tools to identify functionally important regions in Cobra Venom Factor.

    Science.gov (United States)

    Hew, Brian E; Wehrhahn, Daniel; Fritzinger, David C; Vogel, Carl-Wilhelm

    2012-09-15

    Cobra Venom Factor (CVF) is the complement-activating protein in cobra venom. CVF is structurally and functionally highly homologous to complement component C3. CVF, like C3b, the activated form of C3, forms a bimolecular complex with Factor B in serum, called C3/C5 convertase, an enzyme which activates complement components C3 and C5. Despite the high degree of homology, the two C3/C5 convertases exhibit significant functional differences. The most important difference is that the convertase formed with CVF (CVF,Bb) is physico-chemically far more stable than the convertase formed with C3b (C3b,Bb). In addition, the CVF,Bb convertase and CVF are completely resistant to inactivation by the complement regulatory proteins Factor H and Factor I. Furthermore, the CVF,Bb enzyme shows efficient C5-cleaving activity in fluid phase. In contrast, the C3b,Bb enzyme is essentially devoid of fluid-phase C5-cleaving activity. By taking advantage of the high degree of sequence identity at both the amino acid (85%) and DNA levels (93%) between CVF and cobra C3, we created hybrid proteins of CVF and cobra C3 where sections, or only a few amino acids, of the CVF sequence were replaced with the homologous amino acid sequence of cobra C3. In a first set of experiments, we created five hybrid proteins, termed H1 through H5, where the cobra C3 substitutions collectively spanned the entire length of the CVF protein. We also created three additional hybrid proteins where only four or five amino acid residues in CVF were exchanged with the corresponding amino acid residues from cobra C3. Collectively, these hybrid proteins, representing loss-of-function mutants of CVF, allowed the identification of regions and individual amino acid residues important for the CVF-specific functions. The results include the observation that the CVF β-chain is crucially important for forming a stable convertase, whereas the CVF α-chain appears to harbor no CVF-specific functions. Furthermore, the CVF

  19. Regional Issue Identification and Assessment (RIIA): an analysis of the mid-range projection, Series C Scenario

    Energy Technology Data Exchange (ETDEWEB)

    Honea, B.; Hillsman, E.

    1979-10-01

    The Department of Energy has hypothesized a number of alternate energy futures as part of its energy planning and analysis programs. How a proposed energy future called the Mid-Range Projection Series C Scenario would affect Federal Region VI (Arkansas, Louisiana, Oklahoma, Texas, and New Mexico) is examined in this report. This scenario assumes a medium supply and a medium demand for fuel through 1990, and it incorporates the fuel-switching provisions of the Energy Supply and Environmental Coordination Act. The report portrays the major regional environmental, human health and safety, socioeconomic, and institutional effects that might result from the realization of the Series C Scenario. This discussion should serve as a basis for further assessments, as it identifies some issues of major concern for Region VI that must be addressed in more depth.

  20. C-terminal region of Mad2 plays an important role during mitotic spindle checkpoint in fission yeast Schizosaccharomyces pombe.

    Science.gov (United States)

    Singh, Gaurav Kumar; Karade, Sharanbasappa Shrimant; Ranjan, Rajeev; Ahamad, Nafees; Ahmed, Shakil

    2017-02-01

    The mitotic arrest deficiency 2 (Mad2) protein is an essential component of the spindle assembly checkpoint that interacts with Cdc20/Slp1 and inhibit its ability to activate anaphase promoting complex/cyclosome (APC/C). In bladder cancer cell line the C-terminal residue of the mad2 gene has been found to be deleted. In this study we tried to understand the role of the C-terminal region of mad2 on the spindle checkpoint function. To envisage the role of C-terminal region of Mad2, we truncated 25 residues of Mad2 C-terminal region in fission yeast S.pombe and characterized its effect on spindle assembly checkpoint function. The cells containing C-terminal truncation of Mad2 exhibit sensitivity towards microtubule destabilizing agent suggesting perturbation of spindle assembly checkpoint. Further, the C-terminal truncation of Mad2 exhibit reduced viability in the nda3-KM311 mutant background at non-permissive temperature. Truncation in mad2 gene also affects its foci forming ability at unattached kinetochore suggesting that the mad2-∆CT mutant is unable to maintain spindle checkpoint activation. However, in response to the defective microtubule, only brief delay of mitotic progression was observed in Mad2 C-terminal truncation mutant. In addition we have shown that the deletion of two β strands of Mad2 protein abolishes its ability to interact with APC activator protein Slp1/Cdc20. We purpose that the truncation of two β strands (β7 and β8) of Mad2 destabilize the safety belt and affect the Cdc20-Mad2 interaction leading to defects in the spindle checkpoint activation.

  1. The role of VEGF-C staining in predicting regional metastasis in melanoma.

    NARCIS (Netherlands)

    Boone, B.; Blokx, W.; Bacquer, D. de; Lambert, J.; Ruiter, D.; Brochez, L.

    2008-01-01

    Sentinel lymph node status is the most important prognostic factor in primary melanoma. The number of melanoma-associated lymphatic vessels has been associated with sentinel lymph node status and survival. Vascular endothelial growth factor-C (VEGF-C) is found to promote tumour-associated lymphatic

  2. NemaFootPrinter: a web based software for the identification of conserved non-coding genome sequence regions between C. elegans and C. briggsae

    Directory of Open Access Journals (Sweden)

    Morandi Paolo

    2005-12-01

    Full Text Available Abstract Background NemaFootPrinter (Nematode Transcription Factor Scan Through Philogenetic Footprinting is a web-based software for interactive identification of conserved, non-exonic DNA segments in the genomes of C. elegans and C. briggsae. It has been implemented according to the following project specifications: a Automated identification of orthologous gene pairs. b Interactive selection of the boundaries of the genes to be compared. c Pairwise sequence comparison with a range of different methods. d Identification of putative transcription factor binding sites on conserved, non-exonic DNA segments. Results Starting from a C. elegans or C. briggsae gene name or identifier, the software identifies the putative ortholog (if any, based on information derived from public nematode genome annotation databases. The investigator can then retrieve the genome DNA sequences of the two orthologous genes; visualize graphically the genes' intron/exon structure and the surrounding DNA regions; select, through an interactive graphical user interface, subsequences of the two gene regions. Using a bioinformatics toolbox (Blast2seq, Dotmatcher, Ssearch and connection to the rVista database the investigator is able at the end of the procedure to identify and analyze significant sequences similarities, detecting the presence of transcription factor binding sites corresponding to the conserved segments. The software automatically masks exons. Discussion This software is intended as a practical and intuitive tool for the researchers interested in the identification of non-exonic conserved sequence segments between C. elegans and C. briggsae. These sequences may contain regulatory transcriptional elements since they are conserved between two related, but rapidly evolving genomes. This software also highlights the power of genome annotation databases when they are conceived as an open resource and the possibilities offered by seamless integration of different web

  3. Hepatitis C virus (HCV) E1 and E2 protein regions that specifically bind to HepG2 cells.

    Science.gov (United States)

    Garcia, Javier Eduardo; Puentes, Alvaro; Súarez, Jorge; López, Ramses; Vera, Ricardo; Rodríguez, Luis Eduardo; Ocampo, Marisol; Curtidor, Hernando; Guzman, Fanny; Urquiza, Mauricio; Patarroyo, Manuel Elkin

    2002-02-01

    Identify hepatitis C virus (HCV) sequences in E1 and E2 protein binding to HepG2. Synthetic 20-mer long, ten-residue overlapped peptides, from E1 and E2 proteins, were tested in HepG2 or Raji cell-binding assays. Affinity constants, binding site number per cell and Hill coefficients were determined by saturation assay for high activity binding peptides (HABPs). Receptors for HepG2 cell were determined by cross-linking and sodium dodecyl sulfate-polyacrylamide gel electrophoresis analysis. Twelve HABPs were found in HCV genotype 1a, allowing six hepatocyte-binding sequences (HBSs) to be defined: two peptide-binding regions in E1 HABPs 4913 (YQVRNSTGLYHVTNDCPNSS) and 4918 (MTPTVATRDGKLPATQLRRHY). Four hepatocyte-binding regions were defined in E2: region-I, peptide 4931 (ETHVTGGSAGHTVSGFVSLLY); region-II, 4937-4939 (HHKFNSSGCPERLASCRPLTDFDQGWGPISYANGSGPDQR); region-III, 4943-4945 (PVYCFTPSPVVVGTTDRSGAPTYSWGENDTDVFVLNNTR) and region-IV, 4949-4952 (CGAPPCVIGGAGNNTLHCPTDCFRKHPDATYSRCGSGPWITPRCLVDYPY). The underlined sequences are most relevant in the binding process. HABPs 4913 and 4938 also bind to CD81 positive Raji cells. Region-II 4938 HABPs bind to 50 and 60kDa HepG2 cell membrane surface proteins. Six HVRs to the HepG2 were identified. Some HABPs have been previously found to be antigenic and immunogenic. HABPs, 4918 (from E1), 4938, 4949, 4950, 4951 and 4952 (from E2) have not been previously recognised. These HABPs could be relevant to HCV invasion of hepatocytes.

  4. Insights into the Structure of Dimeric RNA Helicase CsdA and Indispensable Role of Its C-Terminal Regions.

    Science.gov (United States)

    Xu, Ling; Wang, Lijun; Peng, Junhui; Li, Fudong; Wu, Lijie; Zhang, Beibei; Lv, Mengqi; Zhang, Jiahai; Gong, Qingguo; Zhang, Rongguang; Zuo, Xiaobing; Zhang, Zhiyong; Wu, Jihui; Tang, Yajun; Shi, Yunyu

    2017-12-05

    CsdA has been proposed to be essential for the biogenesis of ribosome and gene regulation after cold shock. However, the structure of CsdA and the function of its long C-terminal regions are still unclear. Here, we solved all of the domain structures of CsdA and found two previously uncharacterized auxiliary domains: a dimerization domain (DD) and an RNA-binding domain (RBD). Small-angle X-ray scattering experiments helped to track the conformational flexibilities of the helicase core domains and C-terminal regions. Biochemical assays revealed that DD is indispensable for stabilizing the CsdA dimeric structure. We also demonstrate for the first time that CsdA functions as a stable dimer at low temperature. The C-terminal regions are critical for RNA binding and efficient enzymatic activities. CsdA_RBD could specifically bind to the regions with a preference for single-stranded G-rich RNA, which may help to bring the helicase core to unwind the adjacent duplex. Copyright © 2017 Elsevier Ltd. All rights reserved.

  5. Analysing regional climate change in Africa in a 1.5 °C global warming world

    Science.gov (United States)

    Weber, Torsten; Haensler, Andreas; Jacob, Daniela

    2017-04-01

    At the 21st session of the UNFCCC Conference of the Parties (COP21) in Paris, a reaffirmation to strengthen the effort to limit the global temperature increase to 1.5 °C was decided. However, even if global warming is limited, some regions might still be substantially affected by climate change, especially for continents like Africa where the socio-economic conditions are strongly linked to the climatic conditions. Hence, providing a detailed analysis of the projected climate changes in a 1.5 °C global warming scenario will allow the African society to undertake measures for adaptation in order to mitigate potential negative consequences. In order to provide such climate change information, the existing CORDEX Africa ensemble for RCP2.6 scenario simulations has systematically been increased by conducting additional REMO simulations using data from various global circulation models (GCMs) as lateral boundary conditions. Based on this ensemble, which now consists of eleven CORDEX Africa RCP2.6 regional climate model simulations from three RCMs (forced with different GCMs), various temperature and precipitation indices such as number of cold/hot days and nights, duration of the rainy season, the amount of rainfall in the rainy seasons and the number of dry spells have been calculated for a 1.5 °C global warming scenario. The applied method to define the 1.5 °C global warming period has been already applied in the IMPACT2C project. In our presentation, we will discuss the analysis of the climate indices in a 1.5 °C global warming world for the CORDEX-Africa region. Amongst presenting the magnitude of projected changes, we will also address the question for selected indices if the changes projected in a 1.5 °C global warming scenario are already larger than the climate variability and we will also draw links to the changes projected under a more extreme scenario.

  6. Phylogenetic, virological, and clinical characteristics of genotype C hepatitis B virus with TCC at codon 15 of the precore region.

    Science.gov (United States)

    Chan, Henry Lik-Yuen; Tse, Chi-Hang; Ng, Eddie Yuen-Tok; Leung, Kwong-Sak; Lee, Kin-Hong; Tsui, Stephen Kwok-Wing; Sung, Joseph Jao-Yiu

    2006-03-01

    Hepatitis B virus (HBV) with T-1856 of the precore region is always associated with C-1858 (i.e., TCC at nucleotides 1856 to 1858), and it is reported only in genotype C HBV isolates. We aimed to investigate the phylogenetic, virological, and clinical characteristics of HBV isolates bearing TCC at nucleotides 1856 to 1858. We have previously reported on the presence of two major subgroups in genotype C HBV, namely, HBV genotype Cs (Southeast Asia) and HBV genotype Ce (Far East). We have designed a novel 5' nuclease technology based on the nucleotide polymorphism (C or A) at nucleotide 2733 to differentiate the two genotype C HBV subgroups. The mutations at the basal core promoter and precore regions were analyzed by direct sequencing. Among 214 genotype C HBV-infected patients, 31% had TCC, 37% had CCC, 3% had CTC, and 29% had CCT at nucleotides 1856 to 1858. All except one HBV strain with TCC at nucleotides 1856 to 1858 belonged to subgroup Cs, which has been reported only in Hong Kong; Guangzhou, China; and Vietnam. HBV with TCC at nucleotides 1856 to 1858 was associated with the G1898A mutation (64%). Patients infected with HBV harboring TCC had more liver cirrhosis than those infected with HBV harboring CCC (18% versus 5%; P = 0.008), and more of the patients infected with HBV harboring TCC were positive for HBeAg (58% versus 36%; P = 0.01) and had higher median alanine aminotransferase levels (65 IU/liter versus 49 IU/liter; P = 0.006); but similar proportions of patients infected with HBV harboring TCC and those infected with HBV harboring CCT had liver cirrhosis (18% versus 13%; P = 0.43). In summary, we report that HBV with TCC at nucleotides 1856 to 1858 of the precore region might represent a specific HBV strain associated with more aggressive liver disease than other genotype C HBV strains.

  7. Diabetes epidemic in the Asia Pacific region: has hemoglobin A1C finally earned its place as a diagnostic tool?

    Directory of Open Access Journals (Sweden)

    Alexandra Bagley

    2014-02-01

    Full Text Available Two-third of the world's population lives in the Asia Pacific region where prevalence of diabetes has reached epidemic proportion. With China and India being the most populous nations on the globe, it is believed that over 150 million diabetes reside in the region with more than 95% being of type 2 diabetes mellitus (T2DM. Furthermore, other Pacific islands in the region have high rates of T2DM including Tonga, Fiji, French Polynesia, and Nauru. The latter has the highest prevalence of T2DM per population in the world. Over the past two decades, in Australia and New Zealand, the prevalence of T2DM has more than doubled, mainly amongst the Aboriginal and Torres Strait Islander and Maori peoples respectively. With the increasing prevalence of diabetes in the Asia Pacific region coupled with the limited number of resources, use of a reliable and effective mode of diagnosis for T2DM is warranted. Yet to date, only New Zealand has adopted the American Diabetes Association recommendation of using hemoglobin A1C in the diagnosis of the disease. The aim of this review is to discuss the clinical usefulness of hemoglobin A1C and highlight its diagnostic role in the Asia Pacific region where T2DM is increasingly encountered.

  8. Astrocyte activation and neurotoxicity: A study in different rat brain regions and in rat C6 astroglial cells.

    Science.gov (United States)

    Goswami, Poonam; Gupta, Sonam; Joshi, Neeraj; Sharma, Sharad; Singh, Sarika

    2015-07-01

    The present study was conducted to investigate the effect of rotenone on astrocytes activation, their viability and its effect on neuronal death in different brain regions. Rotenone was injected in rat brain by intracerebroventricularly (bilateral) route at dose of 6 μg and 12 μg. In vitro C6 cells were treated with rotenone at concentration of 0.1, 0.25, 0.5, 1 and 2 μM. Rotenone administration to rat brain caused significant astrocytes activation in frontal cortex, cerebellum, cerebellar nucleus, substantia nigra, hypothalamus and hippocampus regions of the rat brain. Rotenone administration also led to significant degeneration of cells in all the studied regions along with altered nuclear morphology assessed by hematoxylin-eosin and cresyl violet staining. Histological staining showed the significantly decreased number of cells in all the studied regions except cerebellar nucleus in dose and time dependant manner. Rotenone administration in the rat brain also caused significant decrease in glutathione levels and augmented nitrite levels. In vitro treatment of rotenone to astrocytic C6 cells caused significantly increased expression of glial fibrillar acidic protein (GFAP) and decreased viability in dose and time dependent manner. Rotenone treatment to C6 cells exhibited significant generation of reactive oxygen species, augmented nitrite level, impaired mitochondrial activity, apoptotic chromatin condensation and DNA damage in comparison to control cells. Findings showed that oxidative stress play a considerable role in rotenone induced astrocyte death that was attenuated with co-treatment of antioxidant melatonin. In conclusion, results showed that rotenone caused significant astrocytes activation, altered nuclear morphology, biochemical alteration and apoptotic cell death in different rat brain regions. In vitro observations in C6 cells showed that rotenone treatment exhibited oxidative stress mediated apoptotic cell death, which was attenuated with co

  9. Impacts on regional climate of an afforestation scenario under a +2°C global warming climate

    Science.gov (United States)

    Strada, Susanna; Noblet-Ducoudré Nathalie, de; Marc, Stéfanon

    2017-04-01

    Through surface-atmosphere interactions (SAI), land-use and land-cover changes (LULCCs) alter atmospheric conditions with effects on climate at different scales, from local/regional (a few ten kilometres) (Pielke et al., 2011) to global scales (a few hundred kilometres) (Mahmood et al., 2014). Focusing on the regional scale, in the context of climate change, LULCCs may either enhance or dampen climate impacts via changes in SAI they may initiate. Those LULCC-driven atmospheric impacts could in turn influence e.g. the functioning of terrestrial ecosystems, with consequences on mitigation and adaptation strategies. Despite LULCC impacts on regional climate are largely discussed in the literature, in Europe information is missing on LULCC impacts under future climate conditions on a country scale (Galos et al., 2015). The latest COPs have urged the scientific community to explore the impacts of reduced global warming (1.5°C to a +2°C) on the Earth system. LULCCs will be one major tool to achieve such targets. In this framework, we investigate impacts on regional climate of a modified landscape under a +2°C climatic scenario. To this purpose, we performed sensitivity studies over western Europe with a fully coupled land-atmosphere regional climate model, WRF-ORCHIDEE (Drobinski et al., 2012, Stefanon et al., 2014). A +2°C scenario was selected among those proposed by the "Impact2C" project (Vautard et al., 2014), and the afforested land-cover scenario proposed in the RCP4.5 is prescribed. We have chosen the maximum extent of forest RCP4.5 simulates for Europe at the end of the 21st century. WRF-ORCHIDEE is fed with boundary atmospheric conditions from the global climate model LMDZ for PD (1971-2000) and the +2°C warming period for the LMDZ model (2028-2057). Preliminary results over the target domain show that, under a +2°C global warming scenario, afforestation contributes by 2% to the total warming due to both climate change and LULCCs. During summer, the

  10. Infrared Optothermal Spectroscopy of N(2)- and OC-DCCH: The C-H Stretching Region.

    Science.gov (United States)

    Hünig; Oudejans; Miller

    2000-11-01

    High-resolution optothermal laser spectroscopy is reported for the C-H stretching vibrations of the binary complexes formed between monodeuterated acetylene and carbon monoxide and nitrogen. In contrast with a previous study of the corresponding C(2)H(2) complexes, where the C-H fundamental spectra were highly perturbed [R. D. Beck, A. G. Maki, S.-H. Tseng, and R. O. Watts, J. Mol. Spectrosc. 158, 306-317 (1993)], the present spectra are well described by a simple linear-rotor Hamiltonian. This is presumed to result from the fact that the C-H vibration in the monodeuterated complexes is decoupled from the intermolecular degrees of freedom. Copyright 2000 Academic Press.

  11. The Hsp60C gene in the 25F cytogenetic region in Drosophila ...

    Indian Academy of Sciences (India)

    Unknown

    1987). Another gene, located at 21D cytogenetic region, and whose putative product displayed properties of the Hsp60 family, was named Hsp60B and this gene was found to have a male germ-cell specific function, especially in the ...... cheal tube size control and proper functioning of the sep- tate junctions (Beitel et al.

  12. Soil modern evolution impact on the C fluxes in Chernozems at the Middle Volga Region

    Science.gov (United States)

    Ramazanov, Sabir; Yashin, Ivan; Atenbekov, Ramiz; Vasenev, Ivan

    2017-04-01

    There are results of long-term stationary field research on the aridization impact on the carbon fluxes in the topsoil of Chernozemic soils in the representative agricultural and native forest-steppe landscapes in conditions of the Middle Volga region of Russia (educational-experimental farm "Mummovskoe", Saratov region). Especial attention is dedicated to the water-soluble organic substances (WSOS) which are better available for soil microorganisms that utilize them, enhancing CO2 emission. Dominated in the Middle-Volga natural and agro-landscapes soil conditions are unfavorable for mobile humic acid production and accumulation: organic acids and polyphenols gradually mobilized into solution from root excretions and crop residues or woody plant litter are quickly neutralized by calcium, magnesium or sodium ions in topsoil. Most arable Chernozems of the Middle-Volga region are actively degraded due to both topsoil CO2 emission and water-soluble organic substances fluxes in form of sodium and calcium humates and fulvates, as evidenced by sorption lysimetry data on the WSOS fluxes in 15-21 g/m2 over the vegetation period. Additional researches are necessary to evaluate the ratio between soil organic carbon losses through soil erosion processes, topsoil CO2 emission and WSOS profile and lateral fluxes in conditions of different land-use practice and climate conditions to develop the modern climate-smart farming systems in the Middle-Volga region agrolandscapes with potentially very prolific Chernozemic soils.

  13. SPANX-B and SPANX-C (Xq27 region) gene dosage analysis in ...

    Indian Academy of Sciences (India)

    Molecolare, Oasi Institute for Research on Mental Retardation and Brain Aging, Troina 94018, Italy. 4Department of ..... pathologies. Additional studies should also be conducted in normal subjects with undescended testis to evaluate the pos- sible implication of other genes mapping in the Xq27 region. References.

  14. Effect of ischemic preconditioning on the expression of c-myb in the CA1 region of the gerbil hippocampus after ischemia/reperfusion injury

    Directory of Open Access Journals (Sweden)

    Hui Young Lee

    2016-06-01

    Conclusion: Our results show that a lethal transient ischemia significantly decreased c-myb immunoreactivity in the SP of the CA1 region and that IPC well preserved c-myb immunoreactivity in the SP of the CA1 region. We suggest that the maintenance of c-myb might be related with IPC-mediated neuroprotection after a lethal ischemic insult.

  15. C-terminal region of MAP7 domain containing protein 3 (MAP7D3 promotes microtubule polymerization by binding at the C-terminal tail of tubulin.

    Directory of Open Access Journals (Sweden)

    Saroj Yadav

    Full Text Available MAP7 domain containing protein 3 (MAP7D3, a newly identified microtubule associated protein, has been shown to promote microtubule assembly and stability. Its microtubule binding region has been reported to consist of two coiled coil motifs located at the N-terminus. It possesses a MAP7 domain near the C-terminus and belongs to the microtubule associated protein 7 (MAP7 family. The MAP7 domain of MAP7 protein has been shown to bind to kinesin-1; however, the role of MAP7 domain in MAP7D3 remains unknown. Based on the bioinformatics analysis of MAP7D3, we hypothesized that the MAP7 domain of MAP7D3 may have microtubule binding activity. Indeed, we found that MAP7 domain of MAP7D3 bound to microtubules as well as enhanced the assembly of microtubules in vitro. Interestingly, a longer fragment MDCT that contained the MAP7 domain (MD with the C-terminal tail (CT of the protein promoted microtubule polymerization to a greater extent than MD and CT individually. MDCT stabilized microtubules against dilution induced disassembly. MDCT bound to reconstituted microtubules with an apparent dissociation constant of 3.0 ± 0.5 µM. An immunostaining experiment showed that MDCT localized along the length of the preassembled microtubules. Competition experiments with tau indicated that MDCT shares its binding site on microtubules with tau. Further, we present evidence indicating that MDCT binds to the C-terminal tail of tubulin. In addition, MDCT could bind to tubulin in HeLa cell extract. Here, we report a microtubule binding region in the C-terminal region of MAP7D3 that may have a role in regulating microtubule assembly dynamics.

  16. GHRSST Level 3C North Atlantic Regional (NAR) subskin Sea Surface Temperature from SNPP/VIIRS (GDS V2) produced by OSI SAF (GDS version 2)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — A regional Group for High Resolution Sea Surface Temperature (GHRSST) Level 3 Collated (L3C) dataset for the North Atlantic Region (NAR) based on retrievals from the...

  17. An isoform of Arabidopsis myosin XI interacts with small GTPases in its C-terminal tail region

    Science.gov (United States)

    Hashimoto, Kohsuke; Igarashi, Hisako; Mano, Shoji; Takenaka, Chikako; Shiina, Takashi; Yamaguchi, Masatoshi; Demura, Taku; Nishimura, Mikio; Shimmen, Teruo; Yokota, Etsuo

    2008-01-01

    Myosin XI, a class of myosins expressed in plants is believed to be responsible for cytoplasmic streaming and the translocation of organelles and vesicles. To gain further insight into the translocation of organelles and vesicles by myosin XI, an isoform of Arabidopsis myosin XI, MYA2, was chosen and its role in peroxisome targeting was examined. Using the yeast two-hybrid screening method, two small GTPases, AtRabD1 and AtRabC2a, were identified as factors that interact with the C-terminal tail region of MYA2. Both recombinant AtRabs tagged with His bound to the recombinant C-terminal tail region of MYA2 tagged with GST in a GTP-dependent manner. Furthermore, AtRabC2a was localized on peroxisomes, when its CFP-tagged form was expressed transiently in protoplasts prepared from Arabidopsis leaf tissue. It is suggested that MYA2 targets the peroxisome through an interaction with AtRabC2a. PMID:18703495

  18. MIGRATION AND IDENTITY IN SOUTHWEST REGION OF CAMEROON: THE GRAFFIE FACTOR, C.1930S-1996

    Directory of Open Access Journals (Sweden)

    Walter Gam Nkwi

    2017-09-01

    Full Text Available This article focuses on the dynamics of internal migration taking the case of Bamenda Grassfielders’ migrants in coastal Cameroon and stresses on how such migrations gave rise to the identity puzzle between those who were branded as the graffie and their host. It questions how the politicization of identity can be understood within the historical and political dynamics of Cameroon. The article further maintains that at the onset of the British colonial rule many people from this region migrated to the industrial complex of coastal Cameroon as plantation labour as well as auxiliary labour in other colonial services. After work in these services they retired and became enterprising to the chagrin of their host. They were thus derogatorily branded as graffie. Using the concept of identity in migration the article questions why and how the graffie have coped with their identity in heterogeneous spaces like the South west region of Cameroon.

  19. Regional groundwater flow model for C, K. L. and P reactor areas, Savannah River Site, Aiken, SC

    Energy Technology Data Exchange (ETDEWEB)

    Flach, G.P.

    2000-02-11

    A regional groundwater flow model encompassing approximately 100 mi2 surrounding the C, K, L, and P reactor areas has been developed. The reactor flow model is designed to meet the planning objectives outlined in the General Groundwater Strategy for Reactor Area Projects by providing a common framework for analyzing groundwater flow, contaminant migration and remedial alternatives within the Reactor Projects team of the Environmental Restoration Department. The model provides a quantitative understanding of groundwater flow on a regional scale within the near surface aquifers and deeper semi-confined to confined aquifers. The model incorporates historical and current field characterization data up through Spring 1999. Model preprocessing is automated so that future updates and modifications can be performed quickly and efficiently. The CKLP regional reactor model can be used to guide characterization, perform scoping analyses of contaminant transport, and serve as a common base for subsequent finer-scale transport and remedial/feasibility models for each reactor area.

  20. Structural effects of methionine oxidation on isolated subdomains of human fibrin D and αC regions.

    Directory of Open Access Journals (Sweden)

    Patrick R Burney

    Full Text Available Oxidation of key methionine residues on fibrin leads to altered fibrin polymerization producing severely altered fibrin gel structure and function. This is important because fibrinogen and its modification by oxidative stress have been implicated as key contributors to both pathological thrombotic and hemorrhagic diseases ranging from cardiovascular thrombosis to the acute coagulopathy of trauma. However, how oxidation leads to altered fibrin polymerization remains poorly understood at the molecular level. We have applied a powerful and novel well-tempered ensemble parallel tempering (PT-WTE technique along with conventional molecular dynamics (MD simulation to investigate the molecular-level consequences of selective methionine oxidation of fibrinogen. We offer new insights into molecular mechanisms of oxidation-induced changes in fibrin polymerization, while focusing on the D region knob 'B' and hole 'b' interaction and αC-domain interactions, both of which are hypothesized to contribute to the lateral aggregation mechanism of fibrin fibrils. Methionine oxidation did not alter the native state or the stability of a bound knob 'B' surrogate when interacting with hole 'b' in the D region. However, applying PT-WTE simulation to a human homology model of the bovine N-terminal subdomain fragment from the αC-domain revealed that methionine oxidation altered the conformation of the hairpin-linking region to favor open rather than closed hairpin structures. We attribute this alteration to the disruption of the hairpin-linking region's conformation, with oxidation increasing the radius of gyration for this segment. This result is in agreement with experimental data demonstrating decreased fibrin protofibril lateral aggregation when methionine oxidation is present in the same αC-domain fragment. Therefore, single methionine oxidation within the αC-domain is a likely molecular mechanism.

  1. Quadruplex forming promoter region of c-myc oncogene as a potential target for a telomerase inhibitory plant alkaloid, chelerythrine.

    Science.gov (United States)

    Ghosh, Saptaparni; Dasgupta, Dipak

    2015-03-27

    Guanine rich sequences present in the promoter region of oncogenes could fold into G-quadruplexes and modulate transcription. Equilibrium between folding and unfolding of the quadruplexes in these regions play important role in disease processes. We have studied the effect of a putative anticancer agent chelerythrine on G-rich NHE III1 present in the promoter region of c-myc oncogene. We have demonstrated the ability of chelerythrine, a telomerase inhibitor, to block the hybridization of Pu27 with its complementary strand via folding it into a quadruplex structure. Calorimetry shows that the association of Pu27 with chelerythrine is primarily enthalpy driven with high binding affinity (∼10(5) M(-1)). The association does not lead to any major structural perturbation of Pu27. The resulting 2:1 complex has enhanced stability as compared to free Pu27. Another notable feature is that the presence of molecular crowding agent like ficoll 70 does not change the mode of recognition though the binding affinity decreases. We suggest that the anticancer activity of chelerythrine could be ascribed to its ability to stabilize the quadruplex structure in the c-myc promoter region thereby downregulating its transcription. Copyright © 2015 Elsevier Inc. All rights reserved.

  2. Combgap Promotes Ovarian Niche Development and Chromatin Association of EcR-Binding Regions in BR-C.

    Directory of Open Access Journals (Sweden)

    Anna Hitrik

    2016-11-01

    Full Text Available The development of niches for tissue-specific stem cells is an important aspect of stem cell biology. Determination of niche size and niche numbers during organogenesis involves precise control of gene expression. How this is achieved in the context of a complex chromatin landscape is largely unknown. Here we show that the nuclear protein Combgap (Cg supports correct ovarian niche formation in Drosophila by controlling ecdysone-Receptor (EcR- mediated transcription and long-range chromatin contacts in the broad locus (BR-C. Both cg and BR-C promote ovarian growth and the development of niches for germ line stem cells. BR-C levels were lower when Combgap was either reduced or over-expressed, indicating an intricate regulation of the BR-C locus by Combgap. Polytene chromosome stains showed that Cg co-localizes with EcR, the major regulator of BR-C, at the BR-C locus and that EcR binding to chromatin was sensitive to changes in Cg levels. Proximity ligation assay indicated that the two proteins could reside in the same complex. Finally, chromatin conformation analysis revealed that EcR-bound regions within BR-C, which span ~30 KBs, contacted each other. Significantly, these contacts were stabilized in an ecdysone- and Combgap-dependent manner. Together, these results highlight Combgap as a novel regulator of chromatin structure that promotes transcription of ecdysone target genes and ovarian niche formation.

  3. GOCO05c: A New Combined Gravity Field Model Based on Full Normal Equations and Regionally Varying Weighting

    Science.gov (United States)

    Fecher, T.; Pail, R.; Gruber, T.

    2017-05-01

    GOCO05c is a gravity field model computed as a combined solution of a satellite-only model and a global data set of gravity anomalies. It is resolved up to degree and order 720. It is the first model applying regionally varying weighting. Since this causes strong correlations among all gravity field parameters, the resulting full normal equation system with a size of 2 TB had to be solved rigorously by applying high-performance computing. GOCO05c is the first combined gravity field model independent of EGM2008 that contains GOCE data of the whole mission period. The performance of GOCO05c is externally validated by GNSS-levelling comparisons, orbit tests, and computation of the mean dynamic topography, achieving at least the quality of existing high-resolution models. Results show that the additional GOCE information is highly beneficial in insufficiently observed areas, and that due to the weighting scheme of individual data the spectral and spatial consistency of the model is significantly improved. Due to usage of fill-in data in specific regions, the model cannot be used for physical interpretations in these regions.

  4. Temporal changes and regional differences in treatment uptake of hepatitis C therapy in EuroSIDA

    DEFF Research Database (Denmark)

    Grint, D; Peters, L; Schwarze-Zander, C

    2013-01-01

    All HIV/hepatitis C virus (HCV)-coinfected patients with chronic HCV infection and ≥ F2 fibrosis should be considered for HCV therapy. This study aimed to determine the rate of HCV treatment uptake among coinfected patients in Europe....

  5. The Influence of Hepatitis C Virus Genetic Region on Phylogenetic Clustering Analysis

    NARCIS (Netherlands)

    Lamoury, François M. J.; Jacka, Brendan; Bartlett, Sofia; Bull, Rowena A.; Wong, Arthur; Amin, Janaki; Schinkel, Janke; Poon, Art F.; Matthews, Gail V.; Grebely, Jason; Dore, Gregory J.; Applegate, Tanya L.

    2015-01-01

    Sequencing is important for understanding the molecular epidemiology and viral evolution of hepatitis C virus (HCV) infection. To date, there is little standardisation among sequencing protocols, in-part due to the high genetic diversity that is observed within HCV. This study aimed to develop a

  6. Regionalization of the C-17A Home Station Check to Minimize Costs

    Science.gov (United States)

    2014-06-13

    scissor lift or comparable stand, a “bomb loader” and engine trailer if the Auxiliary Power Unit (APU) or engines need to be removed, and potentially...a high lift truck or tail stand, which every C-17 base has currently. If HSCs are conducted simultaneously then an additional tail stand may be

  7. A Candidate Gene Approach Identifies the TRAF1/C5 Region as a Risk Factor for Rheumatoid Arthritis

    Science.gov (United States)

    Kurreeman, Fina A. S; Padyukov, Leonid; Marques, Rute B; Schrodi, Steven J; Seddighzadeh, Maria; Stoeken-Rijsbergen, Gerrie; van der Helm-van Mil, Annette H. M; Allaart, Cornelia F; Verduyn, Willem; Houwing-Duistermaat, Jeanine; Alfredsson, Lars; Begovich, Ann B; Klareskog, Lars; Huizinga, Tom W. J; Toes, Rene E. M

    2007-01-01

    Background Rheumatoid arthritis (RA) is a chronic autoimmune disorder affecting ∼1% of the population. The disease results from the interplay between an individual's genetic background and unknown environmental triggers. Although human leukocyte antigens (HLAs) account for ∼30% of the heritable risk, the identities of non-HLA genes explaining the remainder of the genetic component are largely unknown. Based on functional data in mice, we hypothesized that the immune-related genes complement component 5 (C5) and/or TNF receptor-associated factor 1 (TRAF1), located on Chromosome 9q33–34, would represent relevant candidate genes for RA. We therefore aimed to investigate whether this locus would play a role in RA. Methods and Findings We performed a multitiered case-control study using 40 single-nucleotide polymorphisms (SNPs) from the TRAF1 and C5 (TRAF1/C5) region in a set of 290 RA patients and 254 unaffected participants (controls) of Dutch origin. Stepwise replication of significant SNPs was performed in three independent sample sets from the Netherlands (n cases/controls = 454/270), Sweden (n cases/controls = 1,500/1,000) and US (n cases/controls = 475/475). We observed a significant association (p < 0.05) of SNPs located in a haplotype block that encompasses a 65 kb region including the 3′ end of C5 as well as TRAF1. A sliding window analysis revealed an association peak at an intergenic region located ∼10 kb from both C5 and TRAF1. This peak, defined by SNP14/rs10818488, was confirmed in a total of 2,719 RA patients and 1,999 controls (odds ratiocommon = 1.28, 95% confidence interval 1.17–1.39, p combined = 1.40 × 10−8) with a population-attributable risk of 6.1%. The A (minor susceptibility) allele of this SNP also significantly correlates with increased disease progression as determined by radiographic damage over time in RA patients (p = 0.008). Conclusions Using a candidate-gene approach we have identified a novel genetic risk factor for RA

  8. NOAA's Coastal Change Analysis Program (C-CAP) 1985 to 2010 Regional Land Cover Change Data - Coastal United States (NODC Accession 0121254)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The NOAA Coastal Change Analysis Program (C-CAP) produces national standardized land cover and change products for the coastal regions of the U.S. C-CAP products...

  9. Functional analysis of the C-terminal region of human adenovirus E1A reveals a misidentified nuclear localization signal

    Energy Technology Data Exchange (ETDEWEB)

    Cohen, Michael J.; King, Cason R.; Dikeakos, Jimmy D. [Department of Microbiology and Immunology, The University of Western Ontario, A4-833 London Regional Cancer Centre, 800 Commissioners Road E., London, Ontario, N6A 4L6 Canada (Canada); Mymryk, Joe S., E-mail: jmymryk@uwo.ca [Department of Microbiology and Immunology, The University of Western Ontario, A4-833 London Regional Cancer Centre, 800 Commissioners Road E., London, Ontario, N6A 4L6 Canada (Canada); Department of Oncology, The University of Western Ontario, London Regional Cancer Centre, Ontario (Canada)

    2014-11-15

    The immortalizing function of the human adenovirus 5 E1A oncoprotein requires efficient localization to the nucleus. In 1987, a consensus monopartite nuclear localization sequence (NLS) was identified at the C-terminus of E1A. Since that time, various experiments have suggested that other regions of E1A influence nuclear import. In addition, a novel bipartite NLS was recently predicted at the C-terminal region of E1A in silico. In this study, we used immunofluorescence microscopy and co-immunoprecipitation analysis with importin-α to verify that full nuclear localization of E1A requires the well characterized NLS spanning residues 285–289, as well as a second basic patch situated between residues 258 and 263 ({sup 258}RVGGRRQAVECIEDLLNEPGQPLDLSCKRPRP{sup 289}). Thus, the originally described NLS located at the C-terminus of E1A is actually a bipartite signal, which had been misidentified in the existing literature as a monopartite signal, altering our understanding of one of the oldest documented NLSs. - Highlights: • Human adenovirus E1A is localized to the nucleus. • The C-terminus of E1A contains a bipartite nuclear localization signal (NLS). • This signal was previously misidentified to be a monopartite NLS. • Key basic amino acid residues within this sequence are highly conserved.

  10. An autoinhibitory helix in the C-terminal region of phospholipase C-[beta] mediates G[alpaha subscript q] activation

    Energy Technology Data Exchange (ETDEWEB)

    Lyon, Angeline M.; Tesmer, Valerie M.; Dhamsania, Vishan D.; Thal, David M.; Gutierrez, Joanne; Chowdhury, Shoaib; Suddala, Krishna C.; Northup, John K.; Tesmer, John J.G. (Michigan); (NIH)

    2012-03-16

    The enzyme phospholipase C-{beta} (PLC{beta}) is a crucial regulator of intracellular calcium levels whose activity is controlled by heptahelical receptors that couple to members of the G{sub q} family of heterotrimeric G proteins. We have determined atomic structures of two invertebrate homologs of PLC{beta} (PLC21) from cephalopod retina and identified a helix from the C-terminal regulatory region that interacts with a conserved surface of the catalytic core of the enzyme. Mutations designed to disrupt the analogous interaction in human PLC{beta}3 considerably increase basal activity and diminish stimulation by G{alpha}{sub q}. G{alpha}{sub q} binding requires displacement of the autoinhibitory helix from the catalytic core, thus providing an allosteric mechanism for activation of PLC{beta}.

  11. G Genetic c chara acteris Mill.) in sation on two r of avo region ocado

    African Journals Online (AJOL)

    SAM

    nging from 5 were highl er than 0.5. U were cluster ide genetic b ontent, acces mpbell and M nel, 1991; FA very few stu proving the p hana, in contr rop elsewher essing indisc urce in Ghan he terms of the can Journ. (Perse. Ghana. F. Takrama2 ences, Univers w Tafo-Akim, eba ‐ Mampon. 4 rop with cult ch on this c. Ghana.

  12. Structural Aspects of N-Glycosylations and the C-terminal Region in Human Glypican-1.

    Science.gov (United States)

    Awad, Wael; Adamczyk, Barbara; Örnros, Jessica; Karlsson, Niclas G; Mani, Katrin; Logan, Derek T

    2015-09-18

    Glypicans are multifunctional cell surface proteoglycans involved in several important cellular signaling pathways. Glypican-1 (Gpc1) is the predominant heparan sulfate proteoglycan in the developing and adult human brain. The two N-linked glycans and the C-terminal domain that attach the core protein to the cell membrane are not resolved in the Gpc1 crystal structure. Therefore, we have studied Gpc1 using crystallography, small angle x-ray scattering, and chromatographic approaches to elucidate the composition, structure, and function of the N-glycans and the C terminus and also the topology of Gpc1 with respect to the membrane. The C terminus is shown to be highly flexible in solution, but it orients the core protein transverse to the membrane, directing a surface evolutionarily conserved in Gpc1 orthologs toward the membrane, where it may interact with signaling molecules and/or membrane receptors on the cell surface, or even the enzymes involved in heparan sulfate substitution in the Golgi apparatus. Furthermore, the N-glycans are shown to extend the protein stability and lifetime by protection against proteolysis and aggregation. © 2015 by The American Society for Biochemistry and Molecular Biology, Inc.

  13. The C-terminal region controls correct folding of genus Trametes pyranose 2-oxidases.

    Science.gov (United States)

    Maresová, Helena; Palyzová, Andrea; Kyslík, Pavel

    2007-06-30

    The pyranose 2-oxidases from Trametes ochracea and Trametes pubescens share markedly similar amino acid sequences with identity of 93.4%. When expressed from the recombinant plasmids based on the same vector in the Escherichia coli host strain BL21(DE3) at higher growth temperatures, they differ strikingly in the formation of the inclusion bodies. Upon overexpression in the cultures performed at 28 degrees C, the specific activity of pyranose 2-oxidase from T. pubescens was eight times higher than that from T. ochracea: 93% of pyranose 2-oxidase from T. ochracea and only 15% of that from T. pubescens was present in the form of inclusion bodies. To ascertain the cause of this difference, both cloned genes were shuffled. Site-directed recombination of p2o cDNAs revealed that DNA constructs ending with 3' end of p2o cDNA from T. pubescens code for proteins that are folded into an active form to the greater extent, regardless of the gene expression level. "In silicio" analysis of physico-chemical properties of the protein sequences of pyranose 2-oxidases revealed that the sequence of amino acid residues 368-430, constituting the small, head domain of pyranose 2-oxidase from T. pubescens, affects positively the enzyme folding at higher cultivation temperatures. The domain differs in six amino acid residues from that of T. ochracea.

  14. Detections of Long Carbon Chains CH_{3}CCCCH, C_{6}H, LINEAR-C_{6}H_{2} and C_{7}H in the Low-Mass Star Forming Region L1527

    Science.gov (United States)

    Araki, Mitsunori; Takano, Shuro; Sakai, Nami; Yamamoto, Satoshi; Oyama, Takahiro; Kuze, Nobuhiko; Tsukiyama, Koichi

    2017-06-01

    Carbon chains in the warm carbon chain chemistry (WCCC) region has been searched in the 42-44 GHz region by using Green Bank 100 m telescope. Long carbon chains C_{7}H, C_{6}H, CH_{3}CCCCH, and linear-C_{6}H_{2} and cyclic species C_{3}H and C_{3}H_{2}O have been detected in the low-mass star forming region L1527, performing the WCCC. C_{7}H was detected for the first time in molecular clouds. The column density of C_{7}H is derived to be 6.2 × 10^{10} cm^{-2} by using the detected J = 24.5-23.5 and 25.5-24.5 rotational lines. The ^{2}Π_{1/2} electronic state of C_{6}H, locating 21.6 K above the ^{2}Π_{3/2} electronic ground state, and the K_a = 0 line of the para species of linear-C_{6}H_{2} were also detected firstly in molecular clouds. The column densities of the ^{2}Π_{1/2} and ^{2}Π_{3/2} states of C_{6}H in L1527 were derived to be 1.6 × 10^{11} and 1.1 × 10^{12} cm^{-2}, respectively. The total column density of linear-C_{6}H_{2} is obtained to be 1.86 × 10^{11} cm^{-2}. While the abundance ratios of carbon chains in between L1527 and the starless dark cloud Taurus Molecular Cloud-1 Cyanopolyyne Peak (TMC-1 CP) have a trend of decrease by extension of carbon-chain length, column densities of CH_{3}CCCCH and C_{6}H are on the trend. However, the column densities of linear-C_{6}H_{2}, and C_{7}H are as abundant as those of TMC-1 CP in spite of long carbon chain, i.e., they are not on the trend. The abundances of linear-C_{6}H_{2} and C_{7}H show that L1527 is rich for long carbon chains as well as TMC-1 CP.

  15. Prevalence of three campylobacter species, C. jejuni, C. coli, and C. lari, using multilocus sequence typing in wild birds of the Mid-Atlantic region, USA.

    Science.gov (United States)

    Keller, Judith I; Shriver, W Gregory

    2014-01-01

    Campylobacter jejuni is responsible for the majority of bacterial foodborne gastroenteritis in the US, usually due to the consumption of undercooked poultry. Research on which avian species transmit the bacterium is limited, especially in the US. We sampled wild birds in three families-Anatidae, Scolopacidae, and Laridae-in eastern North America to determine the prevalence and specific strains of Campylobacter. The overall prevalence of Campylobacter spp. was 9.2% for all wild birds sampled (n = 781). Campylobacter jejuni was the most prevalent species (8.1%), while Campylobacter coli and Campylobacter lari prevalence estimates were low (1.4% and 0.3%, respectively). We used multilocus sequence typing PCR specific to C. jejuni to characterize clonal complexes and sequence types isolated from wild bird samples and detected 13 novel sequence types, along with a clonal complex previously only associated with human disease (ST-658). Wild birds share an increasing amount of habitat with humans as more landscapes become fragmented and developed for human needs. Wild birds are and will remain an important aspect of public health due to their ability to carry and disperse emerging zoonotic pathogens or their arthropod vectors. As basic information such as prevalence is limited or lacking from a majority of wild birds in the US, this study provides further insight into Campylobacter epidemiology, host preference, and strain characterization of C. jejuni.

  16. Regional, seasonal and interspecific variation in 15N and 13C in sympatric mouse lemurs

    Science.gov (United States)

    Rakotondranary, S. Jacques; Struck, Ulrich; Knoblauch, Christian; Ganzhorn, Jörg U.

    2011-11-01

    Madagascar provides some of the rare examples where two or more primate species of the same genus and with seemingly identical niche requirements occur in sympatry. If congeneric primate species co-occur in other parts of the world, they differ in size in a way that is consistent with Hutchinson's rule for coexisting species, or they occupy different ecological niches. In some areas of Madagascar, mouse lemurs do not follow these "rules" and thus seem to violate one of the principles of community ecology. In order to understand the mechanisms that allow coexistence of sympatric congeneric species without obvious niche differentiation, we studied food composition of two identical sized omnivorous mouse lemur species, Microcebus griseorufus and M. murinus with the help of stable isotope analyses ( δ 15N and δ 13C). The two species are closely related sister species. During the rich season, when food seems abundant, the two species do not differ in their nitrogen isotope composition, indicating that the two species occupy the same trophic level. But they differ in their δ 13C values, indicating that M. griseorufus feeds more on C4 and CAM (Crassulacean-acid-metabolism) plants than M. murinus. During the lean season, M. murinus has lower δ 15N values, indicating that the two species feed at different trophic levels during times of food shortage. Hybrids between the two species showed intermediate food composition. The results reflect subtle differences in foraging or metabolic adaptations that are difficult to quantify by traditional observations but that represent possibilities to allow coexistence of species.

  17. Baryon antibaryon production in the central region at 85 GeV/c

    Energy Technology Data Exchange (ETDEWEB)

    Armstrong, T.A.; French, B.R.; Palano, A.; Bloodworth, I.J.; Carney, J.N; Childs, R.; Kinson, J.B.; Villalobos Baillie, O.; Votruba, M.F.; Ghidini, B.

    1987-06-01

    In a search for glueballs and exotic states decaying into baryons and antibaryons we have investigated the production of baryon antibaryon pairs produced centrally in the reactions ..pi../sup +//pp->..pi../sup +//p(X/sup 0/)p at 85 GeV/c. In particular channels where X/sup 0/ goes to panti p, panti p..pi../sup +/..pi../sup -/, panti p2..pi../sup +/2..pi../sup -/ and ..lambda..anti ..lambda.. have been observed. No significant new structure is observed in the mass spectra.

  18. Site scale wetness classification of tundra regions with C-band SAR satellite data

    DEFF Research Database (Denmark)

    Widhalm, Barbara; Bartsch, Annett; Siewert, Matthias Benjamin

    2016-01-01

    , especially C-band ASAR GM data (1-km resolution). A circumpolar wetness classification map has been introduced previously [1]. With heterogeneity being a major challenge in the Arctic, higher spatial resolution products than GM are essential. In this study we therefore investigate the potential...... of this approach at site scale using ENVISAT ASAR WS data (∼120 m resolution). These higher resolution ASAR WS maps have been produced for study sites representing different settings throughout the Arctic and compared to high resolution land cover maps and field survey data. It can be shown that a medium...

  19. Evolution of naturally occurring 5'non-coding region variants of Hepatitis C virus in human populations of the South American region

    Directory of Open Access Journals (Sweden)

    García-Aguirre Laura

    2007-08-01

    Full Text Available Abstract Background Hepatitis C virus (HCV has been the subject of intense research and clinical investigation as its major role in human disease has emerged. Previous and recent studies have suggested a diversification of type 1 HCV in the South American region. The degree of genetic variation among HCV strains circulating in Bolivia and Colombia is currently unknown. In order to get insight into these matters, we performed a phylogenetic analysis of HCV 5' non-coding region (5'NCR sequences from strains isolated in Bolivia, Colombia and Uruguay, as well as available comparable sequences of HCV strains isolated in South America. Methods Phylogenetic tree analysis was performed using the neighbor-joining method under a matrix of genetic distances established under the Kimura-two parameter model. Signature pattern analysis, which identifies particular sites in nucleic acid alignments of variable sequences that are distinctly representative relative to a background set, was performed using the method of Korber & Myers, as implemented in the VESPA program. Prediction of RNA secondary structures was done by the method of Zuker & Turner, as implemented in the mfold program. Results Phylogenetic tree analysis of HCV strains isolated in the South American region revealed the presence of a distinct genetic lineage inside genotype 1. Signature pattern analysis revealed that the presence of this lineage is consistent with the presence of a sequence signature in the 5'NCR of HCV strains isolated in South America. Comparisons of these results with the ones found for Europe or North America revealed that this sequence signature is characteristic of the South American region. Conclusion Phylogentic analysis revealed the presence of a sequence signature in the 5'NCR of type 1 HCV strains isolated in South America. This signature is frequent enough in type 1 HCV populations circulating South America to be detected in a phylogenetic tree analysis as a distinct

  20. Isotopic paleoecology of the Pleistocene megamammals from the Brazilian Intertropical Region: Feeding ecology (δ13C), niche breadth and overlap

    Science.gov (United States)

    Dantas, Mário André Trindade; Cherkinsky, Alexander; Bocherens, Hervé; Drefahl, Morgana; Bernardes, Camila; França, Lucas de Melo

    2017-08-01

    The extinct megamammals Eremotherium laurillardi (weight 6550 kg), Notiomastodon platensis (w = 6000 kg), Toxodon platensis (w = 3090 kg), Valgipes bucklandi (w = 980 kg) and Equus (Amerhippus) neogaeus (w = 370 kg) are recorded for the late Pleistocene of the Brazilian Intertropical Region. In order to evaluate the isotopic paleoecology (feeding diet, niche breadth and overlap) of these species, 14C dates, δ13C and δ18O analyzes were performed. Our results suggest that E. laurillardi (μδ13C = -4.35 ± 2.87‰; μBA = 0.77 ± 0.25), T. platensis (μδ13C = -5.74 ± 4.80‰; μBA = 0.57 ± 0.40) and N. platensis (μδ13C = -1.17 ± 2.76‰; μBA = 0.56 ± 0.20) were mixed feeders with a wide niche breadth, while E. (A.) neogaeus (μδ13C = 0.73 ± 1.19‰; μBA = 0.38 ± 0.22) was a grazer, and V. bucklandi (δ13C = -10.17‰; BA = 0.13) was a specialist browser. A narrow niche overlap occurred between V. bucklandi and the species that fed principally on C4 plants (>70%; O = 0.24-0.43). In contrast, there was a high niche overlap between E. neogaeus and N. platensis (O = 0.75) and between E. laurillardi and T. platensis (O = 0.86). Therefore, E. laurillardi was probably a key species in this Pleistocene community due to its high body weight and wide niche breadth, suggesting that E. laurillardi was a great competitor for resources in the BIR.

  1. Cytosolic prostaglandin E2 synthase (cPGES) expression is decreased in discrete cortical regions in psychiatric disease.

    Science.gov (United States)

    Maida, Mary E; Hurley, Sean D; Daeschner, Jo Anna; Moore, Amy H; O'Banion, M Kerry

    2006-08-04

    The number of adults in the US affected by bipolar disorder, depression, or schizophrenia is approaching 15 million. Despite decades of research, etiologies of these illnesses remain elusive. Theories of aberrant brain morphology, neurotransmission, and signal conduction have provided the heuristic framework for a large body of literature, with attention focused upon hypotheses of monoamine signaling underlying psychiatric disease. More recently, attention has turned to potential contributions of other signaling pathways, including the arachidonic acid cascade and generation of prostaglandins (PG). To determine the potential involvement of the pathways leading to PGE2 synthesis in psychiatric disease, immunohistochemistry and immunoblotting were performed to measure regional expression of the cyclooxygenases (COX) and one of the terminal PGE2 synthases (PGES) in postmortem tissue provided by The Stanley Medical Research Institute. For normal, bipolar, depressed, and schizophrenic subjects, COX-1 and COX-2 protein levels did not differ across region and patient populations. In contrast, there was a significant effect of diagnosis on cytosolic PGES (cPGES) protein levels in the frontal cortex, with remarkable decreases observed in all psychiatric groups relative to normal tissue (P bipolar subjects. Evaluation of medicated vs. non-medicated subjects revealed a significant effect of medication on cPGES expression in the frontal cortex of bipolar, but not depressed or schizophrenic subjects. These novel findings further support hypotheses of abnormalities in fatty acid and phospholipid metabolism in regions associated with psychiatric disease.

  2. Asparagine 326 in the extremely C-terminal region of XRCC4 is essential for the cell survival after irradiation

    Energy Technology Data Exchange (ETDEWEB)

    Wanotayan, Rujira; Fukuchi, Mikoto; Imamichi, Shoji; Sharma, Mukesh Kumar; Matsumoto, Yoshihisa, E-mail: yoshim@nr.titech.ac.jp

    2015-02-20

    XRCC4 is one of the crucial proteins in the repair of DNA double-strand break (DSB) through non-homologous end-joining (NHEJ). As XRCC4 consists of 336 amino acids, N-terminal 200 amino acids include domains for dimerization and for association with DNA ligase IV and XLF and shown to be essential for XRCC4 function in DSB repair and V(D)J recombination. On the other hand, the role of the remaining C-terminal region of XRCC4 is not well understood. In the present study, we noticed that a stretch of ∼20 amino acids located at the extreme C-terminus of XRCC4 is highly conserved among vertebrate species. To explore its possible importance, series of mutants in this region were constructed and assessed for the functionality in terms of ability to rescue radiosensitivity of M10 cells lacking XRCC4. Among 13 mutants, M10 transfectant with N326L mutant (M10-XRCC4{sup N326L}) showed elevated radiosensitivity. N326L protein showed defective nuclear localization. N326L sequence matched the consensus sequence of nuclear export signal. Leptomycin B treatment accumulated XRCC4{sup N326L} in the nucleus but only partially rescued radiosensitivity of M10-XRCC4{sup N326L}. These results collectively indicated that the functional defects of XRCC4{sup N326L} might be partially, but not solely, due to its exclusion from nucleus by synthetic nuclear export signal. Further mutation of XRCC4 Asn326 to other amino acids, i.e., alanine, aspartic acid or glutamine did not affect the nuclear localization but still exhibited radiosensitivity. The present results indicated the importance of the extremely C-terminal region of XRCC4 and, especially, Asn326 therein. - Highlights: • Extremely C-terminal region of XRCC4 is highly conserved among vertebrate species. • XRCC4 C-terminal point mutants, R325F and N326L, are functionally deficient in terms of survival after irradiation. • N326L localizes to the cytoplasm because of synthetic nuclear export signal. • Leptomycin B restores the

  3. Conservation of Repeats at the Mammalian KCNQ1OT1-CDKN1C Region Suggests a Role in Genomic Imprinting

    Directory of Open Access Journals (Sweden)

    Marcos De Donato

    2017-06-01

    Full Text Available KCNQ1OT1 is located in the region with the highest number of genes showing genomic imprinting, but the mechanisms controlling the genes under its influence have not been fully elucidated. Therefore, we conducted a comparative analysis of the KCNQ1/KCNQ1OT1-CDKN1C region to study its conservation across the best assembled eutherian mammalian genomes sequenced to date and analyzed potential elements that may be implicated in the control of genomic imprinting in this region. The genomic features in these regions from human, mouse, cattle, and dog show a higher number of genes and CpG islands (detected using cpgplot from EMBOSS, but lower number of repetitive elements (including short interspersed nuclear elements and long interspersed nuclear elements, compared with their whole chromosomes (detected by RepeatMasker. The KCNQ1OT1-CDKN1C region contains the highest number of conserved noncoding sequences (CNS among mammals, where we found 16 regions containing about 38 different highly conserved repetitive elements (using mVista, such as LINE1 elements: L1M4, L1MB7, HAL1, L1M4a, L1Med, and an LTR element: MLT1H. From these elements, we found 74 CNS showing high sequence identity (>70% between human, cattle, and mouse, from which we identified 13 motifs (using Multiple Em for Motif Elicitation/Motif Alignment and Search Tool with a significant probability of occurrence, 3 of which were the most frequent and were used to find transcription factor–binding sites. We detected several transcription factors (using JASPAR suite from the families SOX, FOX, and GATA. A phylogenetic analysis of these CNS from human, marmoset, mouse, rat, cattle, dog, horse, and elephant shows branches with high levels of support and very similar phylogenetic relationships among these groups, confirming previous reports. Our results suggest that functional DNA elements identified by comparative genomics in a region densely populated with imprinted mammalian genes may be

  4. Regional differences in treatment rates for patients with chronic hepatitis C infection: Systematic review and meta-analysis.

    Directory of Open Access Journals (Sweden)

    Philip Vutien

    Full Text Available Treatment rates with interferon-based therapies for chronic hepatitis C have been low. Our aim was to perform a systematic review of available data to estimate the rates and barriers for antiviral therapy for chronic hepatitis C.We conducted a systematic review and meta-analysis searching MEDLINE, SCOPUS through March 2016 and abstracts from recent major liver meetings for primary literature with available hepatitis C treatment rates. Random-effects models were used to estimate effect sizes and meta-regression to test for potential sources of heterogeneity.We included 39 studies with 476,443 chronic hepatitis C patients. The overall treatment rate was 25.5% (CI: 21.1-30.5% and by region 34% for Europe, 28.3% for Asia/Pacific, and 18.7% for North America (p = 0.008. On multivariable meta-regression, practice setting (tertiary vs. population-based, p = 0.04, region (Europe vs. North America p = 0.004, and data source (clinical chart review vs. administrative database, p = 0.025 remained significant predictors of heterogeneity. The overall treatment eligibility rate was 52.5%, and 60% of these received therapy. Of the patients who refused treatment, 16.2% cited side effects, 13.8% cited cost as reasons for treatment refusal, and 30% lacked access to specialist care.Only one-quarter of chronic hepatitis C patients received antiviral therapy in the pre-direct acting antiviral era. Treatment rates should improve in the new interferon-free era but, cost, co-morbidities, and lack of specialist care will likely remain and need to be addressed. Linkage to care should even be of higher priority now that well-tolerated cure is available.

  5. Freeze/Thaw Detection in Permafrost Region with C-Band Scatterometers

    Science.gov (United States)

    Naeimi, Vahid; Paulik, Christoph; Wagner, Wolfgang; Barsch, Annett

    2011-01-01

    Distribution of permafrost is largely controlled by climatic conditions. Current permafrost monitoring methods are based on in-situ measurements and modeling and they are mostly local measurements which offer only limited insight in the impacts of global climate variations on the regional to global scale. Permafrost is a subsurface phenomenon which cannot be directly measured with remotely sensed data. But the spatial distribution, thickness and temperature of permafrost is highly dependent on the condition of the active layer overlaying the permafrost. Satellite data can be utilized for operational monitoring of the permafrost active layer by means of a number of indicators and parameters, which are highly valuable for permafrost modeling and monitoring. In this study we present the usage of backscatter measurements from ASCAT scatterometer onboard Metop for detection of freeze/thaw conditions in high latitudes and validate the results with synoptic meteorological measurements. It is shown that there is a high correlation between frozen/unfrozen flag extracted from ASCAT data and the in-situ air temperature measurements.

  6. Evaluation of an enzyme immunoassay for hepatitis C virus antibody detection using a recombinant protein derived from the core region of hepatitis C virus genome

    Directory of Open Access Journals (Sweden)

    Lopes EPA

    2000-01-01

    Full Text Available This study was undertaken to evaluate an enzyme immunoassay (EIA for hepatitis C virus antibody detection (anti-HCV, using just one antigen. Anti-HCV EIA was designed to detect anti-HCV IgG using on the solid-phase a recombinant C22 antigen localized at the N-terminal end of the core region of HCV genome, produced by BioMérieux. The serum samples diluted in phosphate buffer saline were added to wells coated with the C22, and incubated. After washings, the wells were loaded with conjugated anti-IgG, and read in a microtiter plate reader (492 nm. Serum samples of 145 patients were divided in two groups: a control group of 39 patients with non-C hepatitis (10 acute hepatitis A, 10 acute hepatitis B, 9 chronic hepatitis B, and 10 autoimmune hepatitis and a study group consisting of 106 patients with chronic HCV hepatitis. In the study group all patients had anti-HCV detected by a commercially available EIA (Abbott®, specific for HCV structural and nonstructural polypeptides, alanine aminotransferase elevation or positive serum HCV-RNA detected by nested-PCR. They also had a liver biopsy compatible with chronic hepatitis. The test was positive in 101 of the 106 (95% sera from patients in the study group and negative in 38 of the 39 (97% sera from those in the control group, showing an accuracy of 96%. According to these results, our EIA could be used to detect anti-HCV in the serum of patients infected with hepatitis C virus.

  7. Regional estimation of soil C stocks and CO2 emissions as influenced by cropping systems and soil type

    Science.gov (United States)

    Farina, Roberta; Marchetti, Alessandro; Di Bene, Claudia

    2015-04-01

    Soil organic matter (SOM) is of crucial importance for agricultural soil quality and fertility. At global level soil contains about three times the carbon stored in the vegetation and about twice that present in the atmosphere. Soil could act as source and sink of carbon, influencing the balance of CO2 concentration and consequently the global climate. The sink/source ratio depends on many factors that encompass climate, soil characteristics and different land management practices. Thus, the relatively large gross exchange of GHGs between atmosphere and soils and the significant stocks of carbon in soils, may have significant impact on climate and on soil quality. To quantify the dynamics of C induced by land cover change and the spatial and temporal dynamics of C sources and sinks at regional and, potentially, at national and global scales, we propose a methodology, based on a bio-physical model combined with a spatial explicit database to estimate C stock changes and emissions/removals. The study has been conducted in a pilot region in Italy (Apulia, Foggia province), considering the typical cropping systems of the area, namely rainfed cereals, tomato, vineyard and olives. For this purpose, the model RothC10N (Farina et al., 2013), that simulates soil C dynamics, has been modified to work directly in batch using data of climate, soil (over 290 georeferenced soil profiles), annual agriculture land use (1200 observations) The C inputs from crops have been estimated using statistics and data from literature. The model was run to equilibrium for each point of soil, in order to make all the data homogeneous in terms of time. The obtained data were interpolate with geostatisical procedures, obtaining a set of 30x30 km grid with the initial soil C. The new layer produced, together with soil and land use layers, were used for a long-term run (12 years). Results showed that olive groves and vineyards were able to stock a considerable amount of C (from 0.4 to 1.5 t ha-1 y

  8. AgMIP 1.5°C Assessment: Mitigation and Adaptation at Coordinated Global and Regional Scales

    Science.gov (United States)

    Rosenzweig, C.

    2016-12-01

    The AgMIP 1.5°C Coordinated Global and Regional Integrated Assessments of Climate Change and Food Security (AgMIP 1.5 CGRA) is linking site-based crop and livestock models with similar models run on global grids, and then links these biophysical components with economics models and nutrition metrics at regional and global scales. The AgMIP 1.5 CGRA assessment brings together experts in climate, crop, livestock, economics, nutrition, and food security to define the 1.5°C Protocols and guide the process throughout the assessment. Scenarios are designed to consistently combine elements of intertwined storylines of future society including socioeconomic development (Shared Socioeconomic Pathways), greenhouse gas concentrations (Representative Concentration Pathways), and specific pathways of agricultural sector development (Representative Agricultural Pathways). Shared Climate Policy Assumptions will be extended to provide additional agricultural detail on mitigation and adaptation strategies. The multi-model, multi-disciplinary, multi-scale integrated assessment framework is using scenarios of economic development, adaptation, mitigation, food policy, and food security. These coordinated assessments are grounded in the expertise of AgMIP partners around the world, leading to more consistent results and messages for stakeholders, policymakers, and the scientific community. The early inclusion of nutrition and food security experts has helped to ensure that assessment outputs include important metrics upon which investment and policy decisions may be based. The CGRA builds upon existing AgMIP research groups (e.g., the AgMIP Wheat Team and the AgMIP Global Gridded Crop Modeling Initiative; GGCMI) and regional programs (e.g., AgMIP Regional Teams in Sub-Saharan Africa and South Asia), with new protocols for cross-scale and cross-disciplinary linkages to ensure the propagation of expert judgment and consistent assumptions.

  9. Does vitamin C prevent the occurrence of complex regional pain syndrome in patients with extremity trauma requiring surgery?

    OpenAIRE

    Jorge Cabrolier; Marcelo Molina

    2015-01-01

    El síndrome de dolor regional complejo es una patología neuroinflamatoria que afecta tanto al sistema nervioso central como al periférico, y se caracteriza por dolor desproporcionado en relación al trauma experimentado por el paciente. Se ha planteado que el uso de vitamina C podría prevenir la aparición de este síndrome en pacientes con trauma y cirugía de extremidades. Utilizando la base de datos Epistemonikos, la cual es mantenida mediante búsquedas en 30 bases de datos, identificamos dos ...

  10. Search for the decay K+-->π+νν¯ in the momentum region Pπ<195 MeV/c

    Science.gov (United States)

    E787 Collaboration; Adler, S.; Aoki, M.; Ardebili, M.; Atiya, M. S.; Bazarko, A. O.; Bergbusch, P. C.; Bhuyan, B.; Blackmore, E. W.; Bryman, D. A.; Chiang, I.-H.; Convery, M. R.; Diwan, M. V.; Frank, J. S.; Haggerty, J. S.; Inagaki, T.; Ito, M.; Jain, V.; Jaffe, D. E.; Kabe, S.; Kazumori, M.; Kettell, S. H.; Kitching, P.; Kobayashi, M.; Komatsubara, T. K.; Konaka, A.; Kuno, Y.; Kuriki, M.; Kycia, T. F.; Li, K. K.; Littenberg, L. S.; Marlow, D. R.; McPherson, R. A.; Macdonald, J. A.; Meyers, P. D.; Mildenberger, J.; Muramatsu, N.; Nakano, T.; Ng, C.; Ng, S.; Numao, T.; Poutissou, J.-M.; Poutissou, R.; Redlinger, G.; Sasaki, T.; Sato, T.; Shinkawa, T.; Shoemaker, F. C.; Smith, A. J. S.; Soluk, R.; Stone, J. R.; Strand, R. C.; Sugimoto, S.; Yoshimura, Y.; Witzig, C.

    2002-06-01

    We have searched for the decay K+-->π+νν¯ in the kinematic region with pion momentum below the K+-->π+π0 peak. One event was observed, consistent with the background estimate of /0.73+/-0.18. This implies an upper limit on B(K+-- >π+νν¯)π+π0 peak. The same data were used to search for K+-->π+X0, where X0 is a weakly interacting neutral particle or system of particles with 150c2.

  11. Search for the decay K→πγγ in the π momentum region P>213 MeV/c

    Science.gov (United States)

    E949 Collaboration; Artamonov, A. V.; Bassalleck, B.; Bhuyan, B.; Blackmore, E. W.; Bryman, D. A.; Chen, S.; Chiang, I.-H.; Christidi, I.-A.; Cooper, P. S.; Diwan, M. V.; Frank, J. S.; Fujiwara, T.; Hu, J.; Jaffe, D. E.; Kabe, S.; Kettell, S. H.; Khabibullin, M. M.; Khotjantsev, A. N.; Kitching, P.; Kobayashi, M.; Komatsubara, T. K.; Konaka, A.; Kozhevnikov, A. P.; Kudenko, Yu. G.; Kushnirenko, A.; Landsberg, L. G.; Lewis, B.; Li, K. K.; Littenberg, L. S.; MacDonald, J. A.; Mildenberger, J.; Mineev, O. V.; Miyajima, M.; Mizouchi, K.; Mukhin, V. A.; Muramatsu, N.; Nakano, T.; Nomachi, M.; Nomura, T.; Numao, T.; Obraztsov, V. F.; Omata, K.; Patalakha, D. I.; Petrenko, S. V.; Poutissou, R.; Ramberg, E. J.; Redlinger, G.; Sato, T.; Sekiguchi, T.; Shinkawa, T.; Strand, R. C.; Sugimoto, S.; Tamagawa, Y.; Tschirhart, R.; Tsunemi, T.; Vavilov, D. V.; Viren, B.; Yershov, N. V.; Yoshimura, Y.; Yoshioka, T.

    2005-09-01

    We have searched for the K→πγγ decay in the kinematic region with π momentum close to the end point. No events were observed, and the 90% confidence-level upper limit on the partial branching ratio was obtained, B(K→πγγ,P>213 MeV/c)<8.3×10 under the assumption of chiral perturbation theory including next-to-leading order “unitarity” corrections. The same data were used to determine an upper limit on the K→πγ branching ratio of 2.3×10 at the 90% confidence level.

  12. The interaction between progranulin and prosaposin is mediated by granulins and the linker region between saposin B and C.

    Science.gov (United States)

    Zhou, Xiaolai; Sullivan, Peter M; Sun, Lirong; Hu, Fenghua

    2017-10-01

    The frontotemporal lobar degeneration (FTLD) protein progranulin (PGRN) is essential for proper lysosomal function. PGRN localizes in the lysosomal compartment within the cell. Prosaposin (PSAP), the precursor of lysosomal saposin activators (saposin A, B, C, D), physically interacts with PGRN. Previously, we have shown that PGRN and PSAP facilitate each other's lysosomal trafficking. Here, we report that the interaction between PSAP and PGRN requires the linker region of saposin B and C (BC linker). PSAP protein with the BC linker mutated, fails to interact with PGRN and deliver PGRN to lysosomes in the biosynthetic and endocytic pathways. On the other hand, PGRN interacts with PSAP through multiple granulin motifs. Granulin D and E bind to PSAP with similar affinity as full-length PGRN. Read the Editorial Comment for this article on page 154. © 2017 International Society for Neurochemistry.

  13. Coordination of Hepatitis C Virus Assembly by Distinct Regulatory Regions in Nonstructural Protein 5A.

    Directory of Open Access Journals (Sweden)

    Margarita Zayas

    2016-01-01

    Full Text Available Hepatitis C virus (HCV nonstructural protein (NS5A is a RNA-binding protein composed of a N-terminal membrane anchor, a structured domain I (DI and two intrinsically disordered domains (DII and DIII interacting with viral and cellular proteins. While DI and DII are essential for RNA replication, DIII is required for assembly. How these processes are orchestrated by NS5A is poorly understood. In this study, we identified a highly conserved basic cluster (BC at the N-terminus of DIII that is critical for particle assembly. We generated BC mutants and compared them with mutants that are blocked at different stages of the assembly process: a NS5A serine cluster (SC mutant blocked in NS5A-core interaction and a mutant lacking the envelope glycoproteins (ΔE1E2. We found that BC mutations did not affect core-NS5A interaction, but strongly impaired core-RNA association as well as virus particle envelopment. Moreover, BC mutations impaired RNA-NS5A interaction arguing that the BC might be required for loading of core protein with viral RNA. Interestingly, RNA-core interaction was also reduced with the ΔE1E2 mutant, suggesting that nucleocapsid formation and envelopment are coupled. These findings argue for two NS5A DIII determinants regulating assembly at distinct, but closely linked steps: (i SC-dependent recruitment of replication complexes to core protein and (ii BC-dependent RNA genome delivery to core protein, triggering encapsidation that is tightly coupled to particle envelopment. These results provide a striking example how a single viral protein exerts multiple functions to coordinate the steps from RNA replication to the assembly of infectious virus particles.

  14. Pan-genotypic treatment regimens for hepatitis C virus: Advantages and disadvantages in high- and low-income regions.

    Science.gov (United States)

    Hézode, C

    2017-02-01

    During the last 5 years, the availability of direct-acting antiviral (DAA) agents has revolutionized the treatment of hepatitis C virus (HCV). Compared with interferon/ribavirin-the previous standard of care-DAA combination regimens offer improved sustained virological response (SVR) rates, shorter treatment durations of 8-24 weeks, convenient once-daily single-tablet formulations and more favourable tolerability profiles. HCV treatment is complex, and the choice of therapy must consider a complex range of factors, including baseline viral load, fibrosis stage, the HCV genotype and subgenotype, and the presence of resistance-associated substitutions at baseline. Globally, HCV genotype 1 predominates, and there are extensive data and various treatment options available for this genotype. Genotypes 2-6 are prevalent and may even predominate in different geographical regions, reflecting diverse factors including human migration patterns and unsafe use of injection drugs and blood products. Such factors are themselves influenced by socio-economic factors, and poor regions often have the greatest unmet need for effective HCV therapies. The latest pan-genotypic DAA combination regimens provide the potential to eradicate HCV around the globe, regardless of genotype, hence minimizing the need for virological testing services, which often are unavailable in poorer regions. Economics inevitably remain a barrier to access, and extensive cooperation will be required between clinical organisations and pharmaceutical manufacturers to agree appropriate pricing policies, especially in poorer economic regions. This review considers key data and treatment guidelines for DAA therapies, including pan-genotypic combination regimens, in the context of regional differences in HCV genotype and socio-economic factors. © 2016 John Wiley & Sons Ltd.

  15. Hydrocarbon plume discrimination using the C-H stretch region of the Infrared spectrum using OP-FTIR.

    Science.gov (United States)

    Crampton, R. S.; Pikelnaya, O.; Polidori, A.; Tisopulos, L.; Perry, S.

    2016-12-01

    Open path FTIR spectroscopy can measure many different gases including most gaseous hydrocarbons in the atmosphere. Individual Hydrocarbons can be identified in the fingerprint region (500 cm-1 to 1500 cm-1) due to unique bond absorption features. Often times the strongest absorption is not unique because it is a result of the C-H bonds stretching. These bonds and absorption features are in all hydrocarbons and overlap (2850 cm-1 to 3000 cm-1) so they are not ideal for identification of individual compounds. For this reason any FTIR investigations treat total hydrocarbons as hexane or pentane equivalent. This way the C-H stretch can be used to get real information about the total hydrocarbons when the individual compounds cannot be quantified. In the fall of 2015, KASSAY Field Services, Inc, participated in a program sponsored by the South Coast Air Quality Management District (SCAQMD) to conduct open path FTIR measurements downwind of oil wells located in the southern California basin. Most of the oil wells for this measurement study reside in the town of Signal Hill, CA. In a location such as Signal Hill (part of Long Beach, CA) there are always some Hydrocarbons in the air due to vehicles, gas stations, the oil and gas industry, and other sources mixed together. Each source has a different combination of hydrocarbons resulting in different shapes of absorption in the C-H stretch region. The final shape is a result of the ratio of all the absorber concentrations multiplied by the I.R. features of each. We investigated how the C-H stretch absorption feature shape changes over time and space in a complicated air shed and what the implications for possible source apportionment without needing highly accurate quantification of many gases.

  16. Spine segmentation from C-arm CT data sets: application to region-of-interest volumes for spinal interventions

    Science.gov (United States)

    Buerger, C.; Lorenz, C.; Babic, D.; Hoppenbrouwers, J.; Homan, R.; Nachabe, R.; Racadio, J. M.; Grass, M.

    2017-03-01

    Spinal fusion is a common procedure to stabilize the spinal column by fixating parts of the spine. In such procedures, metal screws are inserted through the patients back into a vertebra, and the screws of adjacent vertebrae are connected by metal rods to generate a fixed bridge. In these procedures, 3D image guidance for intervention planning and outcome control is required. Here, for anatomical guidance, an automated approach for vertebra segmentation from C-arm CT images of the spine is introduced and evaluated. As a prerequisite, 3D C-arm CT images are acquired covering the vertebrae of interest. An automatic model-based segmentation approach is applied to delineate the outline of the vertebrae of interest. The segmentation approach is based on 24 partial models of the cervical, thoracic and lumbar vertebrae which aggregate information about (i) the basic shape itself, (ii) trained features for image based adaptation, and (iii) potential shape variations. Since the volume data sets generated by the C-arm system are limited to a certain region of the spine the target vertebra and hence initial model position is assigned interactively. The approach was trained and tested on 21 human cadaver scans. A 3-fold cross validation to ground truth annotations yields overall mean segmentation errors of 0.5 mm for T1 to 1.1 mm for C6. The results are promising and show potential to support the clinician in pedicle screw path and rod planning to allow accurate and reproducible insertions.

  17. Phospholipase C {gamma}-2 (Plcg2) and phospholipase C {gamma}-1 (Plcg1) map to distinct regions in the human and mouse genomes

    Energy Technology Data Exchange (ETDEWEB)

    Argeson, A.C.; Druck, T.; Veronese, M.L. [Thomas Jefferson Univ., Philadelphia, PA (United States)] [and others

    1995-01-01

    The phospholipase C {gamma}-2 (Plcg2) gene encodes an enzyme that plays a crucial role in intracellular signal transduction pathways. This enzyme is important because of its role in the generation of second messengers following the hydrolysis of phosphatidylinositol 4,5-bisphosphate. We have now determined the chromosomal location of this gene in the mouse and human genomes. An interspecific backcross involving AEJ/Gn and Mus spretus mice was used to localize the gene in mouse. A rodent/human somatic cell hybrid panel was used to map PLCG2 in the human genome. Our results position Plcg2 in the central region of mouse chromosome 8. We also show that PLCG2 maps to the long arm of human chromosome 16, in the region q22-qter. Plcg2 does not map near its most closely related family member, Plcg1, in either genome, indicating that the mammalian Plcg genes belong to a dispersed family. 29 refs., 3 figs., 2 tabs.

  18. Crystal Structure of the C-terminal Region of Streptococcus mutans Antigen I/II and Characterization of Salivary Agglutinin Adherence Domains

    Energy Technology Data Exchange (ETDEWEB)

    Larson, Matthew R.; Rajashankar, Kanagalaghatta R.; Crowley, Paula J.; Kelly, Charles; Mitchell, Tim J.; Brady, L. Jeannine; Deivanayagam, Champion (King); (Cornell); (UAB); (Glasgow); (Florida)

    2012-05-29

    The Streptococcus mutans antigen I/II (AgI/II) is a cell surface-localized protein that adheres to salivary components and extracellular matrix molecules. Here we report the 2.5 {angstrom} resolution crystal structure of the complete C-terminal region of AgI/II. The C-terminal region is comprised of three major domains: C{sub 1}, C{sub 2}, and C{sub 3}. Each domain adopts a DE-variant IgG fold, with two {beta}-sheets whose A and F strands are linked through an intramolecular isopeptide bond. The adherence of the C-terminal AgI/II fragments to the putative tooth surface receptor salivary agglutinin (SAG), as monitored by surface plasmon resonance, indicated that the minimal region of binding was contained within the first and second DE-variant-IgG domains (C{sub 1} and C{sub 2}) of the C terminus. The minimal C-terminal region that could inhibit S. mutans adherence to SAG was also confirmed to be within the C{sub 1} and C{sub 2} domains. Competition experiments demonstrated that the C- and N-terminal regions of AgI/II adhere to distinct sites on SAG. A cleft formed at the intersection between these C{sub 1} and C{sub 2} domains bound glucose molecules from the cryo-protectant solution, revealing a putative binding site for its highly glycosylated receptor SAG. Finally, electron microscopy images confirmed the elongated structure of AgI/II and enabled building a composite tertiary model that encompasses its two distinct binding regions.

  19. Does vitamin C prevent the occurrence of complex regional pain syndrome in patients with extremity trauma requiring surgery?

    Directory of Open Access Journals (Sweden)

    Jorge Cabrolier

    2015-07-01

    Full Text Available El síndrome de dolor regional complejo es una patología neuroinflamatoria que afecta tanto al sistema nervioso central como al periférico, y se caracteriza por dolor desproporcionado en relación al trauma experimentado por el paciente. Se ha planteado que el uso de vitamina C podría prevenir la aparición de este síndrome en pacientes con trauma y cirugía de extremidades. Utilizando la base de datos Epistemonikos, la cual es mantenida mediante búsquedas en 30 bases de datos, identificamos dos revisiones sistemáticas que en conjunto incluyen sólo un estudio controlado aleatorizado. Realizamos una tabla de resumen de los resultados utilizando el método GRADE. Concluimos que existe incertidumbre sobre si la vitamina C podría ser útil en la prevención del síndrome de dolor regional complejo en estos pacientes porque la certeza de la evidencia es muy baja.

  20. cDNA sequence, genomic organization, and evolutionary conservation of a novel gene from the WAGR region

    Energy Technology Data Exchange (ETDEWEB)

    Schwartz, F.; Eisenman, R.; Knoll, J.; Bruns, G. [Children`s Hospital and Department of Pediatrics, Boston, MA (United States)

    1995-09-20

    A new gene (239FB) with predominant and differential expression in fetal brain has recently been isolated from a chromosome 11p13-p14 boundary area near FSHB. The corresponding mRNA has an open reading frame of 294 amino acids, a 3` untranslated region of 1247 nucleotides, and a highly GC-rich 5` untranslated region. The coding and 3` UT sequence is specified by 6 exons within nearly 87 kb of isolated genomic locus. The 5` end region of the transcript maps adjacent to the only genomically defined CpG island in a chromosomal subregion that may be associated with part of the mental retardation of some WAGR (Wilms tumor, aniridia, genitourinary anomalies, and mental retardation) syndrome patients. In addition to nucleotide and amino acid similarity to an EST from a normalized infant brain cDNA library, the predicted protein has extensive similarity to Caenorhbditis elegans polypeptides of, as yet, unknown function. The 239FB locus is, therefore, likely part of a family of genes with two members expressed in human brain. The extensive conservation of the predicted protein suggests a fundamental function of the gene product and will enable evaluation of the role of the 239FB gene in neurogenesis in model organisms. 48 refs., 4 figs., 1 tab.

  1. Predicted Coverage and Immuno-Safety of a Recombinant C-Repeat Region Based Streptococcus pyogenes Vaccine Candidate.

    Science.gov (United States)

    McNeilly, Celia; Cosh, Samantha; Vu, Therese; Nichols, Jemma; Henningham, Anna; Hofmann, Andreas; Fane, Anne; Smeesters, Pierre R; Rush, Catherine M; Hafner, Louise M; Ketheesan, Natkuman; Sriprakash, Kadaba S; McMillan, David J

    2016-01-01

    The C-terminal region of the M-protein of Streptococcus pyogenes is a major target for vaccine development. The major feature is the C-repeat region, consisting of 35-42 amino acid repeat units that display high but not perfect identity. SV1 is a S. pyogenes vaccine candidate that incorporates five 14mer amino acid sequences (called J14i variants) from differing C-repeat units in a single recombinant construct. Here we show that the J14i variants chosen for inclusion in SV1 are the most common variants in a dataset of 176 unique M-proteins. Murine antibodies raised against SV1 were shown to bind to each of the J14i variants present in SV1, as well as variants not present in the vaccine. Antibodies raised to the individual J14i variants were also shown to bind to multiple but different combinations of J14i variants, supporting the underlying rationale for the design of SV1. A Lewis Rat Model of valvulitis was then used to assess the capacity of SV1 to induce deleterious immune response associated with rheumatic heart disease. In this model, both SV1 and the M5 positive control protein were immunogenic. Neither of these antibodies were cross-reactive with cardiac myosin or collagen. Splenic T cells from SV1/CFA and SV1/alum immunized rats did not proliferate in response to cardiac myosin or collagen. Subsequent histological examination of heart tissue showed that 4 of 5 mice from the M5/CFA group had valvulitis and inflammatory cell infiltration into valvular tissue, whereas mice immunised with SV1/CFA, SV1/alum showed no sign of valvulitis. These results suggest that SV1 is a safe vaccine candidate that will elicit antibodies that recognise the vast majority of circulating GAS M-types.

  2. Effect of vitamin C on prevention of complex regional pain syndrome type I in foot and ankle surgery.

    Science.gov (United States)

    Besse, Jean-Luc; Gadeyne, Sylvain; Galand-Desmé, Sophie; Lerat, Jean-Luc; Moyen, Bernard

    2009-01-01

    The public health cost impact of complex regional pain syndrome type I (CRPS I) is considerable in both emergency and scheduled orthopaedic surgery. We proposed to assess the effectiveness of vitamin C in prevention of CRPS I in foot and ankle surgery. We carried out a "before-after" quasi-experimental study comparing two chronologically successive groups without (Group I: July 2002-June 2003) and with (Group II: July 2003-June 2004) preventive 1g daily vitamin C treatment. All patients having surgery on the foot or ankle were enrolled, with the exception of diabetic foot cases. Several factors were analysed: sex, age, type of pathology, history of CRPS I, psychological context, tourniquet time, and cast immobilisation time. 420 feet (392 patients) were included in the study: 185 in Group I, 235 in Group II. CRPS I occurred in 18 cases in Group I (9.6%) and 4 cases in Group II (1.7%) (phistory of CRPS I as a significantly correlated factor (relative risk=10.4). The psychological context (anxio-depressive state) showed a (sub-significant) tendency to increase the risk of CRPS I (relative risk=2.6). Vitamin C has been shown to be effective in preventing CRPS I secondary to wrist fracture, but few data are available with respect to foot and ankle cases. The present study demonstrates the effectiveness of vitamin C in preventing CRPS I of the foot and ankle-a frequent complication in our control group (9.6%). The authors recommend preventive management by vitamin C.

  3. Relationship Between HbA1c and Complex Regional Pain Syndrome in Stroke Patients With Type 2 Diabetes Mellitus

    Science.gov (United States)

    2016-01-01

    Objective To investigate the relationship between glycosylated hemoglobin A (HbA1c) and complex regional pain syndrome (CRPS) in stroke patients with type 2 diabetes mellitus (T2DM). Methods A retrospective chart review was performed of stroke patients from January 2012 to December 2013. We reviewed 331 patients and included 200 in the analysis. We divided them into CRPS and non-CRPS groups and compared them by age, gender, stroke lesion, cause of stroke, duration of T2DM, HbA1c (%), National Institutes of Health Stroke Scale score, affected shoulder flexor muscle strength, Fugl-Meyer Assessment score, motricity index, Functional Independence Measure, Korean version of Modified Barthel Index, blood glucose level on admission day, duration from stroke onset to HbA1c check, and duration from stroke onset to three-phase bone scan for CRPS diagnosis. Thereafter, we classified the patients into five groups by HbA1c level (group 1, 5.0%–5.9%; group 2, 6.0%–6.9%; group 3, 7.0%–7.9%; group 4, 8.0%–8.9%; and group 5, 9.0%–9.9%) and we investigated the difference in CRPS prevalence between the two groups. Results Of the 200 patients, 108 were in the CRPS group and 92 were in the non-CRPS group. There were significant differences in HbA1c (pCRPS prevalence (pCRPS prevalence and thus that uncontrolled blood glucose can affect CRPS occurrence in stroke patients with diabetes. PMID:27847707

  4. Regional 11C-hydroxyephedrine retention in hibernating myocardium: chronic inhomogeneity of sympathetic innervation in the absence of infarction.

    Science.gov (United States)

    Luisi, Andrew J; Suzuki, Gen; Dekemp, Robert; Haka, Michael S; Toorongian, Steven A; Canty, John M; Fallavollita, James A

    2005-08-01

    We have previously shown that ex vivo counting of (131)I-metaiodobenzylguanidine can identify regional reductions in sympathetic norepinephrine uptake in pigs with hibernating myocardium. However, nonneuronal uptake limited relative differences between regions and would preclude accurate assessment with conventional imaging. We therefore hypothesized that the superior specificity of the positron-emitting isotope (11)C-hydroxyephedrine (HED) would facilitate the imaging of regional differences, and we designed this study to determine whether altered uptake of norepinephrine by sympathetic nerves in viable, dysfunctional myocardium can be imaged in vivo and to determine the temporal progression and stability of sympathetic dysinnervation in hibernating myocardium. Pigs (n = 15) were chronically instrumented with a 1.5-mm stenosis of the left anterior descending coronary artery, a procedure that we have previously shown to produce viable chronically dysfunctional myocardium with reduced resting flow, or hibernating myocardium, after 3 mo. Physiologic studies and HED PET were performed 1-5 mo later with the animals in the closed-chest sedated state. One animal with a myocardial infarct was analyzed separately. After 3 mo, anterior hypokinesis developed (wall thickening, 32% +/- 4% vs. 60% +/- 4%, P < 0.001), with reductions in resting flow (subendocardial flow, 0.81 +/- 0.11 vs. 1.20 +/- 0.18 mL/min/g, P < 0.05) and a critical reduction in subendocardial flow reserve (subendocardial adenosine flow, 0.53 +/- 0.20 vs. 3.96 +/- 0.43 mL/min/g, P < 0.001). Extensive defects in HED uptake were found for hibernating myocardium, with regional retention approximately 50% lower than that in normally perfused remote myocardium (0.035 +/- 0.002 vs. 0.066 +/- 0.002 min(-1), P < 0.001). Relative HED uptake (left anterior descending coronary artery/remote) was lower in chronically instrumented animals than in control animals (n = 4, P < 0.001) and animals studied 1 mo after

  5. EPIDEMIOLOGY OF ACTIVATED PROTEIN C RESISTANCE AND FACTOR V LEIDEN MUTATION IN THE MEDITERRANEAN REGION

    Directory of Open Access Journals (Sweden)

    Mehrez Mehrez M. Jadaon

    2011-01-01

    also reported in populations living in North Africa and the Middle East.  This review article briefly explains FVL and how it causes VTE, the distribution of FVL worldwide, and then it elaborates on the epidemiology of FVL in the Mediterranean Region and how this brought speculations that FVL might have originated in the Eastern Mediterranean area.

  6. Stable isotopes (C, N, O, H) of feathers collected in an Italian alpine region, during postbreeding migration

    Science.gov (United States)

    Bontempo, Luana; Ceppa, Florencia; Pedrini, Paolo; Tenan, Simone; Camin, Federica

    2013-04-01

    Over the last 20 years the analysis of stable isotope ratios of carbon, nitrogen, oxygen, hydrogen and sulphur have gradually become a formidable tool for the animal ecologists (Hobson and Wassenaar, 1997; Marra et al., 1998; Inger and Bearhop, 2008). In particular many studies have been developed on tracking the movement and the diet of birds in time and space, fundamental to understanding their ecology, but also inherently difficult to determine. The aim of this study was to deepen the origin and behaviour of migratory bird species crossing the Trentino area, an Italian alpine region, during the post-nuptial migration period, and monitored by a long term study by ringing activities (Progetto Alpi, Pedrini et al. 2008). About 800 samples of feathers from 48 local bird species were collected during 2010 - 2012 years. Analysis of d13C, d15N, d18O and dD were performed on these samples using an Isotope Ratio Mass Spectrometer (IRMS) interfaced with an Elemental Analyser or a pyrolyser after a pre-treatment of the feathers (cleaning with diethyl ether:methanol 2:1, equilibration to ambient humitity for 4 days and, for d18O and dD a final drying step wth P2O5 for another 4 days). A first survey of the obtained data is presented in this work. As expected, the first statistical elaboration/'look' of them confirmed that 13C can be used to trace the importance of different carbon pools to a consumer (e.g. C3, C4 or CAM plants, marine algae) whereas d15N vary as a function of a variety of biological, geochemical and anthropogenic processes and is a very effective tracer of trophic level. In particular, it was interesting to note that the specie Loxia curvirostra showed particularly high d13C and low d15N values probably due to the eating of conifer seeds and whereas the specie Motacilla flava, that bases its diet primarily on worms and insects, presented high d15N values. On the other hand d18O values mainly depends by geographical/diet factors whereas dD values are

  7. Mutations in the C-terminal region affect subcellular localization of crucian carp herpesvirus (CaHV) GPCR.

    Science.gov (United States)

    Wang, Jun; Gui, Lang; Chen, Zong-Yan; Zhang, Qi-Ya

    2016-08-01

    G protein-coupled receptors (GPCRs) are known as seven transmembrane domain receptors and consequently can mediate diverse biological functions via regulation of their subcellular localization. Crucian carp herpesvirus (CaHV) was recently isolated from infected fish with acute gill hemorrhage. CaHV GPCR of 349 amino acids (aa) was identified based on amino acid identity. A series of variants with truncation/deletion/substitution mutation in the C-terminal (aa 315-349) were constructed and expressed in fathead minnow (FHM) cells. The roles of three key C-terminal regions in subcellular localization of CaHV GPCR were determined. Lysine-315 (K-315) directed the aggregation of the protein preferentially at the nuclear side. Predicted N-myristoylation site (GGGWTR, aa 335-340) was responsible for punctate distribution in periplasm or throughout the cytoplasm. Predicted phosphorylation site (SSR, aa 327-329) and GGGWTR together determined the punctate distribution in cytoplasm. Detection of organelles localization by specific markers showed that the protein retaining K-315 colocalized with the Golgi apparatus. These experiments provided first evidence that different mutations of CaHV GPCR C-terminals have different affects on the subcellular localization of fish herpesvirus-encoded GPCRs. The study provided valuable information and new insights into the precise interactions between herpesvirus and fish cells, and could also provide useful targets for antiviral agents in aquaculture.

  8. 3-D modelling and analysis of Dst C-responses in the North Pacific Ocean region, revisited

    DEFF Research Database (Denmark)

    Kuvshinov, A.; Utada, H.; Avdeev, D.

    2005-01-01

    was detected. The reason for this shift is still unclear. Even if a very detailed grid of 0.3 x 0.3 is used, the 3-D simulations using a model of the inhomogeneous surface has no notable ocean effect to C-responses at this site. An attempt has been made to reduce the misfit between observed and modelled C-responses...... and mid-mantle conductivity reference model for this region. Keeping the differences in mind, and inspired by recent findings that the ocean effect is a major contributor to the anomalous behaviour of C-responses up to the period of 20 days (especially at coastal observatories), the goal of this paper has...... been three-fold: (1) to understand, on the basis of systematic model studies using 3-D ocean models, which of the published 1-D upper and mid-mantle profiles is in best agreement with the available observations. (2) To try to reduce the misfit between the observed and modelled responses by using dense...

  9. C

    NARCIS (Netherlands)

    Sinninghe Damsté, J.S.; Schouten, S.; Volkman, J.K.

    2014-01-01

    A limited suite of C-27, C-29 and C-30 rearranged hopenes identified as neohop-13(18)-enes have been reported in immature Recent and ancient marine/lacustrine sediments and their presence has been explained by dehydration and isomerisation of ubiquitous hopanols or hopenes. Here we investigated the

  10. Search for the decay K+ to pi+ gamma gamma in the pi+ momentum region P > 213 MeV/c

    Energy Technology Data Exchange (ETDEWEB)

    Artamonov, A.V.; Bassalleck, B.; Bhuyan, B.; Blackmore, E.W.; Bryman, D.A.; Chen, S.; Chiang, I.-H.; Christidi, I.-A.; Cooper, P.S.; Diwan, M.V.; Frank, J.S.; Fujiwara,; Hu, J.; Jaffe, D.E.; Kabe, S.; Kettell, S.H.; Khabibullin, M.M.; Khotjantsev, A.N.; Kitching, P.; Kobayashi, M.; Komatsubara, T.K.; /Serpukhov, IHEP /New Mexico U. /Brookhaven

    2005-05-01

    We have searched for the K{sup +} {yields} {pi}{sup +}{gamma}{gamma} decay in the kinematic region with {pi}{sup +} momentum close to the end point. No events were observed, and the 90% confidence-level upper limit on the partial branching ratio was obtained, B(K{sup +} {yields} {pi}{sup +}{gamma}{gamma}, P > 213 MeV/c) < 8.3 x 10{sup -9} under the assumption of chiral perturbation theory including next-to-leading order ''unitarity'' corrections. The same data were used to determine an upper limit on the K{sup +} {yields} {pi}{sup +}{gamma} branching ratio of 2.3 x 10{sup -9} at the 90% confidence level.

  11. Geothermal flux and basal melt rate in the Dome C region inferred from radar reflectivity and heat modelling

    Directory of Open Access Journals (Sweden)

    O. Passalacqua

    2017-09-01

    Full Text Available Basal melt rate is the most important physical quantity to be evaluated when looking for an old-ice drilling site, and it depends to a great extent on the geothermal flux (GF, which is poorly known under the East Antarctic ice sheet. Given that wet bedrock has higher reflectivity than dry bedrock, the wetness of the ice–bed interface can be assessed using radar echoes from the bedrock. But, since basal conditions depend on heat transfer forced by climate but lagged by the thick ice, the basal ice may currently be frozen whereas in the past it was generally melting. For that reason, the risk of bias between present and past conditions has to be evaluated. The objective of this study is to assess which locations in the Dome C area could have been protected from basal melting at any time in the past, which requires evaluating GF. We used an inverse approach to retrieve GF from radar-inferred distribution of wet and dry beds. A 1-D heat model is run over the last 800 ka to constrain the value of GF by assessing a critical ice thickness, i.e. the minimum ice thickness that would allow the present local distribution of basal melting. A regional map of the GF was then inferred over a 80 km  ×  130 km area, with a N–S gradient and with values ranging from 48 to 60 mW m−2. The forward model was then emulated by a polynomial function to compute a time-averaged value of the spatially variable basal melt rate over the region. Three main subregions appear to be free of basal melting, two because of a thin overlying ice and one, north of Dome C, because of a low GF.

  12. Geothermal flux and basal melt rate in the Dome C region inferred from radar reflectivity and heat modelling

    Science.gov (United States)

    Passalacqua, Olivier; Ritz, Catherine; Parrenin, Frédéric; Urbini, Stefano; Frezzotti, Massimo

    2017-09-01

    Basal melt rate is the most important physical quantity to be evaluated when looking for an old-ice drilling site, and it depends to a great extent on the geothermal flux (GF), which is poorly known under the East Antarctic ice sheet. Given that wet bedrock has higher reflectivity than dry bedrock, the wetness of the ice-bed interface can be assessed using radar echoes from the bedrock. But, since basal conditions depend on heat transfer forced by climate but lagged by the thick ice, the basal ice may currently be frozen whereas in the past it was generally melting. For that reason, the risk of bias between present and past conditions has to be evaluated. The objective of this study is to assess which locations in the Dome C area could have been protected from basal melting at any time in the past, which requires evaluating GF. We used an inverse approach to retrieve GF from radar-inferred distribution of wet and dry beds. A 1-D heat model is run over the last 800 ka to constrain the value of GF by assessing a critical ice thickness, i.e. the minimum ice thickness that would allow the present local distribution of basal melting. A regional map of the GF was then inferred over a 80 km × 130 km area, with a N-S gradient and with values ranging from 48 to 60 mW m-2. The forward model was then emulated by a polynomial function to compute a time-averaged value of the spatially variable basal melt rate over the region. Three main subregions appear to be free of basal melting, two because of a thin overlying ice and one, north of Dome C, because of a low GF.

  13. Observation of immobile regions in natural rubber at ambient temperature by solid-state C-13 CP/MAS NMR spectroscopy

    DEFF Research Database (Denmark)

    Larsen, F.H.; Rasmussen, T.; Pedersen, Walther Batsberg

    1999-01-01

    Employing C-13 CP/MAS NMR spectroscopy, the existence of immobile regions in natural rubber (cis-1,4-polyisoprene) corresponding to a few percent of the monomer units has been detected at ambient temperature. For synthetic rubbers no immobile regions have been detected at all. Applying different ...... physical and chemical treatments to natural rubber it is shown that mastication, gamma-irradiation, and increasing the temperature, slightly above the ambient, reduce the amount of immobile regions. (C) 1999 Elsevier Science Ltd. All rights reserved.......Employing C-13 CP/MAS NMR spectroscopy, the existence of immobile regions in natural rubber (cis-1,4-polyisoprene) corresponding to a few percent of the monomer units has been detected at ambient temperature. For synthetic rubbers no immobile regions have been detected at all. Applying different...

  14. Seasonal contributions to size-resolved n-alkanes (C8-C40) in the Shanghai atmosphere from regional anthropogenic activities and terrestrial plant waxes.

    Science.gov (United States)

    Lyu, Yan; Xu, Tingting; Yang, Xin; Chen, Jianmin; Cheng, Tiantao; Li, Xiang

    2017-02-01

    Size-resolved aerosol samples from the Shanghai atmosphere were analyzed for normal alkanes (n-alkanes, C8-C40) by comprehensive two-dimensional gas chromatography-flame ionization detection and gas chromatography-triple quadruple mass spectroscopy to study their size distribution and contributions from potential regional sources based on a one-year (2012-2013) sampling campaign. The n-alkane concentrations ranged from 62.3 to 398.5ngm-3, with an annual average of 227.6ngm-3. Particle-associated n-alkanes exhibited a bimodal distribution with one peak in the accumulation-mode size range and the other in the coarse-mode size range. As the carbon number increased, the peak in the accumulation mode intensified and the peak in the coarse mode weakened, in accordance with variation of their corresponding volatilities. Source indices (carbon preference index, average chain length, odd-even carbon number preference, unresolved to resolved n-alkanes ratio, and plant wax n-alkanes ratio) indicated that the n-alkane source profile shifted from an anthropogenic-dominated pattern in winter and spring to a terrestrial plant wax-influenced pattern in summer and autumn. Further trajectory cluster analysis and potential source contribution function modeling showed that anthropogenic activities were mainly in the North China Plain and East China and that terrestrial plant waxes originated in Anhui, Zhejiang, and Jiangxi Provinces. The results of our study provide useful information for evaluating the influence of anthropogenic and biogenic activities on the atmospheric transport of important secondary organic aerosol precursors to megacities in East Asia. Copyright © 2016. Published by Elsevier B.V.

  15. C1-C2 alkyl aminiums in urban aerosols: Insights from ambient and fuel combustion emission measurements in the Yangtze River Delta region of China.

    Science.gov (United States)

    Shen, Wenchao; Ren, Lili; Zhao, Yi; Zhou, Luyu; Dai, Liang; Ge, Xinlei; Kong, Shaofei; Yan, Qin; Xu, Honghui; Jiang, Yujun; He, Jun; Chen, Mindong; Yu, Huan

    2017-11-01

    We measured low molar-mass alkyl aminiums (methylaminium, dimethylaminium, ethylaminium and diethylaminium) in urban aerosols in the Yangtze River Delta region of eastern China in August 2014 and from November 2015 to May 2016. After examining artifact formation on sample filters, methylaminium, dimethylaminium and ethylaminium concentrations were quantified. The three C1-C2 aminiums exhibited a unimodal size distribution that maximized between 0.56 and 1.0 μm. Their concentrations in PM2.5 were 5.7 ± 3.2 ng m-3, 7.9 ± 5.4 ng m-3 and 20.3 ± 16.6 ng m-3, respectively, with higher concentrations during the daytime and in warm seasons. On new particle growth days, amine uptake to particles larger than 56 nm was barely enhanced. The molar ratios of individual aminium/NH4+ in PM2.5 were on the order of 10-4 and 10-3. Aminiums were thus far less to out-compete ammonium (NH4+) in neutralizing acidic species in particle sizes down to 56 nm. Abundant nitrate (NO3-/SO42- molar ratio = ∼3) and its correlation to methylaminium and ethylaminium implied that nitrate might be more important aminium salt than sulfate in urban aerosols of this area. Direct measurement of particle-phase amine emission from coal and biomass burning showed that coal burning is an important atmospheric amine source, considering coal burning is top-ranked particulate matter source in China. Copyright © 2017 Elsevier Ltd. All rights reserved.

  16. The C-terminal region Mesd peptide mimics full-length Mesd and acts as an inhibitor of Wnt/β-catenin signaling in cancer cells.

    Directory of Open Access Journals (Sweden)

    Cuihong Lin

    Full Text Available While Mesd was discovered as a specialized molecular endoplasmic reticulum chaperone for the Wnt co-receptors LRP5 and LRP6, recombinant Mesd protein is able to bind to mature LRP5 and LRP6 on the cell surface and acts as a universal antagonist of LRP5/6 modulators. In our previous study, we found that the C-terminal region of Mesd, which is absent in sequences from invertebrates, is necessary and sufficient for binding to mature LRP6 on the cell surface. In the present studies, we further characterized the interaction between the C-terminal region Mesd peptide and LRP5/6. We found that Mesd C-terminal region-derived peptides block Mesd binding to LRP5 at the cell surface too. We also showed that there are two LRP5/6 binding sites within Mesd C-terminal region which contain several positively charged residues. Moreover, we demonstrated that the Mesd C-terminal region peptide, like the full-length Mesd protein, blocked Wnt 3A- and Rspodin1-induced Wnt/β-catenin signaling in LRP5- and LRP6- expressing cells, suppressed Wnt/β-catenin signaling in human breast HS578T cells and prostate cancer PC-3 cells, and inhibited cancer cell proliferation, although the full-length Mesd protein is more potent than its peptide. Finally, we found that treatment of the full-length Mesd protein and its C-terminal region peptide significantly increased chemotherapy agent Adriamycin-induced cytotoxicity in HS578T and PC-3 cells. Together, our results suggest that Mesd C-terminal region constitutes the major LRP5/6-binding domain, and that Mesd protein and its C-terminal region peptide have a potential therapeutic value in cancer.

  17. Molecular phylogeny of OVOL genes illustrates a conserved C2H2 zinc finger domain coupled by hypervariable unstructured regions.

    Directory of Open Access Journals (Sweden)

    Abhishek Kumar

    Full Text Available OVO-like proteins (OVOL are members of the zinc finger protein family and serve as transcription factors to regulate gene expression in various differentiation processes. Recent studies have shown that OVOL genes are involved in epithelial development and differentiation in a wide variety of organisms; yet there is a lack of comprehensive studies that describe OVOL proteins from an evolutionary perspective. Using comparative genomic analysis, we traced three different OVOL genes (OVOL1-3 in vertebrates. One gene, OVOL3, was duplicated during a whole-genome-duplication event in fish, but only the copy (OVOL3b was retained. From early-branching metazoa to humans, we found that a core domain, comprising a tetrad of C2H2 zinc fingers, is conserved. By domain comparison of the OVOL proteins, we found that they evolved in different metazoan lineages by attaching intrinsically-disordered (ID segments of N/C-terminal extensions of 100 to 1000 amino acids to this conserved core. These ID regions originated independently across different animal lineages giving rise to different types of OVOL genes over the course of metazoan evolution. We illustrated the molecular evolution of metazoan OVOL genes over a period of 700 million years (MY. This study both extends our current understanding of the structure/function relationship of metazoan OVOL genes, and assembles a good platform for further characterization of OVOL genes from diverged organisms.

  18. Synchrotron radiation in the interaction region for a Ring-Ring and Linac-Ring LHeC

    CERN Document Server

    Bernard, N; Thompson, L; Holzer, B; Tomas, R; Zimmermann, F; Klein, M; Kostka, P; Nagorny, B; Schneekloth, U

    2011-01-01

    The Large Hadron electron Collider (LHeC) aims at bringing hadron-lepton collisions to CERN with centre of mass energies in the TeV scale. The LHeC will utilise the existing LHC storage ring with the addition of a 60 GeV electron accelerator. The electron beam will be stored and accelerated in either a storage ring in the LHC tunnel (Ring-Ring) or a linac tangent to the LHC tunnel (Linac- Ring). Synchrotron Radiation (SR) in the Interaction Region (IR) of this machine requires an iterative design process in which luminosity is optimised while the SR is minimised. This process also requires attention to be given to the detector as the beam pipe must be designed such that disturbing effects, such as out-gassing and background scattering, are minimised while the tracker remains close to the IP thus maximising the acceptance of the experiment. The machinery of GEANT4 has been used to simulate the SR load in the IR and also to design absorbers/masks to shield SR from backscattering into the detector or propagating...

  19. Identification of a key recombinant narrows the CADASIL gene region to 8 cM and argues against allelism of CADASIL and familial hemiplegic migraine

    Energy Technology Data Exchange (ETDEWEB)

    Dichgans, M.; Mayer, M.; Straube, A. [Univ. of Munich (Germany)] [and others

    1996-02-15

    This article reports on new information regarding the genetic mapping of the human CADASIL gene region. Previously, the gene had been mapped to human chromosome 19q12. Using the identification of a chromosomal crossover, the region has been refined to an 8-cM interval. 11 refs., 2 figs., 1 tab.

  20. Compromiso cívico y participación ciudadana en México: una perspectiva nacional y regional

    Directory of Open Access Journals (Sweden)

    Víctor Alejandro ESPINOZA VALLE

    2008-12-01

    Full Text Available RESUMEN: La transición a la democracia en México no conoció rupturas ni pactos fundacionales, siendo conducida por una serie de reformas electorales. El sistema de partido hegemónico privilegió el intercambio corporativo entre gobierno y sociedad, lo que se tradujo en un histórico retraimiento de la participación ciudadana. La cultura política nacional evidencia un déficit en el compromiso cívico y en la participación electoral. En este trabajo se analizan los resultados de tres encuestas de cultura política aplicadas en 2001, 2003 y 2005 y que nos permiten avanzar en el entendimiento de las formas de participación y pertenencia ciudadana. La información posibilita desarrollar un análisis nacional y regional que muestra que la cultura cívica no sigue patrones homogéneos. Para lograr valorar en su justa dimensión el compromiso cívico y su traducción en participación plural, elementos básicos para avanzar en la dirección de la consolidación de la democracia mexicana, se requiere estudiar lo que sucede en las diferentes realidades estatales o locales.ABSTRACT: Mexico's transition to democracy did not experience a political crisis or was not a result of founding compromises. Its path was paved by a series of electoral reforms. The dominant party system gave preference to a corporativist exchange between government and society, a practice which explains the historical aloofness of citizen political participation. The national political culture reflects a deficit of civic responsibility and electoral participation. This study analyzes the results of three political culture surveys undertaken in the years 2001, 2003 and 2005. These surveys give us a better understanding of the various ways in which citizens belong to and participate in community and political organizations. The data facilitates a regional and national analysis which shows that the civic culture does not have homogeneous patterns throughout Mexico. In order to

  1. Compromiso cívico y participación ciudadana en México: una perspectiva nacional y regional

    Directory of Open Access Journals (Sweden)

    Víctor Alejandro ESPINOZA VALLE

    2008-11-01

    Full Text Available RESUMEN: La transición a la democracia en México no conoció rupturas ni pactos fundacionales, siendo conducida por una serie de reformas electorales. El sistema de partido hegemónico privilegió el intercambio corporativo entre gobierno y sociedad, lo que se tradujo en un histórico retraimiento de la participación ciudadana. La cultura política nacional evidencia un déficit en el compromiso cívico y en la participación electoral. En este trabajo se analizan los resultados de tres encuestas de cultura política aplicadas en 2001, 2003 y 2005 y que nos permiten avanzar en el entendimiento de las formas de participación y pertenencia ciudadana. La información posibilita desarrollar un análisis nacional y regional que muestra que la cultura cívica no sigue patrones homogéneos. Para lograr valorar en su justa dimensión el compromiso cívico y su traducción en participación plural, elementos básicos para avanzar en la dirección de la consolidación de la democracia mexicana, se requiere estudiar lo que sucede en las diferentes realidades estatales o locales.ABSTRACT: Mexico's transition to democracy did not experience a political crisis or was not a result of founding compromises. Its path was paved by a series of electoral reforms. The dominant party system gave preference to a corporativist exchange between government and society, a practice which explains the historical aloofness of citizen political participation. The national political culture reflects a deficit of civic responsibility and electoral participation. This study analyzes the results of three political culture surveys undertaken in the years 2001, 2003 and 2005. These surveys give us a better understanding of the various ways in which citizens belong to and participate in community and political organizations. The data facilitates a regional and national analysis which shows that the civic culture does not have homogeneous patterns throughout Mexico. In order to

  2. Brain Regional α-[11C]Methyl-L-Tryptophan Trapping in Medication-Free Patients With Obsessive-Compulsive Disorder

    Science.gov (United States)

    Berney, Alexandre; Leyton, Marco; Gravel, Paul; Sibon, Igor; Sookman, Debbie; Neto, Pedro Rosa; Diksic, Mirko; Nakai, Akio; Pinard, Gilbert; Todorov, Christo; Okazawa, Hidehiko; Blier, Pierre; Nordahl, Thomas Edward; Benkelfat, Chawki

    2013-01-01

    Context The hypothesis of a serotonin (5-hydroxytryptamine [5-HT]) dysfunction in obsessive-compulsive disorder (OCD) stems largely from the clinical efficacy of 5-HT reuptake inhibitors. Serotonergic abnormalities in the unmedicated symptomatic state, however, remain to be fully characterized. Objective To investigate brain regional 5-HT synthesis, as indexed by positron emission tomography and the α-[11C]methyl-L-tryptophan trapping constant (K*), in treatment-free adults meeting criteria for OCD. Design Between-group comparison. Setting Department of Psychiatry and Montreal Neurological Institute, McGill University, and Department of Psychology, McGill University Health Centre, Quebec, Canada. Participants Twenty-one medication-free patients with OCD (15 men with a mean [SD] age of 33.2 [9.3] years and 6 women with a mean [SD] age of 35.8 [7.1] years) and 21 healthy controls matched for age and sex (15 men with a mean [SD] age of 32.9 [10.1] years and 6 women with a mean [SD] age of 36.5.5 [8.6] years). Main Outcome Measure The α-[11C]methyl-L-tryptophan brain trapping constant K*, which was analyzed with Statistical Parametric Mapping (SPM8) and with proportional normalization (extent threshold of 100 voxels with a peak threshold of P≤.005). Results Compared with healthy controls, the patients with OCD exhibited significantly greater α-[11C]methyl-L-tryptophan trapping in the right hippocampus and left temporal gyrus (Brodmann area 20). In the larger sub-sample of all men, these same differences were also evident, as well as higher K* values in the caudate nucleus. Individual differences in symptom severity correlated positively with K* values sampled from the caudate and temporal lobe of the patients with OCD, respectively. There were no regions where the patients exhibited abnormally low K* values. Volumetric analyses found no morphometric alterations that would account for the group differences. Conclusion The results support previous reports of greater

  3. Regional assimilation of CO2 and δ13C surface data to assess terrestrial biosphere models under drought stress

    Science.gov (United States)

    van der Velde, I. R.; Miller, J. B.; Alden, C. B.; Andrews, A. E.; Schaefer, K. M.; Peters, W.; Tans, P. P.; Vaughn, B. H.; White, J. W. C.

    2016-12-01

    Observed atmospheric carbon dioxide (CO2) and the ratios of its stable isotopologue 13CO2/12CO2 (δ13C) contain unique signals of large-scale drought stress that affect the biosphere. When plants experience physiological stress due to heat and drought at leaf level they respond by closing their stomata. This is a safety mechanism that prevents excessive water loss at the expense of carbon uptake, and it changes the overall water-use efficiency. During photosynthesis, 12CO2 is preferentially assimilated over 13CO2, leaving the atmosphere enriched in 13CO2. Water stress slightly changes the ratio of 13CO2 and 12CO2 molecules being removed from the atmosphere, i.e., a reduction of canopy isotope discrimination (Δ), and its changes are evident in atmospheric δ13C.To improve our understanding of the coupled vegetation-atmosphere system we are developing an ensemble Kalman filter assimilation of high precision measurements of CO2 and δ13C from air samples collected over North America. It uses footprints provided by WRF-STILT that allows for efficient atmospheric transport simulations on a much higher horizontal resolution than with a global Eulerian transport model. To force consistency with atmospheric CO2 and δ13C observations we will optimize regional net terrestrial CO2 exchange (NEE) and Δ from a terrestrial biosphere model. We will carefully evaluate the sensitivity of the optimized parameters to uncertainties in the terrestrial biosphere fluxes, observations, time/space aggregation methods, and boundary conditions. Our main questions are: (i) what signal-to-noise in the data, as interpreted by the model, is large enough to robustly estimate Δ and NEE? and (ii) how do the optimized NEE and Δ that are based on the atmospheric constraint compare with the predicted NEE and Δ that are based on biophysical parameterizations? Our ability to accurately predict the responses of the terrestrial biosphere to changing humidity and soil moisture regimes is currently

  4. BENZO[A]PYRENE AND ITS K-REGION DIOL INDUCE DNA DAMAGE IN C3H10T1/2C18 CELLS AS MEASURED BY THE ALKALINE SINGLE CELL GEL (COMET) ASSAY

    Science.gov (United States)

    160. Benzo[a]pyrene and its K-region diol induce DNA damage in C3HlOTl/2Cl8 cells as measured by the alkaline single cell gel (Comet) assay In a continuing series of studies on the genotoxicity ofK-region dihydrodiols of polycyclic aromatic hydrocarbons, we have repo...

  5. 3-D modelling and analysis of Dst C-responses in the North Pacific Ocean region, revisited

    Science.gov (United States)

    Kuvshinov, Alexei; Utada, Hisashi; Avdeev, Dmitry; Koyama, Takao

    2005-02-01

    During the last decade a number of one-dimensional (1-D) conductivity profiles have been constructed for the upper and mid-mantle of the North Pacific Ocean region. These profiles differ significantly, and from our point of view it is still unclear which profile is the best candidate for the upper and mid-mantle conductivity reference model for this region. Keeping the differences in mind, and inspired by recent findings that the ocean effect is a major contributor to the anomalous behaviour of C-responses up to the period of 20 days (especially at coastal observatories), the goal of this paper has been three-fold: (1) to understand, on the basis of systematic model studies using 3-D ocean models, which of the published 1-D upper and mid-mantle profiles is in best agreement with the available observations. (2) To try to reduce the misfit between the observed and modelled responses by using dense grids in modelling, by considering 3-D models which include not only an inhomogeneous surface layer but also inhomogeneous deeper structures. (3) To derive an alternative 1-D upper and mid-mantle section for the North Pacific Ocean by carefully selecting the data for interpretation and by using 3-D models that are as realistic and detailed as possible. In order to perform the simulations using realistic 3-D models on a routine basis a novel 3-D `spherical' forward solution has been elaborated in this paper. The solution combines the modified iterative-dissipative method with a conjugate gradient iteration and allows one to compute efficiently the electromagnetic fields in full 3-D spherical models with very high lateral contrasts of conductivity and for very dense grids. During the 3-D simulations a systematic shift of observed C-responses at Honolulu compared with those at other observatories was detected. The reason for this shift is still unclear. Even if a very detailed grid of 0.3°× 0.3° is used, the 3-D simulations using a model of the inhomogeneous surface has no

  6. Regional interaction between myocardial sympathetic denervation, contractile dysfunction, and fibrosis in heart failure with preserved ejection fraction: {sup 11}C-hydroxyephedrine PET study

    Energy Technology Data Exchange (ETDEWEB)

    Aikawa, Tadao; Naya, Masanao; Obara, Masahiko [Hokkaido University, Department of Cardiovascular Medicine, Faculty of Medicine and Graduate School of Medicine, Sapporo (Japan); Oyama-Manabe, Noriko [Hokkaido University Hospital, Department of Diagnostic and Interventional Radiology, Sapporo (Japan); Manabe, Osamu [Hokkaido University, Department of Nuclear Medicine, Faculty of Medicine and Graduate School of Medicine, Sapporo (Japan); Magota, Keiichi [Hokkaido University Hospital, Division of Medical Imaging and Technology, Sapporo (Japan); Ito, Yoichi M. [Hokkaido University, Department of Biostatistics, Faculty of Medicine and Graduate School of Medicine, Sapporo (Japan); Katoh, Chietsugu [Hokkaido University, Department of Biomedical Science and Engineering, Faculty of Health Sciences, Sapporo (Japan); Tamaki, Nagara [Kyoto Prefectural University of Medicine, Department of Radiology, Kyoto (Japan)

    2017-10-15

    This investigation aimed to identify significant predictors of regional sympathetic denervation quantified by {sup 11}C-hydroxyephedrine (HED) positron emission tomography (PET) in patients with heart failure with preserved left ventricular ejection fraction (HFpEF). Included in the study were 34 patients (age 63 ± 15 years, 23 men) with HFpEF (left ventricular ejection fraction ≥40%) and 11 age-matched volunteers without heart failure. Cardiac magnetic resonance imaging was performed to measure left ventricular size and function, and the extent of myocardial late gadolinium enhancement (LGE). {sup 11}C-HED PET was performed to quantify myocardial sympathetic innervation that was expressed as a {sup 11}C-HED retention index (RI, %/min). To identify predictors of regional {sup 11}C-HED RI in HFpEF patients, we propose a multivariate mixed-effects model for repeated measures over segments with an unstructured covariance matrix. Global {sup 11}C-HED RI was significantly lower and more heterogeneous in HFpEF patients than in volunteers (P < 0.01 for all). Regional {sup 11}C-HED RI was correlated positively with systolic wall thickening (r = 0.42, P < 0.001) and negatively with the extent of LGE (r = -0.43, P < 0.001). Segments in HFpEF patients with a large extent of LGE had the lowest regional {sup 11}C-HED RI among all segments (P < 0.001 in post hoc tests). Multivariate analysis demonstrated that systolic wall thickening and the extent of LGE were significant predictors of regional {sup 11}C-HED RI in HFpEF patients (both P ≤ 0.001). Regional sympathetic denervation was associated with contractile dysfunction and fibrotic burden in HFpEF patients, suggesting that regional sympathetic denervation may provide an integrated measure of myocardial damage in HFpEF. (orig.)

  7. Structural and dynamic properties of the C-terminal region of the Escherichia coli RNA chaperone Hfq: integrative experimental and computational studies.

    Science.gov (United States)

    Wen, Bin; Wang, Weiwei; Zhang, Jiahai; Gong, Qingguo; Shi, Yunyu; Wu, Jihui; Zhang, Zhiyong

    2017-08-09

    In Escherichia coli, hexameric Hfq is an important RNA chaperone that facilitates small RNA-mediated post-transcriptional regulation. The Hfq monomer consists of an evolutionarily conserved Sm domain (residues 1-65) and a flexible C-terminal region (residues 66-102). It has been recognized that the existence of the C-terminal region is important for the function of Hfq, but its detailed structural and dynamic properties remain elusive due to its disordered nature. In this work, using integrative experimental techniques, such as nuclear magnetic resonance spectroscopy and small-angle X-ray scattering, as well as multi-scale computational simulations, new insights into the structure and dynamics of the C-terminal region in the context of the Hfq hexamer are provided. Although the C-terminal region is intrinsically disordered, some residues (83-86) are motionally restricted. The hexameric core may affect the secondary structure propensity of the C-terminal region, due to transient interactions between them. The residues at the rim and the proximal side of the core have significantly more transient contacts with the C-terminal region than those residues at the distal side, which may facilitate the function of the C-terminal region in the release of double-stranded RNAs and the cycling of small non-coding RNAs. Structure ensembles constructed by fitting the experimental data also support that the C-terminal region prefers to locate at the proximal side. From multi-scale simulations, we propose that the C-terminal region may play a dual role of steric effect (especially at the proximal side) and recruitment (at the both sides) in the binding process of RNA substrates. Interestingly, we have found that these motionally restricted residues may serve as important binding sites for the incoming RNAs that is probably driven by favorable electrostatic interactions. These integrative studies may aid in our understanding of the functional role of the C-terminal region of Hfq.

  8. Improvement of Current Gain in Triple Ion Implanted 4H-SiC Bipolar Junction Transistor with Etched Extrinsic Base Regions

    Science.gov (United States)

    Tajima, Taku; Nakamura, Tadashi; Satoh, Masataka; Nakamura, Tohru

    We demonstrate triple ion implanted 4H-SiC bipolar junction transistor (BJT). By etching the extrinsic base regions using inductively coupled plasma dry etching, the characteristics of triple ion implanted 4H-SiC BJT were significantly improved. Maximum common emitter current gain was improved from 1.7 to 7.5.

  9. The evolution of sex ratio distorter suppression affects a 25 cM genomic region in the butterfly Hypolimnas bolina.

    Directory of Open Access Journals (Sweden)

    Emily A Hornett

    2014-12-01

    Full Text Available Symbionts that distort their host's sex ratio by favouring the production and survival of females are common in arthropods. Their presence produces intense Fisherian selection to return the sex ratio to parity, typified by the rapid spread of host 'suppressor' loci that restore male survival/development. In this study, we investigated the genomic impact of a selective event of this kind in the butterfly Hypolimnas bolina. Through linkage mapping, we first identified a genomic region that was necessary for males to survive Wolbachia-induced male-killing. We then investigated the genomic impact of the rapid spread of suppression, which converted the Samoan population of this butterfly from a 100:1 female-biased sex ratio in 2001 to a 1:1 sex ratio by 2006. Models of this process revealed the potential for a chromosome-wide effect. To measure the impact of this episode of selection directly, the pattern of genetic variation before and after the spread of suppression was compared. Changes in allele frequencies were observed over a 25 cM region surrounding the suppressor locus, with a reduction in overall diversity observed at loci that co-segregate with the suppressor. These changes exceeded those expected from drift and occurred alongside the generation of linkage disequilibrium. The presence of novel allelic variants in 2006 suggests that the suppressor was likely to have been introduced via immigration rather than through de novo mutation. In addition, further sampling in 2010 indicated that many of the introduced variants were lost or had declined in frequency since 2006. We hypothesize that this loss may have resulted from a period of purifying selection, removing deleterious material that introgressed during the initial sweep. Our observations of the impact of suppression of sex ratio distorting activity reveal a very wide genomic imprint, reflecting its status as one of the strongest selective forces in nature.

  10. The evolution of sex ratio distorter suppression affects a 25 cM genomic region in the butterfly Hypolimnas bolina.

    Science.gov (United States)

    Hornett, Emily A; Moran, Bruce; Reynolds, Louise A; Charlat, Sylvain; Tazzyman, Samuel; Wedell, Nina; Jiggins, Chris D; Hurst, Greg D D

    2014-12-01

    Symbionts that distort their host's sex ratio by favouring the production and survival of females are common in arthropods. Their presence produces intense Fisherian selection to return the sex ratio to parity, typified by the rapid spread of host 'suppressor' loci that restore male survival/development. In this study, we investigated the genomic impact of a selective event of this kind in the butterfly Hypolimnas bolina. Through linkage mapping, we first identified a genomic region that was necessary for males to survive Wolbachia-induced male-killing. We then investigated the genomic impact of the rapid spread of suppression, which converted the Samoan population of this butterfly from a 100:1 female-biased sex ratio in 2001 to a 1:1 sex ratio by 2006. Models of this process revealed the potential for a chromosome-wide effect. To measure the impact of this episode of selection directly, the pattern of genetic variation before and after the spread of suppression was compared. Changes in allele frequencies were observed over a 25 cM region surrounding the suppressor locus, with a reduction in overall diversity observed at loci that co-segregate with the suppressor. These changes exceeded those expected from drift and occurred alongside the generation of linkage disequilibrium. The presence of novel allelic variants in 2006 suggests that the suppressor was likely to have been introduced via immigration rather than through de novo mutation. In addition, further sampling in 2010 indicated that many of the introduced variants were lost or had declined in frequency since 2006. We hypothesize that this loss may have resulted from a period of purifying selection, removing deleterious material that introgressed during the initial sweep. Our observations of the impact of suppression of sex ratio distorting activity reveal a very wide genomic imprint, reflecting its status as one of the strongest selective forces in nature.

  11. In Silico Design and Experimental Validation of siRNAs Targeting Conserved Regions of Multiple Hepatitis C Virus Genotypes.

    Science.gov (United States)

    ElHefnawi, Mahmoud; Kim, TaeKyu; Kamar, Mona A; Min, Saehong; Hassan, Nafisa M; El-Ahwany, Eman; Kim, Heeyoung; Zada, Suher; Amer, Marwa; Windisch, Marc P

    2016-01-01

    RNA interference (RNAi) is a post-transcriptional gene silencing mechanism that mediates the sequence-specific degradation of targeted RNA and thus provides a tremendous opportunity for development of oligonucleotide-based drugs. Here, we report on the design and validation of small interfering RNAs (siRNAs) targeting highly conserved regions of the hepatitis C virus (HCV) genome. To aim for therapeutic applications by optimizing the RNAi efficacy and reducing potential side effects, we considered different factors such as target RNA variations, thermodynamics and accessibility of the siRNA and target RNA, and off-target effects. This aim was achieved using an in silico design and selection protocol complemented by an automated MysiRNA-Designer pipeline. The protocol included the design and filtration of siRNAs targeting highly conserved and accessible regions within the HCV internal ribosome entry site, and adjacent core sequences of the viral genome with high-ranking efficacy scores. Off-target analysis excluded siRNAs with potential binding to human mRNAs. Under this strict selection process, two siRNAs (HCV353 and HCV258) were selected based on their predicted high specificity and potency. These siRNAs were tested for antiviral efficacy in HCV genotype 1 and 2 replicon cell lines. Both in silico-designed siRNAs efficiently inhibited HCV RNA replication, even at low concentrations and for short exposure times (24h); they also exceeded the antiviral potencies of reference siRNAs targeting HCV. Furthermore, HCV353 and HCV258 siRNAs also inhibited replication of patient-derived HCV genotype 4 isolates in infected Huh-7 cells. Prolonged treatment of HCV replicon cells with HCV353 did not result in the appearance of escape mutant viruses. Taken together, these results reveal the accuracy and strength of our integrated siRNA design and selection protocols. These protocols could be used to design highly potent and specific RNAi-based therapeutic oligonucleotide

  12. A variant of the bovine noradrenaline transporter reveals the importance of the C-terminal region for correct targeting to the membrane and functional expression.

    OpenAIRE

    Burton, L D; Kippenberger, A G; Van Lingen, B.; Brüss, M; Bönisch, H.; Christie, D L

    1998-01-01

    We have characterized a cDNA clone which encodes a variant (bNAT2) of the bovine noradrenaline transporter. This cDNA differs from the previously identified bovine noradrenaline transporter (bNAT1) in the sequence encoding part of the cytoplasmic-facing C-terminus and the 3'-untranslated region. The bNAT1 and bNAT2 cDNA clones are encoded by a 5.8 and 3.6 kb mRNA species respectively. The bNAT1 and bNAT2 proteins, which are identical apart from their C-terminal 31 and 18 residues, were stably...

  13. The C-terminal Region and SUMOylation of Cockayne Syndrome Group B Protein Play Critical Roles in Transcription-coupled Nucleotide Excision Repair.

    Science.gov (United States)

    Sin, Yooksil; Tanaka, Kiyoji; Saijo, Masafumi

    2016-01-15

    Cockayne syndrome (CS) is a recessive disorder that results in deficiencies in transcription-coupled nucleotide excision repair (TC-NER), a subpathway of nucleotide excision repair, and cells from CS patients exhibit hypersensitivity to UV light. CS group B protein (CSB), which is the gene product of one of the genes responsible for CS, belongs to the SWI2/SNF2 DNA-dependent ATPase family and has an ATPase domain and an ubiquitin-binding domain (UBD) in the central region and the C-terminal region, respectively. The C-terminal region containing the UBD is essential for the functions of CSB. In this study, we generated several CSB deletion mutants and analyzed the functions of the C-terminal region of CSB in TC-NER. Not only the UBD but also the C-terminal 30-amino acid residues were required for UV light resistance and TC-NER. This region was needed for the interaction of CSB with RNA polymerase II, the translocation of CS group A protein to the nuclear matrix, and the association of CSB with chromatin after UV irradiation. CSB was modified by small ubiquitin-like modifier 2/3 in a UV light-dependent manner. This modification was abolished in a CSB mutant lacking the C-terminal 30 amino acid residues. However, the substitution of lysine residues in this region with arginine did not affect SUMOylation or TC-NER. By contrast, substitution of a lysine residue in the N-terminal region with arginine decreased SUMOylation and resulted in cells with defects in TC-NER. These results indicate that both the most C-terminal region and SUMOylation are important for the functions of CSB in TC-NER. © 2016 by The American Society for Biochemistry and Molecular Biology, Inc.

  14. The C-terminal Region and SUMOylation of Cockayne Syndrome Group B Protein Play Critical Roles in Transcription-coupled Nucleotide Excision Repair*

    Science.gov (United States)

    Sin, Yooksil; Tanaka, Kiyoji; Saijo, Masafumi

    2016-01-01

    Cockayne syndrome (CS) is a recessive disorder that results in deficiencies in transcription-coupled nucleotide excision repair (TC-NER), a subpathway of nucleotide excision repair, and cells from CS patients exhibit hypersensitivity to UV light. CS group B protein (CSB), which is the gene product of one of the genes responsible for CS, belongs to the SWI2/SNF2 DNA-dependent ATPase family and has an ATPase domain and an ubiquitin-binding domain (UBD) in the central region and the C-terminal region, respectively. The C-terminal region containing the UBD is essential for the functions of CSB. In this study, we generated several CSB deletion mutants and analyzed the functions of the C-terminal region of CSB in TC-NER. Not only the UBD but also the C-terminal 30-amino acid residues were required for UV light resistance and TC-NER. This region was needed for the interaction of CSB with RNA polymerase II, the translocation of CS group A protein to the nuclear matrix, and the association of CSB with chromatin after UV irradiation. CSB was modified by small ubiquitin-like modifier 2/3 in a UV light-dependent manner. This modification was abolished in a CSB mutant lacking the C-terminal 30 amino acid residues. However, the substitution of lysine residues in this region with arginine did not affect SUMOylation or TC-NER. By contrast, substitution of a lysine residue in the N-terminal region with arginine decreased SUMOylation and resulted in cells with defects in TC-NER. These results indicate that both the most C-terminal region and SUMOylation are important for the functions of CSB in TC-NER. PMID:26620705

  15. Identification of distinct nisin leader peptide regions that determine interactions with the modification enzymes NisB and NisC.

    Science.gov (United States)

    Khusainov, Rustem; Moll, Gert N; Kuipers, Oscar P

    2013-01-01

    Nisin is the most prominent and applied bacteriocin that serves as a model for class I lantibiotics. The nisin leader peptide importantly determines interactions between precursor nisin and its modification enzymes NisB and NisC that mature nisin posttranslationally. NisB dehydrates serines and threonines, while NisC catalyzes the subsequent coupling of the formed dehydroamino acids to form lanthionines. Currently, little is known about how the nisin leader interacts with NisB and even less is known about its interactions with NisC. To investigate the nisin leader peptide requirements for functional interaction with the modification enzymes NisB and NisC, we systematically replaced six regions, of 2-4 amino acids each, with all-alanine regions. By performing NisB and NisC co-purification studies with these mutant leader peptides, we demonstrate that the nisin leader regions STKD(-22-19), FNLD(-18-15) and PR(-2-1) importantly contribute to the interactions of precursor nisin with both NisB and NisC, whereas the nisin leader region LVSV(-14-11) additionally contributes to the interaction of precursor nisin with NisC.

  16. Effect of ischemic preconditioning on the expression of c-myb in the CA1 region of the gerbil hippocampus after ischemia/reperfusion injury.

    Science.gov (United States)

    Lee, Hui Young; Tae, Hyun-Jin; Cho, Geum-Sil; Kim, In Hye; Cho, Jeong Hwi; Park, Joon Ha; Ahn, Ji Hyeon; Chen, Bai Hui; Shin, Bich-Na; Won, Moo-Ho; Park, Chan Woo; Cho, Jun Hwi; Seo, Jeong Yeol; Lee, Jae-Chul

    2016-06-01

    In the present study, we investigated the effect of ischemic preconditioning (IPC) on c-myb immunoreactivity as well as neuronal damage/death after a subsequent lethal transient ischemia in gerbils. IPC was subjected to a 2 min sublethal ischemia and a lethal transient ischemia was given 5 min transient ischemia. The animals in all of the groups were given recovery times of 1 day, 2 days and 5 days and we examined change in c-myb immunoreactivity as well as neuronal damage/death in the hippocampus induced by a lethal transient ischemia. A lethal transient ischemia induced a significant loss of cells in the stratum pyramidale (SP) of the hippocampal CA1 region at 5 days post-ischemia, and this insult showed that c-myb immunoreactivity in cells of the SP of the CA1 region was significantly decreased at 2 days post-ischemia and disappeared at 5 days post-ischemia. However, IPC effectively prevented the neuronal loss in the SP and showed that c-myb immunoreactivity was constitutively maintained in the SP after a lethal transient ischemia. Our results show that a lethal transient ischemia significantly decreased c-myb immunoreactivity in the SP of the CA1 region and that IPC well preserved c-myb immunoreactivity in the SP of the CA1 region. We suggest that the maintenance of c-myb might be related with IPC-mediated neuroprotection after a lethal ischemic insult.

  17. Stable isotope (C, O, H) characteristics and genesis of the Tazheran brucite marbles and skarns, Olkhon region, Russia

    Science.gov (United States)

    Doroshkevich, Anna; Sklyarov, Eugene; Starikova, Anastasia; Vasiliev, Vladimir; Ripp, German; Izbrodin, Ivan; Posokhov, Viktor

    2017-06-01

    Stable isotope compositions are examined for brucite marble and Mg-skarn that occur in the southern part of the Tazheran massif, Olkhon region, Russia. Brucite marble exhibits a narrow range in δ18O of +23.3 to +26.2 ‰ and shows carbon isotope depletion of -1.9 to -4.4 ‰) as compared with the country dolomite isotope compositions (+2.0 to +2.4 ‰) which is explained by both decarbonation processes and participation of fluids depleted in 13C. The emplacement of brucite marble was accompanied by the formation of endo- and exoskarn at the contact between syenite and brucite marble. δ18O profiles across the contact show a typical decrease towards the syenite side interpreted as the result of fluid/rock interaction and influx of magmatic fluids. Finally, we discuss the mechanisms of brucite marble emplacement and consider three possible ways of producing these rocks: (1) injection of dolomite with subsequent transformation to periclase marble and then to brucite marble; (2) injection of periclase marble with a following replacement of periclase by brucite or injection of brucite marble; (3) crustal water-rich carbonate melt. We favor models 2 and 3 and discuss their strengths and weaknesses.

  18. Hypervariable region 1 differentially impacts viability of hepatitis C virus strains of genotypes 1 to 6 and impairs virus neutralization

    DEFF Research Database (Denmark)

    Prentoe, Jannick; Jensen, Tanja B; Meuleman, Philip

    2011-01-01

    Hypervariable region 1 (HVR1) of hepatitis C virus (HCV) E2 envelope glycoprotein has been implicated in virus neutralization and persistence. We deleted HVR1 from JFH1-based HCV recombinants expressing Core/E1/E2/p7/NS2 of genotypes 1 to 6, previously found to grow efficiently in human hepatoma...... Huh7.5 cells. The 2a(ΔHVR1), 5a(ΔHVR1), and 6a(ΔHVR1) Core-NS2 recombinants retained viability in Huh7.5 cells, whereas 1a(ΔHVR1), 1b(ΔHVR1), 2b(ΔHVR1), 3a(ΔHVR1), and 4a(ΔHVR1) recombinants were severely attenuated. However, except for recombinant 4a(ΔHVR1), viruses eventually spread, and reverse...... genetics studies revealed adaptive envelope mutations that rescued the infectivity of 1a(ΔHVR1), 1b(ΔHVR1), 2b(ΔHVR1), and 3a(ΔHVR1) recombinants. Thus, HVR1 might have distinct functional roles for different HCV isolates. Ultracentrifugation studies showed that deletion of HVR1 did not alter HCV RNA...

  19. Hypervariable Region 1 Shielding of Hepatitis C Virus Is a Main Contributor to Genotypic Differences in Neutralization Sensitivity

    DEFF Research Database (Denmark)

    Prentoe, Jannick; Velazquez-Moctezuma, Rodrigo; Foung, Steven K. H.

    2016-01-01

    There are 3-4 million new hepatitis C virus (HCV) infections yearly. The extensive intergenotypic sequence diversity of envelope proteins E1 and E2 of HCV and shielding of important epitopes by hypervariable region 1 (HVR1) of E2 are believed to be major hindrances to developing universally...... protective HCV vaccines. Using cultured viruses expressing the E1/E2 complex of isolates H77 (genotype 1a), J6 (2a), or S52 (3a), with and without HVR1, we tested HVR1-mediated neutralization occlusion in vitro against a panel of 12 well-characterized human monoclonal antibodies (HMAbs) targeting diverse E1......a, 2b, 3a, 5a, and 6a, although for all HMAbs, except AR4A, an outlier was observed. Finally, unique amino acid residues in HCV E2 could explain these outliers in the tested cases of AR5A and HC84.26. Conclusion: HVR1 adds complexity to HCV neutralization by shielding a diverse array of unexpectedly...

  20. Hypervariable region 1 differentially impacts viability of hepatitis C virus strains of genotypes 1 to 6 and impairs virus neutralization

    DEFF Research Database (Denmark)

    Prentø, Jannick Cornelius; Jensen, Tanja Bertelsen; Meuleman, Philip

    2011-01-01

    Hypervariable region 1 (HVR1) of hepatitis C virus (HCV) E2 envelope glycoprotein has been implicated in virus neutralization and persistence. We deleted HVR1 from JFH1-based HCV recombinants expressing Core/E1/E2/p7/NS2 of genotypes 1 to 6, previously found to grow efficiently in human hepatoma...... Huh7.5 cells. The 2a(¿HVR1), 5a(¿HVR1), and 6a(¿HVR1) Core-NS2 recombinants retained viability in Huh7.5 cells, whereas 1a(¿HVR1), 1b(¿HVR1), 2b(¿HVR1), 3a(¿HVR1), and 4a(¿HVR1) recombinants were severely attenuated. However, except for recombinant 4a(¿HVR1), viruses eventually spread, and reverse...... genetics studies revealed adaptive envelope mutations that rescued the infectivity of 1a(¿HVR1), 1b(¿HVR1), 2b(¿HVR1), and 3a(¿HVR1) recombinants. Thus, HVR1 might have distinct functional roles for different HCV isolates. Ultracentrifugation studies showed that deletion of HVR1 did not alter HCV RNA...

  1. Spreading of hepatitis C virus subtypes 1a and 1b through the central region of Argentina.

    Science.gov (United States)

    Culasso, Andrés Carlos Alberto; Farías, Adrián; Di Lello, Federico Alejandro; Golemba, Marcelo Darío; Ré, Viviana; Barbini, Luciana; Campos, Rodolfo

    2014-08-01

    The recent history of the hepatitis C virus (HCV) subtypes 1a and 1b in the central region of Argentina is hypothesized by phylogeographic reconstruction using coalescent based Bayesian analyses. Direct partial E2 sequences from HCV 1a and 1b infected patients attending different health-care centers of the country were analyzed. The inferred date of the most recent common ancestor (tMRCA) for HCV-1a was: 1962 (between 1943 and 1977) and for HCV-1b was earlier: 1929 (between 1895 and 1953). Diverse ancestral populations were inferred from both subtypes in Córdoba and in Buenos Aires cities and after that, HCV spread within and between larger cities and to other smaller cities. The analyses suggested that HCV-1b was dispersed first and it is currently in a stationary phase whereas HCV-1a was dispersed latter and it is still in a growth phase. Finally, as it was observed in the developed countries, while the transmission of HCV-1b appears to have been somehow prevented, the HCV-1a may still represent a concern in the public health. Further work should be carried out to address their current transmission rate (and its main transmission route) in the Argentinean population. Copyright © 2014 Elsevier B.V. All rights reserved.

  2. NODC Standard Product: C-CAP Coastal Change Analysis Project - St. Croix estuary region (1985 - 1992) (NODC Accession 0090142)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The Coastal Change Analysis Project St. Croix Estuary Region CD-ROM data set uses Landsat Thematic Mapper (TM) imagery from 1985 to 1992 to provide a regional change...

  3. Determination of Brain-Regional Blood Perfusion and Endogenous cPKCγ Impact on Ischemic Vulnerability of Mice with Global Ischemia.

    Science.gov (United States)

    Liu, Shuiqiao; Dai, Qingqing; Hua, Rongrong; Liu, Ting; Han, Song; Li, Shujuan; Li, Junfa

    2017-10-01

    Conventional protein kinase C (cPKC)γ participated in cerebral hypoxic preconditioning-induced neuroprotection and affected the neurological outcome of ischemic stroked mice. As an independent predictor of ischemic stroke, the internal carotid artery occlusion (ICAO)-caused brain-regional ischemic injury may worsen the neurological outcome of patients. However, the brain-regional ischemic vulnerability and its underlying mechanism remain unclear. In this study, the bilateral ICAO (BICAO) model was applied in cPKCγ wild type (WT) and knockout (KO) mice to determine the cPKCγ impact on brain-regional ischemic vulnerability. The arterial spin labeling (ASL) imaging results showed that 7 days BICAO-induced global ischemia could cause significant blood perfusion loss in prefrontal cortex (69.13%), striatum (61.69%), hypothalamus (67.36%), hippocampus (69.82%) and midbrain (40.53%) of WT mice, along with neurological deficits. Nissl staining and Western blot results indicated that hypothalamus and midbrain had more severe neural cell loss than prefrontal cortex, striatum and hippocampus, which negatively coincided with endogenous cPKCγ protein levels but not blood perfusion loss and cPKCγ membrane translocation levels. Furthermore, we found that cPKCγ KO significantly aggravated the neuron loss in prefrontal cortex, striatum and hippocampus and abolish the regional ischemic vulnerability by using immunofluorescent staining with neuron-specific marker NeuN. Similarly, cPKCγ KO also significantly increased Caspase-3, -8 and -9 cleavage levels in prefrontal cortex, striatum, hippocampus, hypothalamus and midbrain of mice with 24 h BICAO. These results suggested that hypothalamus and midbrain are more vulnerable to ischemia, and endogenous cPKCγ affects the regional ischemic vulnerability through modulating Caspase-8 and -9 dependent cell apoptosis.

  4. In Silico Design and Experimental Validation of siRNAs Targeting Conserved Regions of Multiple Hepatitis C Virus Genotypes.

    Directory of Open Access Journals (Sweden)

    Mahmoud ElHefnawi

    Full Text Available RNA interference (RNAi is a post-transcriptional gene silencing mechanism that mediates the sequence-specific degradation of targeted RNA and thus provides a tremendous opportunity for development of oligonucleotide-based drugs. Here, we report on the design and validation of small interfering RNAs (siRNAs targeting highly conserved regions of the hepatitis C virus (HCV genome. To aim for therapeutic applications by optimizing the RNAi efficacy and reducing potential side effects, we considered different factors such as target RNA variations, thermodynamics and accessibility of the siRNA and target RNA, and off-target effects. This aim was achieved using an in silico design and selection protocol complemented by an automated MysiRNA-Designer pipeline. The protocol included the design and filtration of siRNAs targeting highly conserved and accessible regions within the HCV internal ribosome entry site, and adjacent core sequences of the viral genome with high-ranking efficacy scores. Off-target analysis excluded siRNAs with potential binding to human mRNAs. Under this strict selection process, two siRNAs (HCV353 and HCV258 were selected based on their predicted high specificity and potency. These siRNAs were tested for antiviral efficacy in HCV genotype 1 and 2 replicon cell lines. Both in silico-designed siRNAs efficiently inhibited HCV RNA replication, even at low concentrations and for short exposure times (24h; they also exceeded the antiviral potencies of reference siRNAs targeting HCV. Furthermore, HCV353 and HCV258 siRNAs also inhibited replication of patient-derived HCV genotype 4 isolates in infected Huh-7 cells. Prolonged treatment of HCV replicon cells with HCV353 did not result in the appearance of escape mutant viruses. Taken together, these results reveal the accuracy and strength of our integrated siRNA design and selection protocols. These protocols could be used to design highly potent and specific RNAi-based therapeutic

  5. Hospital-visiting pregnant women signal an increased spread of hepatitis C infection in Khyber Pakhtunkhwa region of Pakistan.

    Science.gov (United States)

    Afsheen, Zobia; Ahmad, Bashir; Bashir, Shumaila

    2017-10-10

    Seroprevalence of hepatitis C in Khyber Pakhtunkhwa province of Pakistan was determined by screening blood samples of expectant mothers seeking antenatal care in gynecological units of district hospitals. The rationale behind this cohort study was that the availability of free-of-cost antenatal care in district hospitals brings expectant mothers from a broader geographical range in each district and thus provides a large sample-size of healthy pregnant women of known medical history for Hepatitis C Virus (HCV) surveillance. The study was carried out along a south west to north east transact of five districts, Kohat-Peshawar-Nowshera-Charsadda-Mardan, with the central district Peshawar and outer districts Kohat and Mardan bordering northern mountainous ranges of the Khyber Pakhtunkhwa province. This distribution of districts along the transact allowed the study to gauge the impact of proximity to remote highland communities on the HCV burden of visiting pregnant women tested for HCV infection. The cohort study randomly selected 150 pregnant women visiting each hospital for serological screening for Anti-HCV carried out by ELISA assay. The feasibility of ICT and RT-PCR assays for HCV prevalence was also examined in the present study. With a total of 750 blood specimen screened, the results of ELISA tests revealed a staggering 5.9% frequency of Anti-HCV in the five districts with the frequency of ELISA positive cases ranging from 3.3% in Nowshera, 4.7% in Charsadda, 6.0% in Peshawar, 6.7% in Kohat, and 8.7% in Mardan. The relatively higher frequencies of Anti-HCV cases among hospital visiting pregnant women in Peshawar, Kohat and Mardan were consistent with the proximity of these hospitals to the highland communities in the bordering mountain ranges. Compared to 44 Anti-HCV positive serologic specimens detected by ELISA, only 26 and 10 blood specimens were tested positive by ICT and PCR methods, respectively. Our study validates ELISA as a reliable diagnostic

  6. Differentiation of Candida glabrata, C. nivariensis and C. bracarensis based on fragment length polymorphism of ITS1 and ITS2 and restriction fragment length polymorphism of ITS and D1/D2 regions in rDNA

    DEFF Research Database (Denmark)

    Mirhendi, H; Bruun, B; Schønheyder, H C

    2011-01-01

    -ITS2 regions and in the D1/D2 domain of 26S rDNA using primers designed for this study. A total of 133 blood isolates previously identified as C. glabrata were examined by polymerase chain reaction-restriction fragment length polymorphism (PCR-RFLP) and the peptide nucleic acid-fluorescent in situ...... hybridization (PNA-FISH) method. The size of ITS1 allowed differentiation between C. glabrata (483), C. nivariensis (361) and C. bracarensis (385), whereas the ITS2 region was of similar size in C. nivariensis (417) and C. glabrata (418). Sequence analysis of the ITS region suggested that many restriction...... enzymes were suitable for RFLP differentiation of the species. Enzymatic digestion of the D1/D2 domain with TatI produced unique band sizes for each of the three species. PCR-RFLP and PNA-FISH were in agreement for all of the isolates tested. None of the 133 Danish blood isolates were C. nivariensis or C...

  7. Variety of genotypes of a HCV virus and outcomes of chronic hepatitis C: results 5 summer supervision in the territory of the Kirov region

    Directory of Open Access Journals (Sweden)

    S. V. Baramzina

    2013-01-01

    Full Text Available The analysis of the epidemiological situation in respect of chronic hepatitis C in the Russian Federation and the Kirov region for the period 1998–2012 yy. The data on the characteristics and frequency of outcomes of chronic hepatitis C, according to the 5-year observation of patients Kirov branch of viral hepatitis infectious diseases hospital. The results of genotyping HCV-virus in 730 patients with chronic hepatitis C in the dynamics from 2006–2010, and in comparison with other regions of Russia. Dominant in the region are the genotypes 1b and 3a, minor – 2 and 1a. During the analyzed period, there was a trend to a decrease in the proportion of genotypes 1b and 1a, and increase the proportion of subtype 3a and 2.

  8. Association Between Hepatitis C Virus Coinfection and Regional Adipose Tissue Volume in HIV-Infected Men and Women

    Science.gov (United States)

    Tien, Phyllis C.; Bacchetti, Peter; Gripshover, Barbara; Overton, E. Turner; Rimland, David; Kotler, Don

    2011-01-01

    Objective Coinfection with hepatitis C virus (HCV) is reported to be associated with a higher prevalence of lipodystrophy than HIV infection alone. We examine the association between HCV and adipose tissue volume in HIV-infected men and women. Methods Cross-sectional analysis of HIV-infected subjects from the study of Fat Redistribution and Metabolic Change in HIV Infection. MRI measured regional adipose tissue volume. Detectable HCV RNA defined HCV infection. Results Twenty percent of 792 men and 26% of 329 women were HIV/HCV-coinfected. HIV/HCV-coinfected and HIV-monoinfected women had similar amounts of subcutaneous adipose tissue (SAT) in the leg, lower trunk, upper trunk, and arm and similar amounts of visceral adipose tissue (VAT). Similar findings were seen in men, except in the leg and VAT. After adjustment, HCV infection remained associated with more leg fat in men (12.2%, 95% confidence interval [CI]: 0.3 to 25.3; P = 0.043). Among those on stavudine, HIV-monoinfected men had less leg fat (−7% effect per year of stavudine use, 95% CI: −9 to −5; P < 0.001); a weaker association was seen in HIV/HCV-coinfected men (−2% effect, 95% CI: −7 to 3; P = 0.45). Indinavir was associated with less leg fat (−4% in HIV-monoinfected men, 95% CI: −6 to −1; P = 0.002; −5% in HIV/HCV-coinfected men, 95% CI: −11 to 2; P = 0.14). Conclusions Our findings suggest that HIV/HCV coinfection is not associated with less SAT in men and women. HCV infection seems to mitigate the loss of leg fat seen in HIV-infected men on stavudine. PMID:17356466

  9. Deep sequencing of hepatitis C virus hypervariable region 1 reveals no correlation between genetic heterogeneity and antiviral treatment outcome.

    Science.gov (United States)

    Cortés, Kamila Caraballo; Zagordi, Osvaldo; Perlejewski, Karol; Laskus, Tomasz; Maroszek, Krzysztof; Bukowska-Ośko, Iwona; Pawełczyk, Agnieszka; Płoski, Rafał; Berak, Hanna; Horban, Andrzej; Radkowski, Marek

    2014-07-13

    Hypervariable region 1 (HVR1) contained within envelope protein 2 (E2) gene is the most variable part of HCV genome and its translation product is a major target for the host immune response. Variability within HVR1 may facilitate evasion of the immune response and could affect treatment outcome. The aim of the study was to analyze the impact of HVR1 heterogeneity employing sensitive ultra-deep sequencing, on the outcome of PEG-IFN-α (pegylated interferon α) and ribavirin treatment. HVR1 sequences were amplified from pretreatment serum samples of 25 patients infected with genotype 1b HCV (12 responders and 13 non-responders) and were subjected to pyrosequencing (GS Junior, 454/Roche). Reads were corrected for sequencing error using ShoRAH software, while population reconstruction was done using three different minimal variant frequency cut-offs of 1%, 2% and 5%. Statistical analysis was done using Mann-Whitney and Fisher's exact tests. Complexity, Shannon entropy, nucleotide diversity per site, genetic distance and the number of genetic substitutions were not significantly different between responders and non-responders, when analyzing viral populations at any of the three frequencies (≥1%, ≥2% and ≥5%). When clonal sample was used to determine pyrosequencing error, 4% of reads were found to be incorrect and the most abundant variant was present at a frequency of 1.48%. Use of ShoRAH reduced the sequencing error to 1%, with the most abundant erroneous variant present at frequency of 0.5%. While deep sequencing revealed complex genetic heterogeneity of HVR1 in chronic hepatitis C patients, there was no correlation between treatment outcome and any of the analyzed quasispecies parameters.

  10. The 5BSL3.2 Functional RNA Domain Connects Distant Regions in the Hepatitis C Virus Genome

    Directory of Open Access Journals (Sweden)

    Cristina Romero-López

    2017-10-01

    Full Text Available Viral genomes are complexly folded entities that carry all the information required for the infective cycle. The nucleotide sequence of the RNA virus genome encodes proteins and functional information contained in discrete, highly conserved structural units. These so-called functional RNA domains play essential roles in the progression of infection, which requires their preservation from one generation to the next. Numerous functional RNA domains exist in the genome of the hepatitis C virus (HCV. Among them, the 5BSL3.2 domain in the cis-acting replication element (CRE at the 3′ end of the viral open reading frame has become of particular interest given its role in HCV RNA replication and as a regulator of viral protein synthesis. These functionalities are achieved via the establishment of a complex network of long-distance RNA–RNA contacts involving (at least as known to date the highly conserved 3′X tail, the apical loop of domain IIId in the internal ribosome entry site, and/or the so-called Alt region upstream of the CRE. Changing contacts promotes the execution of different stages of the viral cycle. The 5BSL3.2 domain thus operates at the core of a system that governs the progression of HCV infection. This review summarizes our knowledge of the long-range RNA–RNA interaction network in the HCV genome, with special attention paid to the structural and functional consequences derived from the establishment of different contacts. The potential implications of such interactions in switching between the different stages of the viral cycle are discussed.

  11. C-N-P interactions control climate driven changes in regional patterns of C storage on the North Slope of Alaska

    Energy Technology Data Exchange (ETDEWEB)

    Jiang, Yueyang; Rocha, Adrian; Rastetter, Edward; Shaver, Gaius; Mishra, U.; Zhuang, Qianlai; Kwiatkowski, Bonnie

    2016-01-01

    As climate warms, changes in the carbon (C) balance of arctic tundra will play an important role in the global C balance. The C balance of tundra is tightly coupled to the nitrogen (N) and phosphorus (P) cycles because soil organic matter is the principal source of plant-available nutrients and determines the spatial variation of vegetation biomass across the North Slope of Alaska. Warming will accelerate these nutrient cycles, which should stimulate plant growth.

  12. The proline-histidine-rich CDK2/CDK4 interaction region of C/EBPalpha is dispensable for C/EBPalpha-mediated growth regulation in vivo

    DEFF Research Database (Denmark)

    Porse, Bo Torben; Pedersen, Thomas Askov; Hasemann, Marie Sigurd

    2006-01-01

    The C/EBPalpha transcription factor regulates growth and differentiation of several tissues during embryonic development. Several hypotheses as to how C/EBPalpha inhibits cellular growth in vivo have been derived, mainly from studies of tissue culture cells. In fetal liver it has been proposed th...... is dispensable for proper embryonic development of, and cell cycle control in, the liver. Surprisingly, control experiments performed in C/EBPalpha null fetal livers yielded similar results....

  13. Estimation of power dissipation of a 4H-SiC Schottky barrier diode with a linearly graded doping profile in the drift region

    Directory of Open Access Journals (Sweden)

    Rajneesh Talwar

    2009-09-01

    Full Text Available The aim of this paper is to establish the importance of a linearly graded profile in the drift region of a 4H-SiC Schottky barrier diode (SBD. The power dissipation of the device is found to be considerably lower at any given current density as compared to its value obtained for a uniformly doped drift region. The corresponding values of breakdown voltages obtained are similar to those obtained with uniformly doped wafers of 4H-SiC.

  14. Cyanobacterial ecotypes in different optical microenvironments of a 68 C hot spring mat community revealed by 16S-23S rRNA internal transcribed spacer region variation

    DEFF Research Database (Denmark)

    Ferris, Mike J.; Kühl, Michael; Wieland, Andrea

    2003-01-01

    We examined the population of unicellular cyanobacteria (Synechococcus) in the upper 3-mm vertical interval of a 68°C region of a microbial mat in a hot spring effluent channel (Yellowstone National Park, Wyoming). Fluorescence microscopy and microsensor measurements of O2 and oxygenic photosynth......We examined the population of unicellular cyanobacteria (Synechococcus) in the upper 3-mm vertical interval of a 68°C region of a microbial mat in a hot spring effluent channel (Yellowstone National Park, Wyoming). Fluorescence microscopy and microsensor measurements of O2 and oxygenic...

  15. Localization of a breast cancer tumour-suppressor gene to a 3-cM interval within chromosomal region 16q22.

    OpenAIRE

    Iida, A; Isobe, R.; Yoshimoto, M; Kasumi, F.; Nakamura, Y.; Emi, M

    1997-01-01

    Allelic losses on chromosome 16q in tumour cells are frequent in a variety of malignancies, suggesting the presence of one or more tumour-suppressor genes in the region. Among 210 sporadic breast cancers we examined using 15 microsatellite markers on the long arm of chromosome 16, heterozygosity for at least one locus was lost in 141 (67%). Detailed deletion mapping revealed two distinct commonly deleted regions. One region was defined as a 3-cM interval flanked by markers D16S512 and D16S515...

  16. CD45{sup low}c-Kit{sup high} cells have hematopoietic properties in the mouse aorta-gonad-mesonephros region

    Energy Technology Data Exchange (ETDEWEB)

    Nobuhisa, Ikuo, E-mail: nobuhisa.scr@mri.tmd.ac.jp [Department of Stem Cell Regulation, Medical Research Institute, Tokyo Medical and Dental University, 1-5-45 Yushima, Bunkyo-ku, Tokyo 113-8510 (Japan); Department of Cell Fate Modulation, Institute of Molecular Embryology and Genetics/Graduate School of Pharmaceutical Sciences, Kumamoto University, Kumamoto, 860-0811 (Japan); Yamasaki, Shoutarou [Department of Cell Fate Modulation, Institute of Molecular Embryology and Genetics/Graduate School of Pharmaceutical Sciences, Kumamoto University, Kumamoto, 860-0811 (Japan); Ramadan, Ahmed [Department of Stem Cell Regulation, Medical Research Institute, Tokyo Medical and Dental University, 1-5-45 Yushima, Bunkyo-ku, Tokyo 113-8510 (Japan); Department of Cell Fate Modulation, Institute of Molecular Embryology and Genetics/Graduate School of Pharmaceutical Sciences, Kumamoto University, Kumamoto, 860-0811 (Japan); Taga, Tetsuya, E-mail: taga.scr@mri.tmd.ac.jp [Department of Stem Cell Regulation, Medical Research Institute, Tokyo Medical and Dental University, 1-5-45 Yushima, Bunkyo-ku, Tokyo 113-8510 (Japan); Department of Cell Fate Modulation, Institute of Molecular Embryology and Genetics/Graduate School of Pharmaceutical Sciences, Kumamoto University, Kumamoto, 860-0811 (Japan)

    2012-04-01

    Long-term reconstituting hematopoietic stem cells first arise from the aorta of the aorta-gonad-mesonephros (AGM) region in a mouse embryo. We have previously reported that in cultures of the dispersed AGM region, CD45{sup low}c-Kit{sup +} cells possess the ability to reconstitute multilineage hematopoietic cells, but investigations are needed to show that this is not a cultured artifact and to clarify when and how this population is present. Based on the expression profile of CD45 and c-Kit in freshly dissociated AGM cells from embryonic day 9.5 (E9.5) to E12.5 and aorta cells in the AGM from E13.5 to E15.5, we defined six cell populations (CD45{sup -}c-Kit{sup -}, CD45{sup -}c-Kit{sup low}, CD45{sup -}c-Kit{sup high}, CD45{sup low}c-Kit{sup high}, CD45{sup high}c-Kit{sup high}, and CD45{sup high}c-Kit{sup very} {sup low}). Among these six populations, CD45{sup low}c-Kit{sup high} cells were most able to form hematopoietic cell colonies, but their ability decreased after E11.5 and was undetectable at E13.5 and later. The CD45{sup low}c-Kit{sup high} cells showed multipotency in vitro. We demonstrated further enrichment of hematopoietic activity in the Hoechst dye-effluxing side population among the CD45{sup low}c-Kit{sup high} cells. Here, we determined that CD45{sup low}c-Kit{sup high} cells arise from the lateral plate mesoderm using embryonic stem cell-derived differentiation system. In conclusion, CD45{sup low}c-Kit{sup high} cells are the major hematopoietic cells of mouse AGM.

  17. Brain Region-Specific Effects of cGMP-Dependent Kinase II Knockout on AMPA Receptor Trafficking and Animal Behavior

    Science.gov (United States)

    Kim, Seonil; Pick, Joseph E.; Abera, Sinedu; Khatri, Latika; Ferreira, Danielle D. P.; Sathler, Matheus F.; Morison, Sage L.; Hofmann, Franz; Ziff, Edward B.

    2016-01-01

    Phosphorylation of GluA1, a subunit of AMPA receptors (AMPARs), is critical for AMPAR synaptic trafficking and control of synaptic transmission. cGMP-dependent protein kinase II (cGKII) mediates this phosphorylation, and cGKII knockout (KO) affects GluA1 phosphorylation and alters animal behavior. Notably, GluA1 phosphorylation in the KO…

  18. Inappropriate Expression of an NLP Effector in Colletotrichum orbiculare Impairs Infection on Cucurbitaceae Cultivars via Plant Recognition of the C-Terminal Region.

    Science.gov (United States)

    Azmi, Nur Sabrina Ahmad; Singkaravanit-Ogawa, Suthitar; Ikeda, Kyoko; Kitakura, Saeko; Inoue, Yoshihiro; Narusaka, Yoshihiro; Shirasu, Ken; Kaido, Masanori; Mise, Kazuyuki; Takano, Yoshitaka

    2018-01-01

    The hemibiotrophic pathogen Colletotrichum orbiculare preferentially expresses a necrosis and ethylene-inducing peptide 1 (Nep1)-like protein named NLP1 during the switch to necrotrophy. Here, we report that the constitutive expression of NLP1 in C. orbiculare blocks pathogen infection in multiple Cucurbitaceae cultivars via their enhanced defense responses. NLP1 has a cytotoxic activity that induces cell death in Nicotiana benthamiana. However, C. orbiculare transgenic lines constitutively expressing a mutant NLP1 lacking the cytotoxic activity still failed to infect cucumber, indicating no clear relationship between cytotoxic activity and the NLP1-dependent enhanced defense. NLP1 also possesses the microbe-associated molecular pattern (MAMP) sequence called nlp24, recognized by Arabidopsis thaliana at its central region, similar to NLPs of other pathogens. Surprisingly, inappropriate expression of a mutant NLP1 lacking the MAMP signature is also effective for blocking pathogen infection, uncoupling the infection block from the corresponding MAMP. Notably, the deletion analyses of NLP1 suggested that the C-terminal region of NLP1 is critical to enhance defense in cucumber. The expression of mCherry fused with the C-terminal 32 amino acids of NLP1 was enough to trigger the defense of cucurbits, revealing that the C-terminal region of the NLP1 protein is recognized by cucurbits and, then, terminates C. orbiculare infection.

  19. Comparing fludeoxyglucose F18-PET assessment of regional cerebral glucose metabolism and [11C]dihydrotetrabenazine-PET in evaluation of early dementia and mild cognitive impairment.

    Science.gov (United States)

    Albin, Roger L; Koeppe, Robert A; Burke, James F; Giordani, Bruno; Kilbourn, Michael R; Gilman, Sid; Frey, Kirk A

    2010-04-01

    To compare assessment of regional cerebral metabolic changes with [(11)C]dihydrotetrabenazine (DTBZ)-positron emission tomography (PET) measurement of regional cerebral blood flow (K(1)) and fludeoxyglucose F18 (FDG)-PET measurement of regional cerebral glucose uptake (CMR(glc)) in a clinically representative sample of subjects with mild dementia and mild cognitive impairment (MCI). [(11)C]Dihydrotetrabenazine-PET K(1) and FDG-PET CMR(glc) measurements were performed. University-based cognitive disorders clinic. Fifty subjects with either mild dementia (Mini-Mental State Examination score > or = 18) or MCI. Their results were compared with those of 80 normal control subjects. The DTBZ-PET regional K(1) and FDG-PET CMR(glc) measurements were compared with standard correlation analysis. The overall patterns of DTBZ-PET K(1) and FDG-PET CMR(glc) deficits were assessed with stereotaxic surface projections (SSPs) of parametric images. The DTBZ-PET regional K(1) and FDG-PET CMR(glc) measurements were highly correlated, both within and between subjects. The SSP maps of deficits in DTBZ-PET regional K(1) and FDG-PET CMR(glc) measurements were markedly similar. The DTBZ-PET K(1) SSP maps exhibited a mild decrease in sensitivity relative to FDG-PET CMR(glc) maps. Both DTBZ-PET K(1) and FDG-PET CMR(glc) measurements provide comparable information in assessment of regional cerebral metabolic deficits in mild dementia and MCI. Blood flow measures can assess regional cerebral metabolism deficits accurately in mild dementia and MCI. Blood flow assessments of regional cerebral metabolic deficits can be combined with tracer binding results to improve utility of PET imaging in mild dementia and MCI.

  20. Sequence variations in C9orf72 downstream of the hexanucleotide repeat region and its effect on repeat-primed PCR interpretation

    DEFF Research Database (Denmark)

    Nordin, Angelica; Akimoto, Chizuru; Wuolikainen, Anna

    2017-01-01

    A large GGGGCC-repeat expansion mutation (HREM) in C9orf72 is the most common known cause of ALS and FTD in European populations. Sequence variations immediately downstream of the HREM region have previously been observed and have been suggested to be one reason for difficulties in interpreting RP...

  1. No increased susceptibility to breast cancer from combined CHEK2 1100delC genotype and the HLA class III region risk factors

    NARCIS (Netherlands)

    de Jong, Mirjam; Nolte, Ilja; te Meerman, Gerhardus; van der Graaf, WTA; Oosterom, E; Bruinenberg, M; van der Steege, G; Oosterwijk, JC; van der Hout, Annemarie; Boezen, HM; Schaapveld, M; Kleibeuker, JH; de Vries, EGE

    CHEK2 is low-penetrance breast cancer susceptibility gene. The 1100delC mutation may interact with variants/mutations in other breast cancer susceptibility loci. We identified a risk haplotype in the HLA class III region in breast cancer patients [de Jong MM, Nolte IM, de Vries EGE, et al. The HLA

  2. Emission Certificate Trade and Costs under Regional Burden-Sharing Regimes for a 2˚C Climate Change Control Target

    NARCIS (Netherlands)

    Kober, T.; van der Zwaan, B.C.C.; Rösler, H.

    2014-01-01

    In this article we explore regional burden-sharing regimes for the allocation of greenhouse gas emission reduction obligations needed to reach a 2°C long-term global climate change control target by performing an integrated energy-economy-climate assessment with the bottom-up TIAM-ECN model. Our

  3. Productividad, costes salariales y políticas de seguridad alimentaria de las regiones españolas: el caso de la industria cárnica

    OpenAIRE

    José Ruiz Chico; Antonio Rafael Peña Sánchez

    2012-01-01

    El objetivo fundamental de este trabajo es analizar la competitividad de la industria agroalimentaria, y dentro de ella, del sector cárnico de las regiones españolas a partir de elementos como la productividad, los costes salariales y la seguridad alimentaria.

  4. A family of human Y chromosomes has dispersed throughout northern Eurasia despite a 1.8-Mb deletion in the azoospermia factor c region

    NARCIS (Netherlands)

    Repping, Sjoerd; van Daalen, Saskia K. M.; Korver, Cindy M.; Brown, Laura G.; Marszalek, Janet D.; Gianotten, Judith; Oates, Robert D.; Silber, Sherman; van der Veen, Fulco; Page, David C.; Rozen, Steve

    2004-01-01

    The human Y chromosome is replete with amplicons-very large, nearly identical repeats-which render it susceptible to interstitial deletions that often cause spermatogenic failure. Here we describe a recurrent, 1.8-Mb deletion that removes half of the azoospermia factor c (AZFc) region, including 12

  5. Non-genotype-specific role of the hepatitis C virus 5' untranslated region in virus production and in inhibition by interferon

    DEFF Research Database (Denmark)

    Li, Yi-Ping; Ramirez, Santseharay; Gottwein, Judith M

    2011-01-01

    The 5' untranslated region (5'UTR) of hepatitis C virus (HCV) is structured into four domains (I-IV) with numerous genotype-specific nucleotides. It is unknown whether the polymorphisms confer genotype-specific functions to the 5'UTR. Using viable JFH1-based Core-NS2 recombinants, we developed...

  6. Pressure effect on crystallization of metallic glass Fe72P11C6Al5B4Ga2 alloy with wide supercooled liquid region

    DEFF Research Database (Denmark)

    Jiang, Jianzhong; Olsen, J. S.; Gerward, Leif

    2000-01-01

    The effect of pressure on the crystallization behavior of metallic glass Fe72P11C6Al5B4Ga2 alloy with a wide supercooled liquid region has been investigated by in situ high-pressure and high-temperature x-ray diffraction measurements using synchrotron radiation. In the pressure range from 0 to 2....

  7. 75 FR 27665 - Airworthiness Directives; Bombardier, Inc. Model CL-600-2C10 (Regional Jet Series 700, 701 & 702...

    Science.gov (United States)

    2010-05-18

    ...-801 of Part 2, Volume 1, of the Bombardier CRJ Series Regional Jet Aircraft Maintenance Manual (AMM... Maintenance Manual (AMM), CSP B-001, Revision 28, dated January 20, 2009. If any crack is found on one or more...

  8. Contribution of the C-terminal regions of promyelocytic leukemia protein (PML) isoforms II and V to PML nuclear body formation.

    Science.gov (United States)

    Geng, Yunyun; Monajembashi, Shamci; Shao, Anwen; Cui, Di; He, Weiyong; Chen, Zhongzhou; Hemmerich, Peter; Tang, Jun

    2012-08-31

    Promyelocytic leukemia protein (PML) nuclear bodies are dynamic and heterogeneous nuclear protein complexes implicated in various important functions, most notably tumor suppression. PML is the structural component of PML nuclear bodies and has several nuclear splice isoforms that share a common N-terminal region but differ in their C termini. Previous studies have suggested that the coiled-coil motif within the N-terminal region is sufficient for PML nuclear body formation by mediating homo/multi-dimerization of PML molecules. However, it has not been investigated whether any of the C-terminal variants of PML may contribute to PML body assembly. Here we report that the unique C-terminal domains of PML-II and PML-V can target to PML-NBs independent of their N-terminal region. Strikingly, both domains can form nuclear bodies in the absence of endogenous PML. The C-terminal domain of PML-II interacts transiently with unknown binding sites at PML nuclear bodies, whereas the C-terminal domain of PML-V exhibits hyperstable binding to PML bodies via homo-dimerization. This strong interaction is mediated by a putative α-helix in the C terminus of PML-V. Moreover, nuclear bodies assembled from the C-terminal domain of PML-V also recruit additional PML body components, including Daxx and Sp100. These observations establish the C-terminal domain of PML-V as an additional important contributor to the assembly mechanism(s) of PML bodies.

  9. Projection of actual evapotranspiration using the COSMO-CLM regional climate model under global warming scenarios of 1.5 °C and 2.0 °C in the Tarim River basin, China

    Science.gov (United States)

    Su, Buda; Jian, Dongnan; Li, Xiucang; Wang, Yanjun; Wang, Anqian; Wen, Shanshan; Tao, Hui; Hartmann, Heike

    2017-11-01

    Actual evapotranspiration (ETa) is an important component of the water cycle. The goals for limiting global warming to below 2.0 °C above pre-industrial levels and aspiring to 1.5 °C were negotiated in the Paris Agreement in 2015. In this study, outputs from the regional climate model COSMO-CLM (CCLM) for the Tarim River basin (TRB) were used to calculate ETa with an advection-aridity model, and changes in ETa under global warming scenarios of 1.5 °C (2020 to 2039) and 2.0 °C (2040 to 2059) were analyzed. Comparison of warming at the global and regional scale showed that regional 1.5 °C warming would occur later than the global average, while regional 2.0 °C warming would occur earlier than the global average. For global warming of 1.5 °C, the average ETa in the TRB is about 222.7 mm annually, which represents an increase of 6.9 mm relative to the reference period (1986-2005), with obvious increases projected for spring and summer. The greatest increases in ETa were projected for the northeast and southwest. The increment in the annual ETa across the TRB considering a warming of 1.5 °C was 4.3 mm less than that for a warming of 2.0 °C, and the reduction between the two levels of warming was most pronounced in the summer, when ETa was 3.4 mm smaller. The reduction in the increment of annual ETa for warming of 1.5 °C relative to warming of 2.0 °C was most pronounced in the southwest and northeast, where it was projected to be 8.2 mm and 9.3 mm smaller, respectively. It is suggested that the higher ETa under a warming of 2.0 °C mainly results from an increase in the sunshine duration (net radiation) in the southwestern basin and an increase in precipitation in the northeastern basin. Vapor is removed from the limited surface water supplies by ETa. The results of this study are therefore particularly relevant for water resource planning in the TRB.

  10. Deep Soil C, N, and P Stocks and Stoichiometry in Response to Land Use Patterns in the Loess Hilly Region of China.

    Directory of Open Access Journals (Sweden)

    Changzhen Li

    Full Text Available In the Loess Hilly Region of China, the widespread conversion of cropland to forestland and grassland has resulted in great increased in organic carbon (C, nitrogen (N and phosphorus (P stocks in the shallow soil layers. However, knowledge regarding changes in C, N, and P in deep soil is still limited. To elucidate the responses of deep soil C, N, and P stocks and stoichiometry in response to changes in land use, the soil from a 0-200 cm soil profile was collected from the following three typical land use patterns in the heartland of the region: forestland, grassland, and cropland. Compared with cropland, forestland and grassland had improved soil organic carbon (SOC and total nitrogen (TN contents and stocks at most soil depths but decreased total phosphorus (TP contents and stocks. At soil depths of 0-200 cm in the forestland and grassland, the cumulative SOC stocks were improved by 34.97% and 7.61%, respectively, and the TN stocks were improved by 54.54% and 12.47%, respectively. The forestland had higher SOC, TN and TP contents and stocks compared to the grassland in almost all soil layers. The soil depths of 100-200 cm contained the highest percentages of SOC, TN and TP stocks (47.80%-49.93%, 46.08%-50.05% and 49.09%-52.98%, respectively. Additionally, the forestland and grassland showed enhanced soil C:P, N:P and C:N:P ratios, and the forestland had higher C:P, N:P and C:N:P ratios compared to the grassland. Furthermore, the SOC and TN stocks had significant impacts on the soil C:N, C:P and N:P ratios. It was concluded that afforestation was the best choice for soil nutrient restoration of degraded land, and deep soil provided an extremely important resource for evaluating soil C, N and P pools and cycling.

  11. Deep Soil C, N, and P Stocks and Stoichiometry in Response to Land Use Patterns in the Loess Hilly Region of China.

    Science.gov (United States)

    Li, Changzhen; Zhao, Luhong; Sun, Pingsheng; Zhao, Fazhu; Kang, Di; Yang, Gaihe; Han, Xinhui; Feng, Yongzhong; Ren, Guangxin

    2016-01-01

    In the Loess Hilly Region of China, the widespread conversion of cropland to forestland and grassland has resulted in great increased in organic carbon (C), nitrogen (N) and phosphorus (P) stocks in the shallow soil layers. However, knowledge regarding changes in C, N, and P in deep soil is still limited. To elucidate the responses of deep soil C, N, and P stocks and stoichiometry in response to changes in land use, the soil from a 0-200 cm soil profile was collected from the following three typical land use patterns in the heartland of the region: forestland, grassland, and cropland. Compared with cropland, forestland and grassland had improved soil organic carbon (SOC) and total nitrogen (TN) contents and stocks at most soil depths but decreased total phosphorus (TP) contents and stocks. At soil depths of 0-200 cm in the forestland and grassland, the cumulative SOC stocks were improved by 34.97% and 7.61%, respectively, and the TN stocks were improved by 54.54% and 12.47%, respectively. The forestland had higher SOC, TN and TP contents and stocks compared to the grassland in almost all soil layers. The soil depths of 100-200 cm contained the highest percentages of SOC, TN and TP stocks (47.80%-49.93%, 46.08%-50.05% and 49.09%-52.98%, respectively). Additionally, the forestland and grassland showed enhanced soil C:P, N:P and C:N:P ratios, and the forestland had higher C:P, N:P and C:N:P ratios compared to the grassland. Furthermore, the SOC and TN stocks had significant impacts on the soil C:N, C:P and N:P ratios. It was concluded that afforestation was the best choice for soil nutrient restoration of degraded land, and deep soil provided an extremely important resource for evaluating soil C, N and P pools and cycling.

  12. Structure of the DNA-bound BRCA1 C-terminal region from human replication factor C p140 and model of the protein-DNA complex

    NARCIS (Netherlands)

    Kobayashi, M.; AB, E.; Bonvin, A.M.J.J.|info:eu-repo/dai/nl/113691238; Siegal, G.

    2010-01-01

    BRCA1 C-terminal domain (BRCT)-containing proteins are found widely throughout the animal and bacteria kingdoms where they are exclusively involved in cell cycle regulation and DNA metabolism. Whereas most BRCT domains are involved in protein-protein interactions, a small subset has bona fide DNA

  13. TspanC8 Tetraspanins and A Disintegrin and Metalloprotease 10 (ADAM10) Interact via Their Extracellular Regions: EVIDENCE FOR DISTINCT BINDING MECHANISMS FOR DIFFERENT TspanC8 PROTEINS.

    Science.gov (United States)

    Noy, Peter J; Yang, Jing; Reyat, Jasmeet S; Matthews, Alexandra L; Charlton, Alice E; Furmston, Joanna; Rogers, David A; Rainger, G Ed; Tomlinson, Michael G

    2016-02-12

    A disintegrin and metalloprotease 10 (ADAM10) is a ubiquitously expressed transmembrane metalloprotease that cleaves the extracellular regions from its transmembrane substrates. ADAM10 is essential for embryonic development and is implicated in cancer, Alzheimer, and inflammatory diseases. The tetraspanins are a superfamily of 33 four-transmembrane proteins in mammals, of which the TspanC8 subgroup (Tspan5, 10, 14, 15, 17, and 33) promote ADAM10 intracellular trafficking and enzymatic maturation. However, the interaction between TspanC8s and ADAM10 has only been demonstrated in overexpression systems and the interaction mechanism remains undefined. To address these issues, an antibody was developed to Tspan14, which was used to show co-immunoprecipitation of Tspan14 with ADAM10 in primary human cells. Chimeric Tspan14 constructs demonstrated that the large extracellular loop of Tspan14 mediated its co-immunoprecipitation with ADAM10, and promoted ADAM10 maturation and trafficking to the cell surface. Chimeric ADAM10 constructs showed that membrane-proximal stalk, cysteine-rich, and disintegrin domains of ADAM10 mediated its co-immunoprecipitation with Tspan14 and other TspanC8s. This TspanC8-interacting region was required for ADAM10 exit from the endoplasmic reticulum. Truncated ADAM10 constructs revealed differential TspanC8 binding requirements for the stalk, cysteine-rich, and disintegrin domains. Moreover, Tspan15 was the only TspanC8 to promote cleavage of the ADAM10 substrate N-cadherin, whereas Tspan14 was unique in reducing cleavage of the platelet collagen receptor GPVI. These findings suggest that ADAM10 may adopt distinct conformations in complex with different TspanC8s, which could impact on substrate selectivity. Furthermore, this study identifies regions of TspanC8s and ADAM10 for potential interaction-disrupting therapeutic targeting. © 2016 by The American Society for Biochemistry and Molecular Biology, Inc.

  14. Roles of C-Terminal Region of Yeast and Human Rad52 in Rad51-Nucleoprotein Filament Formation and ssDNA Annealing.

    Directory of Open Access Journals (Sweden)

    Nilesh V Khade

    Full Text Available Yeast Rad52 (yRad52 has two important functions at homologous DNA recombination (HR; annealing complementary single-strand DNA (ssDNA molecules and recruiting Rad51 recombinase onto ssDNA (recombination mediator activity. Its human homolog (hRAD52 has a lesser role in HR, and apparently lacks mediator activity. Here we show that yRad52 can load human Rad51 (hRAD51 onto ssDNA complexed with yeast RPA in vitro. This is biochemically equivalent to mediator activity because it depends on the C-terminal Rad51-binding region of yRad52 and on functional Rad52-RPA interaction. It has been reported that the N-terminal two thirds of both yRad52 and hRAD52 is essential for binding to and annealing ssDNA. Although a second DNA binding region has been found in the C-terminal region of yRad52, its role in ssDNA annealing is not clear. In this paper, we also show that the C-terminal region of yRad52, but not of hRAD52, is involved in ssDNA annealing. This suggests that the second DNA binding site is required for the efficient ssDNA annealing by yRad52. We propose an updated model of Rad52-mediated ssDNA annealing.

  15. {Delta}{sup 14}C level of annual plants and fossil fuel derived CO{sub 2} distribution across different regions of China

    Energy Technology Data Exchange (ETDEWEB)

    Xi, X.T.; Ding, X.F.; Fu, D.P. [State Key Laboratory of Nuclear Physics and Technology and Institute of Heavy Ion Physics, School of Physics, Peking University, Beijing 100871 (China); Zhou, L.P. [Laboratory for Earth Surface Processes, Department of Geography, Peking University, Beijing 100871 (China); Liu, K.X., E-mail: kxliu@pku.edu.cn [State Key Laboratory of Nuclear Physics and Technology and Institute of Heavy Ion Physics, School of Physics, Peking University, Beijing 100871 (China)

    2013-01-15

    The {sup 14}C level in annual plants is a sensitive tracer for monitoring fossil fuel derived CO{sub 2} in the atmosphere. Corn leave samples were selected from different regions of China, including high mountains in the Tibetan Plateau, grassland in Inner Mongolia, and inland and coastal cities during the summer of 2010. The {sup 14}C/{sup 12}C ratio of the samples was measured with the NEC compact AMS system at the Institute of Heavy Ion Physics, Peking University. The fossil fuel derived CO{sub 2} was estimated by comparing the measured {Delta}{sup 14}C values of corn leave samples to background atmospheric {Delta}{sup 14}C level. The influences of topography, meteorological conditions and carbon cycling processes on the fossil fuel derived CO{sub 2} concentration are considered when interpreting the data. Our results show a clear association of the low {Delta}{sup 14}C values with regions where human activities are intensive.

  16. Wetlands Research Program. Corps of Engineers Wetlands Delineation Manual. Appendix C. Sections 1 and 2. Region 6 - Southern Plains.

    Science.gov (United States)

    1987-01-01

    Longleaf threeawn A- A.or;"ata Trin. Trinius threeawn FAG .Aristc~ck-ia tc-evztosa Sims. Woolly pipevine FAG .Woraci;a aquatica (Eat.) Wiegand Lk rs B... Cabomba croliniana Gray Fanwort OBL C7aki~e ger’iculata (Robins.) Millsp. Gulf searocket? C. Zanceotata (Willd.) 0. F. Schultz Sea rocket FACW- Calamovi~fa...Michx. Fox 5edge 08L *-2Shkh Sedge OBL ~ :r’ 2 W.alter American horrbeam FAC % - -- - ... Carp aquatica (Michx. f.) Nutt. Water hickory OBL C

  17. The Switch I and II Regions of MinD Are Required for Binding and Activating MinC

    OpenAIRE

    Zhou, Huaijin; Lutkenhaus, Joe

    2004-01-01

    MinD and MinC cooperate to form an efficient inhibitor of Z-ring formation that is spatially regulated by MinE. MinD activates MinC by recruiting it to the membrane and targeting it to a septal component. To better understand this activation, we have isolated loss-of-function mutations in minD and carried out site-directed mutagenesis. Many of these mutations block MinC-MinD interaction; however, they also prevent MinD self-interaction and membrane binding, suggesting that they affect nucleot...

  18. Procerain B, a cysteine protease from Calotropis procera, requires N-terminus pro-region for activity: cDNA cloning and expression with pro-sequence.

    Science.gov (United States)

    Nandana, Vidhyadhar; Singh, Sushant; Singh, Abhay Narayan; Dubey, Vikash Kumar

    2014-11-01

    We have previously reported isolation and characterization of a novel plant cysteine protease, Procerain B, from the latex of Calotropis procera. Our initial attempts for active recombinant Procerain B in Escherichiacoli expression system was not successful. The reason for inactive enzyme production was attributed to the absence of 5' pro-region in the Procerain B cDNA that may be involved in proper folding and production of mature active protein. The current manuscript reports the cloning of full length Procerain B for the production of the active protein. The complete cDNA sequence of Procerain B with pro-region sequence was obtained by using RNA ligase mediated rapid amplification of 5' cDNA ends (RLM-RACE). The N-terminus pro-sequence region consists of 127 amino acids and characterized as the member of inhibitory I29 family. Further the three dimensional structure of full length Procerain B was modelled by homology modelling using X-ray crystal structure of procaricain (PDB ID: 1PCI). N-terminus pro-sequence of full length Procerain B runs along the active site cleft. Full length Procerain B was expressed in prokaryotic system and activated in vitro at pH 4.0. This is the first study reporting the production of active recombinant cysteine protease from C.procera. Copyright © 2014 Elsevier Inc. All rights reserved.

  19. Contribution of the C-terminal tri-lysine regions of human immunodeficiency virus type 1 integrase for efficient reverse transcription and viral DNA nuclear import

    Directory of Open Access Journals (Sweden)

    Fowke Keith R

    2005-10-01

    Full Text Available Abstract Background In addition to mediating the integration process, HIV-1 integrase (IN has also been implicated in different steps during viral life cycle including reverse transcription and viral DNA nuclear import. Although the karyophilic property of HIV-1 IN has been well demonstrated using a variety of experimental approaches, the definition of domain(s and/or motif(s within the protein that mediate viral DNA nuclear import and its mechanism are still disputed and controversial. In this study, we performed mutagenic analyses to investigate the contribution of different regions in the C-terminal domain of HIV-1 IN to protein nuclear localization as well as their effects on virus infection. Results Our analysis showed that replacing lysine residues in two highly conserved tri-lysine regions, which are located within previously described Region C (235WKGPAKLLWKGEGAVV and sequence Q (211KELQKQITK in the C-terminal domain of HIV-1 IN, impaired protein nuclear accumulation, while mutations for RK263,4 had no significant effect. Analysis of their effects on viral infection in a VSV-G pseudotyped RT/IN trans-complemented HIV-1 single cycle replication system revealed that all three C-terminal mutant viruses (KK215,9AA, KK240,4AE and RK263,4AA exhibited more severe defect of induction of β-Gal positive cells and luciferase activity than an IN class 1 mutant D64E in HeLa-CD4-CCR5-β-Gal cells, and in dividing as well as non-dividing C8166 T cells, suggesting that some viral defects are occurring prior to viral integration. Furthermore, by analyzing viral DNA synthesis and the nucleus-associated viral DNA level, the results clearly showed that, although all three C-terminal mutants inhibited viral reverse transcription to different extents, the KK240,4AE mutant exhibited most profound effect on this step, whereas KK215,9AA significantly impaired viral DNA nuclear import. In addition, our analysis could not detect viral DNA integration in each C

  20. Computer aided analysis of breast MRI enhancement kinetics using mean shift c lustering and multifeature iterative region of interest selection

    NARCIS (Netherlands)

    Stoutjesdijk, M.J.; Zijp, M.; Hitge-Boetes, C.; Karssemeijer, N.; Barentsz, J.O.; Huisman, H.

    2012-01-01

    PURPOSE: To evaluate automatic characterization of a breast MR lesion by its spatially coherent region of interest (ROI). MATERIALS AND METHODS: The method delineated 247 enhancing lesions using Otsu thresholding after manually placing a sphere. Mean Shift Clustering subdivided each volume, based on

  1. Epidemiology of Enteric Disease in C-EnterNet’s Pilot Site – Waterloo Region, Ontario, 1990 to 2004

    Directory of Open Access Journals (Sweden)

    Victoria A Keegan

    2009-01-01

    Full Text Available OBJECTIVE: The objective of the present study was to describe the epidemiology of reportable enteric illness in Ontario’s Waterloo region, including comparing calculated incidence rates with published rates, and adjusting for under-reporting to determine the number of community cases, where published data were available.

  2. 76 FR 18957 - Airworthiness Directives; Bombardier, Inc. Model CL-600-2C10 (Regional Jet Series 700, 701 & 702...

    Science.gov (United States)

    2011-04-06

    ... Regional Jet Aircraft Maintenance Manual (AMM), CSP B-001, Revision 28, dated January 20, 2009, as a source of information for doing the inspection of the transcowl assembly. Revision 28 of the AMM does not... NPRM. Requests To Refer to Latest Task Revision of AMM Comair, Inc. (Comair) and Mesa Airlines (Mesa...

  3. The impact of C677T and A1298C MTHFR polymorphisms on methotrexate therapeutic response in East Bohemian region rheumatoid arthritis patients.

    Science.gov (United States)

    Soukup, Tomas; Dosedel, Martin; Pavek, Petr; Nekvindova, Jana; Barvik, Ivan; Bubancova, Iva; Bradna, Petr; Kubena, Ales Antonin; Carazo, Alejandro Fernández; Veleta, Tomas; Vlcek, Jiri

    2015-07-01

    Some single-nucleotide polymorphisms (SNPs) might be predictive of methotrexate (MTX) therapeutic outcome in rheumatoid arthritis (RA). The aim of this study was to determine whether SNPs in the methylenetetrahydrofolate reductase (MTHFR) gene are predictive of MTX response. Comparison was made using EULAR response criteria and according to the change of DAS28 (∆DAS28) after a 6-month MTX treatment in RA patient cohort. The two SNPs C677T (rs1801133) and A1298C (rs1801131) have been genotyped. A total of 120 patients were enrolled in the study, and all of them fulfilled the American College of Rheumatology 1987 RA criteria and are currently or previously taking MTX oral treatment, either as a monotherapy (n = 65) or in a combination with other disease-modifying antirheumatic drugs (n = 55). Genotyping was performed using qPCR allelic discrimination. We did not found any association of C677T and A1298C genotypes with MTX treatment inefficacy in dominant model (OR 1.23, 95 % CI 0.57-2.65, P = 0.697; and OR 0.98, 95 % CI 0.47-2.14, P = 1.0, respectively), or in recessive and codominant models. However, when ∆DAS28 after a 6-month therapy was used as a measure of treatment efficacy, the 677CT and 1298AC genotypes were found to be significantly associated with less favorable response to MTX (P = 0.025 and P = 0.043, respectively). In addition, even lower ∆DAS28 was determined for double-mutated 677CT-1298AC heterozygotes. It means that a synergistic effect of 677CT and 1298AC genotypes was observed. Nevertheless, the DAS28 baseline was lower here comparing to other genotypes. Unexpectedly, quite the opposite trend-i.e., better response to MTX-was found in genotypes 677CC-1298CC and 677TT-1298AA. It is an intriguing finding, because these double-mutated homozygotes are known for their low MTHFR-specific activity. Global significance was P = 0.013, η (2) = 0.160-i.e., large-size effect. Thus, our data show greater ability of 677CC-1298CC and 677TT

  4. Regional brain metabolism with cytochrome c oxidase histochemistry in a PS1/A246E mouse model of autosomal dominant Alzheimer's disease: correlations with behavior and oxidative stress.

    Science.gov (United States)

    Strazielle, Catherine; Jazi, Rozat; Verdier, Yann; Qian, Sue; Lalonde, Robert

    2009-12-01

    Mitochondrial dysfunction and brain metabolic alteration are early neurofunctional aspects in Alzheimer's disease (AD). Regional brain metabolism was analyzed by cytochrome c oxidase (COX) histochemistry in PS1-A246E mouse mutants, a model of autosomal dominant AD overexpressing beta-amyloid (Abeta) peptide without amyloidosis or cell degeneration. Immunohistochemical samples were analyzed on adjacent sections for regional Abeta1-42 levels, as well as DNA oxidative damage with 8-hydroxy-2-deoxyguanosine (8-OHdG). COX activity increased in the basal forebrain nuclear complex, specific parts of the amygdala and hippocampus, as well as in striatum and connected regions. On the contrary, a hypometabolism was observed in midline thalamic, interpeduncular, and pedonculopontine nuclei. The integration of these regions in circuitries subserving emotions, arousal, and cognitive functions may explain why neurochemical alterations in specific brain regions were linearly correlated with psychomotor slowing and disinhibition previously reported in the mutant. As the PS1-A246E model appears to mimick prodromal AD, the results support the existence of mitochondrial abnormalities prior to AD-related cognitive deficits. However, since affected PS1-A246E brain regions were not primarily those altered in AD-associated histopathological features and did not systematically display either Abeta overexpression or higher 8-OHdG immunolabelling, the hypermetabolism observed seems to comprise a compensatory reaction to early mitochondrial abnormalities; furthermore, neuronal synaptic function should be considered as particularly relevant in COX activity changes.

  5. Noninvasive quantitation of regional myocardial oxygen consumption in vivo with (1-/sup 11/C)acetate and dynamic positron emission tomography

    Energy Technology Data Exchange (ETDEWEB)

    Buxton, D.B.; Nienaber, C.A.; Luxen, A.; Ratib, O.; Hansen, H.; Phelps, M.E.; Schelbert, H.R.

    1989-01-01

    The usefulness of (1-11C)acetate as a tracer of overall myocardial oxidative metabolism for use with positron emission tomography has been investigated in 12 closed-chest dogs. Myocardial 11C activity clearance kinetics after intravenous administration of (1-11C)acetate in dogs have been determined noninvasively by positron emission tomography. Biexponential fitting of regional myocardial 11C time-activity curves was performed to give clearance half-times and fractional distribution. The rate constant k1 for the early rapid phase of 11C activity clearance was found to correlate linearly with myocardial oxygen consumption (y = 0.0156x + 0.039; SEE = 0.023; r = 0.95). k1 was approximately 7% lower in septal sectors compared with the left ventricular free wall, suggesting that regional oxygen consumption in the septum was lower; a concomitant regional attenuation of blood flow in the septum relative to the left ventricular free wall was also observed. In dogs using carbohydrates as the predominant fuel, k1 oxygen consumption was somewhat more than in dogs using predominantly free fatty acids (0.021 +/- 0.002 compared with 0.018 +/- 0.002, p less than 0.01), indicating that increased carbohydrate consumption is associated with a small increase in k1 at constant oxygen consumption. It is concluded that measurement of myocardial (1-11C)acetate kinetics allows noninvasive determination of cardiac oxygen consumption by positron emission tomography and that the technique is relatively insensitive to myocardial fuel selection.

  6. Interactions between the Leucine-zipper Motif of cGMP-Dependent Protein Kinase and the C-terminal Region of the Targeting Subunit of Myosin Light Chain Phosphatase*

    Science.gov (United States)

    Lee, Eunhee; Hayes, David B.; Langsetmo, Knut; Sundberg, Eric J.; Tao, Terence C.

    2007-01-01

    Summary Nitric oxide induces vasodilation by elevating the production of cGMP, an activator of cGMP-dependent protein kinase (PKG). PKG subsequently causes smooth muscle relaxation in part via activation of myosin light chain phosphatase (MLCP). To date, the interaction between PKG and the targeting subunit of MLCP (MYPT1) is not fully understood. Earlier studies by one group of workers showed that the binding of PKG to MYPT1 is mediated by the leucine-zipper motifs at the N- and C-termini, respectively, of the two proteins. Another group, however, reported that binding of PKG to MYPT1 did not require the leucine-zipper motif of MYPT1. In this work we fully characterized the interaction between PKG and MYPT1 using biophysical techniques. For this purpose we constructed a recombinant PKG peptide corresponding to a predicted coiled coil region that contains the leucine-zipper motif. We further constructed various C-terminal MYPT1 peptides bearing various combinations of a predicted coiled coil region, extensions preceding this coiled coil region, and the leucine-zipper motif. Our results show, firstly, that while the leucine-zipper motif at the N-terminus of PKG forms a homodimeric coiled coil, the one at the C-terminus of MYPT1 is monomeric and non-helical. Secondly, the leucine-zipper motif of PKG binds to that of MYPT1 to form a heterodimer. Thirdly, when the leucine-zipper motif of MYPT1 is absent, the PKG leucine-zipper motif binds to the coiled coil region and upstream segments of MYPT1 via formation of a heterotetramer. These results provide rationalization of some of the findings by others using alternative binding analyses. PMID:17904578

  7. A promoter in the coding region of the calcium channel gene CACNA1C generates the transcription factor CCAT.

    Directory of Open Access Journals (Sweden)

    Natalia Gomez-Ospina

    Full Text Available The C-terminus of the voltage-gated calcium channel Cav1.2 encodes a transcription factor, the calcium channel associated transcriptional regulator (CCAT, that regulates neurite extension and inhibits Cav1.2 expression. The mechanisms by which CCAT is generated in neurons and myocytes are poorly understood. Here we show that CCAT is produced by activation of a cryptic promoter in exon 46 of CACNA1C, the gene that encodes CaV1.2. Expression of CCAT is independent of Cav1.2 expression in neuroblastoma cells, in mice, and in human neurons derived from induced pluripotent stem cells (iPSCs, providing strong evidence that CCAT is not generated by cleavage of CaV1.2. Analysis of the transcriptional start sites in CACNA1C and immune-blotting for channel proteins indicate that multiple proteins are generated from the 3' end of the CACNA1C gene. This study provides new insights into the regulation of CACNA1C, and provides an example of how exonic promoters contribute to the complexity of mammalian genomes.

  8. Pseudomonas aeruginosa isolates from patients with cystic fibrosis have different beta-lactamase expression phenotypes but are homogeneous in the ampC-ampR genetic region

    DEFF Research Database (Denmark)

    Campbell, J I; Ciofu, O; Høiby, N

    1997-01-01

    Pseudomonas aeruginosa isolates from 1 of 17 cystic fibrosis patients produced secondary beta-lactamase in addition to the ampC beta-lactamase. Isolates were grouped into three beta-lactamase expression phenotypes: (i) beta-lactam sensitive, low basal levels and inducible beta-lactamase production......; (ii) beta-lactam resistant, moderate basal levels and hyperinducible beta-lactamase production; (iii) beta-lactam resistant, high basal levels and constitutive beta-lactamase production. Apart from a base substitution in the ampR-ampC intergenic region of an isolate with moderate...

  9. Impact of dielectric parameters on the reflectivity of 3C–SiC wafers with a rough surface morphology in the reststrahlen region

    Energy Technology Data Exchange (ETDEWEB)

    Engelbrecht, J.A.A., E-mail: Japie.Engelbrecht@nmmu.ac.za [Physics Department, Nelson Mandela Metropolitan University, PO Box 77000, Port Elizabeth 6031 (South Africa); Janzén, E.; Henry, A. [Department of Physics, Chemistry and Biology, Linköping University, SE-581 83 Linköping (Sweden); Rooyen, I.J. van [Fuel Performance and Design Department, Idaho National Laboratory, PO Box 1625, Idaho Falls, ID 83415-6188 (United States)

    2014-04-15

    A layer-on-substrate model is used to obtain the infrared reflectance for 3C–SiC with a rough surface morphology. The effect of varying dielectric parameters of the “damaged layer” on the observed reflectivity of the 3C–SiC in the reststrahlen region is assessed. Different simulated reflectance spectra are obtained to those if the dielectric parameters of the “substrate” were varied. Most notable changes in the shape of the simulated reststrahlen peak are observed for changes in the high frequency dielectric constant, the phonon damping constant, the phonon frequencies and “thickness” of damaged surface layer.

  10. Competitividad y políticas de seguridad alimentaria de las regiones españolas: el caso de la industria cárnica

    Directory of Open Access Journals (Sweden)

    José Ruiz Chico

    2012-01-01

    Full Text Available El objetivo fundamental de este trabajo es analizar la competitividad de la industria agroalimentaria y, dentro de ella, el sector cárnico de las regiones españolas a partir de elementos que, sin duda, influyen en esta como: la productividad, los costes salariales y la seguridad alimentaria. Las principales conclusiones obtenidas permiten identificar la enorme potencialidad económica del sector agroalimentario español, y del subsector cárnico en particular. Aspectos como el tipo de carne o el nivel de internacionalización nos ayudan identificar aquellas regiones españolas que requieren un esfuerzo adicional en las políticas alimentarias para evitar que su competitividad sea perjudicada.

  11. Further search for the decay K+→π+νν¯ in the momentum region P<195 MeV/c

    Science.gov (United States)

    Adler, S.; Aoki, M.; Ardebili, M.; Atiya, M. S.; Bazarko, A. O.; Bergbusch, P. C.; Bhuyan, B.; Blackmore, E. W.; Bryman, D. A.; Chiang, I.-H.; Convery, M. R.; Diwan, M. V.; Frank, J. S.; Haggerty, J. S.; Inagaki, T.; Ito, M. M.; Jain, V.; Jaffe, D. E.; Kabe, S.; Kazumori, M.; Kettell, S. H.; Kitching, P.; Kobayashi, M.; Komatsubara, T. K.; Konaka, A.; Kuno, Y.; Kuriki, M.; Kycia, T. F.; Li, K. K.; Littenberg, L. S.; MacDonald, J. A.; McPherson, R. A.; Meyers, P. D.; Mildenberger, J.; Muramatsu, N.; Nakano, T.; Ng, C.; Ng, S.; Numao, T.; Otomo, A.; Poutissou, J.-M.; Poutissou, R.; Redlinger, G.; Sasaki, T.; Sato, T.; Shinkawa, T.; Shoemaker, F. C.; Smith, A. J. S.; Soluk, R.; Stone, J. R.; Strand, R. C.; Sugimoto, S.; Witzig, C.; Yoshimura, Y.

    2004-08-01

    We report the results of a search for the decay K+→π+νν¯ in the kinematic region with π+ momentum 140c using the data collected by the E787 experiment at BNL. No events were observed. When combined with our previous search in this region, one candidate event with an expected background of 1.22±0.24 events results in a 90% C.L. upper limit of 2.2×10-9 on the branching ratio of K+→π+νν¯. We also report improved limits on the rates of K+→π+X0 and K+→π+X1X2 where X0,X1,X2 are hypothetical, massless, long-lived neutral particles.

  12. New primers for amplification of cytochrome c oxidase subunit I barcode region designed for species of Decapoda (Crustacea)

    OpenAIRE

    Fernando L. Mantelatto; Carvalho, Fabrício L.; Simões,Sabrina M.; Mariana Negri; Souza-Carvalho,Edvanda A.; Mariana Terossi

    2016-01-01

    Abstract We designed 14 new primers for amplification of the COI barcode region of decapod crustacean species. We tested, with high level of success, the generation of ~ 640 ± 49 base-pair sequences in selected groups of decapods (hermit crabs, squat lobsters, marine and freshwater crabs and shrimps), encompassing representatives of 27 genera of 15 families, 11 of Pleocyemata (Anomura, Brachyura, and Caridea) and 4 of Dendrobranchiata. Based on the results we expect the applicability of these...

  13. Photosynthetic limitation and mechanisms of photoprotection under drought and recovery of Calotropis procera, an evergreen C3 from arid regions.

    Science.gov (United States)

    Rivas, Rebeca; Frosi, Gabriella; Ramos, Diego G; Pereira, Silvia; Benko-Iseppon, Ana M; Santos, Mauro G

    2017-09-01

    Calotropis procera is a C3 plant native from arid environmental zones. It is an evergreen, shrubby, non-woody plant with intense photosynthetic metabolism during the dry season. We measured photosynthetic parameters and leaf biochemical traits, such as gas exchange, photochemical parameters, A/Ci analysis, organic solutes, and antioxidant enzymes under controlled conditions in potted plants during drought stress, and following recovery conditions to obtain a better insight in the drought stress responses of C. procera. Indeed, different processes contribute to the drought stress resilience of C. procera and to the fast recovery after rehydration. The parameters analyzed showed that C. procera has a high efficiency for energy dissipation. The photosynthetic machinery is protected by a robust antioxidant system and photoprotective mechanisms such as alternative pathways for electrons (photorespiration and day respiration). Under severe drought stress, increased stomatal limitation and decreased biochemical limitation permitted C. procera to maintain maximum rate of Rubisco carboxylation (Vc,max) and photosynthetic rate (Amax). On the other hand, limitation of stomatal or mesophyll CO2 diffusion did not impair fast recovery, maintaining Vc,max, chloroplast CO2 concentration (Cc) and mesophyll conductance (gm) unchanged while electron flow used for RuBP carboxylation (Jc) and Amax increased. The ability to tolerate drought stress and the fast recovery of this evergreen C3 species was also due to leaf anti-oxidative stress enzyme activity, and photosynthetic pigments. Thus, these different drought tolerance mechanisms allowed high performance of photosynthetic metabolism by drought stressed plants during the re-watering period. Copyright © 2017 Elsevier Masson SAS. All rights reserved.

  14. Autosomal dominant familial spastic paraplegia: Reduction of the FSPI candidate region on chromosome 14q to 7 cM and locus heterogeneity

    Energy Technology Data Exchange (ETDEWEB)

    Gispert, S.; Santos, N.; Auburger, G.; Damen, R.; Voit, T. [University Hospital, Duesseldorf (Germany); Schulz, J.; Klockgether, T. [University Hospital, Tuebingen (Germany); Orozco, G. [Hospital Lenin, Holguin (Cuba); Kreuz, F. [Technical Univ., Dresden (Netherlands); Weissenbach, J. [Unite de Genetique, Paris (France)

    1995-01-01

    Three large pedigrees of Germany descent with autosomal dominant {open_quotes}pure{close_quotes} familial spastic paraplegia (FSP) were characterized clinically and genetically. Haplotype and linkage analyses, with microsatellites covering the FSP region on chromosome 14q (locus FSP1), were performed. In pedigree W, we found a haplotype that cosegregates with the disease and observed three crossing-over events, reducing the FSP1 candidate region to 7 cM; in addition, the observation of apparent anticipation in this family suggests a trinucleotide repeat expansion as the mutation. In pedigree D and S, the gene locus could be excluded from the whole FSP1 region, confirming the locus heterogeneity of autosomal dominant FSP. 11 refs., 2 figs., 2 tabs.

  15. The role of the C-terminus of human α-synuclein: intra-disulfide bonds between the C-terminus and other regions stabilize non-fibrillar monomeric isomers.

    Science.gov (United States)

    Hong, Dong-Pyo; Xiong, Wei; Chang, Jui-Yoa; Jiang, Chuantao

    2011-02-04

    Substantial evidence implicates that the aggregation of α-synuclein (αSyn) is a critical factor in the pathogenesis of Parkinson's disease. This study focuses on the role of αSyn C-terminus. We introduced two additional cysteine residues at positions 107 and 124 (A107C and A124C) to our previous construct. Five X-isomers of oxidative-folded mutation of α-synuclein with three disulfides were isolated and their secondary structures and aggregating features were analyzed. All isomers showed similar random coil structures as wild-type α-synuclein. However, these isomers did not form aggregates or fibrils, even with prolonged incubation, suggesting that the interactions between the C-terminal and N-terminal or central NAC region are important in maintaining the natively unfolded structure of αSyn and thus prevent αSyn from changing conformation, which is a critical step for fibrillation. Published by Elsevier B.V.

  16. Comparison of Nucleotide Sequence of P2C Region in Diabetogenic and Non-Diabetogenic Coxsackie Virus B5 Isolates

    OpenAIRE

    Chou, Cheng-Chong; Lin, Kuei-Hsiang; Ke, Guan-Ming; Tung, Yi-Ching; Cheng, Jeng-Yin; Chen, Bai-Hsiun; Chao, Mei-Chyn

    2004-01-01

    Enteroviruses are environmental triggers in the pathogenesis of type 1 diabetes mellitus (DM). A sequence of six identical amino acids (PEVKEK) is shared by the 2C protein of Coxsackie virus B and the glutamic acid decarboxylase (GAD) molecules. Between 1995 and 2002, we investigated 22 Coxsackie virus B5 (CVB5) isolates from southern Taiwan. Four of these isolates were obtained from four new-onset type 1 DM patients with diabetic ketoacidosis. We compared a 300 nucleotide sequence in the 2C ...

  17. A disordered region in the EvpP protein from the type VI secretion system of Edwardsiella tarda is essential for EvpC binding.

    Directory of Open Access Journals (Sweden)

    Wentao Hu

    Full Text Available The type VI secretion system (T6SS of pathogenic bacteria plays important roles in both virulence and inter-bacterial competitions. The effectors of T6SS are presumed to be transported either by attaching to the tip protein or by interacting with HcpI (haemolysin corregulated protein 1. In Edwardsiella tarda PPD130/91, the T6SS secreted protein EvpP (E. tarda virulent protein P is found to be essential for virulence and directly interacts with EvpC (Hcp-like, suggesting that it could be a potential effector. Using limited protease digestion, nuclear magnetic resonance heteronuclear Nuclear Overhauser Effects, and hydrogen-deuterium exchange mass spectrometry, we confirmed that the dimeric EvpP (40 kDa contains a substantial proportion (40% of disordered regions but still maintains an ordered and folded core domain. We show that an N-terminal, 10-kDa, protease-resistant fragment in EvpP connects to a shorter, 4-kDa protease-resistant fragment through a highly flexible region, which is followed by another disordered region at the C-terminus. Within this C-terminal disordered region, residues Pro143 to Ile168 are essential for its interaction with EvpC. Unlike the highly unfolded T3SS effector, which has a lower molecular weight and is maintained in an unfolded conformation with a dedicated chaperone, the T6SS effector seems to be relatively larger, folded but partially disordered and uses HcpI as a chaperone.

  18. Polymorphism 10034C>T is located in a region regulating polyadenylation of FGG transcripts and influences the fibrinogen gamma'/gammaA mRNA ratio.

    Science.gov (United States)

    Uitte de Willige, S; Rietveld, I M; De Visser, M C H; Vos, H L; Bertina, R M

    2007-06-01

    Fibrinogen gamma haplotype 2 (FGG-H2) is associated with reduced fibrinogen gamma' levels and fibrinogen gamma'/total fibrinogen ratios and with an increased deep-venous thrombosis (DVT) risk. Two FGG-H2 tagging single nucleotide polymorphisms (SNPs), 9615C>T and 10034C>T, are located in the region of alternative FGG pre-mRNA processing. 10034C>T is located in a GT-rich downstream sequence element (DSE) that comprises a putative cleavage stimulation factor (CstF) binding site. To investigate the functionality of SNPs 9615C>T and 10034C>T, and the importance of the DSE containing 10034C>T. Different minigene constructs containing FGG exon 9, intron 9, exon 10 and the 3' region were transiently transfected into HepG2 cells and quantitative real-time polymerase chain reaction was used to measure relative polyadenylation (pA) signal usage (pA1/pA2 ratio). Compared with the reference construct CC (9615C-10034C; FGG-H1; pA1/pA2 ratio set at 100%), the pA1/pA2 ratio of construct TT (9615T-10034T; FGG-H2) was 1.4-fold decreased (71.5%, P = 0.015). The pA1/pA2 ratio of construct CT (9615C-10034T) was almost 1.2-fold decreased (85.3%, P = 0.001), whereas the pA1/pA2 ratio of construct TC (9615T-10034C) did not differ significantly from the reference construct (101.6%, P = 0.890). Functionality of the putative CstF binding site was confirmed using constructs in which this site was deleted or its sequence altered by point mutations. SNP 10034C>T is located in a GT-rich DSE involved in regulating the usage of the pA2 signal of FGG, which may represent a CstF binding site. We propose that the 10034C>T change is the functional variation in FGG-H2 that is responsible for the reduction in the fibrinogen gamma'/total fibrinogen ratio and the increased DVT risk.

  19. Building a Latin American cancer patient advocacy movement: Latin American cancer NGO regional overview Desarrollando un movimiento de apoyo para pacientes de cáncer en America Latina: resumen regional - ONGs de cáncer

    Directory of Open Access Journals (Sweden)

    Alessandra Durstine

    2009-01-01

    Full Text Available The objective of the this paper is to assess and identify the key strengths and weaknesses for cancer control NGOs in Latin America, with the goal to make recommendations about how to improve thev impact of the patient advocacy movement as it pertains to cancer. The methods included literature review, expert interviews and site visits to Latin American cancer hospitals and NGOs. The overall findings conclude that NGOs currently do not take a leadership role in cancer control in Latin America. The lack of a survivorship movement, faulty patient information services and failure of the governments to include NGOs in policy creation are identified as areas for further project work and collaboration. The stigma of cancer still remains and a burgeoning patient movement can be created to help destigmatize and debunk the myths that surround cancer.El objetivo de este artículo es el de identificar y evaluar las fortalezas y debilidades clave de las ONG dedicadas al control del cáncer en Latinoamérica, con el fin de generar recomendaciones sobre el modo de mejorar el impacto del movimiento de apoyo para pacientes de cáncer. Los métodos incluyeron una revisión de la literatura, entrevistas a expertos y visitas a hospiptales y ONG dedicados al cáncer en Latinoamérica. Los hallazgos principales permiten concluir que en este momento las ONG no tienen un rol de liderazgo para el control del cáncer en Latinoamérica. La ausencia de un movimiento de sobrevivientes, servicios de información deficientes a los pacientes y el fracaso del gobierno para incluir a las ONG en la creación de políticas se identifican como áreas de trabajo y colaboración en proyectos a futuro. El estigma del cáncer aún subsiste y es factible crear un movimiento que florezca y ayude a desvanecerlo al exponer los mitos que rodean este padecimiento.

  20. A novel approach for the characterization of tundra wetland regions with C-band SAR satellite data

    Science.gov (United States)

    Widhalm, Barbara; Bartsch, Annett; Heim, Birgit

    2015-01-01

    A circumpolar representative and consistent wetland map is required for a range of applications ranging from upscaling of carbon fluxes and pools to climate modelling and wildlife habitat assessment. Currently available data sets lack sufficient accuracy and/or thematic detail in many regions of the Arctic. Synthetic aperture radar (SAR) data from satellites have already been shown to be suitable for wetland mapping. Envisat Advanced SAR (ASAR) provides global medium-resolution data which are examined with particular focus on spatial wetness patterns in this study. It was found that winter minimum backscatter values as well as their differences to summer minimum values reflect vegetation physiognomy units of certain wetness regimes. Low winter backscatter values are mostly found in areas vegetated by plant communities typically for wet regions in the tundra biome, due to low roughness and low volume scattering caused by the predominant vegetation. Summer to winter difference backscatter values, which in contrast to the winter values depend almost solely on soil moisture content, show expected higher values for wet regions. While the approach using difference values would seem more reasonable in order to delineate wetness patterns considering its direct link to soil moisture, it was found that a classification of winter minimum backscatter values is more applicable in tundra regions due to its better separability into wetness classes. Previous approaches for wetland detection have investigated the impact of liquid water in the soil on backscatter conditions. In this study the absence of liquid water is utilized. Owing to a lack of comparable regional to circumpolar data with respect to thematic detail, a potential wetland map cannot directly be validated; however, one might claim the validity of such a product by comparison with vegetation maps, which hold some information on the wetness status of certain classes. It was shown that the Envisat ASAR-derived classes

  1. Summed Probability Distribution of 14C Dates Suggests Regional Divergences in the Population Dynamics of the Jomon Period in Eastern Japan.

    Science.gov (United States)

    Crema, Enrico R; Habu, Junko; Kobayashi, Kenichi; Madella, Marco

    2016-01-01

    Recent advances in the use of summed probability distribution (SPD) of calibrated 14C dates have opened new possibilities for studying prehistoric demography. The degree of correlation between climate change and population dynamics can now be accurately quantified, and divergences in the demographic history of distinct geographic areas can be statistically assessed. Here we contribute to this research agenda by reconstructing the prehistoric population change of Jomon hunter-gatherers between 7,000 and 3,000 cal BP. We collected 1,433 14C dates from three different regions in Eastern Japan (Kanto, Aomori and Hokkaido) and established that the observed fluctuations in the SPDs were statistically significant. We also introduced a new non-parametric permutation test for comparing multiple sets of SPDs that highlights point of divergences in the population history of different geographic regions. Our analyses indicate a general rise-and-fall pattern shared by the three regions but also some key regional differences during the 6th millennium cal BP. The results confirm some of the patterns suggested by previous archaeological studies based on house and site counts but offer statistical significance and an absolute chronological framework that will enable future studies aiming to establish potential correlation with climatic changes.

  2. Ral GTPase interacts with the N-terminal in addition to the C-terminal region of PLC-delta1.

    Science.gov (United States)

    Grujic, Ognjen; Bhullar, Rajinder P

    2009-06-12

    Previously, we have shown that RalA, a calmodulin (CaM)-binding protein, binds to the C2 region in the C-terminal of PLC-delta1, and increases its enzymatic activity. Since PLC-delta1 contains a CaM-like region in its N-terminus, we have investigated if RalA can also bind to the N-terminus of PLC-delta1. Therefore, we created a GST-PLC-delta1 construct consisting of the first 294 amino acids of PLC-delta1 (GST-PLC-delta1(1-294)). In vitro binding experiments confirmed that PLC-delta1(1-294) was capable of binding directly to RalA. W-7 coupled to polyacrylamide beads bound pure PLC-delta1, demonstrating that PLC-delta1 contains a CaM-like region. Competition assays with W-7, peptides representing RalA and the newly identified RalB CaM-binding regions, or the IQ peptide from PLC-delta1 were able to inhibit RalA binding to PLC-delta1(1-294). This study demonstrates that there are two binding sites for RalA in PLC-delta1 and provides further insight into the role of Ral GTPase in the regulation of PLC-delta1 function.

  3. Human antibody expression in transgenic rats: comparison of chimeric IgH loci with human VH, D and JH but bearing different rat C-gene regions.

    Science.gov (United States)

    Ma, Biao; Osborn, Michael J; Avis, Suzanne; Ouisse, Laure-Hélène; Ménoret, Séverine; Anegon, Ignacio; Buelow, Roland; Brüggemann, Marianne

    2013-12-31

    Expression of human antibody repertoires in transgenic animals has been accomplished by introducing large human Ig loci into mice and, more recently, a chimeric IgH locus into rats. With human VH, D and JH genes linked to the rat C-region antibody expression was significantly increased, similar to wild-type levels not found with fully human constructs. Here we compare four rat-lines containing the same human VH-region (comprising 22 VHs, all Ds and all JHs in natural configuration) but linked to different rat CH-genes and regulatory sequences. The endogenous IgH locus was silenced by zinc-finger nucleases. After breeding, all lines produced exclusively chimeric human H-chain with near normal IgM levels. However, in two lines poor IgG expression and inefficient immune responses were observed, implying that high expression, class-switching and hypermutation are linked to optimal enhancer function provided by the large regulatory region at the 3' end of the IgH locus. Furthermore, exclusion of Cδ and its downstream interval region may assist recombination. Highly diverse IgG and immune responses similar to normal rats were identified in two strains carrying diverse and differently spaced C-genes. © 2013. Published by Elsevier B.V. All rights reserved.

  4. Summed Probability Distribution of 14C Dates Suggests Regional Divergences in the Population Dynamics of the Jomon Period in Eastern Japan.

    Directory of Open Access Journals (Sweden)

    Enrico R Crema

    Full Text Available Recent advances in the use of summed probability distribution (SPD of calibrated 14C dates have opened new possibilities for studying prehistoric demography. The degree of correlation between climate change and population dynamics can now be accurately quantified, and divergences in the demographic history of distinct geographic areas can be statistically assessed. Here we contribute to this research agenda by reconstructing the prehistoric population change of Jomon hunter-gatherers between 7,000 and 3,000 cal BP. We collected 1,433 14C dates from three different regions in Eastern Japan (Kanto, Aomori and Hokkaido and established that the observed fluctuations in the SPDs were statistically significant. We also introduced a new non-parametric permutation test for comparing multiple sets of SPDs that highlights point of divergences in the population history of different geographic regions. Our analyses indicate a general rise-and-fall pattern shared by the three regions but also some key regional differences during the 6th millennium cal BP. The results confirm some of the patterns suggested by previous archaeological studies based on house and site counts but offer statistical significance and an absolute chronological framework that will enable future studies aiming to establish potential correlation with climatic changes.

  5. Subcellular localization of SREBP1 depends on its interaction with the C-terminal region of wild-type and disease related A-type lamins

    Energy Technology Data Exchange (ETDEWEB)

    Duband-Goulet, Isabelle; Woerner, Stephanie [Laboratoire du Stress et Pathologies du Cytosquelette, Universite Paris Diderot-Paris 7, CNRS, Institut de Biologie Fonctionnelle et Adaptative, 4 rue M.A. Lagroua Weill Halle, 75205 Paris cedex 13 (France); Gasparini, Sylvaine [Laboratoire de Biologie Structurale et Radiobiologie, URA CNRS 2096, Commissariat a l' Energie Atomique Saclay, 91190 Gif-sur-Yvette (France); Attanda, Wikayatou [Laboratoire du Stress et Pathologies du Cytosquelette, Universite Paris Diderot-Paris 7, CNRS, Institut de Biologie Fonctionnelle et Adaptative, 4 rue M.A. Lagroua Weill Halle, 75205 Paris cedex 13 (France); Konde, Emilie; Tellier-Lebegue, Carine [Laboratoire de Biologie Structurale et Radiobiologie, URA CNRS 2096, Commissariat a l' Energie Atomique Saclay, 91190 Gif-sur-Yvette (France); Craescu, Constantin T. [INSERM U759, Institut Curie/Universite de Paris-Sud, 91405 Orsay Cedex (France); Gombault, Aurelie [Laboratoire du Stress et Pathologies du Cytosquelette, Universite Paris Diderot-Paris 7, CNRS, Institut de Biologie Fonctionnelle et Adaptative, 4 rue M.A. Lagroua Weill Halle, 75205 Paris cedex 13 (France); Roussel, Pascal [Institut Jacques Monod, UMR 7592, Universite Paris Diderot-Paris 7, CNRS, 15 rue Helene Brion, 75205 Paris (France); Vadrot, Nathalie; Vicart, Patrick [Laboratoire du Stress et Pathologies du Cytosquelette, Universite Paris Diderot-Paris 7, CNRS, Institut de Biologie Fonctionnelle et Adaptative, 4 rue M.A. Lagroua Weill Halle, 75205 Paris cedex 13 (France); Oestlund, Cecilia; Worman, Howard J. [Department of Medicine and Department of Pathology and Cell Biology, College of Physicians and Surgeons, Columbia University, New York, NY (United States); and others

    2011-12-10

    Lamins A and C are nuclear intermediate filament proteins expressed in most differentiated somatic cells. Previous data suggested that prelamin A, the lamin A precursor, accumulates in some lipodystrophy syndromes caused by mutations in the lamin A/C gene, and binds and inactivates the sterol regulatory element binding protein 1 (SREBP1). Here we show that, in vitro, the tail regions of prelamin A, lamin A and lamin C bind a polypeptide of SREBP1. Such interactions also occur in HeLa cells, since expression of lamin tail regions impedes nucleolar accumulation of the SREBP1 polypeptide fused to a nucleolar localization signal sequence. In addition, the tail regions of A-type lamin variants that occur in Dunnigan-type familial partial lipodystrophy of (R482W) and Hutchison Gilford progeria syndrome ( Increment 607-656) bind to the SREBP1 polypeptide in vitro, and the corresponding FLAG-tagged full-length lamin variants co-immunoprecipitate the SREBP1 polypeptide in cells. Overexpression of wild-type A-type lamins and variants favors SREBP1 polypeptide localization at the intranuclear periphery, suggesting its sequestration. Our data support the hypothesis that variation of A-type lamin protein level and spatial organization, in particular due to disease-linked mutations, influences the sequestration of SREBP1 at the nuclear envelope and thus contributes to the regulation of SREBP1 function.

  6. Isolation and characterization of a novel gene close to the human phosphoinositide-specific phospholipase C {beta}3 gene on chromosomal region 11q13

    Energy Technology Data Exchange (ETDEWEB)

    Lagercrantz, J.; Carson, E.; Larsson, C. [Karolinska Hospital, Stockholm (Sweden)] [and others

    1996-02-01

    We describe the isolation, characterization, and genomic structure of a gene, Phospholipase C {beta}3 Neighboring gene (PNG), located on chromosome 11q13. The cDNA was isolated using a cosmid that also contains the phospholipase C{beta}3 gene (PLCB3). PNG does not have any marked similarity to other known genes on the DNA level. However, analysis of hybridization to a panel of somatic cell hybrids indicates the existence of related sequences on chromosomes 2, 4, 7, and 22. PNG showed expression of a 1-kb message in multiple tissues. The predicted protein is 199 amino acids. The gene spans approximately 2.5 kb, divided into four exons and three introns. It is located 4.4 kb upstream of PLCB3, with the 5{prime} ends facing each other. The intergenic region has been completely sequenced, revealing separate CpG islands at both ends of this region. The islands are separated by a stretch of 2 kb, characterized by periodic alteration of the GC content. The 5{prime}-flanking region of PNG does not contain TATA or CCAAT, suggesting a housekeeping promoter structure. 22 refs., 4 figs., 1 tab.

  7. 75 FR 35613 - Airworthiness Directives; Bombardier, Inc. Model CL-600-2C10 (Regional Jet Series 700 & 701...

    Science.gov (United States)

    2010-06-23

    ... along with a repetitive replacement every 6,000 flight cycles. But with the introduction of Part C of... into a landing gear retraction problem on a production test flight revealed that, during aircraft... MCAI states: Investigation into a landing gear retraction problem on a production test flight revealed...

  8. Regional distribution of biogenic amines, amino acids and cholinergic markers in the CNS of the C57BL/6 strain

    NARCIS (Netherlands)

    Van Dam, D; Marescau, B; Cremers, T; Mulder, J; Engelborghs, S; De Deyn, PP

    A reliable extrapolation of neurochemical alterations from a mouse model to human metabolic brain disease requires knowledge of neurotransmitter levels and related compounds in control mouse brain. C57BL/6 is a widely used background strain for knockout and transgenic mouse models. A prerequisite

  9. Changes in the loco-regional cerebral blood flow (r.C.B.F.) during a simulation of weightlessness

    Science.gov (United States)

    Guell, A.; Dupui, Ph.; Barrere, M.; Fanjaud, G.; Bes, A.; Kotowskaia, A.

    Experiments of prolonged bedrest in antiorthostatic position are conducted in order to simulate cardio-circulatory modifications observed in weightlessness. Until now, no studies of r.C.B.F. have been effected in these conditions. Six young, healthy volunteers (average age 23.8) were placed in strict bedrest and in antiorthostatic position -4° for 7 days. The r.C.B.F. measurements were studied by 133Xe inhalation method using a 32 detectors system. Studies were made first in basal conditions, then between the 6th and 12th hr, and finally between the 72nd and the 78th hr after the beginning of the experiment. Three of the subjects received 0.450 mg of Clonidine daily during the experiment. In the subjects having taken no Clonidine, we observed a constant increase in r.C.B.F. (12, 17 and 16% respectively) in the first 12 hr; at the 72nd hour, all values had returned to basal state. This findings agrees with the well known notion of a rapid correction of hemodynamic disturbances observed in the first days of weightlessness. In the subjects treated with Clonidine, the increase of r.C.B.F. did not occur. Several mechanicsms of action are possible; the Clonidine affecting either the heart by inhibiting volemic atrial receptors, or the brain by direct vasoconstriction.

  10. Comparison of nucleotide sequence of p2C region in diabetogenic and non-diabetogenic Coxsacie virus B5 isolates.

    Science.gov (United States)

    Chou, Cheng-Chong; Lin, Kuei-Hsiang; Ke, Guan-Ming; Tung, Yi-Ching; Chao, Mei-Chyn; Cheng, Jeng-Yin; Chen, Bai-Hsiun

    2004-11-01

    Enteroviruses are environmental triggers in the pathogenesis of type 1 diabetes mellitus (DM). A sequence of six identical amino acids (PEVKEK) is shared by the 2C protein of Coxsackie virus B and the glutamic acid decarboxylase (GAD) molecules. Between 1995 and 2002, we investigated 22 Coxsackie virus B5 (CVB5) isolates from southern Taiwan. Four of these isolates were obtained from four new-onset type 1 DM patients with diabetic ketoacidosis. We compared a 300 nucleotide sequence in the 2C protein gene (p2C) in 24 CVB5 isolates (4 diabetogenic, 18 non-diabetogenic and 2 prototype). We found 0.3-10% nucleotide differences. In the four isolates from type 1 DM patients, there was only 2.4-3.4% nucleotide difference, and there was only 1.7-7.1% nucleotide difference between type 1 DM isolates and non-diabetogenic isolates. Comparison of the nucleotide sequence between prototype virus and 22 CVB5 isolates revealed 18.4-24.1% difference. Twenty-one CVB5 isolates from type 1 DM and non-type 1 DM patients contained the PEVKEK sequence, as shown by the p2C nucleotide sequence. Our data showed that the viral p2C sequence with homology with GAD is highly conserved in CVB5 isolates. There was no difference between diabetogenic and non-diabetogenic CVB5 isolates. All four type 1 DM patients had at least one of the genetic susceptibility alleles HLA-DR, DQA1, DQB1. Other genetic and autoimmune factors such as HLA genetic susceptibility and GAD may also play important roles in the pathogenesis in type 1 DM.

  11. Comparison of Nucleotide Sequence of P2C Region in Diabetogenic and Non-Diabetogenic Coxsackie Virus B5 Isolates

    Directory of Open Access Journals (Sweden)

    Cheng-Chong Chou

    2004-11-01

    Full Text Available Enteroviruses are environmental triggers in the pathogenesis of type 1 diabetes mellitus (DM. A sequence of six identical amino acids (PEVKEK is shared by the 2C protein of Coxsackie virus B and the glutamic acid decarboxylase (GAD molecules. Between 1995 and 2002, we investigated 22 Coxsackie virus B5 (CVB5 isolates from southern Taiwan. Four of these isolates were obtained from four new-onset type 1 DM patients with diabetic ketoacidosis. We compared a 300 nucleotide sequence in the 2C protein gene (p2C in 24 CVB5 isolates (4 diabetogenic, 18 non-diabetogenic and 2 prototype. We found 0.3-10% nucleotide differences. In the four isolates from type 1 DM patients, there was only 2.4-3.4% nucleotide difference, and there was only 1.7-7.1% nucleotide difference between type 1 DM isolates and non-diabetogenic isolates. Comparison of the nucleotide sequence between prototype virus and 22 CVB5 isolates revealed 18.4-24.1% difference. Twenty-one CVB5 isolates from type 1 DM and non-type 1 DM patients contained the PEVKEK sequence, as shown by the p2C nucleotide sequence. Our data showed that the viral p2C sequence with homology with GAD is highly conserved in CVB5 isolates. There was no difference between diabetogenic and non-diabetogenic CVB5 isolates. All four type 1 DM patients had at least one of the genetic susceptibility alleles HLA-DR, DQA1, DQB1. Other genetic and autoimmune factors such as HLA genetic susceptibility and GAD may also play important roles in the pathogenesis in type 1 DM.

  12. Regional correlations between [11C]PIB PET and post-mortem burden of amyloid-beta pathology in a diverse neuropathological cohort

    Directory of Open Access Journals (Sweden)

    Sang Won Seo

    2017-01-01

    Full Text Available Imaging-pathological correlation studies show that in vivo amyloid-β (Aβ positron emission tomography (PET strongly predicts the presence of significant Aβ pathology at autopsy. We sought to determine whether regional PiB-PET uptake would improve sensitivity for amyloid detection in comparison with global measures (experiment 1, and to estimate the relative contributions of different Aβ aggregates to in vivo PET signal (experiment 2. In experiment 1, 54 subjects with [11C] PiB-PET during life and postmortem neuropathologic examination (85.2% with dementia, interval from PET to autopsy 3.1 ± 1.9 years were included. We assessed Thal amyloid phase (N = 36 and CERAD score (N = 54 versus both global and regional PiB SUVRs. In experiment 2 (N = 42, PiB SUVR and post-mortem amyloid β burden was analyzed in five customized regions of interest matching regions sampled at autopsy. We assessed the relative contribution of neuritic plaques (NPs, diffuse plaques (DPs and cerebral amyloid angiopathy (CAA to regional PIB SUVR using multi-linear regression. In experiment 1, there were no differences in Area Under the Curve for amyloid phase ≥ A2 and CERAD score ≥ C2 between global and highest regional PiB SUVR (p = 0.186 and 0.230. In experiment 2, when NPs, DPs, and/or CAA were included in the same model, moderate to severe NPs were independently correlated with PiB SUVR in all regions except for the inferior temporal and calcarine ROI (β = 0.414–0.804, p < 0.05, whereas DPs were independently correlated with PiB SUVR in the angular gyrus ROI (β = 0.446, p = 0.010. CAA was also associated with PiB SUVR in the inferior temporal and calcarine ROI (β = 0.222–0.355, p < 0.05. In conclusion, global PiB-PET SUVR performed as well as regional values for amyloid detection in our cohort. The substrate-specific binding of PiB might differ among the brain specific regions.

  13. The tip region of the MacA alpha-hairpin is important for the binding to TolC to the Escherichia coli MacAB-TolC pump.

    Science.gov (United States)

    Xu, Yongbin; Sim, Se-Hoon; Song, Saemee; Piao, Shunfu; Kim, Hong-Man; Jin, Xiao Ling; Lee, Kangseok; Ha, Nam-Chul

    2010-04-16

    The tripartite efflux pump MacAB-TolC found in gram-negative bacteria is involved in resistance to antibiotics. We previously reported the funnel-like hexameric structure of the adaptor protein MacA to be physiologically relevant. In this study, we investigated the role of the tip region of its alpha-hairpin, which forms a cogwheel structure in the funnel-like shape of the MacA hexamer. Mutational and biochemical analyses revealed that the conserved residues located at the tip region of the alpha-hairpin of MacA play an essential role in the binding of TolC. Our findings offer a molecular basis for understanding the drug resistance of pathogenic bacteria. 2010 Elsevier Inc. All rights reserved.

  14. T-cell responsiveness to LCMV segregates as a single locus in crosses between BALB/cA and C.B-17 mice. Evidence for regulation by a gene outside the Igh region

    DEFF Research Database (Denmark)

    Christensen, Jan Pravsgaard; Marker, Ole; Thomsen, Allan Randrup

    1993-01-01

    with a difference in virus-specific T-cell responsiveness measured in terms of virus-specific cytotoxicity in vitro and delayed-type hypersensitivity in vivo. Analysis of F1, BC1 and F2 progeny showed that differential T-cell responsiveness was influenced by a single gene or gene complex; however, no linkage......The course of systemic infection with lymphocytic choriomeningitis virus (LCMV) was studied in BALB/cA and C.B-17 mouse strains differing in the immunoglobulin heavy chain region (Igh). Susceptibility to intracerebral infection and the ability to clear the virus differed significantly between...... these presumably congenic strains, suggesting that a gene in the Igh region might influence the course of this infection. A difference in virus spread prior to appearance of the immune response could not explain the observed differences. On the other hand, the differences in course of infection correlated...

  15. T-cell epitopes identified by BALB/c mice immunized with vaccinia expressing HIV-1 gag lie within immunodominant regions recognized by HIV-infected Indian patients

    Directory of Open Access Journals (Sweden)

    Ashwini V Shete

    2011-01-01

    Full Text Available Background: Human immunodeficiency virus (HIV antigens from transmitted strains of HIV would prove crucial in vaccine designing for prevention of HIV infection. Immune response generated by Vaccinia construct expressing the HIV-1 gag gene from transmitted Indian HIV-1 subtype C strain (Vgag in BALB/c mice is reported in the present study along with the identification of epitopes responsible for induction of the immune response. Aims: The aim of this study was to determine immune response generated by the constructs in a mouse model and to understand the epitope specificities of the response. Settings and Design: This was an observational study carried out in BALB/c mice. Materials and Methods: The immunogenecity of Vgag construct was evaluated in BALB/c mice after multiple immunizations. T-cell response was monitored by the interferon-γ ELISPOT assay using HIV-1 C Gag overlapping peptides and anti-P24 antibodies were estimated by ELISA. Statistical Analysis Used: Graphpad prism software was used for statistical analysis and for plotting graphs. Results: IFN-γ-secreting T cells and antibodies were detected against HIV Gag in mice after immunization. Although after repeated immunizations, antibody-mediated immune response increased or remained sustained, the magnitude of IFN-γ-secreting T cell was found to be decreased over time. The Gag peptides recognized by mice were mainly confined to the P24 region and had a considerable overlap with earlier reported immunodominant regions recognized by HIV-infected Indian patients. Conclusion: Vaccinia construct with a gag gene from transmitted HIV-1 virus was found to be immunogenic. The Gag regions identified by mice could have important implications in terms of future HIV vaccine designing.

  16. New primers for amplification of cytochrome c oxidase subunit I barcode region designed for species of Decapoda (Crustacea

    Directory of Open Access Journals (Sweden)

    Fernando L. Mantelatto

    Full Text Available Abstract We designed 14 new primers for amplification of the COI barcode region of decapod crustacean species. We tested, with high level of success, the generation of ~ 640 ± 49 base-pair sequences in selected groups of decapods (hermit crabs, squat lobsters, marine and freshwater crabs and shrimps, encompassing representatives of 27 genera of 15 families, 11 of Pleocyemata (Anomura, Brachyura, and Caridea and 4 of Dendrobranchiata. Based on the results we expect the applicability of these primers for several studies with different taxa within Decapoda.

  17. Computer-aided detection of breast lesions in DCE-MRI using region growing based on fuzzy C-means clustering and vesselness filter

    Science.gov (United States)

    B. Shokouhi, Shahriar; Fooladivanda, Aida; Ahmadinejad, Nasrin

    2017-12-01

    A computer-aided detection (CAD) system is introduced in this paper for detection of breast lesions in dynamic contrast-enhanced magnetic resonance imaging (DCE-MRI). The proposed CAD system firstly compensates motion artifacts and segments the breast region. Then, the potential lesion voxels are detected and used as the initial seed points for the seeded region-growing algorithm. A new and robust region-growing algorithm incorporating with Fuzzy C-means (FCM) clustering and vesselness filter is proposed to segment any potential lesion regions. Subsequently, the false positive detections are reduced by applying a discrimination step. This is based on 3D morphological characteristics of the potential lesion regions and kinetic features which are fed to the support vector machine (SVM) classifier. The performance of the proposed CAD system is evaluated using the free-response operating characteristic (FROC) curve. We introduce our collected dataset that includes 76 DCE-MRI studies, 63 malignant and 107 benign lesions. The prepared dataset has been used to verify the accuracy of the proposed CAD system. At 5.29 false positives per case, the CAD system accurately detects 94% of the breast lesions.

  18. A YAC contig and an EST map in the pericentromeric region of chromosome 13 surrounding the loci for neurosensory nonsyndromic deafness (DFNB1 and DFNA3) and Limb-Girdle muscular dystrophy type 2C (LGMD2C)

    Energy Technology Data Exchange (ETDEWEB)

    Guilford, P.; Crozet, F.; Blanchard, S. [Institut Pasteur, Paris (France)] [and others

    1995-09-01

    Two forms of inherited childhood nonsyndromic deafness (DFNB1 and DFNA3) and a Duchenne-like form of progressive muscular dystrophy (LGMD2C) have been mapped to the pericentromeric region of chromosome 13. To clone the genes responsible for these diseases we constructed a yeast artificial chromosome (YAC) contig spanning an 8-cM region between the polymorphic markers D13S221. The contig comprises 24 sequence-tagged sites, among which 15 were newly obtained. This contig allowed us to order the polymorphic markers centromere- D13S175-D13S141-D13S143-D13S115-AFM128yc1-D13S292-D13S283-AFM323vh5-D13S221-telomere. Eight expressed sequence tags, previously assigned to 13q11-q12 (D13S182E, D13S183E, D13S502E, D13S504E, D13S505E, D13S837E, TUBA2, ATP1AL1), were localized on the YAC contig. YAC screening of a cDNA library derived from mouse cochlea allowed us to identify an {alpha}-tubulin gene (TUBA2) that was subsequently precisely mapped within the candidate region. 36 refs., 2 figs., 2 tabs.

  19. Conformation and location of amorphous and semi-crystalline regions in C-type starch granules revealed by SEM, NMR and XRD.

    Science.gov (United States)

    Wang, Shujun; Yu, Jinglin; Yu, Jiugao

    2008-09-01

    The conformations and locations of amorphous and semi-crystalline regions in C-type starch granules from Chinese yam were evaluated by a combination of morphology and spectroscopy studies during acid hydrolysis. Scanning electron micrographs showed that amorphous or less crystalline areas were essentially located in the centre part of C-type starch granules, whereas the semi-crystalline and amorphous growth rings were found mainly in the outer part of the granules. (13)C cross-polarization magic angle spinning NMR ((13)C CP/MAS NMR) showed that amorphous regions were hydrolyzed faster than the crystalline ones. In addition, B-type polymorphs were shown to be hydrolyzed more rapidly than A-types. Powder X-ray diffraction (XRD) also revealed that the B-polymorph was hydrolyzed more rapidly than the A-type. XRD showed that the amorphous or less crystalline areas were mainly located in the core of starch granules, while the amorphous growth rings are distributed toward the outside of the granules and alternatively arranged with semi-crystalline growth rings. The amorphous or less crystalline areas predominantly consisted of the B-polymorph whereas the outer semi-crystalline and amorphous growth rings were mostly composed of the A-polymorph. Copyright © 2008 Elsevier Ltd. All rights reserved.

  20. In situ detection of Chlamydia pneumoniae, C. trachomatis, and cytokines among cardiovascular diseased patients from the Amazon region of Brazil.

    Science.gov (United States)

    Freitas, Larissa S; Almeida, Núbia Caroline C; Freitas Queiroz, Maria Alice; Zaninotto, Marcelo M; Fuzii, Hellen T; Ribeiro-Silva, Alfredo; Vallinoto, Antonio Cr; Ishak, Marluísa Og; Quaresma, Juarez As; Ishak, Ricardo

    2017-01-01

    Chronic coronary artery disease has been associated, as a consequence of the local inflammatory reaction with previous or persistent infection with Chlamydia pneumoniae, which led to the investigation of the association of cardiovascular disease and previous infection with C. trachomatis and the role of cytokine profile (in situ) markers in the vascular system tissues. Sixty-nine biopsies were collected for immunohistochemical analysis for the presence of IL-6, IL-8, TNF-α, IFN-γ, TGF-β, and IL-10, in 16 fragments from atheromatous plaques, 32 aorta fragments, and 21 valve fragments, using a tissue microarray technique for paraffin embedded tissues. Most patients undergoing revascularization surgery were men >50 years, while those undergoing valve replacement were mostly women pneumoniae (3.81% vs 1.92%; p=0.0115) and specifically in the aorta (4.83% vs 2.25%; p=0.0025); C. trachomatis infection was higher in valves, and C. pneumoniae in plaques, both without statistical significance. There was no significant difference in the cytokine staining profile between patients previously infected with both species and uninfected patients. Although there was no difference in the cytokine profile between patients previously infected with both species of Chlamydia, and uninfected patients, the presence of the bacteria antigens in the three biological specimens indicates it is important to focus on the role of C. trachomatis. It is necessary to improve the understanding of the natural history of chronic coronary artery disease and the clinical history of the patients and cytokine dynamics in cardiac disease in the presence or absence of infectious agents.

  1. Estimation of surface roughness in a semiarid region from C-band ERS-1 synthetic aperture radar data

    Directory of Open Access Journals (Sweden)

    E. E. Sano

    1999-12-01

    Full Text Available In this study, we investigated the feasibility of using the C-band European Remote Sensing Satellite (ERS-1 synthetic aperture radar (SAR data to estimate surface soil roughness in a semiarid rangeland. Radar backscattering coefficients were extracted from a dry and a wet season SAR image and were compared with 47 in situ soil roughness measurements obtained in the rocky soils of the Walnut Gulch Experimental Watershed, southeastern Arizona, USA. Both the dry and the wet season SAR data showed exponential relationships with root mean square (RMS height measurements. The dry C-band ERS-1 SAR data were strongly correlated (R² = 0.80, while the wet season SAR data have somewhat higher secondary variation (R² = 0.59. This lower correlation was probably provoked by the stronger influence of soil moisture, which may not be negligible in the wet season SAR data. We concluded that the single configuration C-band SAR data is useful to estimate surface roughness of rocky soils in a semiarid rangeland.

  2. Tempering/ageing in region 50 – 600 °C of quenched and cold deformed 585 GOLD alloy for jewelry production

    Directory of Open Access Journals (Sweden)

    R. Perić

    2014-04-01

    Full Text Available Numerous gold alloys posses the ability for thermal hardening, and this property is attractive for improving jewels strength, because the most noble alloys are weak. The thermal treating below the recrystallization temperature, is kind of tempering but also age-hardening. In this paper is made an attempt for studying the possibility for thermal hardening of 585 golden alloy. The goal is to increase the mechanical properties. Those demands could be reached by metallurgical controlling of phase transformations аnd proper thermal treating. Here is studied behavior of quenched and cold deformed gold alloy 585 after tempering/ageing in temperature region 50 - 600 °C, in intervals of 50 °C. The highest hardness values are obtained at temperatures about 200 °C for both initial states.

  3. Contribution of the C-terminal region within the catalytic core domain of HIV-1 integrase to yeast lethality, chromatin binding and viral replication

    Directory of Open Access Journals (Sweden)

    Belhumeur Pierre

    2008-11-01

    Full Text Available Abstract Background HIV-1 integrase (IN is a key viral enzymatic molecule required for the integration of the viral cDNA into the genome. Additionally, HIV-1 IN has been shown to play important roles in several other steps during the viral life cycle, including reverse transcription, nuclear import and chromatin targeting. Interestingly, previous studies have demonstrated that the expression of HIV-1 IN induces the lethal phenotype in some strains of Saccharomyces cerevisiae. In this study, we performed mutagenic analyses of the C-terminal region of the catalytic core domain of HIV-1 IN in order to delineate the critical amino acid(s and/or motif(s required for the induction of the lethal phenotype in the yeast strain HP16, and to further elucidate the molecular mechanism which causes this phenotype. Results Our study identified three HIV-1 IN mutants, V165A, A179P and KR186,7AA, located in the C-terminal region of the catalytic core domain of IN that do not induce the lethal phenotype in yeast. Chromatin binding assays in yeast and mammalian cells demonstrated that these IN mutants were impaired for the ability to bind chromatin. Additionally, we determined that while these IN mutants failed to interact with LEDGF/p75, they retained the ability to bind Integrase interactor 1. Furthermore, we observed that VSV-G-pseudotyped HIV-1 containing these IN mutants was unable to replicate in the C8166 T cell line and this defect was partially rescued by complementation with the catalytically inactive D64E IN mutant. Conclusion Overall, this study demonstrates that three mutations located in the C-terminal region of the catalytic core domain of HIV-1 IN inhibit the IN-induced lethal phenotype in yeast by inhibiting the binding of IN to the host chromatin. These results demonstrate that the C-terminal region of the catalytic core domain of HIV-1 IN is important for binding to host chromatin and is crucial for both viral replication and the promotion of

  4. A [11C]Ro15 4513 PET study suggests that alcohol dependence in man is associated with reduced α5 benzodiazepine receptors in limbic regions.

    Science.gov (United States)

    Lingford-Hughes, Anne; Reid, Alastair G; Myers, James; Feeney, Adrian; Hammers, Alexander; Taylor, Lindsay G; Rosso, Lula; Turkheimer, Federico; Brooks, David J; Grasby, Paul; Nutt, David J

    2012-02-01

    Preclinical evidence suggests the α5 subtype of the GABA-benzodiazepine receptor is involved in some of the actions of alcohol and in memory. The positron emission tomography (PET) tracer, [(11)C]Ro15 4513 shows relative selectivity in labelling the α5 subtype over the other GABA-benzodiazepine receptor subtypes in limbic regions of the brain. We used this tracer to investigate the distribution of α5 subtype availability in human alcohol dependence and its relationship to clinical variables. Abstinent (>6 weeks) alcohol-dependent men and healthy male controls underwent an [(11)C]Ro15 4513 PET scan. We report [(11)C]Ro15 4513 brain uptake for 8 alcohol-dependent men and 11 healthy controls. We found a significant reduction in [(11)C]Ro15 4513 binding in the nucleus accumbens, parahippocampal gyri, right hippocampus and amygdala in the alcohol-dependent compared with the healthy control group. Levels of [(11)C]Ro15 4513 binding in both hippocampi were significantly and positively associated with performance on a delayed verbal memory task in the alcohol-dependent but not the control group. We speculate that the reduced limbic [(11)C]Ro15 4513 binding seen here results from the effects of alcohol, though we cannot currently distinguish whether they are compensatory in nature or evidence of brain toxicity.

  5. Distinct repeat motifs at the C-terminal region of CagA of Helicobacter pylori strains isolated from diseased patients and asymptomatic individuals in West Bengal, India

    Directory of Open Access Journals (Sweden)

    Chattopadhyay Santanu

    2012-05-01

    Full Text Available Abstract Background Infection with Helicobacter pylori strains that express CagA is associated with gastritis, peptic ulcer disease, and gastric adenocarcinoma. The biological function of CagA depends on tyrosine phosphorylation by a cellular kinase. The phosphate acceptor tyrosine moiety is present within the EPIYA motif at the C-terminal region of the protein. This region is highly polymorphic due to variations in the number of EPIYA motifs and the polymorphism found in spacer regions among EPIYA motifs. The aim of this study was to analyze the polymorphism at the C-terminal end of CagA and to evaluate its association with the clinical status of the host in West Bengal, India. Results Seventy-seven H. pylori strains isolated from patients with various clinical statuses were used to characterize the C-ternimal polymorphic region of CagA. Our analysis showed that there is no correlation between the previously described CagA types and various disease outcomes in Indian context. Further analyses of different CagA structures revealed that the repeat units in the spacer sequences within the EPIYA motifs are actually more discrete than the previously proposed models of CagA variants. Conclusion Our analyses suggest that EPIYA motifs as well as the spacer sequence units are present as distinct insertions and deletions, which possibly have arisen from extensive recombination events. Moreover, we have identified several new CagA types, which could not be typed by the existing systems and therefore, we have proposed a new typing system. We hypothesize that a cagA gene encoding higher number EPIYA motifs may perhaps have arisen from cagA genes that encode lesser EPIYA motifs by acquisition of DNA segments through recombination events.

  6. Clinical significance of SNP (rs2596542 in histocompatibility complex class I-related gene A promoter region among hepatitis C virus related hepatocellular carcinoma cases

    Directory of Open Access Journals (Sweden)

    Amal A. Mohamed

    2017-07-01

    Full Text Available The major histocompatibility complex class I-related gene A (MICA is an antigen induced by stress and performs an integral role in immune responses as an anti-infectious and antitumor agent. This work was designed to investigate whether (SNP rs2596542C/T in MICA promoter region is predictive of liver cirrhosis (LC and hepatocellular carcinoma (HCC or not. Forty-seven healthy controls and 94 HCV-infected patients, subdivided into 47 LC and 47 HCC subjects were enrolled in this study. SNP association was studied using real time PCR and soluble serum MICA concentration was measured using ELISA. Results showed that heterozygous genotype rs2596542CT was significantly (P = 0.022 distributed between HCC and LC related CHC patients. The sMICA was significantly higher (P = 0.0001 among HCC and LC. No significant association (P = 0.56 between rs2596542CT genotypes and sMICA levels was observed. Studying SNP rs2596542C/T association with HCC and LC susceptibility revealed that statistical significant differences (P = 0.013, P = 0.027 were only observed between SNP rs2596542C/T and each of HCC and LC, respectively, versus healthy controls, indicating that the rs2596542C/T genetic variation is not a significant contributor to HCC development in LC patients. Moreover, the T allele was considered a risk factor for HCC and LC vulnerability in HCV patients (OR = 1.93 and 2.1, respectively, while the C allele contributes to decreasing HCC risk. Therefore, SNP (rs2596542C/T in MICA promoter region and sMICA levels might be potential useful markers in the assessment of liver disease progression to LC and HCC.

  7. A variant of the bovine noradrenaline transporter reveals the importance of the C-terminal region for correct targeting to the membrane and functional expression.

    Science.gov (United States)

    Burton, L D; Kippenberger, A G; Lingen, B; Brüss, M; Bönisch, H; Christie, D L

    1998-03-01

    We have characterized a cDNA clone which encodes a variant (bNAT2) of the bovine noradrenaline transporter. This cDNA differs from the previously identified bovine noradrenaline transporter (bNAT1) in the sequence encoding part of the cytoplasmic-facing C-terminus and the 3'-untranslated region. The bNAT1 and bNAT2 cDNA clones are encoded by a 5.8 and 3.6 kb mRNA species respectively. The bNAT1 and bNAT2 proteins, which are identical apart from their C-terminal 31 and 18 residues, were stably expressed in HEK293 cells. Cells expressing bNAT1 showed a high level of desipramine-sensitive [3H]noradrenaline uptake activity, whereas no activity was present in bNAT2 cells. The bNAT1 and bNAT2 proteins were present as major 80 and 50 kDa species respectively. Cells expressing bNAT1 showed strong immunostaining of the plasma membrane, whereas bNAT2 was present in the endoplasmic reticulum/Golgi region. Treatment of membrane samples from bNAT1 cells with peptide N-glycosidase F resulted in the formation of a predominantly 50 kDa species, but little effect was observed after similar treatment of bNAT2 cell membranes. These results indicate that bNAT2 is retained in the endoplasmic reticulum and that the glycosylation of this variant differs from that of bNAT1. The characterization of bNAT2 and its comparison with bNAT1 highlight the importance of the cytoplasmic-facing C-terminus for the intracellular trafficking of neurotransmitter transporters.

  8. Region-specific alterations of A-to-I RNA editing of serotonin 2c receptor in the cortex of suicides with major depression.

    Science.gov (United States)

    Weissmann, D; van der Laan, S; Underwood, M D; Salvetat, N; Cavarec, L; Vincent, L; Molina, F; Mann, J J; Arango, V; Pujol, J F

    2016-08-30

    Brain region-specific abnormalities in serotonergic transmission appear to underlie suicidal behavior. Alterations of RNA editing on the serotonin receptor 2C (HTR2C) pre-mRNA in the brain of suicides produce transcripts that attenuate 5-HT2CR signaling by impairing intracellular G-protein coupling and subsequent intracellular signal transduction. In brain, the distribution of RNA-editing enzymes catalyzing deamination (A-to-I modification) shows regional variation, including within the cerebral cortex. We tested the hypothesis that altered pre-mRNA 5-HT2CR receptor editing in suicide is region-specific. To this end, we investigated the complete 5-HT2CR mRNA-editing profile in two architectonically distinct cortical areas involved in mood regulation and decision-making in a clinically well-characterized cohort of age- and sex-matched non-psychiatric drug-free controls and depressed suicides. By using an original biochemical detection method, that is, capillary electrophoresis single-stranded conformational polymorphism (CE-SSCP), we corroborated the 5-HT2CR mRNA-editing profile previously described in the dorsolateral prefrontal cortex (Brodmann area 9 (BA9)). Editing of 5-HT2CR mRNA displayed clear regional difference when comparing dorsolateral prefrontal cortex (BA9) and anterior cingulate cortex (BA24). Compared with non-psychiatric control individuals, alterations of editing levels of 5-HT2CR mRNA were detected in both cortical areas of depressed suicides. A marked increase in editing on 5-HT2CR was especially observed in the anterior cingulate cortex in suicides, implicating this cortical area in suicide risk. The results suggest that region-specific changes in RNA editing of 5-HT2CR mRNA and deficient receptor function likely contribute to the etiology of major depressive disorder or suicide.

  9. The isoform-specific region of the Na,K-ATPase catalytic subunit: role in enzyme kinetics and regulation by protein kinase C.

    Science.gov (United States)

    Duran, Marie-Josée; Pierre, Sandrine V; Carr, Deborah L; Pressley, Thomas A

    2004-12-28

    Comparisons of the primary structures of the Na,K-ATPase alpha-isoforms reveal the existence of regions of structural divergence, suggesting that they are involved in unique functions. One of these regions is the isoform-specific region (ISR), located near the ATP binding site in the major cytoplasmic loop. To evaluate its importance, we constructed mutants of the rodent wild-type alpha1 and alpha3 isoforms in which the ISR was replaced with irrelevant sequences, i.e., the analogous region from the rat gastric H,K-ATPase catalytic subunit or a region from the human c-myc oncogene. Opossum kidney (OK) cells were transfected with wild-type rat alpha1, alpha3, or their corresponding chimeras and selected in ouabain. Introduction of either mutant produced ouabain-resistant colonies, consistent with functional expression of the chimeric protein and indicating that the ISR is not essential for overall Na,K-ATPase function. The introduced chimeras were then characterized enzymatically by measuring the relative rate of K(+) and Li(+) deocclusions. Results showed that exchanges of both alpha1 and alpha3 ISRs significantly modified the sensitivity for the enzyme to either K(+) or Li(+). Subsequent treatment of the cells with phorbol esters revealed an altered Na,K-ATPase transport in response to protein kinase C activation for the alpha1 chimeras. No changes were observed for the alpha3 isoform, suggesting that it is not sensitive to PKC regulation. These results demonstrated that the ISR plays an important role in ion deocclusion and in the response to PKC (only for the alpha1 isoform).

  10. Identification of a novel mutation in the β-globin gene 3' untranslated region (HBB: c.*+118A > G) in Spain.

    Science.gov (United States)

    Herrera, Maria Ascensión; De La Fuente-Gonzalo, Félix; González, Fernando Ataúlfo; Nieto, Jorge M; Dominguez, Alejandra Blum; Villegas, Ana; Ropero, Paloma

    2015-01-01

    The 3' untranslated region (3'UTR) region is well known to be associated with mRNA stability because of its associations with 3' end processing, polyadenylation and mRNA capping. Mutations located in this area cause a β-thalassemia (β-thal) phenotype compatible with β(+)-thal. Two brothers, 49- and 41-years-old, were diagnosed with β-thal intermedia (β-TI) at 2 years of age. The β-globin gene from the promoter region to the 3'UTR was sequenced and both brothers were diagnosed to be compound heterozygotes for the 3'UTR +1592 (A > G) (HBB: c.*+118A > G) and codon 39 (C > T) (HBB: c.118C > T) mutations. Their mother was a carrier of the nonsense codon 39 mutation and her hematological data suggested β-thal trait; their father was a carrier of the 3'UTR +1592 mutation, though he did not have hematological parameters associated with β-thal. The adenine at position +1592 or +118 bases downstream of the termination codon is highly conserved among primates and placental mammals, as it is located between the polyadenylation A signal (PAS) and the polyadenylation A cleavage (PAC) sites. Given its location, it is likely that this mutation would interfere with mRNA maturation; however, the clinical data of the heterozygous carriers show virtually no significant alterations. Therefore, we suggest that the impact on cleavage-stimulation factor (CstF) recognition of the mRNA sequence would be minimal and not significantly alter polyadenylation. Although the mechanism is not known, and because the carrier has no β-thal minor, the mRNA is stable enough that the synthesis of the β-globin chain is unaffected.

  11. Mapping a region of hepatitis C virus E2 that is responsible for escape from neutralizing antibodies and a core CD81-binding region that does not tolerate neutralization escape mutations.

    Science.gov (United States)

    Keck, Zhen-Yong; Saha, Anasuya; Xia, Jinming; Wang, Yong; Lau, Patrick; Krey, Thomas; Rey, Felix A; Foung, Steven K H

    2011-10-01

    Understanding the interaction between broadly neutralizing antibodies and their epitopes provides a basis for the rational design of a preventive hepatitis C virus (HCV) vaccine. CBH-2, HC-11, and HC-1 are representatives of antibodies to overlapping epitopes on E2 that mediate neutralization by blocking virus binding to CD81. To obtain insights into escape mechanisms, infectious cell culture virus, 2a HCVcc, was propagated under increasing concentrations of a neutralizing antibody to isolate escape mutants. Three escape patterns were observed with these antibodies. First, CBH-2 escape mutants that contained mutations at D431G or A439E, which did not compromise viral fitness, were isolated. Second, under the selective pressure of HC-11, escape mutations progressed from a single L438F substitution at a low antibody concentration to double substitutions, L438F and N434D or L438F and T435A, at higher antibody concentrations. Escape from HC-11 was associated with a loss of viral fitness. An HCV pseudoparticle (HCVpp) containing the L438F mutation bound to CD81 half as efficiently as did wild-type (wt) HCVpp. Third, for HC-1, the antibody at a critical concentration completely suppressed viral replication and generated no escape mutants. Epitope mapping revealed contact residues for CBH-2 and HC-11 in two regions of the E2 glycoprotein, amino acids (aa) 425 to 443 and aa 529 to 535. Interestingly, contact residues for HC-1 were identified only in the region encompassing aa 529 to 535 and not in aa 425 to 443. Taken together, these findings point to a region of variability, aa 425 to 443, that is responsible primarily for viral escape from neutralization, with or without compromising viral fitness. Moreover, the region aa 529 to 535 is a core CD81 binding region that does not tolerate neutralization escape mutations.

  12. Wetlands Research Program. Corps of Engineers Wetlands Delineation Manual. Appendix C. Sections 1 and 2. Region 2 - Southeast.

    Science.gov (United States)

    1987-01-01

    Common sneezeweed FACW H. revi ’ OiU7 (Nutt.) Wood Shortleaf sneezeweed O8L c-ar’reatre Snail Sneezeweed FAG dr’errondii H. Rock Fringed sneezeweed OBL *i...Aea~euca quinquenervia (Cay.) Blake Punk tree FAC ’-.ean thera anqustifoZia A. Rich. Melanthera FACW- lc.eZ-rtP-w’m virginic’ze L. Common bunchf...FAC :,. thomasii Sarg. Rock elm FAC "rechites lzutea (L.) Britton Rubber-vine OBL Urtica dic’ica L. Slimsting nettle FAC+ "tricularia =’ethystina Salzm

  13. Compromiso cívico y participación ciudadana en México: una perspectiva nacional y regional

    OpenAIRE

    Víctor Alejandro ESPINOZA VALLE

    2008-01-01

    RESUMEN: La transición a la democracia en México no conoció rupturas ni pactos fundacionales, siendo conducida por una serie de reformas electorales. El sistema de partido hegemónico privilegió el intercambio corporativo entre gobierno y sociedad, lo que se tradujo en un histórico retraimiento de la participación ciudadana. La cultura política nacional evidencia un déficit en el compromiso cívico y en la participación electoral. En este trabajo se analizan los resultados de tres encuestas de ...

  14. Diode laser spectroscopy of two acetylene isotopologues ((12)C2H2, (13)C(12)CH2) in the 1.533 microm region for the PHOBOS-Grunt space mission.

    Science.gov (United States)

    Li, Jingsong; Joly, Lilian; Cousin, Julien; Parvitte, Bertrand; Bonno, Bernard; Zeninari, Virginie; Durry, Georges

    2009-12-01

    Several line intensities of the nu(1) + nu(3)(Sigma(u)(+)) - 0(Sigma(g)(+)) bands of (12)C(2)H(2) and (13)C(12)CH(2) at 1.533 microm have been revised at room temperature. These molecular transitions were selected to measure acetylene within the framework of the Martian space mission PHOBOS-Grunt. In the spectral region ranging from 6518 to 6530 cm(-1), 10 lines of both isotopologues have been analyzed using a high resolution tunable diode laser spectrometer. These transitions are well appropriate to the monitoring of C(2)H(2) by laser absorption spectroscopy with standard telecommunication laser diodes. Both the Voigt and the Rautian models are used to fit the molecular line shape and to provide accurate line strengths. Our data are thoroughly compared to existing database (including HITRAN08) and former experimental measurements.

  15. OH (1720 MHz) MASERS: A MULTIWAVELENGTH STUDY OF THE INTERACTION BETWEEN THE W51C SUPERNOVA REMNANT AND THE W51B STAR FORMING REGION

    Energy Technology Data Exchange (ETDEWEB)

    Brogan, C. L.; Hunter, T. R. [National Radio Astronomy Observatory, 520 Edgemont Rd, Charlottesville, VA 22903 (United States); Goss, W. M.; Chandler, C. J.; Claussen, M. J. [National Radio Astronomy Observatory, P.O. Box 0, Socorro, NM 87801 (United States); Richards, A. M. S. [Jodrell Bank Centre for Astrophysics, Turing Building, University of Manchester, Manchester M13 9PL (United Kingdom); Lazendic, J. S. [Monash University, Clayton, VIC 3800 (Australia); Koo, B.-C. [Astronomy Program, SEES, Seoul National University, Seoul 151-742 (Korea, Republic of); Hoffman, I. M., E-mail: cbrogan@nrao.edu [Wittenberg University, Springfield, OH 45501 (United States)

    2013-07-10

    We present a comprehensive view of the W51B H II region complex and the W51C supernova remnant (SNR) using new radio observations from the VLA, VLBA, MERLIN, JCMT, and CSO along with archival data from Spitzer, ROSAT, ASCA, and Chandra. Our VLA data include the first {lambda} = 400 cm (74 MHz) continuum image of W51 at high resolution (88''). The 400 cm image shows non-thermal emission surrounding the G49.2-0.3 H II region, and a compact source of non-thermal emission (W51B{sub N}T) coincident with the previously-identified OH (1720 MHz) maser spots, non-thermal 21 and 90 cm emission, and a hard X-ray source. W51B{sub N}T falls within the region of high likelihood for the position of TeV {gamma}-ray emission. Using the VLBA, three OH (1720 MHz) maser spots are detected in the vicinity of W51B{sub N}T with sizes of 60-300 AU and Zeeman effect magnetic field strengths of 1.5-2.2 mG. The multiwavelength data demonstrate that the northern end of the W51B H II region complex has been partly enveloped by the advancing W51C SNR and this interaction explains the presence of W51B{sub N}T and the OH masers. This interaction also appears in the thermal molecular gas which partially encircles W51B{sub N}T and exhibits narrow pre-shock ({Delta}v {approx} 5 km s{sup -1}) and broad post-shock ({Delta}v {approx} 20 km s{sup -1}) velocity components. RADEX radiative transfer modeling of these two components yield physical conditions consistent with the passage of a non-dissociative C-type shock. Confirmation of the W51B/W51C interaction provides additional evidence in favor of this region being one of the best candidates for hadronic particle acceleration known thus far.

  16. Dependence of C-Band Backscatter on Ground Temperature, Air Temperature and Snow Depth in Arctic Permafrost Regions

    Directory of Open Access Journals (Sweden)

    Helena Bergstedt

    2018-01-01

    Full Text Available Microwave remote sensing has found numerous applications in areas affected by permafrost and seasonally frozen ground. In this study, we focused on data obtained by the Advanced Scatterometer (ASCAT, C-band during winter periods when the ground is assumed to be frozen. This paper discusses the relationships of ASCAT backscatter with snow depth, air and ground temperature through correlations and the analysis of covariance (ANCOVA to quantify influences on backscatter values during situations of frozen ground. We studied sites in Alaska, Northern Canada, Scandinavia and Siberia. Air temperature and snow depth data were obtained from 19 World Meteorological Organization (WMO and 4 Snow Telemetry (SNOTEL stations. Ground temperature data were obtained from 36 boreholes through the Global Terrestrial Network for Permafrost Database (GTN-P and additional records from central Yamal. Results suggest distinct differences between sites with and without underlying continuous permafrost. Sites characterized by high freezing indices (>4000 degree-days have consistently stronger median correlations of ASCAT backscatter with ground temperature for all measurement depths. We show that the dynamics in winter-time backscatter cannot be solely explained through snow processes, but are also highly correlated with ground temperature up to a considerable depth (60 cm. These findings have important implications for both freeze/thaw and snow water equivalent retrieval algorithms based on C-band radar measurements.

  17. Dynamics and sources of soil organic C following afforestation of croplands with poplar in a semi-arid region in northeast China.

    Directory of Open Access Journals (Sweden)

    Ya-Lin Hu

    Full Text Available Afforestation of former croplands has been proposed as a promising way to mitigate rising atmospheric CO2 concentration in view of the commitment to the Kyoto Protocol. Central to this C sequestration is the dynamics of soil organic C (SOC storage and stability with the development of afforested plantations. Our previous study showed that SOC storage was not changed after afforestation except for the 0-10 cm layer in a semi-arid region of Keerqin Sandy Lands, northeast China. In this study, soil organic C was further separated into light and heavy fractions using the density fractionation method, and their organic C concentration and (13C signature were analyzed to investigate the turnover of old vs. new SOC in the afforested soils. Surface layer (0-10 cm soil samples were collected from 14 paired plots of poplar (Populus × xiaozhuanica W. Y. Hsu & Liang plantations with different stand basal areas (the sum of the cross-sectional area of all live trees in a stand, ranging from 0.2 to 32.6 m(2 ha(-1, and reference maize (Zea mays L. croplands at the same sites as our previous study. Soil ΔC stocks (ΔC refers to the difference in SOC content between a poplar plantation and the paired cropland in bulk soil and light fraction were positively correlated with stand basal area (R (2 = 0.48, p<0.01 and R (2 = 0.40, p = 0.02, respectively, but not for the heavy fraction. SOCcrop (SOC derived from crops contents in the light and heavy fractions in poplar plantations were significantly lower as compared with SOC contents in croplands, but tree-derived C in bulk soil, light and heavy fraction pools increased gradually with increasing stand basal area after afforestation. Our study indicated that cropland afforestation could sequester new C derived from trees into surface mineral soil, but did not enhance the stability of SOC due to a fast turnover of SOC in this semi-arid region.

  18. Evolution and estimated age of the C5 Lukala carbonate-evaporite ramp complex in the Lower Congo region (Democratic Republic of Congo): New perspectives in Central Africa

    Science.gov (United States)

    Delpomdor, F.; Van Vliet, N.; Devleeschouwer, X.; Tack, L.; Préat, A.

    2018-01-01

    New detailed lithological, sedimentological, chemostratigraphic data were obtained from exploration drilling samples on the C5 carbonate-dominated formation of the Neoproterozoic Lukala Subgroup (former Schisto-Calcaire Subgroup) from the West Congo Belt (WCB) in the Democratic Republic of Congo. This formation records the last post-Marinoan sea-level events that occurred in the whole basin, followed by the development of the Araçuaï-West Congo Orogen between 630 and 560 Ma. The C5 Formation consists of back-reef lagoonal and peritidal/sabkha cycles of ∼2.0 m in thickness, that record a short-time marine regression, rapidly flooded by a marine transgression with deposition of organic-rich argillaceous carbonates or shales under dysoxia and anoxia conditions. These dysoxic/anoxic waters were rapidly followed by a regional-scale marine transgression, favouring mixing with well-oxygenated waters, and the development of benthic Tonian to Cambro-Ordovician Obruchevella parva-type 'seagrasses' in the nearshore zones of the lagoons. New δ13C and 87Sr/86Sr isotopic data in the C5 Formation of the Lukala Subgroup are used in the frame of a correlation with the Sete Lagoas Formation in Brazil. Relatively comparable negative to positive δ13C excursions point to marine flooding of the whole basin and allow extension of the debatable Late Ediacaran age of the uppermost Sete Lagoas and C5 formations. Sr isotope ;blind dating; failed due to low Sr concentration related to a dolomitization event close 540 Ma. Several tentative datings of the C5 Formation converge to a Late Ediacaran age ranging between 575 and 540 Ma. As the overlying Mpioka folded Subgroup, the C5 series suffered the Pan African deformation, dated at 566 ± 42 Ma. Unlike the previously generally accepted interpretation, our data suggests that the Mpioka Subgroup was deposited in the Early Cambrian.

  19. On the Formation of the C2H6O Isomers Ethanol (C2H5OH) and Dimethyl Ether (CH3OCH3) in Star-forming Regions

    Science.gov (United States)

    Bergantini, Alexandre; Maksyutenko, Pavlo; Kaiser, Ralf I.

    2017-06-01

    The structural isomers ethanol (CH3CH2OH) and dimethyl ether (CH3OCH3) were detected in several low-, intermediate-, and high-mass star-forming regions, including Sgr B2, Orion, and W33A, with the relative abundance ratios of ethanol/dimethyl ether varying from about 0.03 to 3.4. Until now, no experimental data regarding the formation mechanisms and branching ratios of these two species in laboratory simulation experiments could be provided. Here, we exploit tunable photoionization reflectron time-of-flight mass spectrometry (PI-ReTOF-MS) to detect and analyze the production of complex organic molecules (COMs) resulting from the exposure of water/methane (H2O/CH4) ices to energetic electrons. The main goal is to understand the formation mechanisms in star-forming regions of two C2H6O isomers: ethanol (CH3CH2OH) and dimethyl ether (CH3OCH3). The results show that the experimental branching ratios favor the synthesis of ethanol versus dimethyl ether (31 ± 11:1). This finding diverges from the abundances observed toward most star-forming regions, suggesting that production routes on interstellar grains to form dimethyl ether might be missing; alternatively, ethanol can be overproduced in the present simulation experiments, such as via radical-radical recombination pathways involving ethyl and hydroxyl radicals. Finally, the PI-ReTOF-MS data suggest the formation of methylacetylene (C3H4), ketene (CH2CO), propene (C3H6), vinyl alcohol (CH2CHOH), acetaldehyde (CH3CHO), and methyl hydroperoxide (CH3OOH), in addition to ethane (C2H6), methanol (CH3OH), and CO2 detected from infrared spectroscopy. The yield of all the confirmed species is also determined.

  20. Regional distribution of the opioid receptor agonist N-(methyl- sup 11 C)pethidine in the brain of the rhesus monkey studied with positron emission tomography

    Energy Technology Data Exchange (ETDEWEB)

    Hartvig, P. (Hospital Pharmacy, University Hospital, Uppsala (Sweden)); Eckernaes, S.Aa. (Departments of Neurology, University Hospital, Uppsala (Sweden)); Lindberg, B.S. (Department of Obstetrics and Gynaelogy, University Hospital, Uppsala (Sweden)); Lundqvist, H. (Centre for Radiation Sciences, University of Uppsala (Sweden)); Antoni, G.; Rimland, A.; Laangstroem, B. (Department of Organic Chemistry, University of Uppsala (Sweden))

    1990-01-01

    The regional distribution and kinetics in the brain of Rhesus monkeys of N-(methyl-{sup 11}C)-pethidine have been studied by positron emission tomography, PET. {sup 11}C-Pethidine reached the brain with peak radioactivities appearing within 6-10 min. after administration. Highest radioactivities were measured in areas corresponding to the thalamus, the striatal area and also the lowest transection of the temporal lobes, with an uptake of 2.7-3.1 times the homogenous dilution of the radioactive dose. Low radioactivities were seen in the cerebellum and the occipital lobes. This distribution corresponds to the regional density of opioid receptors using in vitro binding techniques. The {sup 11}C-pethidine derived radioactivity left the brain with an initial half-life of 40--60 minutes, followed by an elimination which paralleled the plasma elimination of unlabelled pethidine. After pretreatment of the monkey with a small dose of naloxone, the radioactivities decreased about 40% in areas corresponding to the thalamus, striatum and lowest section of the temporal lobes, indicating competition for the same binding sties. By the use of a three-compartment model, it was possible to get an estimate of {sup 11}C-pethidine receptor binding characteristics in the brain. The ratio of Kon/Koff, equal to Bmax.Kd, was 0.06-0.1. This indicates that pethidine is bound with low affinity to the opioid receptors and is a poor ligand for studies of opioid receptor function with PET. Brain kinetics of {sup 11}C-pethidine is mainly determined by its blood kinetics. (author).

  1. Molecular gas in the Galactic center region. I. Data from a large scale C18O(J = 1-->0) survey

    Science.gov (United States)

    Dahmen, G.; Huettemeister, S.; Wilson, T. L.; Mauersberger, R.; Linhart, A.; Bronfman, L.; Tieftrunk, A. R.; Meyer, K.; Wiedenhoever, W.; Dame, T. M.; Palmer, E. S.; May, J.; Aparici, J.; Mac-Auliffe, F.

    1997-12-01

    A large scale survey of the Galactic center region in the C18O(J = 1 --> 0) transition is presented. This survey was obtained with the 1.2m Southern Millimeter-Wave Telescope (SMWT) at the Cerro Tololo Interamerican Observatory (CTIO) near La Serena, Chile. It covers the region -1.05d <= l <= +3.6d and -0.9d <= b <= +0.75d with a grid spacing of 9', i.e. the sampling is at full FWHP beamwidth. 357 positions were in total observed. After reviewing the instrumentation of the 1.2m SMWT, the observing techniques, and the methods used in the data reduction, the data of the survey are presented and morphologically described. In addition, data of the HNCO(5_{0,5}-4_{0,4}) line are presented, which was also included in the large bandwidth of the spectrometer. 12CO(1-0) measurements performed for comparison purposes are presented and compared with other 12CO results. The maps of the C18O(1-0) survey demonstrate that there are great differences between the distribution of the optically thin C18O(1-0) emission and the usually optically thick 12CO(1-0) emission.

  2. Cloning and molecular characterization of the cDNAs encoding the variable regions of an anti-CD20 monoclonal antibody.

    Science.gov (United States)

    Shanehbandi, Dariush; Majidi, Jafar; Kazemi, Tohid; Baradaran, Behzad; Aghebati-Maleki, Leili

    2017-01-01

    CD20-based targeting of B-cells in hematologic malignancies and autoimmune disorders is associated with outstanding clinical outcomes. Isolation and characterization of VH and VL cDNAs encoding the variable regions of the heavy and light chains of monoclonal antibodies (MAb) is necessary to produce next generation MAbs and their derivatives such as bispecific antibodies (bsAb) and single-chain variable fragments (scFv). This study was aimed at cloning and characterization of the VH and VL cDNAs from a hybridoma cell line producing an anti-CD20 MAb. VH and VL fragments were amplified, cloned and characterized. Furthermore, amino acid sequences of VH, VL and corresponding complementarity-determining regions (CDR) were determined and compared with those of four approved MAbs including Rituximab (RTX), Ibritumomab tiuxetan, Ofatumumab and GA101. The cloned VH and VL cDNAs were found to be functional and follow a consensus pattern. Amino acid sequences corresponding to the VH and VL fragments also indicated noticeable homologies to those of RTX and Ibritumomab. Furthermore, amino acid sequences of the relating CDRs had remarkable similarities to their counterparts in RTX and Ibritumomab. Successful recovery of VH and VL fragments encourages the development of novel CD20 targeting bsAbs, scFvs, antibody conjugates and T-cells armed with chimeric antigen receptors.

  3. Appearance and chronology of Textile ceramics in the Middle and Upper Volga region: critical comparison of conventional 14C-, AMS- and typological chronologies

    Directory of Open Access Journals (Sweden)

    Lavento Mika T.

    2015-06-01

    Full Text Available The article offers a comparison of three different methods of chronology construction – conventional 14C (radiocarbon dating, AMS (accelerator mass-spectrometry dating and the so called typological chronology – to date the textile ceramics of the Bronze – Early Iron Age in the Northern Coniferous Zone of Europe, from the Upper and Middle Volga and Kama Rivers to the Baltic region and Scandinavia. The Textile Ceramics Culture (also known as “Net”, “Pseudo-textile”, “Spun-and-speckled” is often associated with a Finnish-speaking community from the Bronze – beginning of the Iron Age. The earliest date of the Textile Ceramics sites on the Middle Oka River is presumably considered to be the 18 th century BC. Datings of the reference sites in the Middle Volga region were fixed within the 15 th – 8 th centuries BC. Comparing these data with the AMS chronology available for the materials from Finland and Estonia, the authors conclude that appearance of the Textile Ceramics was almost synchronous in the Volga and the Baltic regions, although chronology of the early tradition of the Textile Ceramics seems to be different in these areas. The results of yet a small number of AMS dates should be treated only as preliminary. However, AMS-dating seems to be the most efficient tool for further refining of the Textile Ceramics chronology over a vast territory, including in the Volga region.

  4. Small angle X-ray scattering studies of mitochondrial glutaminase C reveal extended flexible regions, and link oligomeric state with enzyme activity.

    Directory of Open Access Journals (Sweden)

    Magda Møller

    Full Text Available Glutaminase C is a key metabolic enzyme, which is unregulated in many cancer systems and believed to play a central role in the Warburg effect, whereby cancer cells undergo changes to an altered metabolic profile. A long-standing hypothesis links enzymatic activity to the protein oligomeric state, hence the study of the solution behavior in general and the oligomer state in particular of glutaminase C is important for the understanding of the mechanism of protein activation and inhibition. In this report, this is extensively investigated in correlation to enzyme concentration or phosphate level, using a high-throughput microfluidic-mixing chip for the SAXS data collection, and we confirm that the oligomeric state correlates with activity. The in-depth solution behavior analysis further reveals the structural behavior of flexible regions of the protein in the dimeric, tetrameric and octameric state and investigates the C-terminal influence on the enzyme solution behavior. Our data enable SAXS-based rigid body modeling of the full-length tetramer states, thereby presenting the first ever experimentally derived structural model of mitochondrial glutaminase C including the N- and C-termini of the enzyme.

  5. The calculation of the highest leak level of water pipe lines region at PDAM Tirta Kahuripan using fuzzy C-means and ArcGIS method analysis

    Science.gov (United States)

    Parwatiningtyas, D.; Ambarsari, E. W.; Mariko, S.

    2017-07-01

    Water is a basic necessity for human's life. Water, which is distributed to the public, should in decent condition, healthy, and protected from metal pollutants. In Indonesia, it is handled by a government institution, commonly is PDAM (Indonesian regional water utility company). A PDAM Tirta Kahuripan handles water distribution in Bogor area and part of Depok cities. Based on data, PDAM Tirta Kahuripan had approximately more than 46 % water loss, due to geological factor, human activity, etc. Therefore in this paper, we try to make a decision system of water loss at PDAM pipelines, using cluster Fuzzy C - Means method analysis. Then, mapped into ArcGIS software. Based on this method, we can be determine the region which shows the most water loss and also identify the highest leaks level from water pipelines at PDAM Tirta Kahuripan.

  6. Localization of the candidate gene d-amino acid oxidase outside the refined 1-cM region of spinocerebellar ataxia 2

    Energy Technology Data Exchange (ETDEWEB)

    Auburger, G.; Gispert, S.; Lunkes, A. [Univ. Hospital, Duesseldorf (Germany)] [and others

    1995-10-01

    Spinocerebellar ataxia 2 (SCA2) is one form of the neurodegenerative autosomal dominant cerebellar ataxias and has been linked to chromosome 12q in 25 previously described and 13 new families from a founder collective of {ge}500 patients in Holguin, Cuba. Although SCA2 in most patients cannot be distinguished from other spinocerebellar ataxias by clinical criteria, in some patients it exhibits a particular phenotype with early neuropathy/late slow saccades and late myoclonus. Autopsy in 11 patients demonstrated olivo-ponto-cerebellar atrophy with a selective sparing of the dentate nucleus. Complete allelic association within the Holguin population was established with the microsatellite D12S105, and the candidate region was determined to be within a 6-cM region distal to the marker D12S84, contrasting previous reports by Pulst and Lopes-Cendes and according to preliminary data between D12S84 and D12S1329. 17 refs., 1 fig., 1 tab.

  7. Compositional regions of single phases at 1800 Degree-Sign C in Mo-rich Mo-Si-B ternary system

    Energy Technology Data Exchange (ETDEWEB)

    Ha, Seong-Ho, E-mail: fy11001@mail.kankyo.tohoku.ac.jp [Graduate School of Environmental Studies, Tohoku University, Sendai, Miyagi 980-8579 (Japan); Yoshimi, Kyosuke; Maruyama, Kouichi [Graduate School of Environmental Studies, Tohoku University, Sendai, Miyagi 980-8579 (Japan); Tu, Rong; Goto, Takashi [Institute for Materials Research, Tohoku University, Sendai, Miyagi 980-8577 (Japan)

    2012-08-30

    Single-phase regions in Mo-rich Mo-Si-B alloys at 1800 Degree-Sign C were experimentally determined using a field-emission (FE) gun-type electron probe micro-analyzer (EPMA) in this study. A quantitative analysis by FE-EPMA was conducted with the calibration method we applied in our previous study to improve the accuracy in the B measurements. The compositional ranges of the determined Mo solid solution, silicide and boride phases were in good agreement with those of Mo-Si and Mo-B binary phase diagrams. On the other hand, the determined solubility of B in Mo solid solution, Mo{sub 3}Si and T{sub 1} (Mo{sub 5}Si{sub 3}) were quite different from that indicated in previously reported ternary phase diagrams. The compositional region of the T{sub 2} (Mo{sub 5}SiB{sub 2}) single-phase ranges from 9.7 to 13.3 at% for Si and from 23.5 to 26.8 at% for B. The following two points were made clear by the ternary phase diagram as determined in this study. One is that no stoichiometric T{sub 2} composition is in the T{sub 2} single-phase region, confirming no T{sub 2} single-phase material can be obtained at the stoichiometric composition at 1800 Degree-Sign C. The another is that the T{sub 2} region of this study expands to a Si-rich area from the stoichiometric composition.

  8. The C-terminal region of A-kinase anchor protein 350 (AKAP350A) enables formation of microtubule-nucleation centers and interacts with pericentriolar proteins.

    Science.gov (United States)

    Kolobova, Elena; Roland, Joseph T; Lapierre, Lynne A; Williams, Janice A; Mason, Twila A; Goldenring, James R

    2017-12-15

    Microtubules in animal cells assemble (nucleate) from both the centrosome and the cis-Golgi cisternae. A-kinase anchor protein 350 kDa (AKAP350A, also called AKAP450/CG-NAP/AKAP9) is a large scaffolding protein located at both the centrosome and Golgi apparatus. Previous findings have suggested that AKAP350 is important for microtubule dynamics at both locations, but how this scaffolding protein assembles microtubule nucleation machinery is unclear. Here, we found that overexpression of the C-terminal third of AKAP350A, enhanced GFP-AKAP350A(2691-3907), induces the formation of multiple microtubule-nucleation centers (MTNCs). Nevertheless, these induced MTNCs lacked "true" centriole proteins, such as Cep135. Mapping analysis with AKAP350A truncations demonstrated that AKAP350A contains discrete regions responsible for promoting or inhibiting the formation of multiple MTNCs. Moreover, GFP-AKAP350A(2691-3907) recruited several pericentriolar proteins to MTNCs, including γ-tubulin, pericentrin, Cep68, Cep170, and Cdk5RAP2. Proteomic analysis indicated that Cdk5RAP2 and Cep170 both interact with the microtubule nucleation-promoting region of AKAP350A, whereas Cep68 interacts with the distal C-terminal AKAP350A region. Yeast two-hybrid assays established a direct interaction of Cep170 with AKAP350A. Super-resolution and deconvolution microscopy analyses were performed to define the association of AKAP350A with centrosomes, and these studies disclosed that AKAP350A spans the bridge between centrioles, co-localizing with rootletin and Cep68 in the linker region. siRNA-mediated depletion of AKAP350A caused displacement of both Cep68 and Cep170 from the centrosome. These results suggest that AKAP350A acts as a scaffold for factors involved in microtubule nucleation at the centrosome and coordinates the assembly of protein complexes associating with the intercentriolar bridge.

  9. N- and C-terminal flanking regions modulate light-induced signal transduction in the LOV2 domain of the blue light sensor phototropin 1 from Avena sativa.

    Science.gov (United States)

    Halavaty, Andrei S; Moffat, Keith

    2007-12-11

    Light sensing by photoreceptors controls phototropism, chloroplast movement, stomatal opening, and leaf expansion in plants. Understanding the molecular mechanism by which these processes are regulated requires a quantitative description of photoreceptor dynamics. We focus on a light-driven signal transduction mechanism in the LOV2 domain (LOV, light, oxygen, voltage) of the blue light photoreceptor phototropin 1 from Avena sativa (oat). High-resolution crystal structures of the dark and light states of an oat LOV2 construct including residues Leu404 through Leu546 (LOV2 (404-546)) have been determined at 105 and 293 K. In all four structures, LOV2 (404-546) exhibits the typical Per-ARNT-Sim (PAS) fold, flanked by an additional conserved N-terminal turn-helix-turn motif and a C-terminal flanking region containing an amphipathic Jalpha helix. These regions dock on the LOV2 core domain and bury several hydrophobic residues of the central beta-sheet of the core domain that would otherwise be exposed to solvent. Light structures of LOV2 (404-546) reveal that formation of the covalent bond between Cys450 and the C4a atom of the flavin mononucleotide (FMN) results in local rearrangement of the hydrogen-bonding network in the FMN binding pocket. These rearrangements are associated with disruption of the Asn414-Asp515 hydrogen bond on the surface of the protein and displacement of the N- and C-terminal flanking regions of LOV2 (404-546), both of which constitute a structural signal.

  10. Sequences in the interferon sensitivity-determining region and core region of hepatitis C virus impact pretreatment prediction of response to PEG-interferon plus ribavirin: data mining analysis.

    Science.gov (United States)

    Kurosaki, Masayuki; Sakamoto, Naoya; Iwasaki, Manabu; Sakamoto, Minoru; Suzuki, Yoshiyuki; Hiramatsu, Naoki; Sugauchi, Fuminaka; Tamori, Akihiro; Nakagawa, Mina; Izumi, Namiki

    2011-03-01

    The aim of the present study was to clarify the significance of viral factors for pretreatment prediction of sustained virological response to pegylated-interferon (PEG-IFN) plus ribavirin (RBV) therapy for chronic hepatitis C using data mining analysis. Substitutions in the IFN sensitivity-determining region (ISDR) and at position 70 of the HCV core region (Core70) were determined in 505 patients with genotype 1b chronic hepatitis C treated with PEG-IFN plus RBV. Data mining analysis was used to build a predictive model of sustained virological response in patients selected randomly (n = 304). The reproducibility of the model was validated in the remaining 201 patients. Substitutions in ISDR (odds ratio = 9.92, P predicted sustained virological response independent of other covariates. The decision-tree model revealed that the rate of sustained virological response was highest (83%) in patients with two or more substitutions in ISDR. The overall rate of sustained virological response was 44% in patients with a low number of substitutions in ISDR (0-1) but was 83% in selected subgroups of younger patients (<60 years), wild-type sequence at Core70, and higher level of low-density lipoprotein cholesterol (LDL-C) (≥ 120 mg/dl). Reproducibility of the model was validated (r(2) = 0.94, P < 0.001). In conclusion, substitutions in ISDR and Core70 of HCV are significant predictors of response to PEG-IFN plus RBV therapy. A decision-tree model that includes these viral factors as predictors could identify patients with a high probability of sustained virological response. Copyright © 2011 Wiley-Liss, Inc.

  11. Gender- and region-dependent changes of redox biomarkers in the brain of successfully aging LOU/C rats.

    Science.gov (United States)

    Moyse, Emmanuel; Arseneault, Madeleine; Gaudreau, Pierrette; Ferland, Guylaine; Ramassamy, Charles

    2015-07-01

    The LOU/C (LOU) rat is an obesity resistant strain with higher longevity and healthspan than common rats. The management of oxidative stress being important to successful aging, we characterized this process in the aging LOU rat. Male/female LOU rats were euthanized at 4, 20, and 29 months. Macrodissected hippocampus, striatum, parietal cortex, cerebellum were assayed for tissue concentrations of glutathione (GSH), gamma-glutamyl-cysteine-synthetase (γ-GCS), total thiols, protein carbonyls, mRNAs of clusterin and the known protective enzymes thioredoxine-1 (TRX-1), glutaredoxine-1 (GLRX-1), superoxide dismutase-1 (SOD-1). Brain levels of GSH, γ-GCS, total thiols remained constant with age, except for GSH and γ-GCS which decreases in females. Clusterin, TRX-1, GLRX-1, SOD-1 mRNA levels were maintained or increased in the hippocampus with age. Age-dependency of the markers differed between sexes, with SOD-1 and TRX-1 decreases out of hippocampus in females. Since antioxidants were reported to decrease with age in the brain of Wistar rats, maintenance of GSH levels and of protective enzymes mRNA levels in the LOU rat brain could contribute to the preservation of cognitive functions in old age. Altogether, the successful aging of LOU rats may, at least in part, involve the conservation of functional antioxidant mechanisms in the brain, supporting the oxidative stress theory of aging. Copyright © 2015 Elsevier Ireland Ltd. All rights reserved.

  12. Familial periodic cerebellar ataxia without myokymia maps to a 19-cM region on 19p13

    Energy Technology Data Exchange (ETDEWEB)

    Teh, B.T.; Lindblad, K.; Betz, R. [Karolinska Hospital, Stockholm (Switzerland)] [and others

    1995-06-01

    Familial periodic cerebellar ataxia (FPCA) is a heterogenous group of rare autosomal dominant disorders characterized by episodic cerebellar disturbance. A potassium-channel gene (KCNA1) has been found to be responsible for one of its subgroups, familial periodic cerebellar ataxia with myokymia (FPCA/+M; MIM 160120). A different subgroup that is not associated with myokymia (FPCA/-M; MIM 108500) was recently mapped to chromosome 19p. Here we have performed linkage analysis in two large families with FPCA/-M that also demonstrated neurodegenerative pathology of the cerebellum. Three markers in 19p13 gave significant lod scores (>3.0), while linkage to KCNA1 and three known loci for spinocerebellar ataxia (SCA1, SCA2, and SCA3) was excluded. The highest lod score was obtained with the marker D19S413 (4.4 at recombination fraction 0), and identification of meiotic recombinants in affected individuals placed the locus between the flanking markers D19S406 and D19S226, narrowing the interval to 19 cM. A CAG trinucleotide-repeat expansion was detected in one family but did not consegregate with the disease. 30 refs., 3 figs., 1 tab.

  13. History and origin of the HIV-1 subtype C epidemic in South Africa and the greater southern African region.

    Science.gov (United States)

    Wilkinson, Eduan; Engelbrecht, Susan; de Oliveira, Tulio

    2015-11-17

    HIV has spread at an alarming rate in South Africa, making it the country with the highest number of HIV infections. Several studies have investigated the histories of HIV-1 subtype C epidemics but none have done so in the context of social and political transformation in southern Africa. There is a need to understand how these processes affects epidemics, as socio-political transformation is a common and on-going process in Africa. Here, we genotyped strains from the start of the epidemic and applied phylodynamic techniques to determine the history of the southern Africa and South African epidemic from longitudinal sampled data. The southern African epidemic's estimated dates of origin was placed around 1960 (95% HPD 1956-64), while dynamic reconstruction revealed strong growth during the 1970s and 80s. The South African epidemic has a similar origin, caused by multiple introductions from neighbouring countries, and grew exponentially during the 1980s and 90s, coinciding with socio-political changes in South Africa. These findings provide an indication as to when the epidemic started and how it has grown, while the inclusion of sequence data from the start of the epidemic provided better estimates. The epidemic have stabilized in recent years with the expansion of antiretroviral therapy.

  14. Regional brain distribution of [18F]GBR 13119, a dopamine uptake inhibitor, in CD-1 and C57BL/6 mice.

    Science.gov (United States)

    Kilbourn, M R; Haka, M S; Mulholland, G K; Sherman, P S; Pisani, T

    1989-07-18

    We have examined the regional brain distribution of [18F]GBR 13119 (18F: beta +, T1/2 = 110 min), a dopamine uptake inhibitor, in CD-1 and C57BL/6 mice. High levels of binding are observed in the striatum of both species, with striatum/cerebellum ratios of 3-4 at 60 min after injection of the radiotracer. Striatum radioactivity and striatum/cerebellum ratios are more than 50% reduced in C57BL/6 mice treated chronically with the neurotoxin MPTP. We conclude mice are an appropriate model for the in vivo study of the dopamine uptake system, and that [18F]GBR 13119 may be a suitable in vivo marker for degeneration of striatal dopaminergic neurons.

  15. The clinical significance of nucleotide G1613A and C1653T mutations in the core promoter region of hepatitis B virus

    Directory of Open Access Journals (Sweden)

    Peng-yu HUANG

    2016-04-01

    Full Text Available Objective  To evaluate the impact of hepatitis B virus (HBV genome G1613A and C1653T mutations on disease progression, viral replication capacity, and transcription activity of HBV core promoter (CP. Methods  A total of 258 patients were enrolled in the present study, including 65 patients with acute hepatitis B (AHB, 120 with chronic hepatitis B (CHB, and 73 with acute on chronic liver failure (ACLF. Serum HBV DNA was extracted from patients, and full-length HBV genome was amplified by PCR. The incidences of G1613A, C1653T and G1613A+C1653T in different groups were compared, and through functional experiments, the impact of mutants and wild-type virus on viral replication capacity and CP transcription activity was assessed. Results  Genotype B, C and D were the three detected genotypes in 285 patients, with detection rates of 22.2%, 76.2% and 1.6%, respectively. The incidences of G1613A, C1653T and G1613A+C1653T mutations increased with the disease exacerbation, and they were 13.70%, 31.80% and 45.20% in AHB patients (P<0.01, 2.30%, 16.30% and 27.40% in CHB patients (P<0.01, and 2.29%, 12.07% and 23.29% in ACLF patients (P<0.05. Compare with wild-type strain, the G1613A mutant strain of HBV increased the viral replication capacity by 6%, reduced HBsAg level and core promoter activity by 15% and 16.2%, and reduced HBeAg to undetectable level; the C1653T mutant strain increased the viral replication capacity, HBsAg level, and core promoter activity by 10%, 55% and 17.1%, respectively, and the HBeAg level was comparable to that of wild-type strain; the G1613A+C1653T mutant strain increased viral replication capacity, HBsAg level and HBeAg level by 7%, 66% and 227%, respectively, while it had no influence on core promoter activity. Conclusion The G1613A and C1653T mutation in CP region may increase HBV replication capacity and alter CP activity and HBV antigens expression, the doublet mutation of G1613A+C1653T shows synergic effect on these

  16. Regional Scale Variability in Background and Source δ13C of Methane in the Atlantic, Europe and the Arctic: Cautionary Tales for Isotopic Modeling

    Science.gov (United States)

    Lowry, D.; Fisher, R. E.; France, J. L.; Lanoiselle, M.; Zazzeri, G.; Nisbet, E. G.

    2013-12-01

    Modeling studies of methane δ13C, both of modern atmosphere and glacial palaeoclimates have used a global isotopic signature for each of the main source categories, whereas detailed studies of source fluxes, such as boreal wetlands, suggest that on the centimeter to meter scale there is very great variability. In recent years we have been reassessing the usefulness of using a generic source value from source up to regional scale through sampling campaigns in the European Arctic, the UK and onboard ships sailing the Atlantic up to the Arctic Ocean. Currently the boreal wetland source of methane dominates above 60°N. Within Finland this source varies at the wetland scale from -74 to -66‰ depending on wetland type and seasonal variability in temperature and water table. Lapland road trips and ship sampling suggest that these emissions are homogenized to -70 to -67‰ in the well-mixed regional atmosphere. An infrequent boreal forest fire emission adds a -30 to -26‰ component into the mix, and such inputs have been observed in the Mace Head (Ireland) isotopic record of 2002. The story is much more complex once the latitudes of heavily urbanized and agricultural areas of Northern Europe are reached. Isotopic signatures applied to UK and EC inventories suggest that national emissions can vary from -42 to -60‰ depending on source mix, but even this is too simplified. Fugitive emissions from gas distribution systems vary based on the source of the gas, with biogenic-dominated supplies from west Siberia at -50‰ to thermogenic gas of the Southern North Sea fields at -32‰. Coal emissions are also source-dependent and have a similar range to gas, but unlike pipeline-homogenized gas can vary from one mine to the next. Emissions from ruminants vary due to C3 and C4 plant diets, with C4 closer to -50‰ while C3 emissions are in the low -60's. A recent whole barn experiment in the UK recorded -66‰. Landfill signatures also vary. Sites engineered in the last decade

  17. The C-terminal polyproline-containing region of ELMO contributes to an increase in the life-time of the ELMO-DOCK complex.

    Science.gov (United States)

    Sévajol, Marion; Reiser, Jean-Baptiste; Chouquet, Anne; Pérard, Julien; Ayala, Isabel; Gans, Pierre; Kleman, Jean-Philippe; Housset, Dominique

    2012-03-01

    The eukaryotic Engulfment and CellMotility (ELMO) proteins form an evolutionary conserved family of key regulators which play a central role in Rho-dependent biological processes such as engulfment and cell motility/migration. ELMO proteins interact with a subset of Downstream of Crk (DOCK) family members, a new type of guanine exchange factors (GEF) for Rac and cdc42 GTPases. The physiological function of DOCK is to facilitate actin remodeling, a process which occurs only in presence of ELMO. Several studies have determined that the last 200 C-terminal residues of ELMO1 and the first 180 N-terminal residues of DOCK180 are responsible for the ELMO-DOCK interaction. However, the precise role of the different domains and motifs identified in these regions has remained elusive. Divergent functional, biochemical and structural data have been reported regarding the contribution of the C-terminal end of ELMO, comprising its polyproline motif, and of the DOCK SH3 domain. In the present study, we have investigated the contribution of the C-terminal end of ELMO1 to the interaction between ELMO1 and the SH3 domain of DOCK180 using nuclear magnetic resonance spectroscopy and surface plasmon resonance. Our data presented here demonstrate the ability of the SH3 domain of DOCK180 to interact with ELMO1, regardless of the presence of the polyproline-containing C-terminal end. However, the presence of the polyproline region leads to a significant increase in the half-life of the ELMO1-DOCK180 complex, along with a moderate increase on the affinity. Copyright © 2011 Elsevier Masson SAS. All rights reserved.

  18. A computational approach identifies two regions of Hepatitis C Virus E1 protein as interacting domains involved in viral fusion process

    Directory of Open Access Journals (Sweden)

    El Sawaf Gamal

    2009-07-01

    Full Text Available Abstract Background The E1 protein of Hepatitis C Virus (HCV can be dissected into two distinct hydrophobic regions: a central domain containing an hypothetical fusion peptide (FP, and a C-terminal domain (CT comprising two segments, a pre-anchor and a trans-membrane (TM region. In the currently accepted model of the viral fusion process, the FP and the TM regions are considered to be closely juxtaposed in the post-fusion structure and their physical interaction cannot be excluded. In the present study, we took advantage of the natural sequence variability present among HCV strains to test, by purely sequence-based computational tools, the hypothesis that in this virus the fusion process involves the physical interaction of the FP and CT regions of E1. Results Two computational approaches were applied. The first one is based on the co-evolution paradigm of interacting peptides and consequently on the correlation between the distance matrices generated by the sequence alignment method applied to FP and CT primary structures, respectively. In spite of the relatively low random genetic drift between genotypes, co-evolution analysis of sequences from five HCV genotypes revealed a greater correlation between the FP and CT domains than respect to a control HCV sequence from Core protein, so giving a clear, albeit still inconclusive, support to the physical interaction hypothesis. The second approach relies upon a non-linear signal analysis method widely used in protein science called Recurrence Quantification Analysis (RQA. This method allows for a direct comparison of domains for the presence of common hydrophobicity patterns, on which the physical interaction is based upon. RQA greatly strengthened the reliability of the hypothesis by the scoring of a lot of cross-recurrences between FP and CT peptides hydrophobicity patterning largely outnumbering chance expectations and pointing to putative interaction sites. Intriguingly, mutations in the CT

  19. Further evidence that the rs1858830 C variant in the promoter region of the MET gene is associated with autistic disorder.

    Science.gov (United States)

    Jackson, Pamela B; Boccuto, Luigi; Skinner, Cindy; Collins, Julianne S; Neri, Giovanni; Gurrieri, Fiorella; Schwartz, Charles E

    2009-08-01

    Previous studies in three independent cohorts have shown that the rs1858830 C allele variant in the promoter region of the MET gene on chromosome 7q31 is associated with autism. Another study has found correlations between other alterations in the MET gene and autism in two unrelated cohorts. This study screened two cohorts, an Autistic Disorder cohort from South Carolina and a Pervasive Developmental Disorder (PDD) cohort from Italy, for the presence of the C allele variant in rs1858830. A significant increase in the C allele variant frequency was found in the South Carolina Autistic Disorder patients as compared to South Carolina Controls (chi(2)=5.8, df=1, P=0.02). In the South Carolina cohort, a significant association with Autistic Disorder was found when comparing the CC and CG genotypes to the GG genotype (odds ratio (OR)=1.64; 95% confidence interval (CI)=1.12-2.40; chi(2)=6.5, df=1, P=0.01) in cases and controls. In the Italian cohort, no significant association with PDD was found when comparing the CC or CG genotype to the GG genotype (OR=1.20; 95% CI=0.56-2.56; chi(2)=0.2, df=1, P=0.64). This study is the third independent study to find the rs1858830 C variant in the MET gene promoter to be associated with autism.

  20. Absolute quantification of regional cerebral glucose utilization in mice by 18F-FDG small animal PET scanning and 2-14C-DG autoradiography.

    Science.gov (United States)

    Toyama, Hiroshi; Ichise, Masanori; Liow, Jeih-San; Modell, Kendra J; Vines, Douglass C; Esaki, Takanori; Cook, Michelle; Seidel, Jurgen; Sokoloff, Louis; Green, Michael V; Innis, Robert B

    2004-08-01

    The purpose of this study was to evaluate the feasibility of absolute quantification of regional cerebral glucose utilization (rCMR(glc)) in mice by use of (18)F-FDG and a small animal PET scanner. rCMR(glc) determined with (18)F-FDG PET was compared with values determined simultaneously by the autoradiographic 2-(14)C-DG method. In addition, we compared the rCMR(glc) values under isoflurane, ketamine and xylazine anesthesia, and awake states. Immediately after injection of (18)F-FDG and 2-(14)C-DG into mice, timed arterial samples were drawn over 45 min to determine the time courses of (18)F-FDG and 2-(14)C-DG. Animals were euthanized at 45 min and their brain was imaged with the PET scanner. The brains were then processed for 2-(14)C-DG autoradiography. Regions of interest were manually placed over cortical regions on corresponding coronal (18)F-FDG PET and 2-(14)C-DG autoradiographic images. rCMR(glc) values were calculated for both tracers by the autoradiographic 2-(14)C-DG method with modifications for the different rate and lumped constants for the 2 tracers. Average rCMR(glc) values in cerebral cortex with (18)F-FDG PET under normoglycemic conditions (isoflurane and awake) were generally lower (by 8.3%) but strongly correlated with those of 2-(14)C-DG (r(2) = 0.95). On the other hand, under hyperglycemic conditions (ketamine/xylazine) average cortical rCMR(glc) values with (18)F-FDG PET were higher (by 17.3%) than those with 2-(14)C-DG. Values for rCMR(glc) and uptake (percentage injected dose per gram [%ID/g]) with (18)F-FDG PET were significantly lower under both isoflurane and ketamine/xylazine anesthesia than in the awake mice. However, the reductions of rCMR(glc) were markedly greater under isoflurane (by 57%) than under ketamine and xylazine (by 19%), whereas more marked reductions of %ID/g were observed with ketamine/xylazine (by 54%) than with isoflurane (by 37%). These reverse differences between isoflurane and ketamine/xylazine may be due to

  1. Tooth Enamel δ13C and δ18O Variations in Modern and Archaeological Horses From Northern Kazakhstan as Indicators of Regional Climate

    Science.gov (United States)

    Sikora, M. T.; Rosenmeier, M. F.; Stacy, E. M.; Olsen, S. L.

    2007-12-01

    In this study, the oxygen and carbon isotope values of tooth enamel were measured in forty-one modern and twenty-three Copper Age (3600 - 3100 B.C.) horse specimens from the grassland steppe region of northern Kazakhstan. Modern tooth enamel δ13C and δ18O values were compared with the carbon isotopic compositions of local vegetation and the δ18O values of meteoric waters. Tooth enamel isotope values within the Copper Age specimens (attributed to the so-called Botai culture) were, in turn, compared with modern samples. Average carbon isotopic values within modern bulk tooth enamel samples ranged between -13.7 and -12.0‰ (VPDB). This suggests that the diet of modern northern Kazakhstani horses is comprised almost entirely of C3 plants (considering enamel-diet fractionation factors) consistent with documented grassland compositions within the region. The observed amplitude of δ13C variations within individual teeth (typically less than ~2‰) suggests only minimal seasonal variation in the δ13C of grasses attributed to heat and water stress. Alternatively, the minimal seasonal changes observed within intra-tooth δ13C values may be the direct result of fodder provisioning. Ingested water δ18O values derived from oxygen isotope ratios within bulk tooth enamel samples appear statistically indistinguishable from estimates of regional precipitation, suggesting that Kazakhstani horse tooth enamel δ18O measurements may be used as a direct estimate of the oxygen isotopic composition of meteoric waters. Intra-tooth oxygen isotopic variations therefore reflect the pronounced seasonal variability in precipitation δ18O values tied to temperature changes and amount effects observed annually within Kazakhstan. However, these intra-tooth isotopic variations exhibit slightly reduced amplitudes relative to meteoric water values, suggesting that horses likely consume water from buffered sources such as lakes and wells. Average bulk tooth enamel δ13C values within

  2. Synthetic peptides derived from the C-terminal region of Lys49 phospholipase A2 homologues from viperidae snake venoms: biomimetic activities and potential applications.

    Science.gov (United States)

    Lomonte, Bruno; Angulo, Yamileth; Moreno, Edgardo

    2010-01-01

    Lys49-phospholipase A(2) homologues constitute a large family of toxins present in the venoms of viperid snake species, which despite lacking catalytic activity, cause significant skeletal muscle necrosis. The main structural determinants of this toxic effect have been experimentally mapped to a region near their C-terminus (115-129), which combines cationic and hydrophobic/aromatic amino acid residues. Short (13-mer) synthetic peptides representing this C-terminal region can mimick several of the effects of Lys49 PLA(2) homologues. In addition to their ability to damage muscle cells, these peptides display antibacterial, antiendotoxic, antifungal, antiparasite, and antitumor activities, as well as VEGF-receptor 2 (KDR)-binding and heparin-binding properties. Modifications of their sequences have shown possibilities to enhance their effects upon prokaryotic cells, while decreasing toxicity for eukaryotic cells. This review presents an updated summary on the biomimetic actions exerted by such peptides, and highlights their potential value as molecular tools or as drug leads in diverse biomedical areas.

  3. New variants near RHOJ and C2, HLA-DRA region and susceptibility to endometriosis in the Polish population-The genome-wide association study.

    Science.gov (United States)

    Sobalska-Kwapis, Marta; Smolarz, Beata; Słomka, Marcin; Szaflik, Tomasz; Kępka, Ewa; Kulig, Bartosz; Siewierska-Górska, Anna; Polak, Grzegorz; Romanowicz, Hanna; Strapagiel, Dominik; Szyłło, Krzysztof

    2017-10-01

    Endometriosis is a common gynaecological disease, associated with severe pelvic pain and reduced fertility; however, molecular mechanisms remain largely unknown. Genome-wide association studies (GWAS) are able to identify genetic loci, which can play significant role during endometriosis development. The study aimed at localisation of new genes and chromosomal loci, the nucleotide variants of which determine the level of susceptibility to endometriosis. Blood samples from 171 patients with endometriosis were used as material for studies. The patients were recruited to the study at the Department of Operative Gynaecology of the Institute of the Polish Mother's Memorial Hospital in Lodz. A control group (n=2934) came from the POPULOUS collection registered at Biobank Lab, Department of Molecular Biophysics, University of Lodz. DNA of the patients with endometriosis was compared with DNA of women free from that disease, the comparison being supported by GWAS. Genome-wide significant correlation was identified between one new, not previously described, single nucleotide polymorphism (SNP), rs10129516, localised on chromosome 14 in intergenic region between PARP1P2 and RHOJ genes (p=1.44×10 -10 , OR=3.104, 95% CI=2.329-4.136) and endometriosis. We have also identified significant association with endometriosis of 18 SNPs localised on chromosome 6 in position range 31883957 - 32681631 (C2 and HLA-DRA genes region) with the lowest observed p value for rs644045 in C2 gene (p=2.04×10 -8 , OR=1.955, 95% CI=1.541-2.480). Reported GWAS identified the novel loci associated with endometriosis in Polish women, not previously reported. The most interesting observation shown in our study are regions associated with susceptibility to endometriosis of loci located near C2, HLA-DRA and RHOJ genes. of that study did not correspond to previously published data about polymorphism in that regions and further evaluations are necessary in groups with higher numbers of patients to explain

  4. Identification of the promoter region of human interleukin 1 type I receptor gene: multiple initiation sites, high G+C content, and constitutive expression.

    Science.gov (United States)

    Ye, K; Dinarello, C A; Clark, B D

    1993-01-01

    To better understand the role of interleukin 1 (IL-1) and its receptor in disease, we have isolated a genomic clone of the human IL-1 type I receptor and have identified the promoter region. There are multiple transcriptional initiation sites as demonstrated by primer extension. DNA sequence analysis shows that the promoter region contains neither a TATA nor a CAAT box; however, the 5' upstream regulatory elements contain two AP-1-like binding sites. The internal regulatory sequences found immediately downstream to the 5' transcriptional start site contain four Sp1 binding domains and have a high G+C content of 75%. This portion of the 5' untranslated region of the mRNA can form stable secondary structure as predicted by computer modeling. Base pairs -4 to + 10 share striking resemblance to an initiator sequence that directs basal expression of certain TATA-less genes-e.g., terminal deoxynucleotidyltransferase in lymphocytes. The IL-1 receptor promoter directs basal expression of chloramphenicol acetyltransferase in transiently transfected cells. Overall, the promoter of the IL-1 type I receptor gene resembles that of constitutively expressed genes that have housekeeping- and/or growth-related functions. The constitutive nature of the promoter may account for this gene being expressed at low levels in diverse cell types. Our finding sheds more understanding into the mechanisms governing the regulation of the IL-1 receptor in health and disease. Images Fig. 2 Fig. 6 PMID:8460136

  5. A Compilation of the Historical Earthquakes Database for Marmara Region from 2000 B.C. and 1900 A.D. in frame of Marsite and Mardim Projects

    Science.gov (United States)

    Basarir Basturk, Nilay; Meral Ozel, Nurcan

    2016-04-01

    This study aimed at contributing to creation of a scenario database for tsunamigenic earthquakes occurred in Marmara Region through the investigation of the historical earthquakes under the frame of Marsite and also Mardim Projects for the work package 5 (WP5). Furthermore, this work provides an evaluation of earthquake history in Marmara Region which is important for seismic risk assesment in İstanbul and preparing an active fault map of the Sea of Marmara,which is one of the goals of the work package 7 (WP7) of Marmara Supersite Project. For this purpose, we have created a digital database containing 576 earthquakes with some parameters such as location and intensity, also including macroseismic explanations for Turkey between the dates of 2000 B.C. and 1900 A.D. by compiling over 20 available sources such as Ambraseys(2009), Ambraseys and Finkel(1995), Ergin et al. (1967 and 1971), Soysal et al. (1981), Guidoboni et al. (1994), Papazachos et al. (1997), Shebalin & Tatevossian (1997), Ambraseys & Jackson (1998), Kondorskaya & Ulomov (1999), Ambraseys & Jackson (2000), Guidoboni & Comastri(2005), Stucchi et al(2012), Papazachos&P.,(2003). Among these sources, the basic reference that we used for many earthquakes is the Soysal et al. (1981), including earthquake parameters such as macroseismic epicenter and intensity. Another important catalogue for the assessment of historical events is the Ambraseys (2009) which is a comprehensive review and contains macroseismic explanations of the earthquakes in Turkey from 2000 B.C. to 1900 A.D. Evaulation of every possible sources for the old earthquakes have enabled us to cross check differences among them , find dublicate events and debate the earthquakes in terms of their reliability. In the scope of this study, the historical earthquakes were classified to date, location, intensity, macroseismic explanations using available information. In addition, the coordinate and intensity were assigned to 343 and 114 events

  6. Organization of the TC and TE cT-DNA regions in Nicotiana otophora and functional analysis of three diverged TE-6b genes.

    Science.gov (United States)

    Chen, Ke; de Borne, François Dorlhac; Sierro, Nicolas; Ivanov, Nikolai V; Alouia, Malek; Koechler, Sandrine; Otten, Léon

    2018-02-03

    Nicotiana otophora contains Agrobacterium-derived T-DNA sequences introduced by horizontal gene transfer (Chen et al., 2014). Sixty-nine contigs were assembled into four different cT-DNAs, totalling 83 kb. TC and TE result from two successive transformation events, each followed by duplication, yielding two TC and two TE inserts. TC is also found in other Nicotiana species, whereas TE is unique for N. otophora. Both cT-DNA regions are partially duplicated inverted repeats. Analysis of the cT-DNA divergence patterns allowed reconstruction of the evolution of the TC and TE regions. TC and TE carry ten intact open reading frames. Three of these are TE-6b genes, derived from a single 6b gene carried by the Agrobacterium strain which inserted TE in the N. otophora ancestor. 6b genes have so far only been found on A. tumefaciens or A. vitis T-DNAs and strongly modify plant growth (Chen and Otten, 2016). The TE-6b genes were expressed in N. tabacum under the constitutive 2x35S promoter. TE-1-6b-R and TE-2-6b led to shorter plants, dark-green leaves, a strong increase in leaf vein development, and modified petiole wings. TE-1-6b-L expression led to a similar phenotype, but in addition, leaves show outgrowths at the margins, flowers were modified and plants became viviparous, i. e. embryos germinated in the capsules at an early stage of their development. Embryos could be rescued by culture in vitro. The TE-6b phenotypes are very different from the earlier described 6b phenotypes and could provide new insight into the mode of action of the 6b genes. This article is protected by copyright. All rights reserved. This article is protected by copyright. All rights reserved.

  7. Associations between responses to interferon therapy and genetic variation in interleukin-28B and the core region of hepatitis C virus genotype 3a.

    Science.gov (United States)

    Yamada, Keiichi; Ishigami, Masatoshi; Kuzuya, Teiji; Honda, Takashi; Hayashi, Kazuhiko; Goto, Hidemi

    2015-08-01

    The single-nucleotide polymorphism (SNP) of interleukin-28B (IL-28B) and mutations in the core region of hepatitis C virus (HCV) genotype 1b have been associated with response to interferon (IFN) therapy. However, whether this IL-28B SNP affects responses to INF therapy for HCV genotype 3a is not known. The aim of this study is to investigate whether this IL-28B SNP (rs8099917) and specific missense mutations in the HCV core region affect the response to IFN therapy for HCV genotype 3a. Patients (n = 19; median age 44.5) infected with HCV genotype 3a who received IFN therapy were studied. Of the 19 patients, 12 (63.1%) achieved sustained virological response. Of those 12 patients, 11 had the TT genotype (11/16; 68.7%), and one had the TG genotype (1/3; 33.3%). The difference in the sustained virological response rate between IL-28B genotype groups was not significant (P = 0.5232). HCV core region was well conserved; however, polymorphisms at position 72 were identified. Of the 19 HCV samples; 15 carried a glutamic acid at position 72, and these were defined as E type; the others (4/19) were defined as non-E type. Notably, there was a significant difference in the sustained virological response rate between E type and non-E-type; 12 of the 15 patients with E-type achieved sustained virological response, but none of the four patients with non-E-type achieved sustained virological response (P = 0.009). A glutamic acid at position 72 in the core region of HCV genotype 3a was associated with a good response to IFN therapy. J. Med. Virol. 87:1361-1367, 2015. © 2015 Wiley Periodicals, Inc. © 2015 Wiley Periodicals, Inc.

  8. Expression of c-Fos protein in medial septum/diagonal band of Broca and CA3 region, associated with the temporary inactivation of the supramammillary area.

    Science.gov (United States)

    Aranda, Lourdes

    2016-07-01

    The supramammillary (SuM) area is part of the diencephalic nuclei comprising the mammillary bodies, and is a key structure in the memory and spatial learning processes. It is a critical region in the modulation/generation of hippocampal theta rhythm. In addition, many papers have recently shown a clear involvement of this structure in the processes of spatial learning and memory in animal models, although it is still not known how it modulates spatial navigation and response emotional. The aim of the present research was to study the effect of the temporary inactivation of the SuM area on synaptic plasticity of crucial structures in the formation of spatial memory and emotional response. Sprague-Dawley rats were asigned in three groups: a control group where the animals were not subjected to any treatment, and two groups where the rats received microinjections of tetrodotoxin (TTX) in the SuM area (5ng diluted in 0.5μl of saline) or saline (0.5μl). The microinjections were administered 90min before the perfusion. Later, cellular activity in medial septum/diagonal band of Broca (MS/DBB) and CA3 region of the dorsal hippocampus was assessed, by measuring the immediate early gene c-fos. The results show a clear hiperactivity cellular in medial septum/diagonal band of Broca and a clear hypoactivity cellular in the CA3 region of the hippocampus when there was a functional inactivation of the SuM area. It suggests that the SuM area seems to be part of the connection and information input pathways to CA3 region of the hippocampal formation, key for proper functioning in spatial memory and emotional response. Copyright © 2016 Elsevier B.V. All rights reserved.

  9. Evidence against Extracellular Exposure of a Highly Immunogenic Region in the C-Terminal Domain of the Simian Immunodeficiency Virus gp41 Transmembrane Protein

    Science.gov (United States)

    Postler, Thomas S.; Martinez-Navio, José M.; Yuste, Eloísa

    2012-01-01

    The generally accepted model for human immunodeficiency virus type 1 (HIV-1) envelope glycoprotein topology includes a single membrane-spanning domain. An alternate model has been proposed which features multiple membrane-spanning domains. Consistent with the alternate model, a high percentage of HIV-1-infected individuals produce unusually robust antibody responses to a region of envelope, the so-called “Kennedy epitope,” that in the conventional model should be in the cytoplasm. Here we show analogous, robust antibody responses in simian immunodeficiency virus SIVmac239-infected rhesus macaques to a region of SIVmac239 envelope located in the C-terminal domain, which in the conventional model should be inside the cell. Sera from SIV-infected rhesus macaques consistently reacted with overlapping oligopeptides corresponding to a region located within the cytoplasmic domain of gp41 by the generally accepted model, at intensities comparable to those observed for immunodominant areas of the surface component gp120. Rabbit serum raised against this highly immunogenic region (HIR) reacted with SIV envelope in cell surface-staining experiments, as did monoclonal anti-HIR antibodies isolated from an SIVmac239-infected rhesus macaque. However, control experiments demonstrated that this surface staining could be explained in whole or in part by the release of envelope protein from expressing cells into the supernatant and the subsequent attachment to the surfaces of cells in the culture. Serum and monoclonal antibodies directed against the HIR failed to neutralize even the highly neutralization-sensitive strain SIVmac316. Furthermore, a potential N-linked glycosylation site located close to the HIR and postulated to be outside the cell in the alternate model was not glycosylated. An artificially introduced glycosylation site within the HIR was also not utilized for glycosylation. Together, these data support the conventional model of SIV envelope as a type Ia

  10. HBA1C AND LIPID PROFILE LEVELS IN THE KNOWN TYPE 2 DIABETIC GROUP IN THE RURAL REGION OF VIDARBHA, MAHARASHTRA, INDIA

    Directory of Open Access Journals (Sweden)

    Sarmistha Sarkar

    2017-04-01

    Full Text Available BACKGROUND Diabetes Mellitus (DM is a group of metabolic diseases in which there is high blood sugar levels over a prolonged period of time, and if early interventions are not taken, then it can cause many life-threatening complications like heart disease, stroke, kidney failure, damage to eyes, etc. Our aim is to determine HbA1c and Lipid profile level in the known type 2 diabetic group in the rural region of Vidarbha, Maharashtra, India, to see that as our study is a rural-based study and there is less pollution and stress factor compared to the cities whether it effects out study result or not. MATERIALS AND METHODS FBS, HbA1c, TC, HDL, LDL, VLDL, TG levels were evaluated. Total sample size 60 in between 30-40 years including males and females divided into two groups. 30 patients study group with known history of type 2 DM who attended the Medicine OPD and 30 age, sex matched healthy controls. Statistical analysis was done by using SPSS 17.0 version. RESULTS Results of serum lipid profile showed that mean values for TC, TG, HDL, LDL and VLDL in study group were 227.76±30.72, 152.23 ± 40.94, 40.5 ± 6.43, 153.30 ± 27.70 and 33.00 ± 9.94 mg/dL. FBS showed significant positive correlation with HbA1c (p<0.002. HDL has significant negative correlation with HbA1c (p<0.008. CONCLUSION Early detection in the abnormalities of serum lipid profile and HbA1c can minimise the risk for micro and macroangiopathies in the known type 2 diabetic patients.

  11. Interactions between deformation and fluids in the frontal thrust region of the NanTroSEIZE transect offshore the Kii Peninsula, Japan: Results from IODP Expedition 316 Sites C0006 and C0007

    Science.gov (United States)

    Screaton, E.; Kimura, G.; Curewitz, D.; Moore, G.; Chester, F.; Fabbri, O.; Fergusson, C.; Girault, F.; Goldsby, D.; Harris, R.; Inagaki, F.; Jiang, T.; Kitamura, Y.; Knuth, M.; Li, C.-F.; Liljedahl, L. Claesson; Louis, L.; Milliken, K.; Nicholson, U.; Riedinger, N.; Sakaguchi, A.; Solomon, E.; Strasser, M.; Su, X.; Tsutsumi, A.; Yamaguchi, A.; Ujiee, K.; Zhao, X.

    2009-12-01

    Integrated Ocean Drilling Program (IODP) Expedition 316 Sites C0006 and C0007 examined the deformation front of the Nankai accretionary prism offshore the Kii Peninsula, Japan. In the drilling area, the frontal thrust shows unusual behavior as compared to other regions of the Nankai Trough. Drilling results, integrated with observations from seismic reflection profiles, suggest that the frontal thrust has been active since ˜0.78-0.436 Ma and accommodated ˜13 to 34% of the estimated plate convergence during that time. The remainder has likely been distributed among out-of-sequence thrusts further landward and/or accommodated through diffuse shortening. Unlike results of previous drilling on the Nankai margin, porosity data provide no indication of undercompaction beneath thrust faults. Furthermore, pore water geochemistry data lack clear indicators of fluid flow from depth. These differences may be related to coarser material with higher permeability or more complex patterns of faulting that could potentially provide more avenues for fluid escape. In turn, fluid pressures may affect deformation. Well-drained, sand-rich material under the frontal thrust could have increased fault strength and helped to maintain a large taper angle near the toe. Recent resumption of normal frontal imbrication is inferred from seismic reflection data. Associated décollement propagation into weaker sediments at depth may help explain evidence for recent slope failures within the frontal thrust region. This evidence consists of seafloor bathymetry, normal faults documented in cores, and low porosities in near surface sediments that suggest removal of overlying material. Overall, results provide insight into the complex interactions between incoming materials, deformation, and fluids in the frontal thrust region.

  12. A regional field-based assessment of organic C sequestration and GHG balances in irrigated agriculture in Mediterranean semi-arid land

    Science.gov (United States)

    Virto, Inigo; Antón, Rodrigo; Arias, Nerea; Orcaray, Luis; Enrique, Alberto; Bescansa, Paloma

    2016-04-01

    In a context of global change and increasing food demand, agriculture faces the challenge of ensuring food security making a sustainable use of resources, especially arable land and water. This implies in many areas a transition towards agricultural systems with increased and stable productivity and a more efficient use of inputs. The introduction of irrigation is, within this framework, a widespread strategy. However, the C cycle and the net GHG emissions can be significantly affected by irrigation. The net effect of this change needs to be quantified at a regional scale. In the region of Navarra (NE Spain) more than 22,300 ha of rainfed agricultural land have been converted to irrigation in the last years, adding to the previous existing irrigated area of 70,000 ha. In this framework the project Life+ Regadiox (LIFE12 ENV/ES/000426, http://life-regadiox.es/) has the objective of evaluating the net GHG balances and atmospheric CO2 fixation rates of different management strategies in irrigated agriculture in the region. The project involved the identification of areas representative of the different pedocllimatic conditions in the region. This required soil and climate characterizations, and the design of a network of agricultural fields representative of the most common dryland and irrigation managements in these areas. This was done from available public datasets on climate and soil, and from soil pits especially sampled for this study. Two areas were then delimited, mostly based on their degree of aridity. Within each of those areas, fields were selected to allow for comparisons at three levels: (i) dryland vs irrigation, (ii) soil and crop management systems for non-permanent crops, and (iii) soil management strategies for permanent crops (namely olive orchards and vineyards). In a second step, the objective of this work was to quantify net SOC variations and GHG balances corresponding to the different managements identified in the previous step. These

  13. Bone Metabolism and the c.-223C > T Polymorphism in the 5'UTR Region of the Osteoprotegerin Gene in Patients with Inflammatory Bowel Disease.

    Science.gov (United States)

    Krela-Kaźmierczak, Iwona; Kaczmarek-Ryś, Marta; Szymczak, Aleksandra; Michalak, Michał; Skrzypczak-Zielińska, Marzena; Drwęska-Matelska, Natalia; Marcinkowska, Michalina; Eder, Piotr; Łykowska-Szuber, Lilianna; Wysocka, Ewa; Linke, Krzysztof; Słomski, Ryszard

    2016-12-01

    Osteoporosis is more frequent in inflammatory bowel disease (IBD) patients. A reduction in bone mineral mass in these individuals is caused not only by inflammatory processes in the bowel, because osteoporosis occurs already in very young IBD patients and in newly diagnosed individuals who have not yet undergone any pharmacological treatment. One of individual determinants of the bone turnover parameters is osteoprotegerin (OPG) encoded by the TNFRSF11B gene. The c.-223C > T polymorphism in this gene has been extensively studied in post-menopausal osteoporosis patients. However, no such studies exist for osteoporosis related to IBD. The aim of our study was to determine whether the c.-223C > T (rs2073617) polymorphism in the 5'UTR region of the gene encoding osteoprotegerin is a functional polymorphism which may change the gene expression and resulting OPG levels, and so be associated with osteopenia and osteoporosis, and impaired bone metabolism in Crohn's disease and ulcerative colitis patients. Our study included 198 IBD patients and 41 healthy controls. Lumbar spine and femoral neck bone mineral density, T-score, Z-score as well as OPG, RANKL, vitamin D, calcium and interleukin 4 and 10 concentrations were determined for all study subjects. Genotyping of the TNFRSF11B polymorphic site was performed by restriction fragment length polymorphism technique. Statistical analyses were conducted using Statistica software. Odds ratios, 95 % confidence intervals, and P values were calculated using the HWE calculator. Our results did not allow determining an unequivocal association between the polymorphic variants of the TNFRSF11B 5'UTR region and a susceptibility to osteoporosis in IBD patients. We have shown, however, that the c.-223T allele was twice as more frequent in Crohn's disease (CD) patients than among controls (OR = 1.99, P value = 0.009). Interestingly, average osteoprotegerin levels in CD patients did not significantly differ from those in

  14. [Prevalence of C-reactive protein levels in adult population in two regions in the czech republic and their relation to body composition].

    Science.gov (United States)

    Cerovská, J; Hoskovcová, P; Vosátková, M; Zamrazilová, H; Zamrazil, V

    2006-11-01

    Increased concentration of high sensitivity C-reactive protein (hsCRP) is the new predictor of myocardial infarction, brain strokes, damage peripheral veins and sudden death. The aim of the study was to give an overview of current prevalence of individual risky concentrations of hsCRP in the adult population in two regions in the Czech Republic and to find a relationship to the indicators of fat tissue quantity. test involved a representative sample of 516 adults aged 18 to 65 years (191 men and 322 women), with permanent residence in the Jablonec nad Nisou a Príbram regions. Period of testing: spring of 2004 and 2005. HsCRP was determined using the latex immunoprecipitation method with turbidimetric measurement on Cobas Integra 400 plus analyzer. The risk of cardiovascular disease (CVD) was set according to the scale derived by the American Heart Association. Body fat was measured with TANITA BF 410 MA, Omron and a calliper on 4 places on the body. Waist circumference was measured half-way between the anthropometric landmarks of the iliocristale and the lower angle of the ribs. Body mass index (BMI) was calculated using Quetelet formula: weight/height2. Statistical processing was done with Statgraphics Plus, version 7.1, using categorical data analysis with the chi2 statistic and Spearman's correlation analysis. 20.2% of cases with high CVD risk were identified in the whole sample of adults. Levels of hsCRP exceeding 10 mg/l (infectious disease indicator) at the time of the test were found in 3.9% cases (5.6% in the Jablonec region, 2.3% in the Príbram region). There were no significant regional differences for individual CVD risk categories; however, there was statistically significant difference between the two regions in terms of average hsCRP levels (with higher levels in the Jablonec region). Gender had a statistically significant impact on hsCRP levels: high CVD risk was recorded in 14.8% men and in 23.3% women. Levels of CRP indicating inflammatory

  15. Application Self-organizing Map Type in a Study of the Profile of Gasoline C Commercialized in the Eastern and Northern Parana Regions

    Directory of Open Access Journals (Sweden)

    Lívia Ramazzoti Silva

    2015-06-01

    Full Text Available Artificial neural networks self-organizing map type (SOM was used to classify samples of automotive gasoline C marketed in the eastern and northern regions of the state of Paraná, Brazil. The input order of parameters in the network were the values of temperature of the first drop, the 10, 50 and 90% distilled bulk, the final boiling point, density, residue content and alcohol content. A network with a topology of 25x25 and 5000 training epochs was used. The weight maps of input parameters for the trained network identified that the most important parameters for classifying samples were the temperature of the first drop and the temperature of the 10% and 50% of the distilled fuel. DOI: http://dx.doi.org/10.17807/orbital.v7i2.732 

  16. Sequence conservation in the C-terminal region of spider silk proteins (Spidroin) from Nephila clavipes (Tetragnathidae) and Araneus bicentenarius (Araneidae).

    Science.gov (United States)

    Beckwitt, R; Arcidiacono, S

    1994-03-04

    The polymerase chain reaction (PCR) has been used to amplify the portion of the Spidroin 1 gene that codes for the C-terminal part of the silk protein of the spider Nephila clavipes. Along with some substitution mutations of minor consequence, the PCR-derived sequence reveals an additional base missing from the previously published Nephila Spidroin 1 sequence. Comparison of the PCR-derived sequence with the equivalent region of Spidroin 2 indicates that the insertion of this single base results in greatly increased similarity in the resulting amino acid sequences of Spidroin 1 and Spidroin 2 (75% over 97 amino acids). The same PCR primers also amplified a fragment of the same length from Araneus bicentenarius. This sequence is also very similar to Spidroin 1 of Nephila (71% over 238 bases excluding the PCR primers, which translates into 76% over 79 amino acids).

  17. Policy responses to viral hepatitis B and C among people who inject drugs in Member States of the WHO European region

    DEFF Research Database (Denmark)

    Spina, Alexander; Eramova, Irina; Lazarus, Jeffrey V

    2014-01-01

    it varies greatly. METHODS: The initial survey included 43 questions covering awareness, data, prevention, and screening and treatment. It was sent in five languages to identified national focal points. This sub-analysis included 11 questions and 53 Member States in the WHO European Region. Descriptive...... to the survey (response rate of 83%). More than three-quarters reported offering publicly-funded treatment for HBV or HCV (82% and 80%, respectively), with a significantly higher proportion of EU/EFTA Member States (P=0.004 and P=0.010, respectively). Half of Member States (53%) reported the existence...... of a national policy for hepatitis prevention and control; however less than one-third (27%) reported having written national strategies. Under half of the responding Member States reported holding events for World Hepatitis Day 2012. One-fifth reported offering hepatitis B and C testing free of charge...

  18. Study of the decay K+→π+νν¯ in the momentum region 140c

    Science.gov (United States)

    Artamonov, A. V.; Bassalleck, B.; Bhuyan, B.; Blackmore, E. W.; Bryman, D. A.; Chen, S.; Chiang, I.-H.; Christidi, I.-A.; Cooper, P. S.; Diwan, M. V.; Frank, J. S.; Fujiwara, T.; Hu, J.; Ives, J.; Jaffe, D. E.; Kabe, S.; Kettell, S. H.; Khabibullin, M. M.; Khotjantsev, A. N.; Kitching, P.; Kobayashi, M.; Komatsubara, T. K.; Konaka, A.; Kozhevnikov, A. P.; Kudenko, Yu. G.; Kushnirenko, A.; Landsberg, L. G.; Lewis, B.; Li, K. K.; Littenberg, L. S.; MacDonald, J. A.; Mildenberger, J.; Mineev, O. V.; Miyajima, M.; Mizouchi, K.; Mukhin, V. A.; Muramatsu, N.; Nakano, T.; Nomachi, M.; Nomura, T.; Numao, T.; Obraztsov, V. F.; Omata, K.; Patalakha, D. I.; Petrenko, S. V.; Poutissou, R.; Ramberg, E. J.; Redlinger, G.; Sato, T.; Sekiguchi, T.; Shinkawa, T.; Strand, R. C.; Sugimoto, S.; Tamagawa, Y.; Tschirhart, R.; Tsunemi, T.; Vavilov, D. V.; Viren, B.; Wang, Zhe; Yershov, N. V.; Yoshimura, Y.; Yoshioka, T.

    2009-05-01

    Experiment E949 at Brookhaven National Laboratory has observed three new events consistent with the decay K+→π+νν¯ in the pion momentum region 140c in an exposure of 1.71×1012 stopped kaons with an estimated total background of 0.93±0.17(stat)-0.24+0.32(syst) events. This brings the total number of observed K+→π+νν¯ events to seven. Combining this observation with previous results, assuming the pion spectrum predicted by the standard model, results in a branching ratio of B(K+→π+νν¯)=(1.73-1.05+1.15)×10-10. An interpretation of the results for alternative models of the decay K+→π++nothing is also presented.

  19. Study of the k+ to pi+, neutrino, anti-neutrino decay in the momentum region p(pi+) < 199 MeV/C

    Energy Technology Data Exchange (ETDEWEB)

    Artamonov, A.V.; Bassalleck, B.; Bhuyan, B.; Blackmore, E.W.; Bryman, D.A.; Chen, S.; Chiang, I.-H.; Christidi, I.-A.; Cooper, P.S.; Diwan, M.V.; Frank, J.S.; /Serpukhov, IHEP /New Mexico U. /Brookhaven /TRIUMF /British Columbia U. /Tsinghua U., Beijing /SUNY, Stony Brook /Fermilab /Kyoto U. /KEK, Tsukuba /Moscow, INR

    2009-01-01

    Experiment E949 at Brookhaven National Laboratory has observed three candidate events for the decay K{sup +} {yields} {pi}{sup +}{nu}{bar {nu}} in the pion momentum region 140 < P{sub {pi}} < 199 MeV/c in a exposure of 1.71 x 10{sup 12} stopped kaons with an estimated total background of 0.93 {+-} 0.17(stat.){sub -0.24}{sup +0.32}(syst.) events. Combination of this observation with previous results, assuming a pion spectrum as predicted by the standard model, produces a branching fraction of {beta} = (1.73{sub -1.05}{sup +1.15}) x 10{sup -10}. We also give the interpretation of the combined results for alternative model of the decay K{sup +} {yields} {pi}{sup +} + nothing.

  20. Mutations within a conserved region of the hepatitis C virus E2 glycoprotein that influence virus-receptor interactions and sensitivity to neutralizing antibodies.

    Science.gov (United States)

    Dhillon, Simrat; Witteveldt, Jeroen; Gatherer, Derek; Owsianka, Ania M; Zeisel, Mirjam B; Zahid, Muhammad N; Rychłowska, Malgorzata; Foung, Steven K H; Baumert, Thomas F; Angus, Allan G N; Patel, Arvind H

    2010-06-01

    Cell culture-adaptive mutations within the hepatitis C virus (HCV) E2 glycoprotein have been widely reported. We identify here a single mutation (N415D) in E2 that arose during long-term passaging of HCV strain JFH1-infected cells. This mutation was located within E2 residues 412 to 423, a highly conserved region that is recognized by several broadly neutralizing antibodies, including the mouse monoclonal antibody (MAb) AP33. Introduction of N415D into the wild-type (WT) JFH1 genome increased the affinity of E2 to the CD81 receptor and made the virus less sensitive to neutralization by an antiserum to another essential entry factor, SR-BI. Unlike JFH1(WT), the JFH1(N415D) was not neutralized by AP33. In contrast, it was highly sensitive to neutralization by patient-derived antibodies, suggesting an increased availability of other neutralizing epitopes on the virus particle. We included in this analysis viruses carrying four other single mutations located within this conserved E2 region: T416A, N417S, and I422L were cell culture-adaptive mutations reported previously, while G418D was generated here by growing JFH1(WT) under MAb AP33 selective pressure. MAb AP33 neutralized JFH1(T416A) and JFH1(I422L) more efficiently than the WT virus, while neutralization of JFH1(N417S) and JFH1(G418D) was abrogated. The properties of all of these viruses in terms of receptor reactivity and neutralization by human antibodies were similar to JFH1(N415D), highlighting the importance of the E2 412-423 region in virus entry.

  1. Light-associated and processing-dependent protein binding to 5' regions of rbcL mRNA in the chloroplasts of a C4 plant.

    Science.gov (United States)

    McCormac, D J; Litz, H; Wang, J; Gollnick, P D; Berry, J O

    2001-02-02

    In amaranth, a C(4) dicotyledonous plant, the plastid rbcL gene (encoding the large subunit of ribulose-1,5-bisphosphate carboxylase) is regulated post-transcriptionally during many developmental processes, including light-mediated development. To identify post-transcriptional regulators of rbcL expression, three types of analyses (polysome heel printing, gel retardation, and UV cross-linking) were utilized. These approaches revealed that multiple proteins interact with 5' regions of rbcL mRNA in light-grown, but not etiolated, amaranth plants. Light-associated binding of a 47-kDa protein (p47), observed by UV cross-linking, was highly specific for the rbcL 5' RNA. Binding of p47 occurred only with RNAs corresponding to mature processed rbcL transcripts (5'-untranslated region (UTR) terminating at -66); transcripts with longer 5'-UTRs did not associate with p47 in vitro. Variations in the length of the rbcL 5'-UTR were found to occur in vivo, and these different 5' termini may prevent or enhance light-associated p47 binding, possibly affecting rbcL expression as well. p47 binding correlates with light-dependent rbcL polysome association of the fully processed transcripts in photosynthetic leaves and cotyledons but not with cell-specific rbcL mRNA accumulation in bundle sheath and mesophyll chloroplasts.

  2. Alterations of the Blood-Brain Barrier and Regional Perfusion in Tumor Development: MRI Insights from a Rat C6 Glioma Model.

    Directory of Open Access Journals (Sweden)

    Monika Huhndorf

    Full Text Available Angiogenesis and anti-angiogenetic medications play an important role in progression and therapy of glioblastoma. In this context, in vivo characterization of the blood-brain-barrier and tumor vascularization may be important for individual prognosis and therapy optimization.We analyzed perfusion and capillary permeability of C6-gliomas in rats at different stages of tumor-growth by contrast enhanced MRI and dynamic susceptibility contrast (DSC MRI at 7 Tesla. The analyses included maps of relative cerebral blood volume (CBV and signal recovery derived from DSC data over a time period of up to 35 days after tumor cell injections.In all rats tumor progression was accompanied by temporal and spatial changes in CBV and capillary permeability. A leakage of the blood-brain barrier (slow contrast enhancement was observed as soon as the tumor became detectable on T2-weighted images. Interestingly, areas of strong capillary permeability (fast signal enhancement were predominantly localized in the center of the tumor. In contrast, the tumor rim was dominated by an increased CBV and showed the highest vessel density compared to the tumor center and the contralateral hemisphere as confirmed by histology.Substantial regional differences in the tumor highlight the importance of parameter maps in contrast or in addition to region-of-interest analyses. The data vividly illustrate how MRI including contrast-enhanced and DSC-MRI may contribute to a better understanding of tumor development.

  3. Alterations of the Blood-Brain Barrier and Regional Perfusion in Tumor Development: MRI Insights from a Rat C6 Glioma Model.

    Science.gov (United States)

    Huhndorf, Monika; Moussavi, Amir; Kramann, Nadine; Will, Olga; Hattermann, Kirsten; Stadelmann, Christine; Jansen, Olav; Boretius, Susann

    2016-01-01

    Angiogenesis and anti-angiogenetic medications play an important role in progression and therapy of glioblastoma. In this context, in vivo characterization of the blood-brain-barrier and tumor vascularization may be important for individual prognosis and therapy optimization. We analyzed perfusion and capillary permeability of C6-gliomas in rats at different stages of tumor-growth by contrast enhanced MRI and dynamic susceptibility contrast (DSC) MRI at 7 Tesla. The analyses included maps of relative cerebral blood volume (CBV) and signal recovery derived from DSC data over a time period of up to 35 days after tumor cell injections. In all rats tumor progression was accompanied by temporal and spatial changes in CBV and capillary permeability. A leakage of the blood-brain barrier (slow contrast enhancement) was observed as soon as the tumor became detectable on T2-weighted images. Interestingly, areas of strong capillary permeability (fast signal enhancement) were predominantly localized in the center of the tumor. In contrast, the tumor rim was dominated by an increased CBV and showed the highest vessel density compared to the tumor center and the contralateral hemisphere as confirmed by histology. Substantial regional differences in the tumor highlight the importance of parameter maps in contrast or in addition to region-of-interest analyses. The data vividly illustrate how MRI including contrast-enhanced and DSC-MRI may contribute to a better understanding of tumor development.

  4. Sequence analysis of serotype-specific synthesis regions II of Haemophilus influenzae serotypes c and d: evidence for common ancestry of capsule synthesis in Pasteurellaceae and Neisseria meningitidis.

    Science.gov (United States)

    Lâm, Thiên-Trí; Claus, Heike; Frosch, Matthias; Vogel, Ulrich

    2011-06-01

    Sequencing of yet unknown Haemophilus influenzae serotype c (Hic) and d (Hid) capsule synthesis regions II revealed four (ccs1-4) and five (dcs1-5) open reading frames, respectively. The inferred gene functions were in line with capsular polysaccharide structures. One or more proteins encoded by the Hic capsule synthesis region II showed similarity to Actinobacillus pleuropneumoniae serotype 1 and Actinobacillus suis K1 enzymes. Orthologues to the complete operon were observed in Actinobacillus minor strain 202, where even the gene order was conserved. Furthermore, Ccs4 was related to the capsule O-acetyltransferase of Neisseria meningitidis serogroup W-135. For the Hid locus, similarities to Hie, Mannheimia haemolytica A1 and N. meningitidis serogroup A were identified and the succession of genes was similar in the different species. The resemblance of genes and gene organization found for Hic and Hid with other species suggested horizontal gene transfer during capsule evolution across the bacterial classes. Copyright © 2011 Institut Pasteur. Published by Elsevier SAS. All rights reserved.

  5. Molecular cloning of a full-length cDNA for dentatorubral-pallidoluysian atrophy and regional expressions of the expanded alleles in the CNS

    Energy Technology Data Exchange (ETDEWEB)

    Onodera, Osamu; Oyake, Mutsuo; Takano, Hiroki [Niigata Univ. (Japan)] [and others

    1995-11-01

    Dentatorubral-pallidoluysian atrophy (DRPLA) is an autosomal dominant neurodegenerative disorder characterized by genetic anticipation and variable combinations of symptoms including myoclonus, epilepsy, cerebellar ataxia, choreoathetosis, and dementia. Recently, we discovered that DRPLA is caused by unstable expansion of a CAG repeat of a gene on the short arm of chromosome 12. We determined the consensus DRPLA cDNA sequence containing the complete coding region for 1,185 amino acids. The CAG repeat, which is expanded in DRPLA, is located 1,462 bp downstream from the putative methionine initiation codon and encodes a poly-glutamine tract. Although poly-serine and proline tracts exist near the CAG repeats, these poly-serine or proline tracts did not show any polymorphisms, which is in strong contrast to the high heterogeneity in the length of the CAG repeat. Northern blot analysis revealed a 4.7-kb transcript that is widely expressed in various tissues including heart, lung, kidney, placenta, skeletal muscle, and brain. Reverse transcription-PCR analysis revealed that the expanded alleles are transcribed to levels comparable to those of normal alleles. These results indicate that there is no difference in transcriptional efficiency between expanded and normal alleles. Furthermore, mRNA from cerebellar hemispheres of DRPLA patients showed smaller sizes of CAG repeats compared with other regions of the brain, which reflects somatic mosaicism of the expanded alleles of the DRPLA gene. 49 refs., 6 figs.

  6. Novel phenotypic variant in the MYH7 spectrum due to a stop-loss mutation in the C-terminal region: a case report.

    Science.gov (United States)

    Bánfai, Zsolt; Hadzsiev, Kinga; Pál, Endre; Komlósi, Katalin; Melegh, Márton; Balikó, László; Melegh, Béla

    2017-09-19

    Defects of the slow myosin heavy chain isoform coding MYH7 gene primarily cause skeletal myopathies including Laing Distal Myopathy, Myosin Storage Myopathy and are also responsible for cardiomyopathies. Scapuloperoneal and limb-girdle muscle weakness, congenital fiber type disproportion, multi-minicore disease were also reported in connection of MYH7. Pathogeneses of the defects in the head and proximal rod region of the protein are well described. However, the C-terminal mutations of the MYH7 gene are less known. Moreover, only two articles describe the phenotypic impact of the elongated mature protein product caused by termination signal loss. Here we present a male patient with an unusual phenotypic variant of early-onset and predominant involvement of neck muscles with muscle biopsy indicating myopathy and sarcoplasmic storage material. Cardiomyopathic involvements could not be observed. Sequencing of MYH7 gene revealed a stop-loss mutation on the 3-prime end of the rod region, which causes the elongation of the mature protein. The elongated protein likely disrupts the functions of the sarcomere by multiple functional abnormalities. This elongation could also affect the thick filament degradation leading to protein deposition and accumulation in the sarcomere, resulting in the severe myopathy of certain axial muscles. The phenotypic expression of the detected novel MYH7 genotype could strengthen and further expand our knowledge about mutations affecting the structure of MyHCI by termination signal loss in the MYH7 gene.

  7. The C-terminal region of the non-structural protein 2B from Hepatitis A Virus demonstrates lipid-specific viroporin-like activity

    Science.gov (United States)

    Shukla, Ashutosh; Dey, Debajit; Banerjee, Kamalika; Nain, Anshu; Banerjee, Manidipa

    2015-10-01

    Viroporins are virally encoded, membrane-active proteins, which enhance viral replication and assist in egress of viruses from host cells. The 2B proteins in the picornaviridae family are known to have viroporin-like properties, and play critical roles during virus replication. The 2B protein of Hepatitis A Virus (2B), an unusual picornavirus, is somewhat dissimilar from its analogues in several respects. HAV 2B is approximately 2.5 times the length of other 2B proteins, and does not disrupt calcium homeostasis or glycoprotein trafficking. Additionally, its membrane penetrating properties are not yet clearly established. Here we show that the membrane interacting activity of HAV 2B is localized in its C-terminal region, which contains an alpha-helical hairpin motif. We show that this region is capable of forming small pores in membranes and demonstrates lipid specific activity, which partially rationalizes the intracellular localization of full-length 2B. Using a combination of biochemical assays and molecular dynamics simulation studies, we also show that HAV 2B demonstrates a marked propensity to dimerize in a crowded environment, and probably interacts with membranes in a multimeric form, a hallmark of other picornavirus viroporins. In sum, our study clearly establishes HAV 2B as a bona fide viroporin in the picornaviridae family.

  8. The Neck Region of the C-type Lectin DC-SIGN Regulates Its Surface Spatiotemporal Organization and Virus-binding Capacity on Antigen-presenting Cells*

    Science.gov (United States)

    Manzo, Carlo; Torreno-Pina, Juan A.; Joosten, Ben; Reinieren-Beeren, Inge; Gualda, Emilio J.; Loza-Alvarez, Pablo; Figdor, Carl G.; Garcia-Parajo, Maria F.; Cambi, Alessandra

    2012-01-01

    The C-type lectin DC-SIGN expressed on dendritic cells (DCs) facilitates capture and internalization of a plethora of different pathogens. Although it is known that DC-SIGN organizes in nanoclusters at the surface of DCs, the molecular mechanisms responsible for this well defined nanopatterning and role in viral binding remain enigmatic. By combining biochemical and advanced biophysical techniques, including optical superresolution and single particle tracking, we demonstrate that DC-SIGN intrinsic nanoclustering strictly depends on its molecular structure. DC-SIGN nanoclusters exhibited free, Brownian diffusion on the cell membrane. Truncation of the extracellular neck region, known to abrogate tetramerization, significantly reduced nanoclustering and concomitantly increased lateral diffusion. Importantly, DC-SIGN nanocluster dissolution exclusively compromised binding to nanoscale size pathogens. Monte Carlo simulations revealed that heterogeneity on nanocluster density and spatial distribution confers broader binding capabilities to DC-SIGN. As such, our results underscore a direct relationship between spatial nanopatterning, driven by intermolecular interactions between the neck regions, and receptor diffusion to provide DC-SIGN with the exquisite ability to dock pathogens at the virus length scale. Insight into how virus receptors are organized prior to virus binding and how they assemble into functional platforms for virus docking is helpful to develop novel strategies to prevent virus entry and infection. PMID:23019323

  9. Triple-wavelength, narrowband Mg/SiC multilayers with corrosion barriers and high peak reflectance in the 25-80 nm wavelength region.

    Science.gov (United States)

    Fernández-Perea, Mónica; Soufli, Regina; Robinson, Jeff C; Rodríguez-De Marcos, Luis; Méndez, Jose A; Larruquert, Juan I; Gullikson, Eric M

    2012-10-08

    We have developed new, Mg/SiC multilayer coatings with corrosion barriers which can be used to efficiently and simultaneously reflect extreme ultraviolet (EUV) radiation in single or multiple narrow bands centered at wavelengths in the spectral region from 25 to 80 nm. Corrosion mitigation was attempted through the use of Al-Mg or Al thin layers. Three different multilayer design concepts were developed and deposited by magnetron sputtering and the reflectance was measured at near-normal incidence in a broad spectral range. Standard Mg/SiC multilayers were also deposited and measured for comparison. They were shown to efficiently reflect radiation at a wavelength of 76.9 nm with a peak reflectance of 40.6% at near-normal incidence, the highest experimental reflectance reported at this wavelength for a narrowband coating. The demonstration of multilayer coatings with corrosion resistance and multiple-wavelength EUV performance is of great interest in the development of mirrors for space-borne solar physics telescopes and other applications requiring long-lasting coatings with narrowband response in multiple emission lines across the EUV range.

  10. High-resolution infrared spectrum of jet-cooled methyl acetate in the C=O stretching region: internal rotations of two inequivalent methyl tops.

    Science.gov (United States)

    Sunahori, Fumie X; Borho, Nicole; Liu, Xunchen; Xu, Yunjie

    2011-12-21

    The jet-cooled high resolution infrared (IR) spectrum of methyl acetate (MA), CH(3)-C(=O)-O-CH(3), in the C=O fundamental band region was recorded by using a rapid scan IR laser spectrometer equipped with an astigmatic multipass cell. No high resolution IR analyses of the ro-vibrational transitions between the ground and non-torsionally excited vibrational states have hitherto been reported for molecules with two inequivalent methyl rotors. Because of the two chemically different methyl tops in MA, i.e., the acetyl -CH(3) and methoxy -CH(3), each rotational energy level is split into more than two torsional sublevels by internal rotations of these methyl groups. We were able to assign ro-vibrational transitions of four torsional species by using the ground state combination differences calculated from the molecular constants of the vibrational ground state recently determined by a global fit of the microwave and millimeter wave lines [M. Tudorie, I. Kleiner, J. T. Hougen, S. Melandri, L. W. Sutikdja, and W. Stahl, J. Mol. Spectrosc. 269, 211 (2011)]. The assigned lines were successfully fitted using the BELGI-Cs-IR program to an overall standard deviation which is comparable to the measurement accuracy. This study is also of interest in understanding the role of methyl rotors in the intramolecular vibrational-energy redistribution processes in mid-size organic molecules.

  11. The NOD2 3020insC Mutation in Women with Breast Cancer from the Bydgoszcz Region in Poland. First Results

    Directory of Open Access Journals (Sweden)

    Janiszewska Hanna

    2006-01-01

    Full Text Available Abstract The frameshift NOD2 gene mutation 3020insC is predominantly associated with Crohn's disease, but predisposes to many types of common cancers as well. We studied the frequency of this mutant NOD2 allele in 148 breast cancer women from the Bydgoszcz region in Poland. The NOD2 mutation was present in 8.8% of the patients. The mean age at breast cancer diagnosis of the mutation carriers was 43 years. We did not find any mutation in patients diagnosed with breast cancer after the age of 50 years. There was no association of the NOD2 mutation with a strong family history of breast cancer. On the contrary, the mutation frequency (11.4% was two times higher in women from families with a single case of breast cancer and with aggregation of other common types of cancer, especially digestive tract cancers. Low risk of breast cancer in the mutation carriers seems to be confirmed by finding the 3020insC mutation in three healthy parents of probands aged 73, 74 and 83 years, from three separate families.

  12. The infrared spectrum of 13C2H2 in the 60-2600 cm-1 region: bending states up to v 4 + v 5 = 4

    Science.gov (United States)

    Predoi-Cross, Adriana; Herman, Michel; Fusina, Luciano; Di Lonardo, Gianfranco

    2012-11-01

    The vibration-rotation spectra of 13C substituted acetylene, 13C2H2, have been recorded in the region between 60 and 2600 cm-1 at an effective resolution ranging from 0.001 to 0.006 cm-1. Three different instruments were used to collect the experimental data in the extended spectral interval investigated. In total 9529 rotation vibration transitions have been assigned to 101 bands involving the bending states up to v tot = v 4 + v 5 = 4, allowing the characterization of the ground state and of 33 vibrationally excited states. All the bands involving states up to v tot = 3 have been analyzed simultaneously by adopting a model Hamiltonian which takes into account the vibration and rotation l-type resonances. The derived spectroscopic parameters reproduce the transition wavenumbers with a RMS value of the order of the experimental uncertainty. Using the same model, larger discrepancies between observed and calculated values have been obtained for transitions involving states with v tot = 4. These could be satisfactorily reproduced only by adopting a set of effective constants for each vibrational manifold, in addition to the previously determined parameters, which were constrained in the analysis.

  13. Determination of geographical origin of olive oils using 13C nuclear magnetic resonance spectroscopy. I - Classification of olive oils of the Puglia region with denomination of protected origin.

    Science.gov (United States)

    Vlahov, Giovanna; Del Re, Paolo; Simone, Nicola

    2003-09-10

    13C nuclear magnetic resonance spectroscopy was used to classify olive oils from the three production areas of the Puglia region labeled with the "denomination of protected origin" (DPO) Terra di Bari, Colline di Brindisi, and Dauno. High resolution (13)C spectra of 173 olive oil samples were measured, and the intensity data of triacylglycerol resonances were processed by using linear discriminant analysis, which was carried out stepwise for variable selection. The olive oil samples from the DPOs Colline di Brindisi and Terra di Bari were 90% correctly classified, whereas only 74% of "Dauno" DPO oils were classified in the true group. The performance of the discriminant model was verified by applying the cross-validation procedure based on the "leave one out" formalism. The discriminant model was evaluated against a blind test set of olive oils from the three DPO areas. All the oils used for the purpose were correctly assigned to their respective groups, with the exception of the Dauno oil samples based on the Coratina cv. They were misclassified as Terra di Bari oils because of a common monovarietal composition.

  14. The Ma Gene for Complete-Spectrum Resistance to Meloidogyne Species in Prunus Is a TNL with a Huge Repeated C-Terminal Post-LRR Region1[C][W

    Science.gov (United States)

    Claverie, Michel; Dirlewanger, Elisabeth; Bosselut, Nathalie; Van Ghelder, Cyril; Voisin, Roger; Kleinhentz, Marc; Lafargue, Bernard; Abad, Pierre; Rosso, Marie-Noëlle; Chalhoub, Boulos; Esmenjaud, Daniel

    2011-01-01

    Root-knot nematode (RKN) Meloidogyne species are major polyphagous pests of most crops worldwide, and cultivars with durable resistance are urgently needed because of nematicide bans. The Ma gene from the Myrobalan plum (Prunus cerasifera) confers complete-spectrum, heat-stable, and high-level resistance to RKN, which is remarkable in comparison with the Mi-1 gene from tomato (Solanum lycopersicum), the sole RKN resistance gene cloned. We report here the positional cloning and the functional validation of the Ma locus present at the heterozygous state in the P.2175 accession. High-resolution mapping totaling over 3,000 segregants reduced the Ma locus interval to a 32-kb cluster of three Toll/Interleukin1 Receptor-Nucleotide Binding Site-Leucine-Rich Repeat (LRR) genes (TNL1–TNL3), including a pseudogene (TNL2) and a truncated gene (TNL3). The sole complete gene in this interval (TNL1) was validated as Ma, as it conferred the same complete-spectrum and high-level resistance (as in P.2175) using its genomic sequence and native promoter region in Agrobacterium rhizogenes-transformed hairy roots and composite plants. The full-length cDNA (2,048 amino acids) of Ma is the longest of all Resistance genes cloned to date. Its TNL structure is completed by a huge post-LRR (PL) sequence (1,088 amino acids) comprising five repeated carboxyl-terminal PL exons with two conserved motifs. The amino-terminal region (213 amino acids) of the LRR exon is conserved between alleles and contrasts with the high interallelic polymorphisms of its distal region (111 amino acids) and of PL domains. The Ma gene highlights the importance of these uncharacterized PL domains, which may be involved in pathogen recognition through the decoy hypothesis or in nuclear signaling. PMID:21482634

  15. Paleoenvironments, δ13C and δ18O signatures in the Neoproterozoic carbonates of the Comba Basin, Republic of Congo: Implications for regional correlations and Marinoan event

    Science.gov (United States)

    Préat, Alain; Delpomdor, Franck; Ackouala Mfere, Anna Perla; Callec, Yannick

    2018-01-01

    The Ediacaran Schisto-Calcaire Group is a ∼1300 m-thick succession belonging to the West Congo Supergroup in Central Africa. In the Comba Basin, it consists of three carbonate-dominated units defined as formations (SCI to SCIII) that are unconformably overlain by clastic deposits (Mpioka Group) interpreted as a molassic formation associated with the Panafrican Orogen. The underlying Upper Tillite and Cap Carbonate (SCIa) units, considered as markers of the Snowball Earth event were studied in three sections. We investigated the carbonates of the Schisto-Calcaire Group by defining new microfacies (MF1-MF7) and we performed C and O isotopic analyses in order to constraint the depositional and diagenetic events directly after the Marinoan interval. Stratigraphic variations of the stable isotopes are important in the series with lighter δ18O values (>1.5‰) than those of the Neoproterozoic ocean in the SCIc unit. According to regional stratigraphy a temperature effect can be dismissed and a freshwater surface layer is the origin of such negative δ18O values in this unit. The negative δ13C anomaly (-3.5‰ on average) of the Cap Carbonate is similarly to the δ18O values (-6.4‰ on average) in the range of the marine domain during postglacial sea level rise. The sample suite as a whole (SCII and SCIII formations) displays heavier δ18O and δ13C than those of the lower part (SCI unit) of the Schisto-Calcaire Group. The comparison with the Lower Congo (Democratic Republic of Congo) and Nyanga (Gabon) basins shows that the meteoric flushing in SCIc unit of the Schisto-Calcaire Group was regional and not local, and could be derived from a climatic evolution. Although an overall overprint is present, our isotopic relationships argue against overall diagenetic resetting of primary compositions and suggest that with careful examination combined with detailed petrographic analysis general depositional and diagenetic controls can be discerned in oxygen and carbon

  16. Characterising regional landslide initiation thresholds in Scotland, UK using NIMROD c-band precipitation radar and the BGS National Landslide Database.

    Science.gov (United States)

    Postance, Benjamin; Hillier, John; Dijkstra, Tom; Dixon, Neil

    2016-04-01

    Forecasting changes in slope stability and the location and timing of landslide events is of great scientific and societal interest. This is particularly the case in the context of critical infrastructure systems as these can cross many geological and hydro-geological domains and provide essential societal services. An established area of enquiry is that of characterising site, regional and national scale hydro-meteorological proxies (e.g. precipitation intensity/duration, antecedent precipitation or soil moisture deficit) to distil antecedent and initiation landslide threshold conditions. However, the application of such methods often suffers from limited spatio-temporal availability of meteorological data and landslide inventories. There are relatively few studies applying remotely sensed meteorological data to examine precursory conditions at national, regional and local scale. This study seeks to address this by applying remotely sensed meteorological data to examine precursory conditions at national, regional and local scale in combination with information derived from the BGS National Landslide Database. There are a total 115 landslides in Scotland, UK with recorded date of failure in the BGS National Landslide Database covering the period 2004 to 2015. To determine landslide initiation thresholds high resolution (15 minute 5km2) c-band precipitation intensity (mm/hr) radar data are analysed leading to the establishment of precipitation intensity time series for each landslide location. These time series enable calculation of derived explanatory variables including daily mean, max, volume and the aggregation of antecedent values at 3, 6, 18, 36 and 72 days. The statistical significance of each variable is determined, with the lowest probability of the observed occurrences being due to chance taken as indicating the best explanation. Combinations of thresholds and various spatial scales are examined to identify national and regional triggering conditions

  17. The mitogenic function of hepatitis B virus X protein resides within amino acids 51 to 140 and is modulated by N- and C-terminal regulatory regions.

    Science.gov (United States)

    Li, Huajie; Chi, Chia-Yi; Lee, Sook; Andrisani, Ourania M

    2006-11-01

    The hepatitis B virus (HBV) X protein (pX) is implicated in hepatocarcinogenesis by an unknown mechanism. pX variants encoded by HBV genomes found integrated in genomic DNA from liver tumors of patients with hepatocellular carcinoma (HCC) generally lack amino acids 134 to 154. Since deregulation of mitogenic pathways is linked to oncogenic transformation, herein we define the pX region required for mitogenic pathway activation. A series of pX deletions was used to construct tetracycline-regulated pX-expressing cell lines. The activation of the mitogenic pathways by these pX deletions expressed in the constructed cell lines was measured by transient transreporter assays, effects on endogenous cyclin A expression, and apoptosis. Conditional expression of pX51-140 in AML12 clone 4 cell line activates the mitogenic pathways, induces endogenous cyclin A expression, and sensitizes cells to apoptosis, similar to wild-type (WT) pX. By contrast, pX1-115 is inactive, supporting the idea that amino acids 116 to 140 are required for mitogenic pathway activation. Moreover, this pX deletion analysis demonstrates that WT pX function is modulated by two regions spanning amino acids 1 to 78 and 141 to 154. The N-terminal X1-78, expressed via a retroviral vector in WT pX-expressing 4pX-1 cells, coimmunoprecipitates with WT pX, indicating this pX region participates in protein-protein interactions leading to pX oligomerization. Interestingly, pX1-78 interferes with WT pX in mediating mitogenic pathway activation, endogenous gene expression, and apoptosis. The C-terminal pX region spanning amino acids 141 to 154 decreases pX stability, determined by pulse-chase studies of WT pX and pX1-140, suggesting that increased stability of naturally occurring pX variants lacking amino acids 134 to 154 may play a role in HCC development.

  18. A conserved glycine residue in the C-terminal region of human ATG9A is required for its transport from the endoplasmic reticulum to the Golgi apparatus.

    Science.gov (United States)

    Staudt, Catherine; Gilis, Florentine; Tevel, Virginie; Jadot, Michel; Boonen, Marielle

    2016-10-14

    ATG9A is the only polytopic protein of the mammalian autophagy-related protein family whose members regulate autophagosome formation during macroautophagy. At steady state, ATG9A localizes to several intracellular sites, including the Golgi apparatus, endosomes and the plasma membrane, and it redistributes towards autophagosomes upon autophagy induction. Interestingly, the transport of yeast Atg9 to the pre-autophagosomal structure depends on its self-association, which is mediated by a short amino acid motif located in the C-terminal region of the protein. Here, we investigated whether the residues that align with this motif in human ATG9A (V(515)-C(519)) are also required for its trafficking in mammalian cells. Interestingly, our findings support that human ATG9A self-interacts as well, and that this process promotes transport of ATG9A molecules through the Golgi apparatus. Furthermore, our data reveal that the transport of ATG9A out of the ER is severely impacted after mutation of the conserved V(515)-C(519) motif. Nevertheless, the mutated ATG9A molecules could still interact with each other, indicating that the molecular mechanism of self-interaction differs in mammalian cells compared to yeast. Using sequential amino acid substitutions of glycine 516 and cysteine 519, we found that the stability of ATG9A relies on both of these residues, but that only the former is required for efficient transport of human ATG9A from the endoplasmic reticulum to the Golgi apparatus. Copyright © 2016 Elsevier Inc. All rights reserved.

  19. Regional Distribution of Metals and C and N Stable Isotopes in the Epiphytic Ball Moss (Tillandsia Recurvata) at the Mezquital Valley, Hidalgo State

    Science.gov (United States)

    Zambrano-Garcia, A.; López-Veneroni, D.; Rojas, A.; Torres, A.; Sosa, G.

    2007-05-01

    As a part of the MILAGRO Field Campaign 2006, the influence of anthropogenic sources to metal air pollution in the Mezquital Valley, Hidalgo State, was explored by biomonitoring techniques. This valley is a major industrial- agriculture area located in central Mexico. An oil refinery, an electrical power plant, several cement plants with open-pit mines, as well as intensive wastewater-based agricultural areas, all within a 50 km radius, are some of the most important local sources of particulate air pollution. The concentrations of 25 metals and elements were determined by ICP-AES (EPA 610C method) for triplicate composite samples of the "ball moss" (T. recurvata ) collected at 50 sites. In addition, the ratios of two stable isotopes ((13C/12C and 15N/14N) were determined by continuous-flow isotope-ratio mass spectrometry in order to assess their potential as tracers for industrial emissions. Preliminary results showed high to very high average contents of several metals in the biomonitor compared to values from similar studies in other world regions, indicating a high degree of local air pollution. In contrast, most samples had Ag, As, Be, Se and Tl contents below detection levels (DL = 0.05 mg/kg of sample dry weight) indicating low levels of pollution by these metals. Metals such as Al, Ba, Ca, Fe, Li, Mo, Ni, Sr, Ti, V and Zn concentrated the most at the South portion of the valley, where the Tepeji-Tula-Apaxco industrial corridor is located. A transect parallel to the along-wind direction (N-S) showed a higher concentration of metals farther away from the sources relative to a cross-wind transect, which is consistent with the eolian transport of metal-enriched particles. Regional distribution maps of metals in the biomonitor showed that Al, Ba, Fe, Mo, Ni, Sr, Ti and V had higher levels at the industrial sampling sites; whereas K, Na and P were more abundant near to agriculture areas. Vanadium, a common element of crude oil, reflected better the influence from

  20. Diferenciais regionais de mortalidade por câncer no Estado do Rio de Janeiro, Brasil, 1979-1981 Regional differentials in cancer mortality in a region of, Brazil, 1979-1981

    Directory of Open Access Journals (Sweden)

    Cynthia Boschi

    1991-08-01

    Full Text Available A partir do fato de que os neoplasmas malignos foram a terceira causa de morte no Estado do Rio de Janeiro, Brasil, no ano de 1980, apresentando taxa bruta igual a 89,8 por 100.000 habitantes, foi analisada a mortalidade por câncer segundo suas principais localizações anatômicas, no período 1979-1981. Dividiu-se o Estado em três regiões distintas: Capital, Cinturão Metropolitano e Interior. Foram calculados coeficientes de mortalidade trienais, posteriormente padronizados pelo método direto utilizando-se, para tal, a população mundial. Para cumprir o objetivo de comparar diferentes regiões geográficas foram calculadas razões padronizadas de mortalidade. Observou-se que as principais localizações anatômicas foram pulmão, estômago, próstata, esôfago e fígado, nos homens; e mama, estômago, pulmão, cérvix uterino e útero (não especificado, nas mulheres. Encontrou-se que as maiores taxas para o total de tumores ocorreram na Capital e as menores no Interior, sendo as maiores razões padronizadas de mortalidade aquelas para mama (1,88, cólon (1,71 e pulmão (1,70. A mortalidade por neoplasmas malignos de esôfago e de fígado foi maior no Interior do que nas demais regiões, em ambos os sexos. Concluiu-se que existe comportamento distinto da mortalidade por câncer entre as diferentes regiões, apontando, mais uma vez, na direção da determinação ambiental de grande parte dos neoplasmas malignos.In 1980, malignant neoplasms ranked 3rd as a cause of death in the State of Rio de Janeiro, Brazil, with a crude mortality rate of 89.8 per 100,000. Cancer mortality data for 1979-1981 are presented for the State, with the objective of analyzing regional differentials. For the purpose of comparing mortality from the most important cancers, the State was divided into three regions: Capital, Metropolitan Belt and Interior, on the basis of the geographical structure of the State - which gave rise to the present urbanization patterns

  1. The Chikungunya Virus Capsid Protein Contains Linear B Cell Epitopes in the N- and C-Terminal Regions that are Dependent on an Intact C-Terminus for Antibody Recognition

    Directory of Open Access Journals (Sweden)

    Lucas Y. H. Goh

    2015-06-01

    Full Text Available Chikungunya virus (CHIKV is an arthropod-borne agent that causes severe arthritic disease in humans and is considered a serious health threat in areas where competent mosquito vectors are prevalent. CHIKV has recently been responsible for several millions of cases of disease, involving over 40 countries. The recent re-emergence of CHIKV and its potential threat to human health has stimulated interest in better understanding of the biology and pathogenesis of the virus, and requirement for improved treatment, prevention and control measures. In this study, we mapped the binding sites of a panel of eleven monoclonal antibodies (mAbs previously generated towards the capsid protein (CP of CHIKV. Using N- and C-terminally truncated recombinant forms of the CHIKV CP, two putative binding regions, between residues 1–35 and 140–210, were identified. Competitive binding also revealed that five of the CP-specific mAbs recognized a series of overlapping epitopes in the latter domain. We also identified a smaller, N-terminally truncated product of native CP that may represent an alternative translation product of the CHIKV 26S RNA and have potential functional significance during CHIKV replication. Our data also provides evidence that the C-terminus of CP is required for authentic antigenic structure of CP. This study shows that these anti-CP mAbs will be valuable research tools for further investigating the structure and function of the CHIKV CP.

  2. The Chikungunya Virus Capsid Protein Contains Linear B Cell Epitopes in the N- and C-Terminal Regions that are Dependent on an Intact C-Terminus for Antibody Recognition

    Science.gov (United States)

    Goh, Lucas Y. H.; Hobson-Peters, Jody; Prow, Natalie A.; Baker, Kelly; Piyasena, Thisun B. H.; Taylor, Carmel T.; Rana, Ashok; Hastie, Marcus L.; Gorman, Jeff J.; Hall, Roy A.

    2015-01-01

    Chikungunya virus (CHIKV) is an arthropod-borne agent that causes severe arthritic disease in humans and is considered a serious health threat in areas where competent mosquito vectors are prevalent. CHIKV has recently been responsible for several millions of cases of disease, involving over 40 countries. The recent re-emergence of CHIKV and its potential threat to human health has stimulated interest in better understanding of the biology and pathogenesis of the virus, and requirement for improved treatment, prevention and control measures. In this study, we mapped the binding sites of a panel of eleven monoclonal antibodies (mAbs) previously generated towards the capsid protein (CP) of CHIKV. Using N- and C-terminally truncated recombinant forms of the CHIKV CP, two putative binding regions, between residues 1–35 and 140–210, were identified. Competitive binding also revealed that five of the CP-specific mAbs recognized a series of overlapping epitopes in the latter domain. We also identified a smaller, N-terminally truncated product of native CP that may represent an alternative translation product of the CHIKV 26S RNA and have potential functional significance during CHIKV replication. Our data also provides evidence that the C-terminus of CP is required for authentic antigenic structure of CP. This study shows that these anti-CP mAbs will be valuable research tools for further investigating the structure and function of the CHIKV CP. PMID:26061335

  3. A retrospective case-control study of hepatitis C virus infection and oral lichen planus in Japan: association study with mutations in the core and NS5A region of hepatitis C virus

    Science.gov (United States)

    2012-01-01

    Background The aims of this study were to assess the prevalence of hepatitis C virus (HCV) infection in Japanese patients with oral lichen planus and identify the impact of amino acid (aa) substitutions in the HCV core region and IFN-sensitivity-determining region (ISDR) of nonstructural protein 5A (NS5A) associated with lichen planus. Methods In this retrospective study, 59 patients (group 1-A) with oral lichen planus among 226 consecutive patients who visited our hospital and 85 individuals (group 1-B, controls) with normal oral mucosa were investigated for the presence of liver disease and HCV infection. Risk factors for the presence of oral lichen planus were assessed by logistic regression analysis. We compared aa substitutions in the HCV core region (70 and/or 91) and ISDR of NS5A of 12 patients with oral lichen planus (group 2-A) and 7 patients who did not have oral lichen planus (group 2-B) among patients (high viral loads, genotype 1b) who received interferon (IFN) therapy in group1-A. Results The prevalence of anti-HCV and HCV RNA was 67.80% (40/59) and 59.32% (35/59), respectively, in group 1-A and 31.76% (27/85) and 16.47% (14/85), respectively, in group 1-B. The prevalence of anti-HCV (P lichen planus. The adjusted odds ratios for these three factors were 6.58, 3.53 and 2.58, respectively, and each was statistically significant. No significant differences in viral factors, such as aa substitutions in the core region and ISDR of NS5A, were detected between the two groups (groups 2-A and -B). Conclusion We observed a high prevalence of HCV infection in patients with oral lichen planus. Longstanding HCV infection, hypoalbuminemia, and smoking were significant risk factors for the presence of oral lichen planus in patients. It is advisable for Japanese patients with lichen planus to be tested for HCV infection during medical examination. PMID:22490000

  4. Phospholipase C ε-1 gene polymorphisms and prognosis of esophageal cancer patients from a high-incidence region in northern China.

    Science.gov (United States)

    Zhou, Rong-Miao; Li, Yan; Wang, Na; Huang, Xi; Cao, Shi-Ru

    2018-01-01

    Recent genome-wide association studies identified susceptibility loci for esophageal squamous cell carcinoma (ESCC), the most common histological type of esophageal cancer, in the phospholipase C ε-1 gene (PLCE1). The aim of the present study was to investigate whether polymorphisms of PLCE1 were associated with the prognosis of ESCC patients in a high-incidence region of northern China. The PLCE1 rs2274223 A/G and rs11599672T/G single-nucleotide polymorphisms (SNPs) were genotyped by polymerase chain reaction-ligase detection reaction method in 207 ESCC patients with survival information. The mean age ± standard deviation of the 207 ESCC patients was 60.3±7.9 years. Sex, age, smoking status and family history of upper gastrointestinal cancer were not found to be associated with the survival time of ESCC patients. The mean survival time of rs2274223 SNP A/A, A/G and G/G genotype carriers were 42.9, 43.4 and 46.3 months, respectively; for rs11599672 SNP T/T, T/G and G/G genotype carriers the survival time were 42.8, 43.8 and 42.7 months, respectively. There was no significant difference in survival time among the ESCC patients with different genotypes of rs2274223 and rs11599672 SNPs. In conclusion, PLCE1 rs227423 and rs11599672 SNPs cannot be used as predictive markers for the survival of ESCC patients from a high-incidence region of northern China.

  5. Epidemiologic and clinical characteristics of pregnant women living with HIV/AIDS in a region of Southern Brazil where the subtype C of HIV-1 infection predominates

    Directory of Open Access Journals (Sweden)

    Sandra Aparecida Manenti

    Full Text Available Southern Brazil has the highest prevalence rate of AIDS in the country and is the only region in the Americas where HIV-1 subtype C prevails. OBJECTIVE: We evaluated the epidemiologic and clinical characteristics of pregnant women living with HIV/AIDS in the South region of Santa Catarina, Brazil. METHODS: All pregnant women with HIV infection attending the obstetric outpatient clinic of Criciúma, State of Santa Catarina, in 2007 (n = 46 were invited to participate. Data of 36 eligible participants were obtained through a standardized questionnaire. RESULTS: The great majority were young, with a steady partner, low family income, low education level and referring early first sexual intercourse. Many reported use of illicit non-injecting drugs (55.5% and unprotected sex with partners that were HIV-positive (57.7%, injecting drug user (22.2%, male inmate (19.4%, truck driver (13.8%, with history of sexually transmitted disease (11.1% or men who have sex with men (MSM (2.8%. Most (66.7% of the participants had their HIV diagnosis done during the pregnancy, 7 (19.4% had a previous history of HIV mother-to-child transmission. Therapy based on highly active antiretroviral therapy (94% was initiated at 19.3 weeks on average and 33% showed irregular antiretroviral adherence. CONCLUSION: These results confirm previous data on HIV epidemiology in Brazil and suggest that the women partners' sexual behavior and unprotected sexual intercourse are important aspects of HIV epidemic. Additional efforts in education, prophylaxis and medication adherence are needed.

  6. Seroprevalence of hepatitis B and hepatitis C markers among children and adolescents in the south brazilian region: metropolitan area of Florianópolis, Santa Catarina

    Directory of Open Access Journals (Sweden)

    Andréia Royer Voigt

    Full Text Available Hepatitis B and C are important causes of morbidity and mortality worldwide. In Brazil, according to the Ministry of Health, about 15% of population is infected by hepatitis B virus (HBV and less than 1% by hepatitis C virus (HCV. Nevertheless, the age-specific prevalence of HBV and HCV markers remains unknown. This study aimed to determine the seroprevalence of HBV and HCV markers of infection and immunity in children and adolescents between 10 to 16 years old who live in the metropolitan area of Florianópolis, state of Santa Catarina, South of Brazil. Three hundred and eighty four individuals were enrolled in this study. Serological markers for HBV and HCV (HBsAg, total anti-HBc, anti-HBc IgM, anti-HBs and anti-HCV were determined through Microparticle Enzyme Immunosorbant Assay (MEIA - AxSYM System® - by using commercial diagnostic kits (Abbott Laboratories, Abbott Park, Illinois, USA. All 384 adolescents (100% were negative for HBsAg and anti-HBc IgM. Only two (0.52% were positive for total anti-HBc. Among the studied individuals, 226 (58.85% presented titers of anti-HBs > 10.0mIU/mL, 121 (31.51% presented anti HBs < 10.0mIU/mL, and 37 (9.64% did not present titers of anti-HBs. Regarding to anti-HCV, all 384 adolescents (100% presented negative results for this marker. In conclusion, this study showed a low prevalence of HBV and HCV infections. In addition, it was verified a great number of children and adolescents (89.84% who were positive for the immunity marker anti-HBs, implying that the National Immunization Program Protocol for hepatitis B has been effective in the studied region.

  7. DNA requirements for interaction of the C-terminal region of Ku80 with the DNA-dependent protein kinase catalytic subunit (DNA-PKcs).

    Science.gov (United States)

    Radhakrishnan, Sarvan Kumar; Lees-Miller, Susan P

    2017-09-01

    Non-homologous end joining (NHEJ) is the major pathway for the repair of ionizing radiation induced DNA double strand breaks (DSBs) in human cells. Critical to NHEJ is the DNA-dependent interaction of the Ku70/80 heterodimer with the DNA-dependent protein kinase catalytic subunit (DNA-PKcs) to form the DNA-PK holoenzyme. However, precisely how Ku recruits DNA-PKcs to DSBs ends to enhance its kinase activity has remained enigmatic, with contradictory findings reported in the literature. Here we address the role of the Ku80 C-terminal region (CTR) in the DNA-dependent interaction of Ku70/80 with DNA-PKcs using purified components and defined DNA structures. Our results show that the Ku80 CTR is required for interaction with DNA-PKcs on short segments of blunt ended 25bp dsDNA or 25bp dsDNA with a 15-base poly dA single stranded (ss) DNA extension, but this requirement is less stringent on longer dsDNA molecules (35bp blunt ended dsDNA) or 25bp duplex DNA with either a 15-base poly dT or poly dC ssDNA extension. Moreover, the DNA-PKcs-Ku complex preferentially forms on 25 bp DNA with a poly-pyrimidine ssDNA extension.Our work clarifies the role of the Ku80 CTR and dsDNA ends on the interaction of DNA-PKcs with Ku and provides key information to guide assembly and biology of NHEJ complexes. Copyright © 2017 Elsevier B.V. All rights reserved.

  8. 13C-GC-MS analysis of photosynthetic products of the phytoplankton population in the regional upwelling area around the Izu Island, Japan

    Science.gov (United States)

    Hama, Takeo

    1988-01-01

    Monosaccharide and amino acid composition of the photosynthetic products of the phytoplankton populations were determined by the combined 13C and gas chromatography-mass spectrometry (GC-MS) method inside and outside of regional upwelling waters around the Izu Islands, Japan. The ratio of carbohydrate to protein in photosynthetic products was lower in the "maturing" upwelling waters, where high concentrations of nutrients were measured, than in the non-upwelling and the "aged" upwelling waters. Carbohydrate/protein ratios in photosynthetic products were closely correlated with glucose/carbohydrate ratios. The specific production rate (SPR) of glucose showed the highest value among compounds at almost all stations. The difference between SPR of glucose and those of other compounds was small in the "maturing" upwelling waters, whereas daytime SPR of glucose was over 10 times greater than those in other compounds in the non-upwelling and the "aged" upwelling waters. These results indicate that more "balanced" organic matter production occurred in the "maturing" waters than in the non-upwelling and the "aged" upwelling waters.

  9. Design of low DMD few-mode optical fibers with extremely enlarged core diameter providing nonlinearity suppression for operating over "C"-band central region

    Science.gov (United States)

    Andreev, Vladimir A.; Bourdine, Anton V.; Burdin, Vladimir A.; Evtushenko, Alexander S.; Halikov, Rashid H.

    2017-04-01

    We present method for design of refractive index profile for silica GeO2-doped graded-index few-mode optical fibers with reduced differential mode delay and suppressed mode nonlinearity due to extremely enlarged core diameter up to 42 μm. Proposed solution is based on earlier on developed modified Gaussian approximation generalized for analysis of silica weakly guiding optical fibers with single outer cladding and arbitrary axially-symmetric refractive index profile, that provides ability to derive analytical expressions for guided mode delays. Therefore the objective function is represented as a sum of squares of deviations between mode staff delays and reference value corresponding to refractive index profile of current iteration. Based on developed method we performed computation for various combination of the reference mode delay and first iteration profile parameter. Some results of desired graded-index profile for a few-mode optical fibers 42/125 providing differential mode delay minimization over central region of "C"-band are represented.

  10. Breakpoint cluster region-c-abl oncogene 1, non-receptor tyrosine kinase signaling: Current patterns of the versatile regulator revisited

    Directory of Open Access Journals (Sweden)

    Aamir Rana

    2013-01-01

    Full Text Available Increasing sophisticated information suggests that cancer cells express constitutively active oncogenic kinases such as breakpoint cluster region- c-abl oncogene 1, non-receptor tyrosine kinase (BCR-ABL1 that promote carcinogenesis independent of extrinsic growth factors. It is a well-established fact that through the aberrant activation of BCR-ABL1 signal transduction cascade, the perception of cellular growth signals becomes disconnected from the processes promoting cell growth, and this underlies the pathophysiology of leukemia. In this particular review we discuss the oncogenes and tumor suppressors comprising the regulatory network upstream and downstream of BCR-ABL1 and dismantle how derailed BCR-ABL1 signaling provides cell a selective growth advantage. Besides, we discuss why activation of BCR-ABL1, as an outcome of distinct oncogenic events, results in miscellaneous clinical outcomes, and how the intricacy of the BCR-ABL1 signaling network might dictate therapeutic approaches. In this review, our current comprehension of BCR-ABL1 signaling will be summarized.

  11. Seroprevalencia de Hepatitis C en el personal asistencial del Hospital regional de Ayacucho y la Microrred de Salud Huamanga. Ayacucho, Perú 2005

    Directory of Open Access Journals (Sweden)

    Sara Ramos V

    2006-04-01

    Full Text Available Se efectuó una encuesta epidemiológica al personal de salud del Hospital Regional de Ayacucho y al personal de los establecimientos de salud de su jurisdicción (Microrred Huamanga, sobre la exposición laboral al virus de la hepatitis C (VHC; se realizó ELISA en suero para detectar anticuerpos contra el VHC. Participaron 320 de 518 trabajadores en total, representando 44,1% (156/354 del hospital y 100% (164 de la microrred. No se detectaron anticuerpos contra HVC en ninguna trabajador, pero 211 (65,9% trabajadores reconocieron haber tenido al menos un accidente laboral (69,2% en el hospital y 62,8% en la microrred, siendo 182 (56,9% percutáneos; en 55,3% el líquido contaminante fue la sangre. En conclusión, si bien no encontramos infección por el VHC en el personal de salud, la necesidad de implementar un programa de prevención y manejo de riesgos laborales quedó evidenciada y debería ser tomada en cuenta.

  12. Characterization of the humic substances isolated from postfire soils of scotch pine forest in Togljatty city, Samara region by the 13C-NMR spectroscopy

    Science.gov (United States)

    Maksimova, Ekaterina; Abakumov, Evgeny

    2016-04-01

    Postpyrogenic soil dynamics is an informative tool for studying of soil elementary processes in extreme temperature conditions and for predicting of short time environmental changes in conditions of catastrophic landscape changes. Soil organic matter (SOM) system evolution is the most rapid process of postpyrogenic soil development. In this relation the evaluation of humus accumulation rates and humification trend were conducted with use of the classical chemical and modern spectroscopy methods. Soil restoration after spontaneous forest fires near Togljatty city (Samara region, Russia) was abandoned in 2010, and further monitoring over the next four years was organized to evaluate the speed of biogenic processes and humus accumulation dynamics. Three key soil plots were studied for estimating SOM quality changes under the forest fire effect: surface forest fire, crown forest fire and control. Total carbon and nitrogen content as well as Cha/Cfa ratios (content of humic acids/ content of fulvic acids), were estimated to assess the dynamics of soil restoration. Humic acid powders were extracted and analyzed by elemental composition and 13C-NMR spectroscopy to assess changes in humic substance structure and composition. The data obtained indicate that burning of a forest floor and sod (humic) horizon led to humus losses and decreases in total carbon stocks. As a result of the fires, the content of humic acids in the pyrogenic horizon increased, leading alterations of humus type. Greater increases in the degree of organic matter humification were observed for surface fires than crown fires. It was shown that the humus molecular composition was substantially affected by the wildfires. The data show an increase in aromaticity, a loss of oxygen-containing groups and dehydrogenation of humic acids. Humic acids in the soils of the control plots and after wildfires were significantly different, especially in the ratios of hydrogen, oxygen and carbon. The increase in the

  13. Teores de cátions dos vinhos da Serra Gaúcha Cation content of wines from the Serra Gaúcha region

    Directory of Open Access Journals (Sweden)

    Luiz Antenor Rizzon

    2008-09-01

    Full Text Available Os cátions representam uma parte das cinzas e podem contribuir para caracterizar os vinhos de diferentes regiões vitícolas. O objetivo do presente trabalho foi determinar a concentração dos principais cátions de vinhos da Serra Gaúcha, RS, visando a sua caracterização. Foram analisados 600 vinhos de mesa e 380 vinhos finos, ambos distribuídos nas categorias tinto, rosado e branco. As análises de K+, Na+, Li+ e Rb+ foram feitas por emissão de chama, enquanto que as de Ca++, Mg++, Mn++, Fe++, Cu++ e Zn++ por absorção atômica. Os dados foram submetidos à análise de variância, ao teste de Tukey e à Análise de Componentes Principais (ACP. A análise de variância não mostrou diferenças significativas nas concentrações de Na+, Cu++ e Zn++ nos diferentes tipos de vinhos da Serra Gaúcha; os vinhos de mesa apresentaram maior concentração de Mn++ em relação aos finos; os de mesa e os rosados finos apresentaram concentração mais elevada de Fe++; enquanto que os tintos finos apresentaram concentrações mais elevadas de K+ e Rb+. A ACP permitiu diferenciar os vinhos em relação à cor - tinto, rosado e branco - e ao tipo - fino e de mesa.Cations represent an important part of the ash content and they can contribute to characterize wines from different viticultural regions. The purpose of this work was to determine the concentration of the main cations in the wines of the Serra Gaúcha region in Brazil. Six hundred table wines, primarily from American/hybrid varieties, and 380 wines elaborated with Vitis vinifera varieties, both including red, rosé and white wines, were analyzed. The analyses of K+, Na+, Li+ and Rb+ were performed by flame emission, while Ca++, Mg++, Mn++, Fe++, Cu++ and Zn++ analyses were performed by atomic absorption. Data were submitted to analysis of variance and the Tukey test and to Principal Component Analysis (PCA. Results showed that there was no significant difference in the concentration of Na

  14. Comparison of antibody responses against Mycobacterium tuberculosis antigen Rv0679c in tuberculosis patients from the endemic and non-endemic regions of the Beijing genotype: a case control study.

    Science.gov (United States)

    Zhao, Jingge; Matsuba, Takashi; Zhang, Xiaoyan; Leano, Susan; Nakajima, Chie; Chagan-Yasutan, Haorile; Telan, Elizabeth Freda; Suzuki, Yasuhiko; Hattori, Toshio

    2017-05-15

    Strains of the Beijing genotype of Mycobacterium tuberculosis (MTB) are reportedly associated with the virulence of tuberculosis (TB) infection, unfavorable outcomes of anti-TB treatment, and the global TB pandemic. Rv0679c, a hypothetical membrane protein related to host cell invasion, has a Beijing genotype-specific mutation at residue 142 (Asn142Lys). Antigenicity differences between Rv0679c-Asn142 (N-type) and Rv0679c-Lys142 (K-type) have been previously observed in mice antigen-antibody responses. However, the immune response to Rv0679c in humans remains unknown. Therefore, we aimed to investigate the anti-Rv0679c immune response in TB patients from the endemic and non-endemic regions of the Beijing MTB genotype. We analyzed the Rv0679c-specific antibody responses in 84 subjects from the endemic region of the Beijing genotype MTB in China, including 45 pulmonary TB patients (C-PTB) and 39 healthy controls (C-HC), and 81 subjects from the Philippines (the endemic region of the non-Beijing genotype), including 51 pulmonary TB patients (P-PTB) and 30 healthy controls (P-HC). Anti-tuberculous-glycolipid (TBGL) antigen was used as the control antibody. TBGL IgG titers were higher in both C-PTB and P-PTB than those in their corresponding HC (C-PTB median 4.2, P-PTB median 11.2; C-PTB vs. P-PTB, p > 0.05), suggesting immune response comparability in PTB from two different countries. C-PTB showed a higher response compared to C-HC for anti-K-type IgG (53.3%) than anti-N-type IgG (6.67%); this response was not observed in P-PTB (both N-type and K-type 9.80%). Dimorphic antigen Rv0679c was found to be associated with distinct immune response patterns, indicating the role of Beijing/non-Beijing genotype of MTB in stimulating specific responses in TB patients from the endemic region of Beijing MTB. Meanwhile, reactions to Rv0679c in patients and HC from non-endemic regions of the Beijing MTB may be caused by the response to the common epitope of Rv0679c N/K-type.

  15. Pigments, elemental composition (C, N, P, and Si), and stoichiometry of particulate matter in the naturally iron fertilized region of Kerguelen in the Southern Ocean

    Science.gov (United States)

    Lasbleiz, M.; Leblanc, K.; Blain, S.; Ras, J.; Cornet-Barthaux, V.; Hélias Nunige, S.; Quéguiner, B.

    2014-10-01

    The particulate matter distribution and phytoplankton community structure of the iron-fertilized Kerguelen region were investigated in early austral spring (October-November 2011) during the KEOPS2 cruise. The iron-fertilized region was characterized by a complex mesoscale circulation resulting in a patchy distribution of particulate matter. Integrated concentrations over 200 m ranged from 72.2 to 317.7 mg m-2 for chlorophyll a 314 to 744 mmol m-2 for biogenic silica (BSi), 1106 to 2268 mmol m-2 for particulate organic carbon, 215 to 436 mmol m-2 for particulate organic nitrogen, and 29.3 to 39.0 mmol m-2 for particulate organic phosphorus. Three distinct high biomass areas were identified: the coastal waters of Kerguelen Islands, the easternmost part of the study area in the polar front zone, and the southeastern Kerguelen Plateau. As expected from previous artificial and natural iron-fertilization experiments, the iron-fertilized areas were characterized by the development of large diatoms revealed by BSi size-fractionation and high performance liquid chromatography (HPLC) pigment signatures, whereas the iron-limited reference area was associated with a low biomass dominated by a mixed (nanoflagellates and diatoms) phytoplankton assemblage. A major difference from most previous artificial iron fertilization studies was the observation of much higher Si : C, Si : N, and Si : P ratios (0.31 ± 0.16, 1.6 ± 0.7 and 20.5 ± 7.9, respectively) in the iron-fertilized areas compared to the iron-limited reference station (0.13, 1.1, and 5.8, respectively). A second difference is the patchy response of the elemental composition of phytoplankton communities to large scale natural iron fertilization. Comparison to the previous KEOPS1 cruise also allowed to address the seasonal dynamics of phytoplankton bloom over the southeastern plateau. From particulate organic carbon (POC), particulate organic nitrogen (PON), and BSi evolutions, we showed that the elemental composition

  16. Pigments, elemental composition (C, N, P, Si) and stoichiometry of particulate matter, in the naturally iron fertilized region of Kerguelen in the Southern Ocean

    Science.gov (United States)

    Lasbleiz, M.; Leblanc, K.; Blain, S.; Ras, J.; Cornet-Barthaux, V.; Hélias Nunige, S.; Quéguiner, B.

    2014-06-01

    The particulate matter distribution and phytoplankton community structure of the iron-fertilized Kerguelen region were investigated in early austral spring (October-November 2011) during the KEOPS2 cruise. The iron-fertilized region was characterized by a complex mesoscale circulation resulting in a patchy distribution of particulate matter. Integrated concentrations over 200 m ranged from 72.2 to 317.7 mg m-2 for chlorophyll a, 314 to 744 mmol m-2 for biogenic silica (BSi), 1106 to 2268 mmol m-2 for particulate organic carbon, 215 to 436 mmol m-2 for particulate organic nitrogen, and 29.3 to 39.0 mmol m-2 for particulate organic phosphorus. Three distinct high biomass areas were identified: the coastal waters of Kerguelen Islands, the easternmost part of the study area in the Polar Front Zone, and the southeastern Kerguelen Plateau. As expected from previous artificial and natural iron-fertilization experiments, the iron-fertilized areas were characterized by the development of large diatoms revealed by BSi size-fractionation and HPLC pigment signatures, whereas the iron-limited reference area was associated to a low biomass dominated by a mixed (nanoflagellates and diatoms) phytoplankton assemblage. A major difference from previous artificial iron fertilization studies was the observation of much higher Si : C, Si : N, and Si : P ratios (respectively 0.31 ± 0.16, 1.6 ± 0.7 and 20.5 ± 7.9) in the iron-fertilized areas compared to the iron-limited reference station (respectively 0.13, 1.1, 5.8). A second difference is the patchy response of the elemental composition of phytoplankton communities to large scale natural iron fertilization. Comparison to the previous KEOPS1 cruise also allowed to address the seasonal dynamics of phytoplankton bloom over the southeastern plateau. From POC, PON, and BSi evolutions, we showed that the elemental composition of the particulate matter also varies at the seasonal scale. This temporal evolution followed changes of the

  17. Truncation of the C-terminal region of Toscana Virus NSs protein is critical for interferon-β antagonism and protein stability

    National Research Council Canada - National Science Library

    Gori Savellini, Gianni; Gandolfo, Claudia; Cusi, Maria Grazia

    2015-01-01

    .... To this aim, two C-terminal truncated NSs proteins, Δ1C-NSs (aa 1-284) and Δ2C-NSs (aa 1-287) were tested. Only Δ1C-NSs did not present any inhibitory effect on RIG-I and it showed a greater stability than the whole NSs protein...

  18. Hot Band Analysis and Kinetics Measurements for Ethynyl Radical, C_2H, in the 1.49 μm Region

    Science.gov (United States)

    Le, Anh T.; Hall, Gregory; Sears, Trevor

    2017-06-01

    Ethynyl, C_2H, is an important intermediate in combustion processes and has been widely observed in interstellar space. Spectroscopically, it is of particular interest because it possesses three low-lying electronic surfaces: a ground ^2Σ^+state, and a low-lying ^2Π excited electronic state, which splits due to the Renner-Teller effect. Vibronic coupling among these states leads to a complicated, mixed-character, energy level structure. We have previously reported work on three bands originating from the ˜{X}(0,0,0) ^2Σ ground state to excited vibronic states: two ^2Σ - ^2 Σ transitions at 6696 and 7088 \\wn and a ^2Π - ^2Σ transition at 7108 \\wn. In this work, the radicals were formed in a hot, non-thermal, population distribution by u.v. pulsed laser photolysis of a precursor. Kinetic measurements of the time-evolution of the ground state populations following collisional relaxation and reactive loss were also made, using some of the stronger rotational lines observed. Time-dependent signals in mixtures containing a variable concentration of precursor in argon suggested that vibronically hot C_2H radicals were less reactive than the relaxed, thermalized, radical. Two additional hot bands originating in states ˜{X}(0,1^1,0) ^2Π and ˜{X}(0,2^0,0) ^2Σ, have now been identified in the same spectral region. In a new series of experiments, we have measured the kinetics of formation and decay of representative levels involving all the assigned transitions, i.e. originating in ˜{X}(0,v_2,0), with v_2 =0 ,1, and 2, in various concentrations of mixtures of precursor, inert gas and hydrogen. The new spectra also show greatly improved signal-to-noise ratio in comparison to our previous work, due to the use of a transient FM detection scheme, and additional spectral assignments seem likely. Both kinetics and spectroscopic results will be described in the talk. Acknowledgments: Work at Brookhaven National Laboratory was carried out under Contract No. DE-SC0012704

  19. Concordant genetic distinctness of the phylogroup of the Siberian chipmunk from the Korean peninsula (Tamias sibiricus barberi), reexamined with nuclear DNA c-myc gene exon 2 and mtDNA control region sequences.

    Science.gov (United States)

    Koh, Hung Sun; Zhang, Minghai; Bayarlkhagva, Damdingiin; Ham, Eui Jeong; Kim, Jin Seong; Jang, Kyung Hee; Park, Nam Jeong

    2010-08-01

    We reexamined Tamias sibiricus barberi from Korea by sequencing c-myc exon 2 and the mtDNA control region. In the c-myc exon, the monogenic T. s. barberi differed from the monogenic T. s. orientalis (nucleotide distance 0.48%; 3 variable sites at 168, 306, and 552), whereas T. s. orientalis was identical to T. s. sibiricus. In the control region, T. s. barberi differed from T. s. orientalis (distance 6.84%) and T. s. sibiricus (9.35%). We considered the concordant, extensive gaps between the phylogroup of T. s. barberi and other subspecies of T. sibiricus in the c-myc gene, control region, and cytochrome b gene to be evidence of a lack of intergradation through North Korea from T. s. barberi to T. s. orientalis. Our results, showing the genetic and morphological distinctness of T. s. barberi, support that this phylogroup is a distinct species.

  20. The impacts of aerosol loading, composition, and water uptake on aerosol extinction variability in the Baltimore-Washington, D.C. region

    Science.gov (United States)

    Beyersdorf, A. J.; Ziemba, L. D.; Chen, G.; Corr, C. A.; Crawford, J. H.; Diskin, G. S.; Moore, R. H.; Thornhill, K. L.; Winstead, E. L.; Anderson, B. E.

    2016-01-01

    In order to utilize satellite-based aerosol measurements for the determination of air quality, the relationship between aerosol optical properties (wavelength-dependent, column-integrated extinction measured by satellites) and mass measurements of aerosol loading (PM2.5 used for air quality monitoring) must be understood. This connection varies with many factors including those specific to the aerosol type - such as composition, size, and hygroscopicity - and to the surrounding atmosphere, such as temperature, relative humidity (RH), and altitude, all of which can vary spatially and temporally. During the DISCOVER-AQ (Deriving Information on Surface conditions from Column and Vertically Resolved Observations Relevant to Air Quality) project, extensive in situ atmospheric profiling in the Baltimore, MD-Washington, D.C. region was performed during 14 flights in July 2011. Identical flight plans and profile locations throughout the project provide meaningful statistics for determining the variability in and correlations between aerosol loading, composition, optical properties, and meteorological conditions. Measured water-soluble aerosol mass was composed primarily of ammonium sulfate (campaign average of 32 %) and organics (57 %). A distinct difference in composition was observed, with high-loading days having a proportionally larger percentage of sulfate due to transport from the Ohio River Valley. This composition shift caused a change in the aerosol water-uptake potential (hygroscopicity) such that higher relative contributions of inorganics increased the bulk aerosol hygroscopicity. These days also tended to have higher relative humidity, causing an increase in the water content of the aerosol. Conversely, low-aerosol-loading days had lower sulfate and higher black carbon contributions, causing lower single-scattering albedos (SSAs). The average black carbon concentrations were 240 ng m-3 in the lowest 1 km, decreasing to 35 ng m-3 in the free troposphere (above

  1. The impacts of aerosol loading, composition, and water uptake on aerosol extinction variability in the Baltimore–Washington, D.C. region

    Directory of Open Access Journals (Sweden)

    A. J. Beyersdorf

    2016-01-01

    Full Text Available In order to utilize satellite-based aerosol measurements for the determination of air quality, the relationship between aerosol optical properties (wavelength-dependent, column-integrated extinction measured by satellites and mass measurements of aerosol loading (PM2.5 used for air quality monitoring must be understood. This connection varies with many factors including those specific to the aerosol type – such as composition, size, and hygroscopicity – and to the surrounding atmosphere, such as temperature, relative humidity (RH, and altitude, all of which can vary spatially and temporally. During the DISCOVER-AQ (Deriving Information on Surface conditions from Column and Vertically Resolved Observations Relevant to Air Quality project, extensive in situ atmospheric profiling in the Baltimore, MD–Washington, D.C. region was performed during 14 flights in July 2011. Identical flight plans and profile locations throughout the project provide meaningful statistics for determining the variability in and correlations between aerosol loading, composition, optical properties, and meteorological conditions. Measured water-soluble aerosol mass was composed primarily of ammonium sulfate (campaign average of 32 % and organics (57 %. A distinct difference in composition was observed, with high-loading days having a proportionally larger percentage of sulfate due to transport from the Ohio River Valley. This composition shift caused a change in the aerosol water-uptake potential (hygroscopicity such that higher relative contributions of inorganics increased the bulk aerosol hygroscopicity. These days also tended to have higher relative humidity, causing an increase in the water content of the aerosol. Conversely, low-aerosol-loading days had lower sulfate and higher black carbon contributions, causing lower single-scattering albedos (SSAs. The average black carbon concentrations were 240 ng m−3 in the lowest 1 km, decreasing to 35

  2. [Effects of acupuncture intervention on expression of glucose-regulated protein 78 and C/EBP homologous protein in hippocampal CA 1 region in rats with hyperspasmia].

    Science.gov (United States)

    Yang, Fan; Ma, Yun; Ang, Wen-Ping; Chen, Hao; Du, Wei-Dong; Wu, Sheng-Bing; Lü, Lei; Zhang, Dao-Qin

    2014-08-01

    To observe the effect of acupuncture intervention on expression of glucose-regulated protein 78 (Grp 78) and C/EBP homologous protein (CHOP) in the hippocampus in epilepsy rats so as to explore its mechanism underlying improvement of hyperspasmia-induced brain injury. Forty-two SD rats were randomly divided into normal control group (n = 6), model group (n = 18), and acupuncture group (n = 18). The epileptic seizure model was established by intraperitonel injection of Pentylenetetrazol (50 mg/kg, 2 mL). Manual acupuncture stimulation of "Baihui" (GV 20) and "Dazhui" (GV 14) was conducted for rats of the acupuncture group for 30 min. Two hours (h), 12 h and 48 h after acupuncture intervention, the hippocampal tissue was sampled (6 rats at each time-point). The expression levels of Grp 78 and CHOP proteins in the hippocampal CA 1 region were detected by immunohistochemistry. Compared with the normal group, the expression levels of Grp 78 protein at time-points of 2 h and 12 h, and those of CHOP protein at 2 h, 12 h and 48 h after epilpeptic seizure were significantly increased in the model group (P acupuncture treatment, the expression levels of Grp 78 at 12 and 48 h were significantly increased, and those of CHOP protein at 2 h, 12 h and 24 h in the acupuncture group were considerably downregulated (P Acupuncture treatment can up-regulate Grp 78 protein expression and down-regulate CHOP protein expression level in epilepsy rats , which may contribute to its protective effect on seizure-induced brain injury.

  3. Identification of a glycosaminoglycan binding region of the alpha C protein that mediates entry of group B Streptococci into host cells.

    Science.gov (United States)

    Baron, Miriam J; Filman, David J; Prophete, Gina A; Hogle, James M; Madoff, Lawrence C

    2007-04-06

    Group B Streptococcus (GBS) frequently colonizes the human gastrointestinal and gynecological tracts and less frequently causes deep tissue infections. The transition between colonization and infection depends upon the ability of the organism to cross epithelial barriers. The alpha C protein (ACP) on the surface of GBS contributes to this process. A virulence factor in mouse models of infection, and prototype for a family of Gram-positive bacterial surface proteins, ACP facilitates GBS entry into human cervical epithelial cells and movement across cell layers. ACP binds to host cell surface glycosaminoglycan (GAG). From crystallography, we have identified a cluster of basic residues (BR2) that is a putative GAG binding area in Domain 2, near the junction of the N-terminal domain of ACP and the first of a series of tandem amino acid repeats. D2-R, a protein construct including this region, binds to cells similarly to full-length ACP. We now demonstrate that the predicted charged BR2 residues confer GAG binding; site-directed mutagenesis of these residues (Arg(172), Arg(185), or Lys(196)) eliminates cell-binding activity of construct D2-R. In addition, we have constructed a GBS strain expressing a variant ACP with a charge-neutralizing substitution at residue 185. This strain enters host cells less effectively than does the wild-type strain and similarly to an ACP null mutant strain. The point mutant strain transcytoses similarly to the wild-type strain. These data indicate that GAG-binding activity underlies ACP-mediated cellular entry of GBS. GBS entry into host cells and transcytosis of host cells may occur by distinct mechanisms.

  4. The C-terminal 18 Amino Acid Region of Dengue Virus NS5 Regulates its Subcellular Localization and Contains a Conserved Arginine Residue Essential for Infectious Virus Production.

    Directory of Open Access Journals (Sweden)

    Moon Y F Tay

    2016-09-01

    Full Text Available Dengue virus NS5 is the most highly conserved amongst the viral non-structural proteins and is responsible for capping, methylation and replication of the flavivirus RNA genome. Interactions of NS5 with host proteins also modulate host immune responses. Although replication occurs in the cytoplasm, an unusual characteristic of DENV2 NS5 is that it localizes to the nucleus during infection with no clear role in replication or pathogenesis. We examined NS5 of DENV1 and 2, which exhibit the most prominent difference in nuclear localization, employing a combination of functional and structural analyses. Extensive gene swapping between DENV1 and 2 NS5 identified that the C-terminal 18 residues (Cter18 alone was sufficient to direct the protein to the cytoplasm or nucleus, respectively. The low micromolar binding affinity between NS5 Cter18 and the nuclear import receptor importin-alpha (Impα, allowed their molecular complex to be purified, crystallised and visualized at 2.2 Å resolution using x-ray crystallography. Structure-guided mutational analysis of this region in GFP-NS5 clones of DENV1 or 2 and in a DENV2 infectious clone reveal residues important for NS5 subcellular localization. Notably, the trans conformation adopted by Pro-884 allows proper presentation for binding Impα and mutating this proline to Thr, as present in DENV1 NS5, results in mislocalizaion of NS5 to the cytoplasm without compromising virus fitness. In contrast, a single mutation to alanine at NS5 position R888, a residue conserved in all flaviviruses, resulted in a completely non-viable virus, and the R888K mutation led to a severely attenuated phentoype, even though NS5 was located in the nucleus. R888 forms a hydrogen bond with Y838 that is also conserved in all flaviviruses. Our data suggests an evolutionarily conserved function for NS5 Cter18, possibly in RNA interactions that are critical for replication, that is independent of its role in subcellular localization.

  5. The C-terminal region of Rad52 is essential for Rad52 nuclear and nucleolar localization, and accumulation at DNA damage sites immediately after irradiation

    Energy Technology Data Exchange (ETDEWEB)

    Koike, Manabu, E-mail: m_koike@nirs.go.jp [DNA Repair Gene Res., National Institute of Radiological Sciences, 4-9-1 Anagawa, Inage-ku, Chiba 263-8555 (Japan); Yutoku, Yasutomo [DNA Repair Gene Res., National Institute of Radiological Sciences, 4-9-1 Anagawa, Inage-ku, Chiba 263-8555 (Japan); Graduate School of Science, Chiba University, Yayoicho, Inage-ku, Chiba 263-8522 (Japan); Koike, Aki [DNA Repair Gene Res., National Institute of Radiological Sciences, 4-9-1 Anagawa, Inage-ku, Chiba 263-8555 (Japan)

    2013-05-31

    Highlights: •Rad52 might play a key role in the repair of DSB immediately after irradiation. •EYFP-Rad52 accumulates rapidly at DSB sites and colocalizes with Ku80. •Accumulation of Rad52 at DSB sites is independent of the core NHEJ factors. •Localization and recruitment of Rad52 to DSB sites are dependent on the Rad52 CTR. •Basic amino acids in Rad52 CTR are highly conserved among vertebrate species. -- Abstract: Rad52 plays essential roles in homologous recombination (HR) and repair of DNA double-strand breaks (DSBs) in Saccharomyces cerevisiae. However, in vertebrates, knockouts of the Rad52 gene show no hypersensitivity to agents that induce DSBs. Rad52 localizes in the nucleus and forms foci at a late stage following irradiation. Ku70 and Ku80, which play an essential role in nonhomologous DNA-end-joining (NHEJ), are essential for the accumulation of other core NHEJ factors, e.g., XRCC4, and a HR-related factor, e.g., BRCA1. Here, we show that the subcellular localization of EYFP-Rad52(1–418) changes dynamically during the cell cycle. In addition, EYFP-Rad52(1–418) accumulates rapidly at microirradiated sites and colocalizes with the DSB sensor protein Ku80. Moreover, the accumulation of EYFP-Rad52(1–418) at DSB sites is independent of the core NHEJ factors, i.e., Ku80 and XRCC4. Furthermore, we observed that EYFP-Rad52(1–418) localizes in nucleoli in CHO-K1 cells and XRCC4-deficient cells, but not in Ku80-deficient cells. We also found that Rad52 nuclear localization, nucleolar localization, and accumulation at DSB sites are dependent on eight amino acids (411–418) at the end of the C-terminal region of Rad52 (Rad52 CTR). Furthermore, basic amino acids on Rad52 CTR are highly conserved among mammalian, avian, and fish homologues, suggesting that Rad52 CTR is important for the regulation and function of Rad52 in vertebrates. These findings also suggest that the mechanism underlying the regulation of subcellular localization of Rad52 is

  6. The domain structure of Helicobacter pylori DnaB helicase: the N-terminal domain can be dispensable for helicase activity whereas the extreme C-terminal region is essential for its function

    Science.gov (United States)

    Nitharwal, Ram Gopal; Paul, Subhankar; Dar, Ashraf; Choudhury, Nirupam Roy; Soni, Rajesh K; Prusty, Dhaneswar; Sinha, Sukrat; Kashav, Tara; Mukhopadhyay, Gauranga; Chaudhuri, Tapan Kumar; Gourinath, Samudrala; Dhar, Suman Kumar

    2007-01-01

    Hexameric DnaB type replicative helicases are essential for DNA strand unwinding along with the direction of replication fork movement. These helicases in general contain an amino terminal domain and a carboxy terminal domain separated by a linker region. Due to the lack of crystal structure of a full-length DnaB like helicase, the domain structure and function of these types of helicases are not clear. We have reported recently that Helicobacter pylori DnaB helicase is a replicative helicase in vitro and it can bypass Escherichia coli DnaC activity in vivo. Using biochemical, biophysical and genetic complementation assays, here we show that though the N-terminal region of HpDnaB is required for conformational changes between C6 and C3 rotational symmetry, it is not essential for in vitro helicase activity and in vivo function of the protein. Instead, an extreme carboxy terminal region and an adjacent unique 34 amino acid insertion region were found to be essential for HpDnaB activity suggesting that these regions are important for proper folding and oligomerization of this protein. These results confer great potential in understanding the domain structures of DnaB type helicases and their related function. PMID:17430964

  7. Single Nucleotide Polymorphisms in Noncoding Regions of Rad51C Do Not Change the Risk of Unselected Breast Cancer but They Modulate the Level of Oxidative Stress and the DNA Damage Characteristics

    DEFF Research Database (Denmark)

    Gresner, Peter; Gromadzinska, Jolanta; Jablonska, Ewa

    2014-01-01

    subjects to investigate whether common single nucleotide polymorphisms (SNPs) in non-coding regions of RAD51C modulate the risk of BrC, and whether they affect the level of oxidative stress and the extent/characteristics of DNA damage. Neither SNPs nor reconstructed haplotypes were found to significantly...... affect the unselected BrC risk. Contrary to this, carriers of rs12946522, rs16943176, rs12946397 and rs17222691 rare-alleles were found to present significantly increased level of blood plasma TBARS compared to respective wild-type homozygotes (p

  8. Diferencias regionales en la mortalidad por cáncer de mama y cérvix en México entre 1979 y 2006 Regional differences in breast and cervical cancer mortality in Mexico between 1979-2006

    Directory of Open Access Journals (Sweden)

    Lina Sofía Palacio-Mejía

    2009-01-01

    Full Text Available OBJETIVO: Explorar las diferencias regionales en la mortalidad por cáncer de mama (CaMa y cervical (CaCu en México. MATERIAL Y MÉTODOS: Se calcularon tendencias de mortalidad por CaMa y CaCu mediante modelos probabilísticos ajustados por estado, grado de marginación y lugar de residencia (urbano/rural. RESULTADOS: La tendencia de mortalidad por CaMa ha sido ascendente, de una tasa estandarizada de 5.6 muertes por cada 100 000 mujeres en 1979 a 10.1 en 2006. La mortalidad por CaCu alcanzó un pico en 1989 y a partir de esa fecha se redujo a 9.9 en 2006. Las tasas más altas de mortalidad por CaMa se encuentran en la capital (13.2 y la región norte (11.8, mientras en el sur se registra la mortalidad por CaCu más alta (11.9. DISCUSIÓN: El número de muertes por CaMa aumenta de forma gradual a lo largo del tiempo a nivel nacional y persisten elevadas tasas de mortalidad por CaCu en áreas marginadas.OBJECTIVE: Explore the regional differences in breast (BC and cervical cancer (CC mortality in Mexico. MATERIAL AND METHODS: We estimated mortality trends for BC and CC using probabilistic models adjusted by state marginalization level and urban and rural residence. RESULTS: BC mortality shows a rising trend, from a rate of 5.6 deaths per 100000 women in 1979 to 10.1 in 2006. The CC mortality rate reached a peak in 1989 and after this decreased significantly to 9.9 in 2006. The highest BC mortality rates are found in Mexico City (13.2 and the northern part of the country (11.8. As for CC, the highest mortality rates are found in the south (11.9 per 100000 women the. DISCUSSION: The number of BC cases are increased gradually at the national level during the last three decades and high rates of CC mortality persist in marginalized areas.

  9. GHRSST Level 3C North Atlantic Regional Subskin Sea Surface Temperature from the Advanced Very High Resolution Radiometer (AVHRR) on NOAA-19 (GDS version 2)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — A Group for High Resolution Sea Surface Temperature (GHRSST) dataset for the North Atlantic Region (NAR) from the Advanced Very High Resolution Radiometer (AVHRR) on...

  10. GHRSST Level 3C North Atlantic Regional (NAR) subskin Sea Surface Temperature from Metop/AVHRR (GDS V2) produced by OSI SAF (GDS version 2)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — A Group for High Resolution Sea Surface Temperature (GHRSST) dataset for the North Atlantic Region (NAR) derived from the Advanced Very High Resolution Radiometer...

  11. Association of endothelial nitric oxide synthase promoter region (T-786C gene polymorphism with acute coronary syndrome and coronary heart disease

    Directory of Open Access Journals (Sweden)

    Kılıçgedik M

    2008-02-01

    Full Text Available Abstract Background Nitric oxide (NO is an endothelium derived relaxing factor (EDRF which has an important role for regulating the heart-vessel physiology. The objective of this study was to evaluate the effects of the eNOS T-786C polymorphism on lipid parameters and the development of acute coronary syndrome (ACS and coronary heart disease (CHD for the first time in a Turkish study group. We have analyzed the genotype frequencies of the T-786C polymorphism of the eNOS gene in 10 ACS patients (5 men, 5 women, 20 CHD patients (14 men, 6 women, and 31 controls (10 men, 21 women, who were angiographically proven to have normal coronaries. Results The demographic, biochemical and left ventricule systolic dysfunction data of the ACS, CHD patients and controls were analyzed as a function of eNOS T-786C genotypes. The eNOS gene T-786C polymorphism frequencies for T/T, C/T and C/C genotypes were respectively 10%, 40%, 50% in subjects with ACS; 75%, 20%, 5% in subjects with CHD and 67.7%, 25.8%, 6.5% in the control group. Significant difference was observed in genotype frequencies between the study groups for T-786C polymorphism (p = 0.001. The CC genotype frequency was found to be the most prevalent in ACS group in comparison to CHD and control groups (p = 0.001. TT was the most frequently observed genotype in both CHD patients and controls (p = 0.001. Left ventricule systolic dysfunction frequency was found to be highest in C/T genotype carriers (66.7% in patients (ACS+CHD. None of the patients with LVSD were carrying the normal genotype (T/T. The eNOS T-786C polymorphism was not found to be effective over any analyzed lipid variable in patients (ACS+CHD. The HDL-cholesterol levels were found to be lower in CHD group were compared to controls (p Conclusion The significantly high frequency of eNOS -786C/C genotype in ACS patients than in those of controls, indicate the genotype association with ACS. The finding of significantly high frequency of T

  12. Characterization of age/sex and the regional distribution of mGluR5 availability in the healthy human brain measured by high-resolution [{sup 11}C]ABP688 PET

    Energy Technology Data Exchange (ETDEWEB)

    DuBois, Jonathan M.; Porras-Betancourt, Manuel; Massarweh, Gassan; Soucy, Jean-Paul; Kobayashi, Eliane [McGill University, Department of Neurology and Neurosurgery, Montreal Neurological Institute, Montreal, Quebec (Canada); Rousset, Olivier G. [Johns Hopkins University, The Russell H. Morgan Department of Radiology and Radiological Science, Baltimore, MD (United States); Rowley, Jared [McGill University, Translational Neuroimaging Laboratory, McGill Center for Studies in Aging, Douglas Mental Health University Institute, Montreal (Canada); Reader, Andrew J. [McGill University, PET Unit, McConnell Brain Imaging Center, Montreal Neurological Institute, Montreal (Canada); King' s College London, St. Thomas' Hospital, Division of Imaging Sciences and Biomedical Engineering, London (United Kingdom); Labbe, Aurelie [McGill University, Department of Epidemiology, Biostatistics and Occupational health, Montreal (Canada); Douglas Mental Health University Institute / Douglas Institut Universitaire en Sante Mentale, Department of Psychiatry, Montreal (Canada); Rosa-Neto, Pedro [McGill University, Department of Neurology and Neurosurgery, Montreal Neurological Institute, Montreal, Quebec (Canada); McGill University, Translational Neuroimaging Laboratory, McGill Center for Studies in Aging, Douglas Mental Health University Institute, Montreal (Canada)

    2016-01-15

    Metabotropic glutamate receptor type 5 (mGluR5) is a G protein-coupled receptor that has been implicated in several psychiatric and neurological diseases. The radiopharmaceutical [{sup 11}C]ABP688 allows for in vivo quantification of mGluR5 availability using positron emission tomography (PET). In this study, we aimed to detail the regional distribution of [{sup 11}C]ABP688 binding potential (BP{sub ND}) and the existence of age/sex effects in healthy individuals. Thirty-one healthy individuals aged 20 to 77 years (men, n = 18, 45.3 ± 18.2 years; females, n = 13, 41.5 ± 19.6 years) underwent imaging with [{sup 11}C]ABP688 using the high-resolution research tomograph (HRRT). We developed an advanced partial volume correction (PVC) method using surface-based analysis in order to accurately estimate the regional variation of radioactivity. BP{sub ND} was calculated using the simplified reference tissue model, with the cerebellum as the reference region. Surface-based and volume-based analyses were performed for 39 cortical and subcortical regions of interest per hemisphere. We found the highest [{sup 11}C]ABP688 BP{sub ND} in the lateral prefrontal and anterior cingulate cortices. The lowest [{sup 11}C]ABP688 BP{sub ND} was observed in the pre- and post-central gyri as well as the occipital lobes and the thalami. No sex effect was observed. Associations between age and [{sup 11}C]ABP688 BP{sub ND} without PVC were observed in the right amygdala and left putamen, but were not significant after multiple comparisons correction. The present results highlight complexities underlying brain adaptations during the aging process, and support the notion that certain aspects of neurotransmission remain stable during the adult life span. (orig.)

  13. Noncoding regions of C. elegans mRNA undergo selective adenosine to inosine deamination and contain a small number of editing sites per transcript

    Science.gov (United States)

    Wheeler, Emily C; Washburn, Michael C; Major, Francois; Rusch, Douglas B; Hundley, Heather A

    2015-01-01

    ADARs (Adenosine deaminases that act on RNA) “edit” RNA by converting adenosines to inosines within double-stranded regions. The primary targets of ADARs are long duplexes present within noncoding regions of mRNAs, such as introns and 3′ untranslated regions (UTRs). Because adenosine and inosine have different base-pairing properties, editing within these regions can alter splicing and recognition by small RNAs. However, despite numerous studies identifying multiple editing sites in these genomic regions, little is known about the extent to which editing sites co-occur on individual transcripts or the functional output of these combinatorial editing events. To begin to address these questions, we performed an ultra-deep sequencing analysis of 4 Caenorhabditis elegans 3′ UTRs that are known ADAR targets. Synchronous editing events were determined for the long duplexes in vivo. Furthermore, the validity of each editing event was confirmed by sequencing the same regions of mRNA from worms that lack A-to-I editing. This analysis identified a large number of editing sites that can occur within each 3′ UTR, but interestingly, each individual transcript contained only a small fraction of these A-to-I editing events. In addition, editing patterns were not random, indicating that an editing event can affect the efficiency of editing at subsequent adenosines. Furthermore, we identified specific sites that can be both positively and negatively correlated with additional sites leading to mutually exclusive editing patterns. These results suggest that editing in noncoding regions is selective and hyper-editing of cellular RNAs is rare. PMID:25826568

  14. Effect of vitamin C in pineapple rind (Ananas comosus L. Merr on thyroxine hormone and anti stress on broilers in tropical region

    Directory of Open Access Journals (Sweden)

    Syahruddin E

    2013-03-01

    Full Text Available This study was aimed to determine the right level of vitamin C in extracted pineapple rind to prevent heat stress effects so it does not interfere with the performance of broiler chickens. This study was done in a series of field experiments. Experiments in the field/cage was biological test of the effect of vitamin C from pineapple rind on production responses (percentage of body weight gain and carcass and physiological responses (thyroxine hormone levels in broiler chicken aged 3 weeks as many as 360 of Strain Arbor acress. The basic design used was CRD 3 x 4 factorial models and 3 replications with 10 chickens for each box, as factor 1: Room temperature (21 : 27 and 33ºC, and factor II: level of vitamin C in the pineapple rind (0:500:1000 and 1500 ppm. The data obtained were statistically analyzed using SAS program package, and if it showed any significant effect then followed by Duncans test/DMRT. Variables measured were body weight gain, carcass percentage and levels of thyroxine hormone of broiler. Results showed that addition of pineapple rind containing 500 ppm vitamin C in the drinking water reduced heat stress in chicken that were kept at temperature of 27ºC, while at 33ºC needed 1000 ppm vitamin C. Both treatments increase level of thyroxine hormone, produce weight gain equal to control, more over, there was no effect on the percentage of carcasses.

  15. The α4β2 nicotine acetylcholine receptor agonist ispronicline induces c-Fos expression in selective regions of the rat forebrain

    DEFF Research Database (Denmark)

    Jacobsen, Julie; Hansen, Henrik H; Kiss, Alexander

    2012-01-01

    was found only within its medial part. In addition, an increased number of c-Fos-immunoreactive cells were observed in the central nucleus of the amygdala, and the dorsolateral part of the bed nucleus of the stria terminalis. The restricted distribution of c-Fos to these areas, all of which are directly...

  16. Classification of extremely metal-poor stars: absent region in A(C)-[Fe/H] plane and the role of dust cooling

    Science.gov (United States)

    Chiaki, Gen; Tominaga, Nozomu; Nozawa, Takaya

    2017-11-01

    Extremely metal-poor (EMP) stars are the living fossils with records of chemical enrichment history at the early epoch of galaxy formation. By the recent large observation campaigns, statistical samples of EMP stars have been obtained. This motivates us to reconsider their classification and formation conditions. From the observed lower limits of carbon and iron abundances of Acr(C) ∼ 6 and [Fe/H]cr ∼ -5 for C-enhanced EMP (CE-EMP) and C-normal EMP (CN-EMP) stars, we confirm that gas cooling by dust thermal emission is indispensable for the fragmentation of their parent clouds to form such low mass, i.e. long-lived stars, and that the dominant grain species are carbon and silicate, respectively. We constrain the grain radius r_i^cool of a species i and condensation efficiency fij of a key element j as r_C^cool / f_C,C = 10 {μ m} and r_Sil^cool / f_Sil,Mg = 0.1 {μ m} to reproduce Acr(C) and [Fe/H]cr, which give a universal condition 10[C/H] - 2.30 + 10[Fe/H] > 10-5.07 for the formation of every EMP star. Instead of the conventional boundary [C/Fe] = 0.7 between CE-EMP and CN-EMP stars, this condition suggests a physically meaningful boundary [C/Fe]b = 2.30 above and below which carbon and silicate grains are dominant coolants, respectively.

  17. Oligomerization-induced conformational change in the C-terminal region of Nel-like molecule 1 (NELL1) protein is necessary for the efficient mediation of murine MC3T3-E1 cell adhesion and spreading.

    Science.gov (United States)

    Nakamura, Yoko; Hasebe, Ai; Takahashi, Kaneyoshi; Iijima, Masumi; Yoshimoto, Nobuo; Maturana, Andrés D; Ting, Kang; Kuroda, Shun'ichi; Niimi, Tomoaki

    2014-04-04

    NELL1 is a large oligomeric secretory glycoprotein that functions as an osteoinductive factor. NELL1 contains several conserved domains, has structural similarities to thrombospondin 1, and supports osteoblastic cell adhesion through integrins. To define the structural requirements for NELL1-mediated cell adhesion, we prepared a series of recombinant NELL1 proteins (intact, deleted, and cysteine-mutant) from a mammalian expression system and tested their activities. A deletion analysis demonstrated that the C-terminal cysteine-rich region of NELL1 is critical for the cell adhesion activity of NELL1. Reducing agent treatment decreased the cell adhesion activity of full-length NELL1 but not of its C-terminal fragments, suggesting that the intramolecular disulfide bonds within this region are not functionally necessary but that other disulfide linkages in the N-terminal region of NELL1 may be involved in cell adhesion activity. By replacing cysteine residues with serines around the coiled-coil domain of NELL1, which is responsible for oligomerization, we created a mutant NELL1 protein that was unable to form homo-oligomers, and this monomeric mutant showed substantially lower cell adhesion activity than intact NELL1. These results suggest that an oligomerization-induced conformational change in the C-terminal region of NELL1 is important for the efficient mediation of cell adhesion and spreading by NELL1.

  18. Oligomerization-induced Conformational Change in the C-terminal Region of Nel-like Molecule 1 (NELL1) Protein Is Necessary for the Efficient Mediation of Murine MC3T3-E1 Cell Adhesion and Spreading*

    Science.gov (United States)

    Nakamura, Yoko; Hasebe, Ai; Takahashi, Kaneyoshi; Iijima, Masumi; Yoshimoto, Nobuo; Maturana, Andrés D.; Ting, Kang; Kuroda, Shun'ichi; Niimi, Tomoaki

    2014-01-01

    NELL1 is a large oligomeric secretory glycoprotein that functions as an osteoinductive factor. NELL1 contains several conserved domains, has structural similarities to thrombospondin 1, and supports osteoblastic cell adhesion through integrins. To define the structural requirements for NELL1-mediated cell adhesion, we prepared a series of recombinant NELL1 proteins (intact, deleted, and cysteine-mutant) from a mammalian expression system and tested their activities. A deletion analysis demonstrated that the C-terminal cysteine-rich region of NELL1 is critical for the cell adhesion activity of NELL1. Reducing agent treatment decreased the cell adhesion activity of full-length NELL1 but not of its C-terminal fragments, suggesting that the intramolecular disulfide bonds within this region are not functionally necessary but that other disulfide linkages in the N-terminal region of NELL1 may be involved in cell adhesion activity. By replacing cysteine residues with serines around the coiled-coil domain of NELL1, which is responsible for oligomerization, we created a mutant NELL1 protein that was unable to form homo-oligomers, and this monomeric mutant showed substantially lower cell adhesion activity than intact NELL1. These results suggest that an oligomerization-induced conformational change in the C-terminal region of NELL1 is important for the efficient mediation of cell adhesion and spreading by NELL1. PMID:24563467

  19. Scientific study of 13C/12C carbon and 18O/16O oxygen stable isotopes biological fractionation in grapes in the Black Sea, Don Basin and the Western Caspian regions

    Directory of Open Access Journals (Sweden)

    Kolesnov Alexander

    2017-01-01

    Full Text Available The report presents the results of a study of carbon and oxygen stable isotopes in carbohydrates and intracellular water of red and white grapes of 2016 wine-growing season in the Crimean peninsula areas, South-west coast of the Greater Caucasus, the Don basin and the Western Caspian region. The mass concentration of reducing sugars in the studied grape samples has been from 17.5 to 25.0 g/100 ml, titrated acids concentration (based on tartaric acid – from 6.0 to 9.1 g/l, the buffer capacity 34.1–63.2 mg-Eq/l. Red and white wine made from respective grapes contained from 0.5 to 3.6 g/l of residual sugar; from 11.1 to 14.5% ethanol by volume; buffer capacity was 35.2–52.6 mg-Eq/l. It has been found that the δ13CVPDB values for carbohydrates of red and white grape varieties as a result of biological fractionation of carbon isotopes in the agro-climatic conditions of plant growth for the studied geographical areas are ranging from − 26.74 to − 20.74‰ (the Crimean peninsula; from − 27.31 to − 21.58‰ (South West Coast of the Greater Caucasus, from − 27.33 to − 24.73‰ (Don Basin and from − 26.64 to − 23.17‰ (West Caspian. The δ13CVPDB values for ethanol of the red and white dry wines range from − 28.52 to − 24.26‰ (the Crimean peninsula; from − 29.23 to − 24.52‰ (South West Coast of the Greater Caucasus; from − 28.97 to − 26.22‰ (Don Basin; from − 29.14 to − 25.22‰ (Western Caspian. Compared with the surface water and groundwater (averages from δ18OVSMOW− 13.90 to − 6.38‰ and with precipitation (averages from δ18OVSMOW − 10.30 to − 9.04‰ the δ18OVSMOW values in intracellular water of grapes are the following: for the Crimean peninsula grapes, from 0.40 to 4.97‰; the South West Coast of the Greater Caucasus, from -2.11 to 6.29‰; the Don Basin, from − 2.21 to 6.26‰; the Western Caspian, from − 0.24 to 1.44‰. It has been noted that in conditions of

  20. Localization of cDNAs to a region poorly represented in the CEPH chromosome 21 YAC contig: Candidate genes for genetic diseases mapped to 21q22.3

    Energy Technology Data Exchange (ETDEWEB)

    Gardiner, K.; Patterson, D. [Eleanor Roosevelt Inst., Denver, CO (United States); Ichikawa, H.; Ohki, Misao [National Cancer Center, Tokyo (Japan); Cheng, Jan-Fang [Lawerence Berkeley National Lab., CA (United States)

    1995-11-20

    Fifty-three cDNA fragments previously obtained by hybridization selection from random clones in the chromosome 21 cosmid library LL21CNO2 failed to identify clones in the chromosome 21 YAC contig described. Using an expanded panel of somatic cell hybrids, we have verified that the majority of these cDNAs map to chromosome 21 and that in particular a very high proportion, {approximately}85%, localize to a 5-Mb region of distal 21q22.3. Pulsed-field analysis coupled with information from the NotI restriction map of the region further indicate that 17 cDNA fragments map within 650 kb of the PFKL gene and thus may be candidates for genetic diseases linked to this gene. This work helps to characterize a region poorly represented in the CEPH YAC contig and adds to the number of cDNAs useful in analysis of chromosome 21-associated diseases. 4 refs., 3 figs., 1 tab.

  1. Localization of cDNAs to a region poorly represented in the CEPH chromosome 21 YAC contig: candidate genes for genetic diseases mapped to 21q22.3.

    Science.gov (United States)

    Gardiner, K; Ichikawa, H; Ohki, M; Patterson, D; Cheng, J F

    1995-11-20

    Fifty-three cDNA fragments previously obtained by hybridization selection from random clones in the chromosome 21 cosmid library LL21CNO2 failed to identify clones in the chromosome 21 YAC contig described by Chumakov et al. (1992, Nature 359: 380-387). Using an expanded panel of somatic cell hybrids, we have verified that the majority of these cDNAs map to chromosome 21 and that in particular a very high proportion, approximately 85%, localize to a 5-Mb region of distal 21q22.3. Pulsed-field analysis coupled with information from the NotI restriction map of the region further indicate that 17 cDNA fragments map within 650 kb of the PFKL gene and thus may be candidates for genetic diseases linked to this gene. This work helps to characterize a region poorly represented in the CEPH YAC contig and adds to the number of cDNAs useful in analysis of chromosome 21-associated diseases.

  2. CalA, a Cyanobacterial AbrB Protein, Interacts with the Upstream Region of hypC and Acts as a Repressor of Its Transcription in the Cyanobacterium Nostoc sp. Strain PCC 7120▿ †

    Science.gov (United States)

    Agervald, Åsa; Zhang, Xiaohui; Stensjö, Karin; Devine, Ellenor; Lindblad, Peter

    2010-01-01

    The filamentous, heterocystous, nitrogen-fixing cyanobacterium Nostoc sp. strain PCC 7120 may contain, depending on growth conditions, up to two hydrogenases directly involved in hydrogen metabolism. HypC is one out of at least seven auxiliary gene products required for synthesis of a functional hydrogenase, specifically involved in the maturation of the large subunit. In this study we present a protein, CalA (Alr0946 in the genome), belonging to the transcription regulator family AbrB, which in protein-DNA assays was found to interact with the upstream region of hypC. Transcriptional investigations showed that calA is cotranscribed with the downstream gene alr0947, which encodes a putative protease from the abortive infection superfamily, Abi. CalA was shown to interact specifically not only with the upstream region of hypC but also with its own upstream region, acting as a repressor on hypC. The bidirectional hydrogenase activity was significantly downregulated when CalA was overexpressed, demonstrating a correlation with the transcription factor, either direct or indirect. In silico studies showed that homologues to both CalA and Alr0947 are highly conserved proteins within cyanobacteria with very similar physical organizations of the corresponding structural genes. Possible functions of the cotranscribed downstream protein Alr0947 are presented. In addition, we present a three-dimensional (3D) model of the DNA binding domain of CalA and putative DNA binding mechanisms are discussed. PMID:20023111

  3. Hepatitis C virus and GBV-C virus prevalence among patients with B-cell lymphoma in different European regions: a case-control study of the International Extranodal Lymphoma Study Group.

    Science.gov (United States)

    Nicolosi Guidicelli, Sabrina; Lopez-Guillermo, Armando; Falcone, Umberto; Conconi, Annarita; Christinat, Alexandre; Rodriguez-Abreu, Delvys; Grisanti, Salvatore; Lobetti-Bodoni, Chiara; Piffaretti, Jean Claude; Johnson, Peter W; Mombelli, Giorgio; Cerny, Andreas; Montserrat, Emili; Cavalli, Franco; Zucca, Emanuele

    2012-09-01

    Hepatitis C virus (HCV) infection is associated with some B-cell non-Hodgkin lymphoma (B cell-NHLs). Patients with HCV infection frequently show co-infections with GB virus C (GBV-C, formerly known as hepatitis G virus), and some studies have suggested a higher incidence of GBV-C infection in patients with B cell-NHLs. The aim of this study was to prospectively evaluate the association between HCV and/or GBV-C infection and B cell-NHLs in different geographic areas. One hundred thirty-seven lymphoma cases and 125 non-lymphoma matched controls were enrolled in an international case-control study conducted in Switzerland (Bellinzona), Spain (Barcelona) and England (Southampton) on samples collected from 2001 to 2002. In Bellinzona (41 cases and 81 controls), the overall prevalence of HCV was 3.3% (4.9% in NHLs), and the overall prevalence of GBV-C was 24% (22% in NHLs). In Barcelona (46 cases and 44 controls), the prevalence of HCV was 10% (8.7% in NHLs) and the prevalence of GBV-C 20% (13% in NHLs). There was no statistically significant difference in the frequency of both infections between patients with NHL and controls. In Southampton, 50 NHL cases were analysed, none of them was found to be HCV-positive; therefore, no control group was analysed and GBV-C analysis was not performed, too. Both in Bellinzona and in Barcelona, the seropositivity rate was significantly lower for HCV than for GBV-C, suggesting that their transmission can be independent. The incidence of HCV was significantly higher in Barcelona than that in Bellinzona. This study confirmed the existence of marked geographic differences in the prevalence of HCV in NHL but cannot provide any significant evidence for an association between HCV and/or GBV-C and B-cell NHLs. Copyright © 2011 John Wiley & Sons, Ltd.

  4. Cloning and expression of a cDNA covering the complete coding region of the P32 subunit of human pre-mRNA splicing factor SF2

    DEFF Research Database (Denmark)

    Honoré, B; Madsen, Peder; Rasmussen, H H

    1993-01-01

    We have cloned and expressed a cDNA encoding the 32-kDa subunit (P32) of the human pre-mRNA splicing factor, SF2. This cDNA extends beyond the 5'-end of a previously reported cDNA [Krainer et al., Cell 66 (1991) 383-394]. Importantly, our fragment includes an ATG start codon which was absent from...... the previously reported cDNA, where it was suggested that translation might initiate at a CTG codon instead of at an ATG codon. Using the vaccinia virus (Vv) expression system, we demonstrate that translation starts at the conventional ATG start codon and not at the CTG codon. The protein is synthesized as a pro...

  5. NODC Standard Product: Coastal Change Analysis Program (C-CAP) Chesapeake Bay Region Data from 1984 to 1989 on CD-ROM (NODC Accession 9200303)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The data set on this CD-ROM shows changes in land cover for the Chesapeake Bay region over the 5-year interval from 1984 to 1988-89. The data set was produced...

  6. Detection of local, regional, and distant recurrence in patients with psa relapse after external-beam radiotherapy using (11)C-choline positron emission tomography

    NARCIS (Netherlands)

    Breeuwsma, Anthonius J.; Pruim, Jan; van den Bergh, Alphons C. M.; Leliveld, Anna M.; Njman, Rien J. M.; Dierckx, Rudi A. J. O.; de Jong, Idle J.

    2010-01-01

    PURPOSE: An elevated serum prostate-specific antigen (PSA) level cannot distinguish between local-regional recurrences and the presence of distant metastases after treatment with curative intent for prostate cancer. With the advent of salvage treatment such as cryotherapy, it has become important to

  7. On the Paleopathological Features of the Sarmatian Population of the Lower Volga and the Lower Don Regions in the 4th - 1st Centuries B.C.

    Directory of Open Access Journals (Sweden)

    Pererva Evgeniy Vladimirovich

    2015-12-01

    Full Text Available The paper is dedicated to the study of paleopathological features of the early Sarmatians. The bone remains which are the material to this research originate from tombs beneath burials mounds from the area of the Lower Volga and the Lower Don regions. The author applied the technique of analysis of bone remains that was introduce into scientific use by A.P. Buzhilova. As a result of the conducted research, the author found out that the early Sarmatians are most likely to have come from the Lower Volga and the Don regions being migrating population which was not uniform in its composition. Some of the Sarmatians, men, in the first place, were overweight and suffered from obesity. The early Sarmatian population in the Lower Volga region and the Don region experienced the periods of prolonged starvation that resulted in chronic diseases which were exacerbated during winters or in dry years. At the same time, the Sarmatians rarely suffered from specific infectious diseases due to the low density of population. War was an integral part of the Sarmatian that was often reflected on skull bones and post-cranial skeleton as war wounds and traumas due to ritual ceremonies.

  8. Genotype versus phenotype: conflicting results in mapping a lung tumor susceptibility locus to the G7c recombination interval in the mouse MHC class III region

    NARCIS (Netherlands)

    van Kooij, M.; de Groot, K.; van Vugt, H.; Aten, J.; Snoek, M.

    2001-01-01

    Susceptibility to chemically induced lung tumorigenesis has previously been mapped to a genomic interval of 27 kb in the MHC class III region of the mouse using two H2 (a/b) intra- H2 recombinants, B10.A(1R) and B10.A(2R). Three genes are located within this interval, G7e (encoding a viral envelope

  9. C16. Terapêutica multidisciplinar no estádio loco-regional do carcinoma do pulmão não-pequenas células

    Directory of Open Access Journals (Sweden)

    Jorge Dionísio

    2003-11-01

    Full Text Available Efectuou-se estudo retrospectivo, baseado na nossa experiência com terapêutica multidisciplinar em doentes com neoplasia do pulmão em estadio loco-regional, tendo sido avaliadas as terapêuticas efectuadas, resposta ao tratamento, intervalo livre de doença e sobrevivência.A análise de sobrevivência foi efectuada pela curva de Kaplan-Meier. Estudaram-se 95 doentes (84 homens, idade média-61 anos. Carcinoma Epidermóide – 46; Adenocarcinoma – 36. Performance Status 0/1 – 84. Emagrecimento <5% - 82.Esquema de tratamento habitual - Quimioterapia (QT 2 ciclos de Cisplatina e Vinorelbina seguidos de Radioterapia (RT numa dose total de 60 Gy ou Cirurgia (C se downstaging. Em doentes com obstrução endobrônquica foi efectuada terapêutica endoscópica (TE.Sessenta e seis doentes efectuaram QTRT sequencial. Em 32 doentes (48,5% verificou-se uma resposta parcial ao tratamento, com intervalo livre de doença até à recidiva de 32,9 semanas. A sobrevida global foi de 73.5 semanas (58.3-88.8, sendo a sobrevida a 1 ano de 53,8% e a 2 anos de 12,9%. Da toxicidade da QT salienta-se neutropénia G3/4 em 36,5% e da toxicidade da RT, Esofagite G3/4 em 1,5% e Pneumonite G3/4 em 6%.Treze doentes foram submetidos previamente a TE num total de 17 tratamentos com Laser em 5, Árgon-Plasma e Electrocoagulação em 1 cada e colocação de 13 próteses, permitindo desobstrução brônquica.Foram operados 10 doentes após QT neoadjuvante e 1 após QRT.O esquema de QTRT sequencial teve uma sobrevivência média sobreponível à da literatura, apresentando uma toxicidade aceitável. A TE como terapêutica inicial na prevenção de pneumonia obstrutiva facilitou o uso de QT. Foi possível downstaging para C em 24% dos doentes em estádio IIIa. : This retrospective study, based in our clinical database, represents the experience of our department with multidisciplinary

  10. Epidemiology of Clostridium difficile in infants in Oxfordshire, UK: Risk factors for colonization and carriage, and genetic overlap with regional C. difficile infection strains.

    Science.gov (United States)

    Stoesser, Nicole; Eyre, David W; Quan, T Phuong; Godwin, Heather; Pill, Gemma; Mbuvi, Emily; Vaughan, Alison; Griffiths, David; Martin, Jessica; Fawley, Warren; Dingle, Kate E; Oakley, Sarah; Wanelik, Kazimierz; Finney, John M; Kachrimanidou, Melina; Moore, Catrin E; Gorbach, Sherwood; Riley, Thomas V; Crook, Derrick W; Peto, Tim E A; Wilcox, Mark H; Walker, A Sarah

    2017-01-01

    Approximately 30-40% of children <1 year of age are Clostridium difficile colonized, and may represent a reservoir for adult C. difficile infections (CDI). Risk factors for colonization with toxigenic versus non-toxigenic C. difficile strains and longitudinal acquisition dynamics in infants remain incompletely characterized. Predominantly healthy infants (≤2 years) were recruited in Oxfordshire, UK, and provided ≥1 fecal samples. Independent risk factors for toxigenic/non-toxigenic C. difficile colonization and acquisition were identified using multivariable regression. Infant C. difficile isolates were whole-genome sequenced to assay genetic diversity and prevalence of toxin-associated genes, and compared with sequenced strains from Oxfordshire CDI cases. 338/365 enrolled infants provided 1332 fecal samples, representing 158 C. difficile colonization or carriage episodes (107[68%] toxigenic). Initial colonization was associated with age, and reduced with breastfeeding but increased with pet dogs. Acquisition was associated with older age, Caesarean delivery, and diarrhea. Breastfeeding and pre-existing C. difficile colonization reduced acquisition risk. Overall 13% of CDI C. difficile strains were genetically related to infant strains. 29(18%) infant C. difficile sequences were consistent with recent direct/indirect transmission to/from Oxfordshire CDI cases (≤2 single nucleotide variants [SNVs]); 79(50%) shared a common origin with an Oxfordshire CDI case within the last ~5 years (0-10 SNVs). The hypervirulent, epidemic ST1/ribotype 027 remained notably absent in infants in this large study, as did other lineages such as STs 10/44 (ribotype 015); the most common strain in infants was ST2 (ribotype 020/014)(22%). In predominantly healthy infants without significant healthcare exposure C. difficile colonization and acquisition reflect environmental exposures, with pet dogs identified as a novel risk factor. Genetic overlap between some infant strains and

  11. Epidemiology of Clostridium difficile in infants in Oxfordshire, UK: Risk factors for colonization and carriage, and genetic overlap with regional C. difficile infection strains.

    Directory of Open Access Journals (Sweden)

    Nicole Stoesser

    Full Text Available Approximately 30-40% of children <1 year of age are Clostridium difficile colonized, and may represent a reservoir for adult C. difficile infections (CDI. Risk factors for colonization with toxigenic versus non-toxigenic C. difficile strains and longitudinal acquisition dynamics in infants remain incompletely characterized.Predominantly healthy infants (≤2 years were recruited in Oxfordshire, UK, and provided ≥1 fecal samples. Independent risk factors for toxigenic/non-toxigenic C. difficile colonization and acquisition were identified using multivariable regression. Infant C. difficile isolates were whole-genome sequenced to assay genetic diversity and prevalence of toxin-associated genes, and compared with sequenced strains from Oxfordshire CDI cases.338/365 enrolled infants provided 1332 fecal samples, representing 158 C. difficile colonization or carriage episodes (107[68%] toxigenic. Initial colonization was associated with age, and reduced with breastfeeding but increased with pet dogs. Acquisition was associated with older age, Caesarean delivery, and diarrhea. Breastfeeding and pre-existing C. difficile colonization reduced acquisition risk. Overall 13% of CDI C. difficile strains were genetically related to infant strains. 29(18% infant C. difficile sequences were consistent with recent direct/indirect transmission to/from Oxfordshire CDI cases (≤2 single nucleotide variants [SNVs]; 79(50% shared a common origin with an Oxfordshire CDI case within the last ~5 years (0-10 SNVs. The hypervirulent, epidemic ST1/ribotype 027 remained notably absent in infants in this large study, as did other lineages such as STs 10/44 (ribotype 015; the most common strain in infants was ST2 (ribotype 020/014(22%.In predominantly healthy infants without significant healthcare exposure C. difficile colonization and acquisition reflect environmental exposures, with pet dogs identified as a novel risk factor. Genetic overlap between some infant strains

  12. Seasonally varying contributions to urban CO2 in the Chicago, Illinois, USA region: Insights from a high-resolution CO2 concentration and δ13C record

    Directory of Open Access Journals (Sweden)

    Joel Moore

    2015-06-01

    Full Text Available Abstract Understanding urban carbon cycling is essential given that cities sustain 54% of the global population and contribute 70% of anthropogenic CO2 emissions. When combined with CO2 concentration measurements ([CO2], stable carbon isotope analyses (δ13C can differentiate sources of CO2, including ecosystem respiration and combustion of fossil fuels, such as petroleum and natural gas. In this study, we used a wavelength scanned-cavity ringdown spectrometer to collect ∼2x106 paired measurements for [CO2] and δ13C values in Evanston, IL for August 2011 through February 2012. Evanston is located immediately north of Chicago, IL, the third largest city in the United States. The measurements represent one of the longest records of urban [CO2] and δ13C values thus far reported. We also compiled local meteorological information, as well as complementary [CO2] and δ13C data for background sites in Park Falls, WI and Mauna Loa, HI. We use the dataset to examine how ecosystem processes, fossil fuel usage, wind speed, and wind direction control local atmospheric [CO2] and δ13C in a midcontinent urban setting on a seasonal to daily basis. On average, [CO2] and δ13C values in Evanston were 16–23 ppm higher and 0.97–1.13‰ lower than the background sites. While seasonal [CO2] and δ13C values generally followed broader northern hemisphere trends, the difference between Evanston and the background sites was larger in winter versus summer. Mixing calculations suggest that ecosystem respiration and petroleum combustion equally contributed CO2 in excess of background during the summer and that natural gas combustion contributed 80%–94% of the excess CO2 in winter. Wind speed and direction strongly influenced [CO2] and δ13C values on an hourly time scale. The highest [CO2] and lowest δ13C values occurred at wind speeds <3 m s−1 and when winds blew from the northwest, west, and south over densely populated neighborhoods.

  13. Single amino acid changes in the 6K1-CI region can promote the alternative adaptation of Prunus- and Nicotiana-propagated Plum pox virus C isolates to either host.

    Science.gov (United States)

    Calvo, María; Malinowski, Tadeusz; García, Juan Antonio

    2014-02-01

    Plum pox virus (PPV) C is one of the less common PPV strains and specifically infects cherry trees in nature. Making use of two PPV-C isolates that display different pathogenicity features, i.e., SwCMp, which had been adapted to Nicotiana species, and BY101, which had been isolated from cherry rootstock L2 (Prunus lannesiana) and propagated only in cherry species, we have generated two infective full-length cDNA clones in order to determine which viral factors are involved in the adaptation to each host. According to our results, the C-P3(PIPO)/6K1/N-CI (cylindrical inclusion) region contains overlapping but not coincident viral determinants involved in symptoms development, local viral amplification, and systemic movement capacity. Amino acid changes in this region promoting the adaptation to N. benthamiana or P. avium have trade-off effects in the alternative host. In both cases, adaptation can be achieved through single amino acid changes in the NIapro protease recognition motif between 6K1 and CI or in nearby sequences. Thus, we hypothesize that the potyvirus polyprotein processing could depend on specific host factors and the adaptation of PPV-C isolates to particular hosts relies on a fine regulation of the proteolytic cleavage of the 6K1-CI junction.

  14. Influence of N- and/or C-terminal regions on activity, expression, characteristics and structure of lipase from Geobacillus sp. 95.

    Science.gov (United States)

    Gudiukaitė, Renata; Gegeckas, Audrius; Kazlauskas, Darius; Citavicius, Donaldas

    2014-01-01

    GD-95 lipase from Geobacillus sp. strain 95 and its modified variants lacking N-terminal signal peptide and/or 10 or 20 C-terminal amino acids were successfully cloned, expressed and purified. To our knowledge, GD-95 lipase precursor (Pre-GD-95) is the first Geobacillus lipase possessing more than 80% lipolytic activity at 5 °C. It has maximum activity at 55 °C and displays a broad pH activity range. GD-95 lipase was shown to hydrolyze p-NP dodecanoate, tricaprylin and canola oil better than other analyzed substrates. Structural and sequence alignments of bacterial lipases and GD-95 lipase revealed that the C-terminus forms an α helix, which is a conserved structure in lipases from Pseudomonas, Clostridium or Staphylococcus bacteria. This work demonstrates that 10 and 20 C-terminal amino acids of GD-95 lipase significantly affect stability and other physicochemical properties of this enzyme, which has never been reported before and can help create lipases with more specific properties for industrial application. GD-95 lipase and its modified variants GD-95-10 can be successfully applied to biofuel production, in leather and pulp industries, for the production of cosmetics or perfumes. These lipases are potential biocatalysts in processes, which require extreme conditions: low or high temperature, strongly acidic or alkaline environment and various organic solvents.

  15. Linear antenna microwave plasma CVD diamond deposition at the edge of no-growth region of C-H-O ternary diagram

    Energy Technology Data Exchange (ETDEWEB)

    Potocky, Stepan; Babchenko, Oleg; Hruska, Karel; Kromka, Alexander [Institute of Physics AS CR, v.v.i., Cukrovarnicka 10, 16200 Praha (Czech Republic)

    2012-12-15

    The process parametric window for diamond deposition using the chemical vapor deposition at low pressures is quite limited where addition of oxygen in the gas phase broadens this window. The lower boundary of the lens-shaped domain in C-H-O ternary diagram concurs with the H{sub 2}-CO tie-line (C/(C + O) = 0.5). In this work, we present the set of experiments where the ratio of C/(C + O) was kept at a constant value 0.385. The effect of hydrogen concentration (ratio O/(O + H) varied from 0.047 to 0.364) on plasma characteristics and deposited NCD films were investigated. Raman spectroscopy confirmed the diamond character of all deposited coatings while scanning electron microscopy showed transformation from not closed to continuous film and further decrease of grain size and finally growth of diamond nanowires while decreasing hydrogen concentration in a gas mixture. (Copyright copyright 2012 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  16. The C-terminal random coil region tunes the Ca²⁺-binding affinity of S100A4 through conformational activation.

    Directory of Open Access Journals (Sweden)

    Annette Duelli

    Full Text Available S100A4 interacts with many binding partners upon Ca2+ activation and is strongly associated with increased metastasis formation. In order to understand the role of the C-terminal random coil for the protein function we examined how small angle X-ray scattering of the wild-type S100A4 and its C-terminal deletion mutant (residues 1-88, Δ13 changes upon Ca2+ binding. We found that the scattering intensity of wild-type S100A4 changes substantially in the 0.15-0.25 Å-1 q-range whereas a similar change is not visible in the C-terminus deleted mutant. Ensemble optimization SAXS modeling indicates that the entire C-terminus is extended when Ca2+ is bound. Pulsed field gradient NMR measurements provide further support as the hydrodynamic radius in the wild-type protein increases upon Ca2+ binding while the radius of Δ13 mutant does not change. Molecular dynamics simulations provide a rational explanation of the structural transition: the positively charged C-terminal residues associate with the negatively charged residues of the Ca2+-free EF-hands and these interactions loosen up considerably upon Ca2+-binding. As a consequence the Δ13 mutant has increased Ca2+ affinity and is constantly loaded at Ca2+ concentration ranges typically present in cells. The activation of the entire C-terminal random coil may play a role in mediating interaction with selected partner proteins of S100A4.

  17. In situ detection of Chlamydia pneumoniae, C. trachomatis, and cytokines among cardiovascular diseased patients from the Amazon region of Brazil

    Directory of Open Access Journals (Sweden)

    Freitas LS

    2017-04-01

    Full Text Available Larissa S Freitas,1 Núbia Caroline C Almeida,1 Maria Alice Freitas Queiroz,1 Marcelo M Zaninotto,2 Hellen T Fuzii,3 Alfredo Ribeiro-Silva,4 Antonio CR Vallinoto,1 Marluísa OG Ishak,1 Juarez AS Quaresma,3 Ricardo Ishak1 1Virus Laboratory, Institute of Biological Sciences, Federal University of Para, 2Hospital of Clinic Gaspar Viana, 3Laboratory of Immunopathology, Nucleus of Tropical Medicine, Federal University of Para, Belém, 4Departament of Pathology, Medical School of Ribeirão Preto, University of Sao Paulo, São Paulo, Brazil Background: Chronic coronary artery disease has been associated, as a consequence of the local inflammatory reaction with previous or persistent infection with Chlamydia pneumoniae, which led to the investigation of the association of cardiovascular disease and previous infection with C. trachomatis and the role of cytokine profile (in situ markers in the vascular system tissues. Methods: Sixty-nine biopsies were collected for immunohistochemical analysis for the presence of IL-6, IL-8, TNF-α, IFN-γ, TGF-β, and IL-10, in 16 fragments from atheromatous plaques, 32 aorta fragments, and 21 valve fragments, using a tissue microarray technique for paraffin embedded tissues. Results: Most patients undergoing revascularization surgery were men >50 years, while those undergoing valve replacement were mostly women <50 years. TNF-α was the most prevalent marker, detected in 91.7% (55/60 of the samples. The mean percent area stained was greater in patients infected with C. pneumoniae (3.81% vs 1.92%; p=0.0115 and specifically in the aorta (4.83% vs 2.25%; p=0.0025; C. trachomatis infection was higher in valves, and C. pneumoniae in plaques, both without statistical significance. There was no significant difference in the cytokine staining profile between patients previously infected with both species and uninfected patients. Conclusion: Although there was no difference in the cytokine profile between patients previously

  18. Cadmium quantification in Brazilian mothers colostrum: a regional study Quantificação de cádmio em colostro de mães brasileiras: um estudo regional

    Directory of Open Access Journals (Sweden)

    Luiz Fernando C. Nascimento

    2005-06-01

    Full Text Available OBJECTIVES: to estimate the amount of cadmium in human colostrum of mothers from Taubaté. METHODS: it was a cross-sectional study with mothers who delivered in University Hospital of Taubaté, in year 2003. The colostrum was collected in special tubes, one day after the delivery and frozen at -200 C. The independent variables were maternal age, birthweight, gestational age, parity, dietary habits, smoking report and maternal occupation. Cadmium was quantified by atomic absorption spectrometry. It was used Mann-Whitney non-parametric approach to compare mean values; Pearson correlation was also used to verify associations. The level of significance was alpha = 5%. RESULTS: the mean value of cadmium was 54.5 mg/L (sd=381.0 mg/L. Cadmium was detected in 18 out of 58 samples (31.0%. There was neither correlation nor differences between the cadmium values and the independent variables maternal age, birthweight, gestational age, parify and smoking report. CONCLUSIONS: these values are above those the amounts described in other papers and it is important to identify the possible sources of this heavy metal in maternal environment.OBJETIVOS: estimar a quantidade de cádmio em colostro de mães de Taubaté. MÉTODOS: foi realizado um estudo do tipo transversal envolvendo mães que deram à luz no Hospital Universitário de Taubaté, no ano de 2003. O colostro foi coletado até um dia após o parto, em tubos de polipropileno previamente tratados e refrigerado a -20° C. As variáveis independentes foram idade materna, peso do recém-nascido, idade gestacional, paridade, hábitos alimentares, relato de fumo e ocupação materna. Cádmio foi quantificado através da técnica da espectroscopia de absorção atômica. Foram utilizados a técnica não-paramétrica de Mann-Whitney para comparação das médias e a correlação de Pearson para verificar associações. O nível de significância adotado foi alfa = 5%. RESULTADOS: o valor médio de c

  19. Detecting human presence at the border of the Northeastern Italian Pre-Alps. 14C dating at Rio Secco cave as expression of the first Gravettian and the late mousterian in the Northern Adriatic Region.

    Directory of Open Access Journals (Sweden)

    Sahra Talamo

    Full Text Available In the northern Adriatic regions, which include the Venetian region and the Dalmatian coast, late Neanderthal settlements are recorded in few sites and even more ephemeral are remains of the Mid-Upper Palaeolithic occupations. A contribution to reconstruct the human presence during this time range has been produced from a recently investigated cave, Rio Secco, located in the northern Adriatic region at the foot of the Carnic Pre-Alps. Chronometric data make Rio Secco a key site in the context of recording occupation by late Neanderthals and regarding the diffusion of the Mid-Upper Palaeolithic culture in a particular district at the border of the alpine region. As for the Gravettian, its diffusion in Italy is a subject of on-going research and the aim of this paper is to provide new information on the timing of this process in Italy. In the southern end of the Peninsula the first occupation dates to around 28,000 14C BP, whereas our results on Gravettian layer range from 29,390 to 28,995 14C years BP. At the present state of knowledge, the emergence of the Gravettian in eastern Italy is contemporaneous with several sites in Central Europe and the chronological dates support the hypothesis that the Swabian Gravettian probably dispersed from eastern Austria.

  20. Factor VIII C1 domain spikes 2092-2093 and 2158-2159 comprise regions that modulate cofactor function and cellular uptake

    NARCIS (Netherlands)

    Bloem, Esther; van den Biggelaar, Maartje; Wroblewska, Aleksandra; Voorberg, Jan; Faber, Johan H.; Kjalke, Marianne; Stennicke, Henning R.; Mertens, Koen; Meijer, Alexander B.

    2013-01-01

    The C1 domain of factor VIII (FVIII) has been implicated in binding to multiple constituents, including phospholipids, von Willebrand factor, and low-density lipoprotein receptor-related protein (LRP). We have previously described a human monoclonal antibody called KM33 that blocks these

  1. Cooperativity in virus neutralization by human monoclonal antibodies to two adjacent regions located at the amino terminus of hepatitis C virus E2 glycoprotein

    DEFF Research Database (Denmark)

    Keck, Zhenyong; Wang, Wenyan; Wang, Yong

    2013-01-01

    A challenge for hepatitis C virus (HCV) vaccine development is defining conserved epitopes that induce protective antibodies against this highly diverse virus. An envelope glycoprotein (E2) segment located at amino acids (aa) 412 to 423 contains highly conserved neutralizing epitopes. While...

  2. Small Angle X-Ray Scattering Studies of Mitochondrial Glutaminase C Reveal Extended Flexible Regions, and Link Oligomeric State with Enzyme Activity

    DEFF Research Database (Denmark)

    Møller, M.; Nielsen, Søren Skou; Ramachandran, Siddharth

    2013-01-01

    Glutaminase C is a key metabolic enzyme, which is unregulated in many cancer systems and believed to play a central role in the Warburg effect, whereby cancer cells undergo changes to an altered metabolic profile. A long-standing hypothesis links enzymatic activity to the protein oligomeric state...

  3. Identification of distinct nisin leader peptide regions that determine interactions with the modification enzymes NisB and NisC

    NARCIS (Netherlands)

    Khusainov, Rustem; Moll, Gert N.; Kuipers, Oscar P.

    2013-01-01

    Nisin is the most prominent and applied bacteriocin that serves as a model for class I lantibiotics. The nisin leader peptide importantly determines interactions between precursor nisin and its modification enzymes NisB and NisC that mature nisin posttranslationally. NisB dehydrates serines and

  4. High-accuracy Quartic Force Field Calculations for the Spectroscopic Constants and Vibrational Frequencies of 11 A' l-C3H-: A Possible Link to Lines Observed in the Horsehead Nebula Photodissociation Region

    Science.gov (United States)

    Fortenberry, Ryan C.; Huang, Xinchuan; Crawford, T. Daniel; Lee, Timothy J.

    2013-07-01

    It has been shown that rotational lines observed in the Horsehead nebula photodissociation region (PDR) are probably not caused by l-C3H+, as was originally suggested. In the search for viable alternative candidate carriers, quartic force fields are employed here to provide highly accurate rotational constants, as well as fundamental vibrational frequencies, for another candidate carrier: 1 1 A' C3H-. The ab initio computed spectroscopic constants provided in this work are, compared to those necessary to define the observed lines, as accurate as the computed spectroscopic constants for many of the known interstellar anions. Additionally, the computed D eff for C3H- is three times closer to the D deduced from the observed Horsehead nebula lines relative to l-C3H+. As a result, 1 1 A' C3H- is a more viable candidate for these observed rotational transitions. It has been previously proposed that at least C6H- may be present in the Horsehead nebular PDR formed by way of radiative attachment through its dipole-bound excited state. C3H- could form in a similar way through its dipole-bound state, but its valence excited state increases the number of relaxation pathways possible to reach the ground electronic state. In turn, the rate of formation for C3H- could be greater than the rate of its destruction. C3H- would be the seventh confirmed interstellar anion detected within the past decade and the first C n H- molecular anion with an odd n.

  5. Superficial disposition of the N-terminal region of the surfactant protein SP-C and the absence of specific SP-B-SP-C interactions in phospholipid bilayers

    DEFF Research Database (Denmark)

    Plasencia, I; Cruz, A; Casals, C

    2001-01-01

    phospholipids tested, of the order of a few micromolar. Cooling of Dns-SP-C-containing dipalmitoyl PC bilayers to temperatures below the phase transition of the phospholipid produced a progressive blue-shift of the fluorescence emission of the protein. This effect is interpreted as a consequence of the transfer...... of the N-terminal segment of the protein into less polar environments that originate during protein lateral segregation. This suggests that conformation and interactions of the N-terminal segment of SP-C could be important in regulating the lateral distribution of the protein in surfactant bilayers...

  6. The experiments of Ramón M. Termeyer SJ on the electric eel in the River Plate region (c. 1760) and other early accounts of Electrophorus electricus.

    Science.gov (United States)

    de Asúa, Miguel

    2008-01-01

    This paper focuses on Ramón M. Termeyer SJ (1737-1814?), a naturalist who experimented with the electric eel in the River Plate region during the 1760s. After going through an enumeration of the chroniclers that since the sixteenth century noticed the benumbing discharge of Electrophorus electricus, the article summarizes the work that immediately preceded Termeyer's and considers as a term of comparison the experiments on the electric eel performed by Bertrand Bajon (fl. 1751-1778) in the French Guyanne. It ends by discussing the meaning of Termeyer's 1781 and 1810 articles in the light of contemporary ideas of animal electricity.

  7. Influência da lista única de uma regional de transplantes de córnea em um Banco de Olhos vinculado a um hospital escola

    Directory of Open Access Journals (Sweden)

    Oliveira Lauro Augusto de

    2003-01-01

    Full Text Available OBJETIVO: Avaliar como a implantação do sistema de lista única para transplantes de córnea influenciou um Banco de Olhos vinculado a um hospital escola. Analisar sua interferência nas córneas (captação e destino, no número de transplantes realizados e também na média de tempo de espera pela cirurgia. MÉTODOS: Foi realizado estudo retrospectivo, avaliando os prontuários dos pacientes submetidos a ceratoplastia penetrante e também os dados do Banco de Olhos da Faculdade de Medicina de São José do Rio Preto - SP. O estudo comparou dados relativos ao funcionamento do serviço por um ano antes e após a criação da lista única. RESULTADOS: O número de cirurgias aumentou de 60 para 92 cirurgias. A média mensal de córneas retiradas aumentou de 13,83 ± 6,57 para 18,16 ± 4,80 (p=0,07. O número de córneas enviadas por esta instituição foi maior que o número de córneas recebidas de outros serviços (p=0,003. Não houve diferença significativa entre o tempo de espera pela cirurgia antes e após a criação da fila única (desconsiderando o período de cadastramento. CONCLUSÕES: Este Banco de Olhos funcionou como fornecedor de córneas para outras instituições. Após seu primeiro ano de funcionamento, a implantação da lista única não alterou o tempo de espera dos pacientes pela cirurgia. Apesar disso, evidenciou-se uma tendência à homogeneização do tempo de espera pela ceratoplastia penetrante entre os pacientes.

  8. Search for $H^0 \\rightarrow b \\bar{b}$ or $c \\bar{c}$ in association with a $W$ or $Z$ boson in the forward region of $pp$ collisions

    CERN Document Server

    The LHCb Collaboration

    2016-01-01

    The LHCb dataset consisting of proton--proton collisions recorded at $\\sqrt{s}=8$ $\\mathrm{TeV}$, corresponding to an integrated luminosity of 1.98 $\\pm$ 0.02 $fb^{-1}$, is used to search for a Higgs boson with a mass of 125 $\\mathrm{GeV}$, produced in association with a $W$ or $Z$ boson and decaying to a $b \\bar{b}$ or $c \\bar{c}$ pair. The final state considered is a pair of heavy flavour tagged jets and one or two high $p_T$ leptons (electrons or muons). No excess over the background expectation is found and upper limits on the product of cross section times branching fraction, with two heavy quarks from $H^0$ and one lepton from $W$/$Z$ in the $\\text {LHCb}$ acceptance $2 < \\eta < 5$, are set at $95\\% ~\\text{CL}$: \\begin{align} \\sigma (pp \\rightarrow W/Z + H^0 ) \\times \\mathrm{{\\cal B}}(H^0 \\to b \\bar{b}) < 1.6 ~ \\mathrm{pb}, \\end{align} \\begin{align} \\sigma(pp \\rightarrow W/Z + H^0 ) \\times \\mathrm{{\\cal B}}(H^0 \\to c \\bar{c}) < 9.4 ~ \\mathrm{pb}. \\end{align}

  9. Interaction between the C-terminal region of human myelin basic protein and calmodulin: analysis of complex formation and solution structure

    Directory of Open Access Journals (Sweden)

    Hayashi Nobuhiro

    2008-02-01

    Full Text Available Abstract Background The myelin sheath is a multilamellar membrane structure wrapped around the axon, enabling the saltatory conduction of nerve impulses in vertebrates. Myelin basic protein, one of the most abundant myelin-specific proteins, is an intrinsically disordered protein that has been shown to bind calmodulin. In this study, we focus on a 19-mer synthetic peptide from the predicted calmodulin-binding segment near the C-terminus of human myelin basic protein. Results The interaction of native human myelin basic protein with calmodulin was confirmed by affinity chromatography. The binding of the myelin basic protein peptide to calmodulin was tested with isothermal titration calorimetry (ITC in different temperatures, and Kd was observed to be in the low μM range, as previously observed for full-length myelin basic protein. Surface plasmon resonance showed that the peptide bound to calmodulin, and binding was accompanied by a conformational change; furthermore, gel filtration chromatography indicated a decrease in the hydrodynamic radius of calmodulin in the presence of the peptide. NMR spectroscopy was used to map the binding area to reside mainly within the hydrophobic pocket of the C-terminal lobe of calmodulin. The solution structure obtained by small-angle X-ray scattering indicates binding of the myelin basic protein peptide into the interlobal groove of calmodulin, while calmodulin remains in an extended conformation. Conclusion Taken together, our results give a detailed structural insight into the interaction of calmodulin with a C-terminal segment of a major myelin protein, the myelin basic protein. The used 19-mer peptide interacts mainly with the C-terminal lobe of calmodulin, and a conformational change accompanies binding, suggesting a novel mode of calmodulin-target protein interaction. Calmodulin does not collapse and wrap around the peptide tightly; instead, it remains in an extended conformation in the solution structure

  10. Construction of a YAC contig and STS map spanning at least 10 cM in 1q41, the critical region of Usher II gene

    Energy Technology Data Exchange (ETDEWEB)

    Wang, J.Y.; Zhen, D.K.; Li, B.F. [Univ. of Nebraska, Omaha, NE (United States)] [and others

    1994-09-01

    Usher syndrome is an autosomal recessive disorder causing congenital hearing loss, progressive retinitis pigmentosa and vestibular dysfunction. The Usher syndrome is both clinically and genetically heterogeneous. At least three genetic types of Usher syndrome are know to exist. The Usher II (USH2) syndrome has originally been linked to 1q41 between D1S70 and D1S81. more recently its location was refined and placed between D1S217 and D1S229. We have constructed a YAC contig containing 23 clones and a minimum of 10 Mbp of human DNA. A total of three NotI linking clones, fourteen polymorphic microsatelite markers, eight YAC end clones and twenty lambda and cosmid subclones have been used to order the YACs and assess their integrity. The YAC subclones were used to reassess the location of the USH2 gene. Seven CpG islands have already been identified in the region. Several potential exons have been identified by exon amplification in the cosmid subclones. This map of overlapping clones, the set of densely spaced physical markers and potential exons will promote our understanding of the 1q1 region, its associated genes and eventually the gene mutated in Usher syndrome type II.

  11. O-H-C isotope ratio determination in wine in order to be used as a fingerprint of its regional origin.

    Science.gov (United States)

    Raco, B; Dotsika, E; Poutoukis, D; Battaglini, R; Chantzi, P

    2015-02-01

    Stable isotopes have been applied to determine the origin assignment and verify the geographical provenance that is considered important characteristics of wine products both for consumers and the international regulations, of wines. Stable isotope analyses of (18)O/(16)O, D/H and (13)C/(12)C ratio for the detection of origin and of adulteration in wine are discussed in this study. The δ(13)C analysis of ethanol and wines water δ(18)O underlines the importance of the photosynthetic pathway and the environmental conditions of wine. Also we discuss the main factors that are responsible for the differentiation of the oxygen isotope ratios of wine water. Data interpretation demonstrated the efficacy of δ(18)O analysis not only in the wine but also in grape berries, preferably if the determination of the δ(18)O value is employed together with the determination of the δ(2)H isotope content of wine, for the detection of the geographical origin of wine. Copyright © 2014 Elsevier Ltd. All rights reserved.

  12. An 11p15 imprinting centre region 2 deletion in a family with Beckwith Wiedemann syndrome provides insights into imprinting control at CDKN1C.

    Directory of Open Access Journals (Sweden)

    Elizabeth Algar

    Full Text Available We report a three generation family with Beckwith Wiedemann syndrome (BWS in whom we have identified a 330 kb deletion within the KCNQ1 locus, encompassing the 11p15.5 Imprinting Centre II (IC2. The deletion arose on the paternal chromosome in the first generation and was only associated with BWS when transmitted maternally to subsequent generations. The deletion on the maternal chromosome was associated with a lower median level of CDKN1C expression in the peripheral blood of affected individuals when compared to a cohort of unaffected controls (p<0.05, however was not significantly different to the expression levels in BWS cases with loss of methylation (LOM within IC2 (p<0.78. Moreover the individual with a deletion on the paternal chromosome did not show evidence of elevated CDKN1C expression or features of Russell Silver syndrome. These observations support a model invoking the deletion of enhancer elements required for CDKN1C expression lying within or close to the imprinting centre and importantly extend and validate a single observation from an earlier study. Analysis of 94 cases with IC2 loss of methylation revealed that KCNQ1 deletion is a rare cause of loss of maternal methylation, occurring in only 3% of cases, or in 1.5% of BWS overall.

  13. O diagnóstico das zonas mortas na cóclea e sua importância no processo de reabilitação auditiva Diagnosing cochlear "dead" regions and its importance in the auditory rehabilitation process

    Directory of Open Access Journals (Sweden)

    Cristiane Padilha

    2007-08-01

    Full Text Available Cada vez mais na prática da audiologia é indispensável um bom diagnóstico audiológico, para que se tenha conhecimento das necessidades do paciente para seleção e adaptação de próteses auditivas. OBJETIVO: Expor literaturas recentes que referem conceitos de zonas mortas na cóclea, estratégias de diagnóstico e a importância deste no processo de seleção e adaptação de próteses auditivas. METODOLOGIA: Realizou-se um levantamento bibliográfico sobre zonas mortas na cóclea. As zonas mortas na cóclea foram descritas como regiões onde as células ciliadas internas e/ou neurônios adjacentes não se encontram funcionais. Assim, nessas regiões a informação gerada pela vibração da membrana basilar não é transmitida ao sistema nervoso central. Porém, um tom com freqüência correspondente a zona morta, desde que suficientemente intenso, pode ser percebido em regiões próximas a esta zona, onde às células ciliadas internas e/ou fibras nervosas ainda apresentam-se funcionais. CONCLUSÃO: A identificação das zonas mortas na cóclea está sendo utilizada visando melhores resultados no processo de seleção e adaptação de próteses auditivas, pois as informações geradas pelas CCI ao nervo auditivo são importantes para um melhor reconhecimento dos sons, principalmente os sons da fala.A good audiologic diagnosis is increasingly more important in the practice of audiology, in order to understand patients’ needs for selection and fitting of hearing aid devices. AIM: Show recent literature that mention the concept of cochlear dead regions, diagnostic strategies and its relevance in the process of selection and fitting of hearing aids. METHODS: to carry out a bibliographical survey on dead cochlear regions. Dead cochlear regions were described as regions where inner hair cells and/or adjacent neurons do not work. Therefore, in these regions, the information generated by basilar membrane vibration is not transmitted to the

  14. A WIDE DISTRIBUTION OF A NEW VRN-B1c ALLELE OF WHEAT TRITICUM AESTIVUM L. IN RUSSIA, UKRAINE AND ADJACENT REGIONS: A LINK WITH THE HEADING TIME AND ADAPTIVE POTENTIAL

    Directory of Open Access Journals (Sweden)

    Shcherban A.

    2012-08-01

    Full Text Available The adaptation of common wheat (T. aestivum L. to diverse environmental conditions is greatly under the control of genes involved in determination of vernalization response (Vrn-1 genes. It was found that the variation in common wheat heading time is affected not only by combination of Vrn-1 homoeoalleles but also by multiple alleles at a separate Vrn-1 locus. Previously, we described the Vrn-B1c allele from T.aestivum cv. 'Saratovskaya 29' and found significant differences in the structure of the first (1st intron of this allele when compared to another highly abundant Vrn-B1a allele, specifically, the deletion of 0.8 kb coupled with the duplication of 0.4 kb. We suggested that the changes in the intron 1 of Vrn-B1c allele caused earlier ear emergence in the near-isogenic line and cultivars, carrying this allele. In this study we investigate the distribution of the Vrn-B1c allele in a wide set of spring wheat cultivars from Russia, Ukraine and adjacent regions. The analysis revealed that 40% of Russian and 53% of Ukranian spring wheat cultivars contain the Vrn-B1c allele. The high distribution of the Vrn-B1c allele can be explained by a frequent using of 'Saratovskaya 29' in the breeding process inside the studied area. From the other hand, the predominance of the Vrn-B1c allele among cultivars cultivated in West Siberia and Kazakhstan may be due to the selective advantage of this allele for the region where there is a high risk of early fall frosts.

  15. A study on single nucleotide polymorphism of exon 7 T/C (locus 593 of platelet-activating factor acetylhydrolase gene in healthy Han population in the Shanghai region

    Directory of Open Access Journals (Sweden)

    Tian-bao XIA

    2012-08-01

    Full Text Available Objective To investigate the distribution of single nucleotide polymorphism (SNP in platelet-activating factor acetylhydrolase (PAF-AH gene exon 7 T/C (locus 593 in healthy Han population in Shanghai region and the features different from other races. Methods The SNP in PAF-AH gene exon 7 T/C (locus 593 was detected and analyzed by PCR and sequencing in 110 healthy Han people from Shanghai areas. The genotype and allele frequency were then calculated and compared with that in other races in combination with review of relevant literature. Results The amplified product of the SNP in PAF-AH gene exon 7 T/C (locus 593 was 240 bp in 110 healthy Han people, of whom 97 were with TT genotype and 13 with TC genotype, but no CC genotype was found. As to the allele frequency distribution, T type allele took the highest position, and C type followed. The genotype frequency of TT and TC was 88.2% and 11.8%, respectively, and they were markedly different from that in German population (0.95%, while not statistically significant different from that in British population (7.67%. Conclusions There exists SNP in PAF-AH gene exon 7 T/C (position 593 in healthy Han people in Shanghai region, with a higher frequency of T→C mutation. The mutational genotype frequency is found to be located at the locus 593 is 11.81%, and it is markedly different from that in German population, but not significantly different from that in British population.

  16. Variation of δ2H, δ18O & δ13C in crude palm oil from different regions in Malaysia: Potential of stable isotope signatures as a key traceability parameter.

    Science.gov (United States)

    Muhammad, Syahidah Akmal; Seow, Eng-Keng; Mohd Omar, A K; Rodhi, Ainolsyakira Mohd; Mat Hassan, Hasnuri; Lalung, Japareng; Lee, Sze-Chi; Ibrahim, Baharudin

    2018-01-01

    A total of 33 crude palm oil samples were randomly collected from different regions in Malaysia. Stable carbon isotopic composition (δ13C) was determined using Flash 2000 elemental analyzer while hydrogen and oxygen isotopic compositions (δ2H and δ18O) were analyzed by Thermo Finnigan TC/EA, wherein both instruments were coupled to an isotope ratio mass spectrometer. The bulk δ2H, δ18O and δ13C of the samples were analyzed by Hierarchical Cluster Analysis (HCA), Principal Component Analysis (PCA) and Orthogonal Partial Least Square-Discriminant Analysis (OPLS-DA). Unsupervised HCA and PCA methods have demonstrated that crude palm oil samples were grouped into clusters according to respective state. A predictive model was constructed by supervised OPLS-DA with good predictive power of 52.60%. Robustness of the predictive model was validated with overall accuracy of 71.43%. Blind test samples were correctly assigned to their respective cluster except for samples from southern region. δ18O was proposed as the promising discriminatory marker for discerning crude palm oil samples obtained from different regions. Stable isotopes profile was proven to be useful for origin traceability of crude palm oil samples at a narrower geographical area, i.e. based on regions in Malaysia. Predictive power and accuracy of the predictive model was expected to improve with the increase in sample size. Conclusively, the results in this study has fulfilled the main objective of this work where the simple approach of combining stable isotope analysis with chemometrics can be used to discriminate crude palm oil samples obtained from different regions in Malaysia. Overall, this study shows the feasibility of this approach to be used as a traceability assessment of crude palm oils. Copyright © 2017 The Chartered Society of Forensic Sciences. Published by Elsevier B.V. All rights reserved.

  17. Transition-region/Coronal Signatures and Magnetic Setting of Sunspot Penumbral Jets: Hinode (SOT/FG), Hi-C, and SDO/AIA Observations

    Science.gov (United States)

    Tiwari, Sanjiv K.; Moore, Ronald L.; Winebarger, Amy R.; Alpert, Shane E.

    2016-01-01

    Penumbral microjets (PJs) are transient narrow bright features in the chromosphere of sunspot penumbrae, first characterized by Katsukawa et al. using the Ca ii H-line filter on Hinode's Solar Optical Telescope (SOT). It was proposed that the PJs form as a result of reconnection between two magnetic components of penumbrae (spines and interspines), and that they could contribute to the transition region (TR) and coronal heating above sunspot penumbrae. We propose a modified picture of formation of PJs based on recent results on the internal structure of sunspot penumbral filaments. Using data of a sunspot from Hinode/SOT, High Resolution Coronal Imager, and different passbands of the Atmospheric Imaging Assembly (AIA) on board the Solar Dynamics Observatory, we examine whether PJs have signatures in the TR and corona. We find hardly any discernible signature of normal PJs in any AIA passbands, except for a few of them showing up in the 1600 Å images. However, we discovered exceptionally stronger jets with similar lifetimes but bigger sizes (up to 600 km wide) occurring repeatedly in a few locations in the penumbra, where evidence of patches of opposite-polarity fields in the tails of some penumbral filaments is seen in Stokes-V images. These tail PJs do display signatures in the TR. Whether they have any coronal-temperature plasma is unclear. We infer that none of the PJs, including the tail PJs, directly heat the corona in active regions significantly, but any penumbral jet might drive some coronal heating indirectly via the generation of Alfvén waves and/or braiding of the coronal field.

  18. Critical role of the isoform-specific region in alpha1-Na,K-ATPase trafficking and protein Kinase C-dependent regulation.

    Science.gov (United States)

    Sottejeau, Yoann; Belliard, Aude; Duran, Marie-Josée; Pressley, Thomas A; Pierre, Sandrine V

    2010-05-04

    The isoform-specific region (ISR) is a region of structural heterogeneity among the four isoforms of the catalytic alpha-subunit of the Na,K-ATPase and an important structural determinant for isoform-specific functions. In the present study, we examined the role of a potential dileucine clathrin adaptor recognition motif [DE]XXXL[LI] embedded within the alpha1-ISR. To this end, a rat alpha1 construct where leucine 499 was replaced by a valine (as found in the alpha2 isoform sequence) was compared to wild-type rat alpha1 after stable expression in opossum kidney cells. Total Na,K-ATPase expression, activity, or in situ (86)Rb(+) transport was not affected by the L499V mutation. However, surface Na,K-ATPase expression was nearly doubled. This increase was associated with a reduced rate of internalization from the cell surface of about 50% after a 4 h chase and became undetectable if clathrin-coated pit-mediated trafficking was blocked with chlorpromazine. Further, PKC-induced stimulation of Na,K-ATPase-mediated (86)Rb(+) uptake was doubled in mutant-expressing cells, comparable to the chimera containing the intact alpha2-ISR. Similar results were observed when the potential motif was disrupted by means of an E495S mutation. These findings suggest that a dileucine motif embedded within the Na,K-ATPase alpha1-ISR plays a critical role in the surface expression of Na,K-ATPase alpha1 polypeptides at steady state and in the response to PKC activation.

  19. The 14-3-3 protein interacts directly with the C-terminal region of the plant plasma membrane H(+)-ATPase

    DEFF Research Database (Denmark)

    Jahn, T.; Fuglsang, A.T.; Olsson, A.

    1997-01-01

    Accumulating evidence suggests that 14-3-3 proteins are involved in the regulation of plant plasma membrane H(+)-ATPase activity. However, it is not known whether the 14-3-3 protein interacts directly or indirectly with the H(+)-ATPase. In this study, detergent-solubilized plasma membrane H(+)-AT...... plasma membrane H(+)-ATPase. We propose that the 14-3-3 protein is a natural ligand of the plasma membrane H(+)-ATPase, regulating proton pumping by displacing the C-terminal autoinhibitory domain of the H(+)-ATPase....

  20. Systems biology analysis of hepatitis C virus infection reveals the role of copy number increases in regions of chromosome 1q in hepatocellular carcinoma metabolism

    DEFF Research Database (Denmark)

    Elsemman, Ibrahim; Mardinoglu, Adil; Shoaie, Saeed

    2016-01-01

    Hepatitis C virus (HCV) infection is a worldwide healthcare problem; however, traditional treatment methods have failed to cure all patients, and HCV has developed resistance to new drugs. Systems biology-based analyses could play an important role in the holistic analysis of the impact of HCV...... 1q, had increased copy numbers in the cancer samples relative to the normal samples. Finally, we confirmed our predictions with the results of metabolomics studies and proposed that inhibiting the identified targets has the potential to provide an effective treatment strategy for HCV...

  1. High-resolution crystal structure reveals a HEPN domain at the C-terminal region of S. cerevisiae RNA endonuclease Swt1

    Energy Technology Data Exchange (ETDEWEB)

    Peng, Shuxia, E-mail: pengsx@ihep.ac.cn; Zhou, Ke; Wang, Wenjia; Gao, Zengqiang; Dong, Yuhui; Liu, Quansheng

    2014-10-31

    Highlights: • Crystal structure of the C-terminal (CT) domain of Swt1 was determined at 2.3 Å. • Structure of the CT domain was identified as HEPN domain superfamily member. • Low-resolution envelope of Swt1 full-length in solution was analyzed by SAXS. • The middle and CT domains gave good fit to SAXS structural model. - Abstract: Swt1 is an RNA endonuclease that plays an important role in quality control of nuclear messenger ribonucleoprotein particles (mRNPs) in eukaryotes; however, its structural details remain to be elucidated. Here, we report the crystal structure of the C-terminal (CT) domain of Swt1 from Saccharomyces cerevisiae, which shares common characteristics of higher eukaryotes and prokaryotes nucleotide binding (HEPN) domain superfamily. To study in detail the full-length protein structure, we analyzed the low-resolution architecture of Swt1 in solution using small angle X-ray scattering (SAXS) method. Both the CT domain and middle domain exhibited a good fit upon superimposing onto the molecular envelope of Swt1. Our study provides the necessary structural information for detailed analysis of the functional role of Swt1, and its importance in the process of nuclear mRNP surveillance.

  2. An effective tool for identifying HIV-1 subtypes B, C, CRF01_AE, their recombinant forms, and dual infections in Southeast Asia by the multi-region subtype specific PCR (MSSP) assay.

    Science.gov (United States)

    Sakkhachornphop, Supachai; Kijak, Gustavo H; Beyrer, Chris; Razak, Myat Htoo; Sanders-Buell, Eric; Jittiwutikarn, Jaroon; Suriyanon, Vinai; Robb, Merlin L; Kim, Jerome H; Celentano, David D; McCutchan, Francine E; Tovanabutra, Sodsai

    2015-06-01

    The RV144 Thai vaccine trial has been the only vaccine study to show efficacy in preventing HIV infection. Ongoing molecular surveillance of HIV-1 in Southeast Asia is vital for vaccine development and evaluation. In this study a novel tool, the multi-region subtype specific PCR (MSSP) assay, that was able to identify subtypes B, C, CRF01_AE for Thailand, other Southeast Asian countries, India and China is described. The MSSP assay is based on a nested PCR strategy and amplifies eight short regions distributed along the HIV-1 genome using subtype-specific primers. A panel of 41 clinical DNA samples obtained primarily from opiate users in northern Thailand was used to test the assay performance. The MSSP assay provided 73-100% sensitivity and 100% specificity for the three subtypes in each genome region. The assay was then field-tested on 337 sera from HIV infected northern Thai drug users collected between 1999 and 2002. Subtype distribution was CRF01_AE 77.4% (n=261), subtype B 3.3% (n=11), CRF01_AE/B recombinant 12.2% (n=41), CRF01_AE/C recombinant 0.6% (n=2), and non-typeable 6.5% (n=22). The MSSP assay is a simple, cost-effective, and accurate genotyping tool for laboratory settings with limited resources and is sensitive enough to capture the recombinant genomes and dual infections. Copyright © 2015 Elsevier B.V. All rights reserved.

  3. SU-C-BRA-01: Interactive Auto-Segmentation for Bowel in Online Adaptive MRI-Guided Radiation Therapy by Using a Multi-Region Labeling Algorithm

    Energy Technology Data Exchange (ETDEWEB)

    Lu, Y; Chen, I; Kashani, R; Wan, H; Maughan, N; Muccigrosso, D; Parikh, P [Washington University School of Medicine, Saint Louis, MO (United States)

    2016-06-15

    Purpose: In MRI-guided online adaptive radiation therapy, re-contouring of bowel is time-consuming and can impact the overall time of patients on table. The study aims to auto-segment bowel on volumetric MR images by using an interactive multi-region labeling algorithm. Methods: 5 Patients with locally advanced pancreatic cancer underwent fractionated radiotherapy (18–25 fractions each, total 118 fractions) on an MRI-guided radiation therapy system with a 0.35 Tesla magnet and three Co-60 sources. At each fraction, a volumetric MR image of the patient was acquired when the patient was in the treatment position. An interactive two-dimensional multi-region labeling technique based on graph cut solver was applied on several typical MRI images to segment the large bowel and small bowel, followed by a shape based contour interpolation for generating entire bowel contours along all image slices. The resulted contours were compared with the physician’s manual contouring by using metrics of Dice coefficient and Hausdorff distance. Results: Image data sets from the first 5 fractions of each patient were selected (total of 25 image data sets) for the segmentation test. The algorithm segmented the large and small bowel effectively and efficiently. All bowel segments were successfully identified, auto-contoured and matched with manual contours. The time cost by the algorithm for each image slice was within 30 seconds. For large bowel, the calculated Dice coefficients and Hausdorff distances (mean±std) were 0.77±0.07 and 13.13±5.01mm, respectively; for small bowel, the corresponding metrics were 0.73±0.08and 14.15±4.72mm, respectively. Conclusion: The preliminary results demonstrated the potential of the proposed algorithm in auto-segmenting large and small bowel on low field MRI images in MRI-guided adaptive radiation therapy. Further work will be focused on improving its segmentation accuracy and lessening human interaction.

  4. Carotenoid composition and vitamin A value in ají (Capsicum baccatum L.) and rocoto (C. pubescens R. & P.), 2 pepper species from the Andean region.

    Science.gov (United States)

    Rodríguez-Burruezo, Adrián; González-Mas, Maria del Carmen; Nuez, Fernando

    2010-10-01

    The carotenoid patterns of fully ripe fruits from 12 Bolivian accessions of the Andean peppers Capsicum baccatum (ají) and C. pubescens (rocoto) were determined by high-performance liquid chromatography (HPLC)-photodiode array detector (PDA)-mass spectrometry (MS). We include 2 California Wonder cultivars as C. annuum controls. A total of 16 carotenoids were identified and differences among species were mostly found at the quantitative level. Among red-fruited genotypes, capsanthin was the main carotenoid in the 3 species (25% to 50% contribution to carotenoid fraction), although ajíes contained the lowest contribution of this carotenoid. In addition, the contribution of capsanthin 5,6-epoxide to total carotenoids in this species was high (11% to 27%) in comparison to rocotos and red C. annuum. Antheraxanthin and violaxanthin were, in general, the next most relevant carotenoids in the red Andean peppers (6.1% to 10.6%). Violaxanthin was the major carotenoid in yellow-/orange-fruited genotypes of the 3 species (37% to 68% total carotenoids), although yellow rocotos were characterized by lower levels (<45%). Cis-violaxanthin, antheraxanthin, and lutein were the next most relevant carotenoids in the yellow/orange Andean peppers (5% to 14%). As a whole, rocotos showed the highest contributions of provitamin A carotenoids to the carotenoid fraction. In terms of nutritional contribution, both ajíes and rocotos provide a remarkable provitamin A activity, with several accessions showing a content in retinol equivalents higher than California Wonder controls. Furthermore, levels of lutein in yellow/orange ajíes and rocotos were clearly higher than California Wonder pepper (≥1000 μg·100/g). Finally, the Andean peppers, particularly red ajíes, can be also considered as a noticeable source of capsanthin, the most powerful antioxidant compound among pepper carotenoids. Practical Application: Capsicum peppers are known for their content in carotenoids, although there is

  5. Correct usage of multiple transcription initiation sites and C/EBP-dependent transcription activation of the rat XDH/XO TATA-less promoter requires downstream elements located in the coding region of the gene.

    Science.gov (United States)

    Clark, M P; Chow, C W; Rinaldo, J E; Chalkley, R

    1998-04-01

    In the present study, we have shown that a downstream element located in the coding region of the TATA-less rat xanthine dehydrogenase/oxidase (XDH/XO) gene (-7 to +42) plays an important role in transcription initiation and C/EBP transcriptional activation. Previous work from our laboratory has shown that the promoter is organized with multiple initiator elements (Inr 1, 2, 3 and 4) which are important for transcription initiation. Additionally, we had identified two C/EBP binding sites upstream of this promoter. Deletional and mutational studies revealed that C/EBP binding was not essential for the basal level of transcriptional initation. However when XO-luciferase constructs include downstream sequence extending to +42 there is development of C/EBP sensitivity as well as a shift in the initiator usage. In the absence of the downstream element, primer extension analyses reveals Inr 3 and 4 to be the major start sites but in the presence of this additional sequence the usage is shifted to Inr 1 and 2. This shift in Inr usage more closely resembles that seen in intact macrophages or liver cells. Gel mobility shift assays indicate the presence of several binding factors located in this downstream region, one of which has been identified as YY-1. We postulate that YY-1 allows DNA bending which permits the upstream C/EBP elements to exhibit a transcriptional activation which is not seen when the downstream element is absent. This study presents a potential model for regulation of the XDH/XO promoter.

  6. Impacts of projected maximum temperature extremes for C21 by an ensemble of regional climate models on cereal cropping systems in the Iberian Peninsula

    Directory of Open Access Journals (Sweden)

    M. Ruiz-Ramos

    2011-12-01

    Full Text Available Crops growing in the Iberian Peninsula may be subjected to damagingly high temperatures during the sensitive development periods of flowering and grain filling. Such episodes are considered important hazards and farmers may take insurance to offset their impact. Increases in value and frequency of maximum temperature have been observed in the Iberian Peninsula during the 20th century, and studies on climate change indicate the possibility of further increase by the end of the 21st century. Here, impacts of current and future high temperatures on cereal cropping systems of the Iberian Peninsula are evaluated, focusing on vulnerable development periods of winter and summer crops. Climate change scenarios obtained from an ensemble of ten Regional Climate Models (multimodel ensemble combined with crop simulation models were used for this purpose and related uncertainty was estimated. Results reveal that higher extremes of maximum temperature represent a threat to summer-grown but not to winter-grown crops in the Iberian Peninsula. The study highlights the different vulnerability of crops in the two growing seasons and the need to account for changes in extreme temperatures in developing adaptations in cereal cropping systems. Finally, this work contributes to clarifying the causes of high-uncertainty impact projections from previous studies.

  7. STUDY ON THE NOROVIRUS PRESENCE IN MYTILUS GALLOPROVINCIALIS SUBJECTED TO DEPURATION IN TWO C.D.Ms. IN THE SARDINIA REGION

    Directory of Open Access Journals (Sweden)

    R. Bazzardi

    2012-08-01

    Full Text Available Noroviruses (NoVs, known as Norwalk-Like Viruses (NLV or Small-Round-Structured-Viruses (SRVS, are among the most frequent causes of acute viral gastroenteritis in human beings, often associated with food poisoning, if raw or poorly cooked bivalve molluscs (mussels, clams and oysters are ingested. In compliance with EU regulations, the safety of these products is evaluated according to bacteriological paramenters (Salmonella and E.coli as provided for by Regulation (EC No. 2073/2005, biotoxicological parameters, as provided for by Regulation (EC No. 853/2004, and chemical parameters, as provided for by Regulation (EC No. 1881/06. This essay focuses on the evaluation of NoV concentration levels in Mytilus galloprovincialis populations, farmed in 2009 in two different Mussels Depuration Centers (CDMs in Sardinia (Italy. During the assessment procedures, Noroviruses were detected for the first time on the regional territory with one-step TaqMan real-time RT-PCR.

  8. Variability of 14C reservoir age and air-sea flux of CO2 in the Peru-Chile upwelling region during the past 12,000 years

    Science.gov (United States)

    Carré, Matthieu; Jackson, Donald; Maldonado, Antonio; Chase, Brian M.; Sachs, Julian P.

    2016-01-01

    The variability of radiocarbon marine reservoir age through time and space limits the accuracy of chronologies in marine paleo-environmental archives. We report here new radiocarbon reservoir ages (ΔR) from the central coast of Chile ( 32°S) for the Holocene period and compare these values to existing reservoir age reconstructions from southern Peru and northern Chile. Late Holocene ΔR values show little variability from central Chile to Peru. Prior to 6000 cal yr BP, however, ΔR values were markedly increased in southern Peru and northern Chile, while similar or slightly lower-than-modern ΔR values were observed in central Chile. This extended dataset suggests that the early Holocene was characterized by a substantial increase in the latitudinal gradient of marine reservoir age between central and northern Chile. This change in the marine reservoir ages indicates that the early Holocene air-sea flux of CO2 could have been up to five times more intense than in the late Holocene in the Peruvian upwelling, while slightly reduced in central Chile. Our results show that oceanic circulation changes in the Humboldt system during the Holocene have substantially modified the air-sea carbon flux in this region.

  9. Recombinant mapping of the familial hyperinsulinism gene to an 0.8 cM region on chromosome 11p15.1 and demonstration of a founder effect in Ashkenazi Jews.

    Science.gov (United States)

    Glaser, B; Chiu, K C; Liu, L; Anker, R; Nestorowicz, A; Cox, N J; Landau, H; Kaiser, N; Thornton, P S; Stanley, C A

    1995-05-01

    A gene for autosomal recessive familial hyperinsulinism (HI) (OMIM: 256450), a neonatal metabolic disease characterized by inappropriate insulin secretion in the presence of severe hypoglycemia, was recently mapped to a 6.6 cM interval between the markers D11S926 and D11S928 on chromosome 11p in 15 families (1). In the current study we evaluated six additional families and five new markers, and further localized the gene between D11S419 and D11S1310. Using genotype data from CEPH Version 7 and data generated from this study, this region was estimated to be 0.8 cM in length. Significant linkage disequilibrium between markers and the HI gene was observed over a region of 10.3 cM (11 pter-D11S926-D11S1308-11pcen) for Ashkenazi Jewish chromosomes. Haplotype analysis showed that 12 of 36 HI chromosomes, versus one of 36 non-HI chromosomes, bore a specific haplotype for D11S419-D11S902-D11S921 (p < 0.0007), strongly suggesting a founder effect in this ethnic group.

  10. Stability, orientation and position preference of the stem region (residues 689-703 in Hepatitis C Virus (HCV envelope glycoprotein E2: a molecular dynamics study [v2; ref status: indexed, http://f1000r.es/14q

    Directory of Open Access Journals (Sweden)

    Rahmad Akbar

    2013-07-01

    Full Text Available Envelope glycoproteins of Hepatitis C Virus (HCV play an important role in the virus assembly and initial entry into host cells. Conserved charged residues of the E2 transmembrane (TM domain were shown to be responsible for the heterodimerization with envelope glycoprotein E1. Despite intensive research on both envelope glycoproteins, the structural information is still not fully understood. Recent findings have revealed that the stem (ST region of E2 also functions in the initial stage of the viral life cycle. We have previously shown the effect of the conserved charged residues on the TM helix monomer of E2. Here, we extended the model of the TM domain by adding the adjacent ST segment. Explicit molecular dynamics simulations were performed for the E2 amphiphilic segment of the ST region connected to the putative TM domain (residues 683-746. Structural conformation and behavior are studied and compared with the nuclear magnetic resonance (NMR-derived segment of E2 (2KQZ.pdb. We observed that the central helix of the ST region (residues 689 - 703 remained stable as a helix in-plane to the lipid bilayer. Furthermore, the TM domain appeared to provide minimal contribution to the structural stability of the amphipathic region. This study also provides insight into the orientation and positional preferences of the ST segment with respect to the membrane lipid-water interface.

  11. High level of HIV-2 false positivity in KwaZulu-Natal province: a region of South Africa with a very high HIV-1 subtype C prevalence.

    Science.gov (United States)

    Singh, Lavanya; Parboosing, Raveen; Manasa, Justen; Moodley, Pravi; de Oliveira, Tulio

    2013-12-01

    Human immunodeficiency virus 2 (HIV-2) is found predominantly in West Africa. It is not unlikely, however, that HIV-2 may also be found in South Africa, due to the influx of immigrants into this country. It is important to distinguish between HIV-1 and HIV-2 since the clinical courses and treatment responses of these viruses are different. Routine serological methods for diagnosing HIV do not differentiate between HIV-1 and -2 infections, while rapid tests, viral load quantification and PCR are HIV-type--specific. The objective of this study was to describe the seroprevalence and molecular epidemiology of HIV-2 in KwaZulu-Natal, one of the regions with the highest HIV prevalence in the world and home of the two largest harbors in South Africa. HIV-1 positive samples were screened for antibodies against HIV-2, using a rapid test. The confirmation of HIV-2 positive samples was done by PCR. Of the 2,123 samples screened, 319 (15%) were identified as positive by the rapid test. None of these samples were confirmed positive by PCR. To explore this discrepancy in the results, a subset (n = 52) of the rapid HIV-2 positive samples was subjected to Western blotting. Thirty-seven (71%) of these were positive, yielding an overall HIV-2 seroprevalence of 10.6%. Three out of 28 (10.7%) Western blot positive samples were positive by a Pepti-LAV assay. This discrepancy between serological and molecular confirmation may be attributed to non-specific or cross-reacting antibodies. The use of rapid tests and Western blots for HIV-2 diagnosis in South Africa should be interpreted with caution. © 2013 Wiley Periodicals, Inc.

  12. Granuloma reparativo de células gigantes agresivo en región mandibular Aggressive giant cells reparative granulomas in mandibular region

    Directory of Open Access Journals (Sweden)

    Ernesto Sánchez Cabrales

    2010-06-01

    Full Text Available El granuloma reparativo de células gigantes (GRCG es un proceso reactivo agresivo, que aparece con mayor frecuencia en los sectores anteriores de la mandíbula y el maxilar, en niños y adolecentes jóvenes. Constituye el 1 % de las lesiones óseas tumorales. Existe una considerable controversia acerca de si son lesiones benignas o reactivas; también desde el punto de vista de su origen, de sus características clínicas e histológicas, así como su terapéutica. En octubre de 2007 acudió un caso a consulta externa de Cirugía Maxilofacial del Hospital