WorldWideScience

Sample records for byg statens byggeforskningsinstitut

  1. A COMPARATIVE STUDY OF BYG SEARCH ENGINES

    Directory of Open Access Journals (Sweden)

    Kailash Kumar

    2013-01-01

    Full Text Available This paper compares the retrieval effectiveness of the Bing, Yahoo and Google (BYG Search Engines. The precision and relative recall of each search engine was considered for evaluating the effectiveness of the search engines. General Queries were tested. Results of the study showed that the precision of Google was high as compared to other two search engines and Yahoo has better precision than Bing

  2. NanoByg - a survey of nanoinnovation in Danish construction

    DEFF Research Database (Denmark)

    Andersen, Maj Munch; Molin, Måns J.

    NanoByg is a pre-project funded by the private strategic foundation Realdania running in the period November 2006 until March 2007. The pre-project looks into the perspectives and potentials of nanotechnology in Danish construction. The purpose is to establish a basis for discussion on a potential...... initiative within nanoconstruction (termed NanoByg), with RealDania as well as varies ministries and other funding agents.. The pre-project also seeks to establish knowledge of and links between the nano science community and the construction industry to facilitate future cooperation between these areas....

  3. Statens nye tilstedeværelse?

    DEFF Research Database (Denmark)

    Rasmussen, Mattias Borg

    2014-01-01

    staten anses som værende socialt. Ved at undersøge, hvordan møderne mellem staten og borgerne udspiller sig vises det, hvordan folk fra landområderne forsøger at møde staten som en særlig social form. Det fremhæves her, hvordan magten i landområderne traditionelt har været indlejret i sociale forhold, og...

  4. Case03: BIM hos driftsherre og byg- og driftsherrerådgiver

    DEFF Research Database (Denmark)

    Vestergaard, Flemming; Karlshøj, Jan; Hauch, Peter;

    Casen repræsenterer et koncept, hvor både byg- og driftsherren og en byg- og driftsherrerådgiver er aktive i anvendelsen af en BIM-orienteret arbejdsmetode og modelbaserede værktøjer, som omfatter følgende aktiviteter: Design, Projektering, Udbud/tilbud, produktionsforberedelse, Udførelse og Drift...

  5. Statens blik – blikket på staten

    DEFF Research Database (Denmark)

    Ivarsson, Søren; Rud, Søren

    2016-01-01

    aspekter af disse fænomeners komplekse natur. I det følgende indkredser vi Scotts statsforståelse gennem en præsentation af Scotts analyser i de tre bøger Seeing Like a State, The Moral Economy of the Peasant og The Art of Not Being Governed. Derefter kontekstualiserer og problematiserer vi Scotts...... bedre verden til tider er endt i fiasko. Imidlertid rejser en nærlæsning af Scotts argumenter en række spørgsmål om karakteren af den stat, som på mange måder er udgangspunktet for hans undersøgelse. Vi tænker her dels på, at staten, i Scotts optik, optræder som en monolit, der af natur er repressiv og...... udbyttende. Dels på hvordan stat og samfund fremstår som enheder, der helt uproblematisk kan adskilles. På den ene side gør Scotts essentialisering af statens natur, og hans dikotomiske opfattelse af stat-samfund, det muligt at rette en helt fundamental og ofte vedkommende kritik af statslige projekter. På...

  6. Evaluation of the BYG Carba Test, a New Electrochemical Assay for Rapid Laboratory Detection of Carbapenemase-Producing Enterobacteriaceae.

    Science.gov (United States)

    Bogaerts, Pierre; Yunus, Sami; Massart, Marion; Huang, Te-Din; Glupczynski, Youri

    2016-02-01

    Accurate detection of carbapenemase-producing Enterobacteriaceae (CPE) constitutes a major laboratory diagnostic challenge. We evaluated an electrochemical technique (the BYG Carba test) which allows detection of CPE in less than 35 min. The BYG Carba test was first validated in triplicate against 57 collection isolates with previously characterized β-lactam resistance mechanisms (OXA-48, n = 12; KPC, n = 8; NDM, n = 8; VIM, n = 8; IMP, n = 3; GIM, n = 1; GES-6, n = 1; no carbapenemase, n = 16) and against a panel of 10 isolates obtained from the United Kingdom National External Quality Assessment Service (NEQAS). The test was then evaluated prospectively against 324 isolates referred to the national reference center for suspicion of CPE. The BYG Carba test results were compared with those obtained with the Carba NP test using multiplex PCR sequencing as the gold standard. Of the 57 collection and the 10 NEQAS isolates, all but one GES-6-producing isolate were correctly identified by the Carba BYG test. Among the 324 consecutive Enterobacteriaceae isolates tested prospectively, 146 were confirmed as noncarbapenemase producers by PCR while 178 harbored a carbapenemase gene (OXA-48, n = 117; KPC, n = 25; NDM, n = 23; and VIM, n = 13). Prospectively, in comparison with PCR results, the BYG Carba test displayed 95% sensitivity and 100% specificity versus 89% and 100%, respectively, for the Carba NP test. The BYG Carba test is a novel, rapid, and efficient assay based on an electro-active polymer biosensing technology discriminating between CPE and non-CPE. The precise electrochemical signal (electrochemical impedance variations) allows the establishment of real-time objective measurement and interpretation criteria which should facilitate the accreditation process of this technology.

  7. Actuele veranderingen in het recreatiebeleid in de Verenigde Staten

    NARCIS (Netherlands)

    Beckers, Th.A.M.

    1982-01-01

    Afgelopen najaar bracht de auteur een studiebezoek aan de Verenigde Staten van Amerika. Drie zaken hadden daarbij zijn speciale aandacht: de inhoud en organisatie van het recreatieonderwijs, de stand van zaken en ontwikkelingen in het recreatie-onderzoek en actuele veranderingen in het recreatiebele

  8. Alternativ isolering i bygninger

    DEFF Research Database (Denmark)

    Hansen, Ernst Jan de Place

    2001-01-01

    Resume af rapport om målinger på alternative isoleringsmaterialer i bygninger, udgivet af Statens Byggeforskningsinstitut (SBI meddelelse 128) under Energistyrelsens udviklingsprogram "Miljø- og arbejdsmiljøvenlig isolering"...

  9. Serologic evidence for West Nile virus infection in birds in Staten Island, New York, after an outbreak in 2000.

    Science.gov (United States)

    Komar, N; Burns, J; Dean, C; Panella, N A; Dusza, S; Cherry, B

    2001-01-01

    After an outbreak of West Nile virus (WNV) infections in people, horses, and wildlife in Staten Island, NY, during the summer of 2000, we surveyed the bird population of the island for evidence of infection. Neutralizing antibodies were detected in 59 of 257 (23.0%) resident birds and none of 96 transient (migrating) birds sampled in early October. Species with the greatest seroprevalence were northern cardinal (Cardinalis cardinalis) (69.2%) and rock dove (Columba livia) (54.5%). House sparrows (Passer domesticus) and chickens (Gallus gallus) had lower than expected seroprevalences, 8.6% and 5.5%, respectively. The geographic distribution of seropositivity suggested focal transmission at several locations on the island. The concentration of seropositive birds among resident bird populations on Staten Island supports the concept that many birds survive WNV infection and that some of these play an important role in the WNV-bird-mosquito transmission cycle.

  10. Statens helseundersøkelser: Fra tuberkulosekamp til mangesidig epidemiologisk virksomhet

    Directory of Open Access Journals (Sweden)

    Kjell Bjartveit

    2009-10-01

    Full Text Available  SAMMENDRAGI 1940 ble skjermbildefotografering tatt i bruk i tuberkulosearbeidet. Statens skjermbildefotografering bleopprettet i 1943 for at dette helsetilbudet kunne nå frem til alle. Fra 1952 var virksomheten landsdekkende.Screeningen ble utført av team som besøkte alle kommuner med buss eller båt. Resultatene ble meddelt den lokalehelsetjeneste, som tok seg av oppfølgingen.I 1962 ble Det sentrale tuberkuloseregister opprettet. Fra 1969 ble totalundersøkelsene gradvis avløst av selektivetuberkuloseundersøkelser. Risiko ble beregnet på grunnlag av resultater fra tidligere masseundersøkelser, ogbare personer med relativt høy risiko ble innbudt.På 1950-60-tallet ble undersøkelsene utvidet med enkelte større epidemiologiske prosjekter. I 1970-80-åreneble det gjennomført omfattende kartlegginger av risikofaktorer for hjerte-karsykdom i tre fylker, og i 1985 startetdet såkalte 40-åringsprogrammet, som fra 1993 er landsomfattende. Alle kommuner besøkes med tre års intervall.Ved hver runde innbys alle personer 40-42 år til undersøkelse mhp. kardiovaskulær risiko. Undersøkelsene er entotalpakke som omfatter overvåking, forskning, undervisning og forebygging ved masse- og høyrisikostrategi.I 1986 ble navnet endret til Statens helseundersøkelser. Institusjonen er i dag engasjert i mangesidig virksomhetinnenfor forebygging og epidemiologi. Epidemiologisk forskning, rådgivning og helseopplysning spiller ensentral rolle. Opp gjennom årene er det samlet en unik datakilde som burde ha vært utnyttet mer inngående.Bjartveit K. The National Health Screening Service: From fight against tuberculosis to many-sidedepidemiological activities. Nor J Epidemiol 1997; 7 (2: 157-174. ENGLISH SUMMARYFrom 1940 miniature chest X-ray screening was used in tuberculosis work. In 1943 the National Mass RadiographyService was established so that this health measure could be offered everyone. From 1952 onwards thisservice covered the entire

  11. Byg det op”

    DEFF Research Database (Denmark)

    Falkenberg, Helene; Juelskjær, Malou

    2015-01-01

    læringsledelsen spatialiseres i en specifik udgave – den parkouriseres. Med parkouriseringen ’hacker’ læringsledelsen sig ind på et fænomen (parkour), som ikke har noget med skole at gøre. Denne indirekte form at fremme læring på, er et sindebillede på en ledelsestendens – også i en reformtid, og derfor en...

  12. Notes from the Field: Thyrotoxicosis After Consumption of Dietary Supplements Purchased Through the Internet--Staten Island, New York, 2015.

    Science.gov (United States)

    Regina, Angela; Majlesi, Nima

    2016-04-08

    On June 18, 2015, a woman aged 30 years was brought to the Staten Island University Hospital Emergency Department (ED) in New York by her mother, who reported that the patient had become acutely confused at home, was repeating herself, and did not recognize her family members. She had a diagnosis of bipolar disorder for which she took lithium, and she had a history notable for polysubstance abuse (use of three or more addictive drugs in the past 12 months). Her other medications included risperidone (an antipsychotic), benztropine (an anticholinergic), and bupropion (an antidepressant). ED staff members learned from the patient's mother that the patient had started taking "diet pills" that contained a thyroid hormone, which the patient had purchased through the Internet 2 weeks earlier. The patient volunteered that she had doubled the dosage 1 week earlier, in an attempt to lose more weight.

  13. Lung cancer trends: smoking, obesity, and sex assessed in the Staten Island University’s lung cancer patients

    Directory of Open Access Journals (Sweden)

    Gupta S

    2014-07-01

    Full Text Available Shilpi Gupta,1 Samer Hassan,1 Vijaya R Bhatt,2 Houssein Abdul Sater,1 Asma Dilawari31Hematology-Oncology, Staten Island University Hospital, Staten Island, NY, USA; 2Hematology-Oncology, Nebraska Medical Ctr, Omaha, NE, USA; 3Hematology-Oncology, MedStar Georgetown University Hospital, Olney, Maryland, USAIntroduction: The incidence of lung cancer in the United States decreased by 1.8% from 1991 to 2005 while it increased by 0.5% in females. We assessed whether nonsmokers afflicted with lung cancer at Staten Island University Hospital are disproportionately female in comparison to national averages. We also evaluated different factors including race, histology, and body mass index (BMI in correlation with smoking history.Methods: A retrospective chart review was conducted from 2005 to 2011 on 857 patients. Patients were divided into two groups according to their smoking status: current or ever-smokers, and former or never-smokers. A chi-square test for categorical data and multivariate logistic regression analyses was used to study the relation between BMI and the other clinical and demographic data.Results: Forty-nine percent of patients were men and 51% were women with a mean age at diagnosis of 67.8 years. Current smokers were most common (50.2% followed by ever-smokers (18.2%, former smokers (15.8% and never-smokers (15.6%. Forty eight percent had stage IV lung cancer upon presentation. Never-smokers with lung cancer were 24 times more likely to be females. However, the proportion of female former smokers (31.6% was lower than the proportion of male former smokers (68.4% (P=0.001. There was no significant association between American Joint Committee on Cancer (AJCC stage, sex, race, and histological type in the two smoking groups. Current/ever-smokers tended to be younger at age of diagnosis (P=0.0003. BMI was lower in the current/ever-smokers (26.8 kg/m2 versus former/never-smokers (28.8 in males (P=0.0005. BMI was significantly higher in

  14. Phytoplankton and other data from net and bottle casts from the USCGC STATEN ISLAND as part of Outer Continental Shelf Environmental Assessment Program (OCSEAP) from 07 August 1974 to 15 August 1974 (NODC Accession 8000564)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Phytoplankton and other data were collected from net and bottle casts from the USCGC STATEN ISLAND from 07 August 1974 to 15 August 1974. Data were collected by the...

  15. Bygningsakustik 1

    DEFF Research Database (Denmark)

    Petersen, J.

    Med denne anvisning om bygningsakustik er forsøgsvis indledt et samarbejde mellem Kunstakademiets Arkitektskole og Statens Byggeforskningsinstitut om udsendelse af publikationer til brug for undervisningen af arkitektstuderende. Selvom anvisningen således er begrænset i sit hovedsigte, er det udg...

  16. Hjemløshed i Grønland

    DEFF Research Database (Denmark)

    Hansen, Knud Erik; Andersen, Hans Thor

    Justitsvæsen, Grønlands Selvstyre og Statens Byggeforskningsinstitut. Forskningsprojektet, der ligger bag rapporten, er finansieret af Selvstyret. English The report provides a description of the nature of homelessness in Greenland. It describes the situation of three forms of homelessness in Greenland, how...

  17. Trin på vej mod år 2018?

    DEFF Research Database (Denmark)

    Schjerup Hansen, J.; Hansen, K.E.; Kristensen, H.;

    Statens Byggeforskningsinstitut har i foråret 1996 for Miljø- og Energiministeriets landsplanafdeling evalueret eksempelprojekterne fra Landsplanredegørelsen 1992. I alt 11 eksempelprojekter blev iværksat 14 forskellige steder i landet i 1993/94, og det er forløbet og resultaterne af disse projek...

  18. Clean energy and sustainable building in the west of the USA; Schone energie en duurzaam bouwen in het westen van de Verenigde Staten

    Energy Technology Data Exchange (ETDEWEB)

    Van den Heuvel, J. [TWA Netwerk, San Francisco (United States)

    2012-01-15

    In preparation of an upcoming public-private partnership in the field of clean energy and sustainable building, a team of the Consulate General of San Francisco made several exploratory visits to stakeholders in the west of the United States. This article reports on a number of findings [Dutch] In voorbereiding op een aanstaande privaat-publieke samenwerking op het vlak van schone energie en duurzaam bouwen bracht een team van het Consulaat Generaal van San Francisco in de afgelopen maanden verkennende bezoeken aan belangwekkende partijen in het westen van de Verenigde Staten. In dit artikel wordt een aantal bevindingen daarvan nader uitgelicht.

  19. Quentin Skinner, Staten og friheten. Oslo: Res Publica, 2011. José Luis Martí and Philip Pettit, A Political Philosophy in Public Life. Civic Republicanism in Zapatero's Spain. Princeton: Princeton University Press, 2010 (Simon Laumann Jørgensen)

    DEFF Research Database (Denmark)

    Jørgensen, Simon Laumann

    2012-01-01

    Anmeldelse af Quentin Skinner, Staten og friheten, Oslo: Res Publica 2011, 199 NOK & José Luis Martí & Philip Pettit, A Political Philosophy in Public Life. Civic Republicanism in Zapatero’s Spain, Princeton: Princeton University Press 2010, $ 24.95......Anmeldelse af Quentin Skinner, Staten og friheten, Oslo: Res Publica 2011, 199 NOK & José Luis Martí & Philip Pettit, A Political Philosophy in Public Life. Civic Republicanism in Zapatero’s Spain, Princeton: Princeton University Press 2010, $ 24.95...

  20. [Johan Engström. Revals Befästningsdhistoria sedd utifrån en maquett från 1682. Statens försvarshistoriska museer 2011. Skrift nr 17. ] / Ragnar Nurk, Robert Treufeld

    Index Scriptorium Estoniae

    Nurk, Ragnar

    2014-01-01

    Arvustus: Johan Engström. Revals Befästningsdhistoria sedd utifrån en maquett från 1682. Statens försvarshistoriska museer 2011. Skrift nr 17. 2011. Rootsi-aegsestest kindlustustest. Hilisema perioodi kindlustustest

  1. Byg og hold bøtte!

    DEFF Research Database (Denmark)

    Munch, Anders V.

    2009-01-01

    Anmeldelse af en bog, der gennemgår forskellige receptioner af Ludwig Mies van der Rohes arkitektur ud fra forskellige filosofiske og kulturkritiske vinkler. Bogen har som særlig dagsorden af genoverveje den kritiske teoris status på feltet mellem arkitektur og kulturkritik og følger de rene...

  2. USA and European Union. Loyal allies? A new episode in energy diplomacy; Verenigde Staten en Europese Unie. Trouwe bondgenoten? Nieuwe episode in energiediplomatie

    Energy Technology Data Exchange (ETDEWEB)

    Van der Linde, C.; Hoogeveen, F.

    2005-07-15

    The authors focus on a new chapter in energy diplomacy of the United States and the European Union. They deal with various relevant causes of the structural change in global petrol and gas markets in the context of Transatlantic relations. Their key question is whether efforts at improving energy security will help maintain the Transatlantic relationship or rather act as divisive element. [Dutch] De auteurs richten zich op een nieuw hoofdstuk in de energie-diplomatie van de Verenigde Staten en de Europese Unie. Zij bespreken diverse relevante oorzaken van de structurele veranderingen in de wereldwijde benzine-en gasmarkten in het kader van de transatlantische betrekkingen. Hun belangrijkste vraag is of de inspanningen ter verbetering van de energie zekerheid de trans-Atlantische relatie zal helpen onderhouden van als splijtzwam zal fungeren.

  3. Primary productivity and other data from bottle casts from the USCGC STATEN ISLAND and other platforms in the North Pacific Ocean in support of the Outer Continental Shelf Environmental Assessment Program (OCSEAP) from 07 August 1974 to 06 May 1979 (NODC Accession 8000599)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Primary productivity and other data were collected from bottle casts from the USCGC STATEN ISLAND and other platforms in the North Pacific Ocean from 07 August 1974...

  4. Staten har inddraget universiteternes frihed

    DEFF Research Database (Denmark)

    Ingemann, Jan Holm; Christensen, Jens; Madsen, Mogens Ove

    2007-01-01

    I kronikken analyseres den seneste universitetsreform i et historisk perspektiv og i relation til universiteternes principielle rolle. Det konkluderes bl.a., at den klassiske kontrakt om afstand mellem statsmagt og universitet nu de facto er opsagt af den danske stat og frihedslogikken af styring...

  5. Staten, folkekirken og dansk sekularisme

    DEFF Research Database (Denmark)

    Dabelsteen, Hans Boas

    2012-01-01

    Dette kapitel bringer et forsøg på at begrebsliggøre grænsedragningen mellem religion og politik, med det formål at tydeliggøre de værdier, rationaler og magtformer, der ligger i dansk kirke- og religionspolitik. Hovedargumentet er, at politisk diskussion blandt ledende politikere ikke tager udga...

  6. Direct claims of third parties on participants in an upstream joint venture. A few significant differences between the Netherlands, England and the USA; Directe aanspraken van derden op de deelnemers in een upstream joint venture. Enkele significante verschillen tussen Nederland, Engeland en de Verenigde Staten

    Energy Technology Data Exchange (ETDEWEB)

    Otterbeek, D.M.J.M. [Upstream International Commercial/NBD, Shell International, Den Haag (Netherlands); Joosten, J.J.H. [Hughes and Hubbard and Reed LLP, New York (United States)

    2011-08-15

    This article compares the civil liability of non operators in an upstream joint venture towards third parties in the Netherlands, England and the United States, based on either an agreement or on an unlawful action. A contemporary example of a situation in which this issue occurs is the Macondo/Deepwater Horizon incident. The conclusion is that the outlines of Dutch law and American law can lead to similar results, whereas English law deviates significantly. [Dutch] Dit artikel vergelijkt de civielrechtelijke aansprakelijkheid van non-operators in een upstream joint venture jegens derden in Nederland, Engeland en de Verenigde Staten op grond van hetzij een overeenkomst hetzij een onrechtmatige daad. Een actueel voorbeeld van een situatie waarin deze vraag zich voordoet is het Macondo/Deepwater Horizon incident. De conclusie luidt dat Nederlands recht en Amerikaans recht in grote lijnen tot vergelijkbare uitkomsten kunnen leiden, terwijl Engels recht daar significant van afwijkt.

  7. Arkitektur og energi

    DEFF Research Database (Denmark)

    Marsh, Rob; Grupe Larsen, Vibeke; Lauring, Michael;

    Sigtet med denne bog er at belyse samspillet mellem arkitektur og energi i et helhedsperspektiv med afsæt i de nye energibestemmelser for nybyggeri. Samspillet belyses gennem fire samordnede temaer: Dagslys. Samspillet mellem dagslys og arkitektur. Solvarme. Samspillet mellem solvarme og energi....... Råhus. Samspillet mellem materialer og energi. Teknik. Samspillet mellem teknologi og energi. Temaerne præsenteres på en let tilgængelig og grafisk inspirerende måde, så fremtidens lavenergiarkitektur kan udformes på kvalificeret, afvejet og effektiv vis. Bogen henvender sig primært til arkitekter, men...... kan også læses af ingeniører, bygherrer, myndigheder, studerende og andre der interesserer sig for byggeriets energiforhold. Bogens udgivelse er blevet støttet af Dansk Energi-Net's PSO-midler for 2005. Bogen udgives af Statens Byggeforskningsinstitut i samarbejde med Akademisk Arkitektforening....

  8. Private følgeinvesteringer ved områdefornyelse

    DEFF Research Database (Denmark)

    Jensen, Jesper Ole

    Det er en god forretning, når stat og kommuner investerer i områdefornyelse i udsatte områder. Det motiverer også de private bygningsejere i området til at investere i forbedringer af deres ejendomme. Det viser en undersøgelse fra Statens Byggeforskningsinstitut ved Aalborg Universitet København......, der er udarbejdet for Ministeriet for By, Bolig og Landdistrikter. Denne pjece opsamler resultaterne fra undersøgelsen og viser eksempler på private investeringer som følge af områdefornyelse. Pjecen retter sig særligt mod kommunale byplanlæggere og indeholder også en række mulige emner, der kan indgå...

  9. ZeroWaste BYG: Redesigning construction materials towards zero waste society

    DEFF Research Database (Denmark)

    Kirkelund, Gunvor Marie; Schmidt, Jacob Wittrup; Ottosen, Lisbeth M.

    2014-01-01

    to change the status of different ashes from waste to raw material and that export for disposal will be no longer be allowed. We wish to influence the consequences from this new situation. In principle some of the ashes can be used already, but the huge variation in ash characteristics and lack of knowledge...

  10. Folkekirkens økonomi og staten - et historisk rids

    DEFF Research Database (Denmark)

    Møller, Jes Fabricius

    2006-01-01

    I.C. Christensens reform af kirken 1903-22 var især en omlægning af folkekirkens økonomi fra en feudal struktur baseret på landbrugsjord til en moderne økonomi baseret på beskatning af indkomst. Selvom det indebar de facto konfiskation af kirkelig ejendom, har det reddet folkekirkens økonomi....

  11. RUSSIANS AS STATE-NATION: PROBLEMS, DETAILS, RESULTS

    Directory of Open Access Journals (Sweden)

    Nikolai F. Bugay

    2016-01-01

    Full Text Available Offered to the reader the article is rather a response to the outcome of the July 2016 forum of public associations of the Republic of Adygea, neighboring countries, the country's center, as well as representatives of scientists, politicians. The main issue was the recognition and giving the Russian people in Russia, his undisputed status as the state forming the community, who are building an alliance of nations and considered it his main task at many stages of development of Russian statehood.Participants of the forum based on their understanding of the problem, however, is based, naturally, on the terms and conclusions of the President of Russia VV article Putin, published by him in January 2012. According to the speakers, the federal authorities aimed to solve the problems the scope of national public policy, is not sufficient to decide whether, or simply do not show attention to him. Stage by stage carried out a kind of "zabaltyvanie" such a complex and fundamental issue, which is an alternative society, is not. It should be solved at all levels of government and society, and the position on the status of the Russian people, as a state-forming must be recorded in the Basic Law of the state - the Russian Federation Constitution.This article attempts to examine the understanding and perception of this problem in the multi-ethnic Russian community, its development, the first interim results.Named and the results of the forum in the Republic of Adygea, which indicates a high assessment of the role of the Russian people, which flows around the process of uniting the other peoples of Russia, including the peoples of the Caucasus. Attention is paid to the role and place of such spheres of life as a community of nations in economic development, in the dialogue of cultures, the estimation of the value of the measures carried out in the first place to consolidate the country's people, their progressive development. Sounds also call for the active work of ethnic communities joining efforts in solving disputes, to create conditions for easy sharing peoples' and their spiritual development. 

  12. De Verenigde Staten van Midden-Amerika? De lezingen

    NARCIS (Netherlands)

    Weerdenburg, J.; Zantwijk, R.A.M. van; Ridder, R. de; Carrière, J.A.; Fitz-Gerald, E.W.K.; Zwinkels, M.; Ooyens, J.; Spijkers, P.; Coolen, C.; Geldermalsen, I.H. van; Buuren, E.M.H. van

    1988-01-01

    In de maanden februari/maart 1988 organiseerde Bureau Studium Generale een lezingen- en discussie-programma over Midden-Amerika. Een van de centrale vragen in dit programma was die naar de eigen Midden-amerikaanse identiteit. In de lezingen, waarvan deze bundel verslag doet, is vanuit vele invalshoe

  13. Modernisering og læring i staten

    DEFF Research Database (Denmark)

    Andersen, Anders Siig; Andersen, Vibeke; Gleerup, Janne

    Bogen sætter fokus på læringsmiljøer på statslige arbejdspladser og den betydning de har for medarbejde med en længerevarende uddannelse. Etienne Wengers sociale læringsteori danner udgangspunkt for analyser af forandrings- og læreprocesser på fire statslige arbejdspladser: En styrelse, HTX, en...

  14. Het verantwoorde verschil. Intelligentiemeting in de Verenigde Staten. Historische wortels van een hedendaags vraagstuk

    NARCIS (Netherlands)

    Friesen, Gérôme Lambertus

    2006-01-01

    The central question in this thesis is why standardised intelligence testing plays such a dominant part in the lives of citizens in the United States and also leads to such vicious debates between believers and non-believers of intelligence testing. Over the years a number of studies where written o

  15. Ongevallen met zware voertuigen : een vergelijking van gegevens uit Nederland, Europa en de Verenigde Staten.

    NARCIS (Netherlands)

    Tromp, J.P.M.

    1988-01-01

    As stated in an earlier report autobuses and lorries are important and often very necessary transport vehicles, but they are the most dangerous for other road users (see irrd 288526). The following factors can in theory be responsible for accidents in which heavy lorries are involved: (a) vehicle de

  16. Etnisch ondernemerschap : de Chinese horecasector in Nederland en in de Verenigde Staten van Amerika

    NARCIS (Netherlands)

    Rijkschroeff, Boudewijn Roger

    1998-01-01

    Chinese cuisine has become very familiar to Dutch society in the past few decades. Although there already existed a handful of Chinese restaurants in the Netherlands shortly after the Second World War, it was not until the 1970s that the Chinese restaurant and catering sector began to bloom. In 1960

  17. Hvad er statens rolle i stigmatiseringen af de forsømte boligområder?

    DEFF Research Database (Denmark)

    Larsen, Troels Schultz

    2015-01-01

    Vi kender dem alle sammen – Tåstrupgård, Stationsbyen, Vejleåparken, Høje Gladsaxe osv. – navnene på berømte og berygtede forstæder på Vestegnen. De giver os villigt eller uvilligt billeder på nethinden af grå beton, sutter med bajere, hunde og Puch-Maxier med mælkekasser, enlige mødre og mennesker...

  18. Hvordan kan staten fremme innovation, der fører til bæredygtige energisystemer?

    DEFF Research Database (Denmark)

    Nielsen, Helle Ørsted; Pedersen, Anders Branth

    2013-01-01

    gennem en sammenligning af hollandsk og dansk energipolitik, idet den hol-landske politik eksplicit hviler på transitionsteorien. Vi finder, at økonomiske teorier og transitions-teorier på det abstrakte plan understøtter forskellige ambitionsniveauer for energipolitikken, men bruger af samme...

  19. Resolutiën Staten-Generaal 1626-1630. Omvangrijke inhoudelijke update.

    NARCIS (Netherlands)

    Nijenhuis, I.J.A.

    2011-01-01

    De update betrof een tijdrovende (vanaf 2007 tot publicatie bij elkaar toch al snel een jaar onderzoekstijd) herziening en verbetering van de inhoud van de webpublicatie. Aan de data is nieuwe informatie toegevoegd en errata zijn verwerkt.

  20. Beyond the borderland: Incursion of the State-Nation, NAFTA and external control within the Mexican-American mango industry

    Directory of Open Access Journals (Sweden)

    Robert R. Álvarez

    2002-07-01

    Full Text Available Using the case of the US-Mexico Mango Industry this paper explores the engagement of the nation-state in transnational activity through the activities of the United States Department of Agriculture (USDA. US control and certification of mangos imported into the United States is part of a broader system that includes NAFTA and historic labor immigration inducing new markets for “ethnic products”. This is part of a broader hemispheric system linked to US prerogatives. Although the USDA (like other border agencies controls the entrance of commodities at the US-Mexico geopolitical border, the encroachment of this agency into Mexico and its offshore control of commodity production and deistribution is not often a subject of investigation. This paper traces the development of the current USDA certification of mangos for US import, focusing on the hot water treatment of mangos and its controlling effects at local sites of production and distribution.

  1. F00455: NOS Hydrographic Survey , Fire Island to Staten Island, New York and New Jersey, 1999-10-13

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The National Oceanic and Atmospheric Administration (NOAA) has the statutory mandate to collect hydrographic data in support of nautical chart compilation for safe...

  2. SSI`s review of ASAR Ringhals 2, 1994; Statens straalskyddsinstituts granskning av ASAR-rapport foer Ringhals 2, 1994

    Energy Technology Data Exchange (ETDEWEB)

    Hofvander, P.

    1995-11-01

    Swedish nuclear power reactors are subject to periodic safety reviews, ASAR. Parts of ASAR deal with questions concerning radiation protection and are therefore submitted to a review performed by the Swedish Radiation Protection Institute. This report consists of SSI`s review of ASAR Ringhals 2, 1994 . The following areas have been included in this review: Organisation, education, occupational exposures, effluents and discharges, emergency preparedness. 13 figs.

  3. 76 FR 39361 - AmeriCorps State/National, Senior Companions, Foster Grandparents, and Retired and Senior...

    Science.gov (United States)

    2011-07-06

    ... History Check regulations to require grantees to conduct and document criminal history checks (including both state criminal history checks and FBI fingerprint checks) on Senior Companions, Foster Grandparents, Retired Senior Volunteer Program grant-funded staff, Learn and Serve America, AmeriCorps...

  4. 77 FR 60922 - Criminal History Check Requirements for AmeriCorps State/National, Senior Companions, Foster...

    Science.gov (United States)

    2012-10-05

    ... required state criminal history registry check(s). b. The Serve America Act's National Service Criminal... AND COMMUNITY SERVICE 45 CFR Parts 2510, 2522, 2540, 2551, and 2552 RIN 3045-AA56 Criminal History... National and Community Service. ACTION: Final rule. SUMMARY: To implement the Serve America Act,...

  5. "Stop - ro på - tænk!" Normativitet og selvkontrol i statens arbejde med børn og indsatte

    DEFF Research Database (Denmark)

    Pedersen, Oline; Laursen, Julie

    2016-01-01

    Artiklenundersøger de krav til individet, der ligger i de adfærdsregulerende programmer, der bruges i så forskellige institutionelle kontekster som danske fængsler og danske børnehaver og børnehaveklasser....

  6. Wettelijke regels betreffende het gedrag van voetgangers en voertuigbestuurders op en nabij VOP's : een overzicht van alle West-Europese landen en de Verenigde Staten.

    NARCIS (Netherlands)

    Kraay, J.H.

    1971-01-01

    Starting from the supposition that legal rules influence in a certain way the behaviour of as well the pedestrian as the driver, it is useful to know the different rules, which are force, in different countries. A review is made of legal rules for pedestrian and driver on and near pedestrian crossin

  7. Norwegian Radiation Protection Authority. Roles, responsibilities, crisis management and challenges in Norwegian nuclear and radiological preparedness.; Statens straalevern. Roller, ansvar, krisehaandtering og utfordringer i norsk atomberedskap

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2012-07-15

    The Crisis Committee for Nuclear and Radiological Preparedness initiated a project to assess the current national preparedness regarding nuclear and radiological emergencies. The purpose of the project was to make recommendations on how to further develop the Norwegian nuclear and radiological preparedness. The Crisis Committee outlines in this report the most important areas in the further development of Norway's nuclear and radiological emergency preparedness. (Author)

  8. Politiek door de staten: doel- of waarderationeel handelen in het besloten overleg over de Wadden en het openbaar beraad over de ecologische hoofdstructuur

    OpenAIRE

    2001-01-01

    POLITICS BY PROVINCE: Goal-oriented rational action or value-oriented rational action in closed debate on the Wadden region and public consultation on the ecological infrastructure General This thesis is a study of political conduct, and of provincial politics in particular. It is based on three research projects. The first two research projects are empirical studies that examine, respectively, the functioning of the discussion platform for government bodies relating to the Wadden Islands are...

  9. Politiek door de staten : doel- of waarderationeel handelen in het besloten overleg over de Wadden en het openbaar beraad over de ecologische hoofdstructuur

    NARCIS (Netherlands)

    Tromp, Gerbrig Heleen Maria

    2001-01-01

    POLITICS BY PROVINCE: Goal-oriented rational action or value-oriented rational action in closed debate on the Wadden region and public consultation on the ecological infrastructure General This thesis is a study of political conduct, and of provincial politics in particular. It is based on three res

  10. Governmental exposure connected to possible slide scale execution for future field developments; Statens eksponering knyttet til mulig glideskalautoevelse paa fremtidige feltutbygginger

    Energy Technology Data Exchange (ETDEWEB)

    Bjoerstad, Heidi; Sunnevaag, Kjell

    1993-07-01

    In the allotment of exploitation permits the governmental and Statoil parts have in the beginning been 50 % in all. This usually is divided in 30 % to the government and 20 % to Statoil. The slide scale system gives the government the right to increase the propriety share in a development project in connection with approval of the development plans. It is also possible in some permits to use the slide scale at a later date. The slide scale system was abolished for new permits in connection with the state budget discussions in 1993. The practice of giving Statoil and SDOE a share of at least 50 % was also eased. At the allotment time the uncertainty of the resource potential and the economy in the development project was considerable. However the companies have expectations for the location potentials. On this bases they made their allotment applications for exploitation permits. The application also contained an offer for a slide scale. In connection with the allotments the companies and the authorities also negotiated for the slice scale design and level. When the final propriety composition was to be established the slide scale offers were important criterias. The background for the slide scale system is the wish of the authorities to involve a larger part of the basic interest in large findings. The slide scale is an attempt from the authorities to make the system progressive with respect to reserve size. This progressiveness is difficult to obtain by aid of the taxation system because the companies are the objects not the fields. In order to establish a portfolio of possible developments where the slide scale option is present we have used data rom Wood Mackenzie from March 1993. The fields which are used as well as the contribution to the government by the use of a slide scale for the single field in increased present value is shown. The yearly alterations in governmental income are shown for use of the slide scale system for all the fields in the portfolio as well as the accumulated alteration in present value. In the first years the alterations in income is negative as there is little production and large investments in the fields in the portfolio. Furthermore thereis a marked ''dip'' in the income from 2002 to 2007 as there are large investments in the development of Midgard. We also have made the same calculations when Smoerbukk Soer is replaced by a common development of Smoerbukk and Smoerbukk Soer and 34/11 is included in the portfolio. This however, only shows small alterations compared to the basic example. The accumulated governmental income shows an increase towards the year 2013 while the alterations in income will show a positive fluctuation from the year 1999 onwards in the level of 1,00 to 2,00. In the calculations there are used fields and assumptions from Wood Mackenzie, March 1993. These assumptions may seem somewhat optimistic. Therefore the alterations in the governmental income when other price premises are laid down are briefly dealt with. When a currency exchange rate of 7 NOK to 1 $ and a constant oil price are stipulated the limiting value of profits for execution of a slide scale would be apr. 16.5 $ a barrel for the portfolio as a whole.

  11. Identification and comparative analysis of microRNAs in barnyardgrass (Echinochloa crus-galli) in response to rice allelopathy.

    Science.gov (United States)

    Fang, Changxun; Li, Yingzhe; Li, Chengxun; Li, Biliang; Ren, Yongjie; Zheng, Haiping; Zeng, Xiaomei; Shen, Lihua; Lin, Wenxiong

    2015-07-01

    Rice allelopathy is a hot topic in the field of allelopathy, and behaviour of donor allelopathic rice has been well documented. However, few study addresses response of receiver barnyardgrass (BYG). We found that expression of miRNAs relevant to plant hormone signal transduction, nucleotide excision repair and the peroxisome proliferator-activated receptor and p53 signalling pathways was enhanced in BYG co-cultured with the allelopathic rice cultivar PI312777, the expression levels of these miRNAs in BYG plants were positively correlated with allelopathic potential of the co-cultured rice varieties. Treatment of BYG plants with rice-produced phenolic acids also increased miRNA expression in BYG, while treatment with rice-produced terpenoids had no obvious effect on miRNA expression. In the hydroponic system, the largest number of Myxococcus sp. was found in the growth medium containing rice with the highest allelopathic potential. The addition of phenolic acids in the hydroponic medium also increased the number of Myxococcus sp. More interestingly, inoculation with Myxococcus xanthus significantly increased miRNA expression in the treated BYG. Jointed treatments of ferulic acid and M. xanthus led to strongest growth inhibition of BYG. The results suggest that there exist involvement of Myxococcus sp. and mediation of miRNA expression in rice allelopathy against BYG.

  12. Case03

    DEFF Research Database (Denmark)

    Vestergaard, Flemming; Karlshøj, Jan; Hauch, Peter;

    Casen repræsenterer et koncept, hvor både byg- og driftsherren og en byg- og driftsherrerådgiver er aktive i anvendelsen af en BIM-orienteret arbejdsmetode og modelbaserede værktøjer, som omfatter følgende aktiviteter: Design, Projektering, Udbud/tilbud, produktionsforberedelse, Udførelse og Drift...

  13. Case04: BIM hos større entreprenør

    DEFF Research Database (Denmark)

    Vestergaard, Flemming; Karlshøj, Jan; Hauch, Peter;

    Casen repræsenterer et koncept, hvor både byg- og driftsherren og en byg- og driftsherrerådgiver er aktive i anvendelsen af en BIM-orienteret arbejdsmetode og modelbaserede værktøjer, som omfatter følgende aktiviteter: Design, Projektering, Udbud/tilbud, produktionsforberedelse, Udførelse og Drift...

  14. Calculating the Economic and Environmental Effects of Agricultural Production

    DEFF Research Database (Denmark)

    Skop, E.; Schou, J. S.

    Projekt: Bæredygtige strategier i landbruget. Et tværfagligt forskningsprojekt med deltagelse af Statens Jordbrugsøkonomiske Institut, Statens Planteavlsforsøg, Statens Jordbrugstekniske Forsøg, Statens Husdyrsforsøg, Den Kgl. Veterinær- og Landbohøjskole og Danmarks Miljøundersøgelser....

  15. Procedure for determining the design value of the thermal conductivity of thermal insulation materials

    DEFF Research Database (Denmark)

    Hansen, Ernst Jan de Place

    2002-01-01

    Resume af rapport om en nyudviklet beregningsmetode til at bestemme fugtens indflydelse på varmeledningsevnen af isoleringsmaterialer, udarbejdet af Byg DTU under Energistyrelsens udviklingsprogram "Miljø- og arbejdsmiljøvenlig isolering"...

  16. Praksisorienteret forskningsformidling via et offentligt website

    DEFF Research Database (Denmark)

    Kirkeskov, Jesper

    I dialog med brugerne gennemføres en videreudvikling af By og Bygs website, www.by-og-byg.dk, som primært henvender sig til professionelle praktikere der beskæftiger sig med byggeriet og det byggede miljø. Ex ante antages det at såvel navigationsstruktur som søgefaciliteter skal rekonstrueres...... lignende informationstunge websites med fordel vil kunne hente inspiration i den udviklede løsning. Afhandlingen beskriver endvidere en komplet rekonstruktion af By og Bygs website, inkl. en ny navigationsstruktur som imødekommer brugernes behov for en emnebaseret indgang til websitets indhold. Ved den...... forskningsrapporter i traditionel, lineær form. Ex post synes det således fortsat at være en stor udfordring at hypermediere forskningsresultater med henblik på anvendelsesorientering. Afhandlingen ledsages af en betaversion af By og Bygs ny website, som blev idriftsat april 2004 på adressen www.by-og-byg.dk ....

  17. Væglast fra korn i en lav lagerbygning

    DEFF Research Database (Denmark)

    Møller, S.

    Rapporten bringer resultater af fuldskalaforsøg gennemført for at bestemme væglasten fra korn i lave lagerbygninger, fx plansiloer. Væglasten er målt for byg og hvede, for to forskellige ifyldningsmåder: indlægning i successivt voksende kegler og i vandrette lag, og for to fyldningsgrader: til va...

  18. Ny industrialisering - et bedre produktmarked

    DEFF Research Database (Denmark)

    Beim, Anne

    2001-01-01

    for byggeriet med titlerne: 1. Bygherren som forandringsagent. 2. Tæt samarbejde i byggedelen. 3. Ny industrialisering. 4. Byg med kommunikation og innovation. Dette debathæfte er nummer tre i rækken og omhandler byggeriets industridel og mulighederne for at fremme en succesfuld industriel produktion....

  19. Prefabricated elements and structures: Developments, tests and experiences

    DEFF Research Database (Denmark)

    Goltermann, Per

    2014-01-01

    Danish concrete structures are often built with prefabricated elements, joined together on the site and this provides a large challenge to constantly improve and optimize the elements, the joints and the models. DTU Byg has been active in the development, testing and modelling of new elements...

  20. 40 CFR 265.14 - Security.

    Science.gov (United States)

    2010-07-01

    ... facility must have: (1) A 24-hour surveillance system (e.g., television monitoring or surveillance by....g., an attendant, television monitors, locked entrance, or controlled roadway access to the facility...; facilities in counties bordering Mexico must post signs in Spanish), and must be legible from a distance...

  1. Halmhuse

    DEFF Research Database (Denmark)

    Munch-Andersen, Jørgen

    Huse bygget af halmballer, ler og muslingeskaller er så småt ved at finde vej i det danske nybyggeri til boliger. For at sikre at kvalitet, sikkerhed og sundhed er i orden i halmhusene, har By og Byg udarbejdet denne bog, der gennemgår halmhuset fra gulv til tag med hensyn til udformning af konst...

  2. Thermo Active Building Systems(TABS) - Performance in practice and possibilities for optimization

    DEFF Research Database (Denmark)

    Kolarik, Jakub

    The project “Thermo Active Building Systems (TABS) – Performance in practice and possibilities for optimization” was carried out at DTU Byg in the period form 1.9.2012 until 31.12.2014. The aim of the project was to conduct field measurements in modern office buildings equipped with TABS systems...

  3. Fermentering af korn øger fordøjeligheden af næringsstoffer

    DEFF Research Database (Denmark)

    Pedersen, Anni Øyan; Jørgensen, Henry Johs. Høgh; Knudsen, Knud Erik Bach;

    2010-01-01

    Et fordøjelighedsforsøg har vist, at energiværdien af byg og hvede steg ved fermentering. Effekten var størst ved fermentering af byg, hvor fordøjeligheden af organisk stof for enden af tyndtarmen steg statistisk sikkert med 9 %. Ved fermentering af hvede steg fordøjeligheden af organisk stof...... statistisk sikkert med 3 %. Stigningen i energiværdien ved fermentering af korn kunne ikke vises ved foderanalyser (FEsv), hvilket viser, at in vitro-analyserne EFOS og EFOSi ikke kan anvendes til vurdering af effekten af fermentering. Fordøjeligheden af fosfor i foderblandinger baseret på byg eller hvede og...... tilskudsfoder steg statistisk sikkert ved fermentering af kornet. Der blev ikke tilsat mikrobiel fytase. Ved fermentering af byg steg fordøjeligheden af fosfor i foderblandingen fra 32 til 47 %, og ved fermentering af hvede steg fordøjeligheden af fosfor i blandingen fra 43 til 57 %. Fordøjeligheden af fosfor i...

  4. Mensen in de koude oorlog; sociologische bijdrage tot onze kennis vam internationaal-politieke conflictsituaties

    NARCIS (Netherlands)

    Valkenburgh, Paul

    1964-01-01

    Samenvatting Het verschijnsel oorlog dat in het eerste gedeelte van deze studie het voornaamste object van onderzoek vormt, hebben wij omschreven als een conflict tussen staten of groepen van staten, waarbij van gewelddadige middelen gebruik wordt gemaakt om dit conflict tot een oplossing te brengen

  5. Musik og folkesundhed

    DEFF Research Database (Denmark)

    Bonde, Lars Ole; Ekholm, Ola

    2015-01-01

    Præsentation af undersøgelsen "Musik og folkesundhed", som er blevet til i et samarbejde mellem Musikterapi AAU og Statens Institut for Folkesundhed......Præsentation af undersøgelsen "Musik og folkesundhed", som er blevet til i et samarbejde mellem Musikterapi AAU og Statens Institut for Folkesundhed...

  6. Aanslagen VS geen vorm van nieuw terrorisme : tegen terreur met simpele middelen kan veiligheidsdienst weinig doen

    NARCIS (Netherlands)

    Teszelszky, Roger; Maat, Johri H.

    2001-01-01

    Politici en media spreken sinds de aanslagen in de Verenigde Staten van het "nieuwe terrorisme". Begrijpelijk, want de gebeurtenissen in de Verenigde Staten en vooral in New York zijn van een nieuwe orde. Toch is het terrorisme dat zich daar heeft gemanifesteerd niet nieuw, maar 'slechts' een extrem

  7. Putins russere eller russernes Putin?

    DEFF Research Database (Denmark)

    Frederichsen, Kim

    2014-01-01

    Om forholdet mellem staten og borgeren i dagens Rusland, og hvilke forandringer der kan spores i tiden med Vladimir Putin og Dmitrij Medvedev som skiftevise præsidenter og premierministre.......Om forholdet mellem staten og borgeren i dagens Rusland, og hvilke forandringer der kan spores i tiden med Vladimir Putin og Dmitrij Medvedev som skiftevise præsidenter og premierministre....

  8. Student Day in Iran

    DEFF Research Database (Denmark)

    Elling, Rasmus Christian

    2008-01-01

    Om Studerendes Dag i Iran der blev markeret med demonstrationer og protester mod statens undertrykkelse af den pro-demokratiske studenterbevægelse i Iran. Udgivelsesdato: 6/12......Om Studerendes Dag i Iran der blev markeret med demonstrationer og protester mod statens undertrykkelse af den pro-demokratiske studenterbevægelse i Iran. Udgivelsesdato: 6/12...

  9. Identification and evaluation of surveillance data from the Norwegian Pollution Control Authority with respect to the deterioration of cultural monuments in air, soil and water; Identifisering og vurdering av Statens forurensningstilsyns overvaakingsdata sett i relasjon til nedbrytning av kulturminner i luft, jord og vann

    Energy Technology Data Exchange (ETDEWEB)

    Dahlin, Elin; Henriksen, Jan; Anda, Odd; Krigsvoll, Guri; Boerja, Isabella; Wright, RIchard

    1999-07-01

    The main aim of the project is to identify and evaluate to what extent ''National program for pollution monitoring'' contains data which are relevant for the evaluation of the risk of deterioration of cultural monuments in Norway when exposed to air or preserved in soil or water. Even if many measuring stations have collected data for over 20 years is this an immensely short period. Long distance transported pollutions are important primarily outside the urban areas. It would be particularly the archaeological artefacts that would be affected by water quality and acidity in the soil and the degradation rate is greater. The amount of monuments in the cities are larger. In the bases there are sufficient data for estimating the degradation rates for several materials and they contain data which may give information regarding the average load in the areas and that cannot be used for evaluating the degradation rate in the air in the micro environments of the monuments. With the present dose response equations it would mainly be the ozone measurements for the urban air that may contribute to improved predictions. As the equations use long term average values the costs for including this for such areas through using passive test sampling would be reasonable. There is a substantial national measuring network for forest soils which will be useful for predicting what areas have increased risk of deterioration. There are however, few time studies of the soil changes. There are few known dose response equations for soil and water. The location of the cultural monuments in soil and water is an additional problem which will complicate the transfer of general knowledge to artefacts which may be buried at various depths. For soil and water the polluted areas may be defined. Several models for air pollution exist. When the pollution maps are connected with the meteorological maps the CorrCost model may be applied for direct calculations of where the corrosion and deterioration dangers may be the greatest.

  10. AcEST: DK950795 [AcEST

    Lifescience Database Archive (English)

    Full Text Available A OS=Bos t... 53 1e-06 sp|Q7TNB4|MSTRO_MOUSE Protein maestro OS=Mus musculus GN=Mro PE=... 50 9e-06 sp|Q9BYG7|MSTRO_HUMAN Protein mae...stro OS=Homo sapiens GN=MRO PE=... 42 0.002 sp|Q8WNV3|MSTRO_MACFA Protein maestro O...S=Macaca fascicularis GN=... 40 0.009 sp|Q58DE2|MSTRO_BOVIN Protein maestro OS=Bos taurus GN=MRO PE=2 ... 39...ACRFALRMCGPNLECEELAAV 1544 >sp|Q7TNB4|MSTRO_MOUSE Protein maestro OS=Mus musculus GN=Mro PE=2 SV=1 Length = ...+ V + CK T++ + YL Sbjct: 163 AGWRWKKFFTQQVNQTQDSLLGHLQDESPKVAKACKMTVRACVPYL 208 >sp|Q9BYG7|MSTRO_HUMAN Protein maestro

  11. Arkitektur, energi og dagslys

    DEFF Research Database (Denmark)

    Christoffersen, Jens; Petersen, Erwin; Svensson, Ole

    Man kan udmærket opfylde kravene til gode dagslysforhold uden at gå på kompromis med ønsket om at skabe god arkitektur. Det fremgår af en undersøgelse af syv bygninger, som er foretaget af forskere fra By og Byg i samarbejde med fire dagslyseksperter. De syv bygninger er meget forskellige, men ge...

  12. Geometri

    DEFF Research Database (Denmark)

    Byg din egen boomerang, kast den, se den flyve, forstå hvorfor og hvordan den vender tilbage, og grib den. Det handler om opdriften på vingerne når du flyver, men det handler også og allermest om den mærkværdige gyroskop-effekt, du bruger til at holde balancen, når du kører på cykel. Vi vil bruge...

  13. Zuur aerosol in de buitenlucht. Directe schade voor de volksgezondheid?

    NARCIS (Netherlands)

    Balfoort HW; de Leeuw FAAM

    1986-01-01

    Epidemiologische studies in Canada en de Verenigde Staten laten een correlatie zien tussen (zuur) aerosol concentraties en respiratoire ziekten of sterfte. Resultaten van dierexperimentele en humane blootstelling studies geven aan dat een herhaalde blootstelling aan zwavelzuur aerosol psysiologisch

  14. Leasing and legal culture : towards consistent behaviour in tax treatment in civil law and common law jurisdictions

    NARCIS (Netherlands)

    Mosquera Valderrama, Irma Johanna

    2007-01-01

    Dit proefschrift bevat een historisch rechtsvergelijkende studie naar het fenomeen leasing als een 'commmon law' concept ontwikkeld in de Verenigde Staten dat is getransplanteerd naar de 'civil law' landen Colombia, Frankrijk en Nederland. Bovendien verschaft dit proefschrift aanbevelingen met betre

  15. Animal welfare in a global perspective

    NARCIS (Netherlands)

    Bracke, M.B.M.

    2009-01-01

    Wereldwijd overzicht van dierenwelzijnswetgeving, praktijken en percepties, met voorbeeldstudies over kippenvlees uit Brazilië en Thailand, eieren uit India en de Verenigde Staten, welzijnswetgeving voor kweekvis en welzijnsaspecten van (vermeende) overpopulatie van wilde dieren.Global survey of ani

  16. Continuing Education Instrumentation Training in Clinical Chemistry.

    Science.gov (United States)

    LeBlanc, Jacqueline; Frankel, Saundra

    1980-01-01

    Describes the continuing education program for clinical chemistry instrumentation training established at The College of Staten Island, New York. A course consisting of 14 sessions is outlined and discussed. (CS)

  17. Too Many Public Defibrillators Out of Reach When Needed

    Science.gov (United States)

    ... reviewed the findings, Dr. Howard Levite. He directs cardiology at Staten Island University Hospital in New York ... stops beating. According to the American College of Cardiology (ACC), over 400,000 cases of out-of- ...

  18. Bange anelser om ny anbringelsesreform

    DEFF Research Database (Denmark)

    Kildedal, Karin

    2004-01-01

    Artiklen omhandler en analyse af den anbringelsereform, der er under behandling i folketinget i 2004. Analysen problematiserer, at staten fortsat prøver at kvalificere det sociale arbejdes praksis gennem lovgivning....

  19. Jean Bodin

    DEFF Research Database (Denmark)

    Harste, Gorm

    2009-01-01

    Jean Bodin (1530 - 1596) skabte teorien om statens suverænitet. Staten er indplaceret på et niveau mellem lokale  domstole og pave/kejser. Grunden til at staten kan få en permanent status er, at den netop på Bodins tid udstyrerede sig som en etat med en hierarikisk opbygget centraladministration....... Bodins bidrag var således at skabe den første egentlige statsteori, idet han kunne vise, at embeder kunne blive permanente selv hvis besidderne af dem døde. Staten får da retten til at kunne udvikle ret, hvis den både kan centralisere magt og decentralisere magt. Bodins teori blev direkte lagt til grund...

  20. Sequential Treatments with Tongsai and Bufei Yishen Granules Reduce Inflammation and Improve Pulmonary Function in Acute Exacerbation-Risk Window of Chronic Obstructive Pulmonary Disease in Rats

    Directory of Open Access Journals (Sweden)

    Xiaofan Lu

    2016-01-01

    Full Text Available Background. Sequential treatments of Chinese medicines for acute exacerbation of chronic obstructive pulmonary disease (AECOPD risk window (RW have benefits for preventing reoccurrences of AEs; however, the effects on pulmonary function, pulmonary, and systemic inflammatory biomarkers remain unclear. Methods. Cigarette-smoke/bacterial infections induced rats were randomized into Control, COPD, AECOPD, Tongsai Granule/normal saline (TSG/NS, moxifloxacin + salbutamol/NS (MXF+STL/NS, TSG/Bufei Yishen Granule (BYG, MXF+STL/STL, and TSG+MXF+STL/BYG+STL groups and given corresponding medicine(s in AE- and/or RW phase. Body temperature, pulmonary function, blood cytology, serum amyloid A (SAA and C-reactive protein (CRP, pulmonary histomorphology and myeloperoxidase (MPO, polymorphonuclear (PMN elastase, interleukins IL-1β, IL-6, and IL-10, and tumor necrosis factor- (TNF- α expressions were determined. Results. Body temperature, inflammatory cells and cytokines, SAA, CRP, and pulmonary impairment were higher in AECOPD rats than stable COPD, while pulmonary function declined and recovered to COPD level in 14–18 days. All biomarkers were improved in treated groups with shorter recovery times of 4–10 days, especially in TSG+MXF+STL/BYG+STL group. Conclusion. Sequential treatments with Tongsai and Bufei Yishen Granules, during AECOPD-RW periods, can reduce inflammatory response and improve pulmonary function and shorten the recovery courses of AEs, especially the integrated Chinese and Western medicines.

  1. Sequential Treatments with Tongsai and Bufei Yishen Granules Reduce Inflammation and Improve Pulmonary Function in Acute Exacerbation-Risk Window of Chronic Obstructive Pulmonary Disease in Rats

    Science.gov (United States)

    Lu, Xiaofan; Li, Ya; Wang, Haifeng; Wu, Zhaohuan; Li, Hangjie; Wang, Yang

    2016-01-01

    Background. Sequential treatments of Chinese medicines for acute exacerbation of chronic obstructive pulmonary disease (AECOPD) risk window (RW) have benefits for preventing reoccurrences of AEs; however, the effects on pulmonary function, pulmonary, and systemic inflammatory biomarkers remain unclear. Methods. Cigarette-smoke/bacterial infections induced rats were randomized into Control, COPD, AECOPD, Tongsai Granule/normal saline (TSG/NS), moxifloxacin + salbutamol/NS (MXF+STL/NS), TSG/Bufei Yishen Granule (BYG), MXF+STL/STL, and TSG+MXF+STL/BYG+STL groups and given corresponding medicine(s) in AE- and/or RW phase. Body temperature, pulmonary function, blood cytology, serum amyloid A (SAA) and C-reactive protein (CRP), pulmonary histomorphology and myeloperoxidase (MPO), polymorphonuclear (PMN) elastase, interleukins IL-1β, IL-6, and IL-10, and tumor necrosis factor- (TNF-) α expressions were determined. Results. Body temperature, inflammatory cells and cytokines, SAA, CRP, and pulmonary impairment were higher in AECOPD rats than stable COPD, while pulmonary function declined and recovered to COPD level in 14–18 days. All biomarkers were improved in treated groups with shorter recovery times of 4–10 days, especially in TSG+MXF+STL/BYG+STL group. Conclusion. Sequential treatments with Tongsai and Bufei Yishen Granules, during AECOPD-RW periods, can reduce inflammatory response and improve pulmonary function and shorten the recovery courses of AEs, especially the integrated Chinese and Western medicines. PMID:27563333

  2. Darwins aktualitet

    DEFF Research Database (Denmark)

    2009-01-01

    - han får os til at diskutere os selv. Uddrag af PETER C. KJÆRGAARDs tale ved åbningen af Darwin-udstillingen på Statens Naturhistoriske Museum d. 4. februar. Udgivelsesdato: Marts......- han får os til at diskutere os selv. Uddrag af PETER C. KJÆRGAARDs tale ved åbningen af Darwin-udstillingen på Statens Naturhistoriske Museum d. 4. februar. Udgivelsesdato: Marts...

  3. Research News from Norway, Sweden, and Finland

    Directory of Open Access Journals (Sweden)

    Sven Skjenneberg

    1986-06-01

    Full Text Available Norge: 1 Forskningsavd ved Reindriftsadministrasjonen. 2 Avd. for arktisk biologi, Univ. i Tromsø 3 Viltforskningen ved DN, Trondheim 4 Institutt for biologi og geologi, Univ. i Tromsø 5 Institutt for husdyrnæring, Norges landbrukshøgskole 6 Institutt for zoologi, Norges landbrukshøgskole 7 Stipendiat Norges landbruksvit. forskningsråd 8 Statens veterinære laboratorium i Nord-Norge Sverige: 1 Renförsöksavdelningen, Sveriges lantbruksuniversitet 2 Statens veterinärmedicinska anstalt 3 Statens naturvårdsverk Finland: 1 Vilt- och fiskeriforskningsinstitutet, Renforskning 2 Kaamanen försöksstation, Renägareföreningen 3 Veterinärmedicinska högskolan 4 Helsingfors universitets husdjursvetenskapliga institut 5 Kuopios och Uleåborgs universiteter 6 Helsingfors universitets geologiska institut 7 Jyväskyläs universitet 8 Lantbrukets forskningscentral

  4. Measurement and modelling of a multifunctional solar plus heatpump system from Nilan

    DEFF Research Database (Denmark)

    Perers, Bengt; Andersen, Elsa; Furbo, Simon;

    concerning advanced control. The operation into extreme states of high hot water demand and low air ventilation rates, has also been done to develop and validate a TRNSYS system model. The model was developed and validated for the first period of operation mainly winter and early spring conditions. Now......A multifunctional solar and heat pump unit from Nilan has been installed in the Performance Test Facility (PTF) at DTU Byg Denmark. It is part of the IEA Task 44 cooperation. Multifunctional means in this case: Hot water, Air heating, Ventilation, Air heat recovery, Air filtering and Floor heating...

  5. Transnational organisatorisk innovation i den offentlige sektor

    DEFF Research Database (Denmark)

    Hansen, Morten Balle

    2013-01-01

    , benchmarking, Balanced Scorecard, Pay-for-performance, Lean og værdibaseret ledelse. Artiklens empiriske grundlag er surveys gennemført i kommunerne i efteråret 2008 og i staten i foråret 2009. Analysen viser en klar tendens til større udbredelse i kommunerne end i staten for de fleste af de inkluderede...... forskelle og ligheder mellem statslige og kommunale organisationer. 11 former for organisatorisk innovation, hvoraf mange ofte forbindes med New Public Management (NPM), er inkluderet i de empiriske analyser: privatisering/udlicitering, Bestiller-Udfører-model, kontraktstyring, mål- og rammestyring...

  6. Teacher Preparation for the Minority and Disadvantaged. NCRIEEO Tipsheet, Number 10.

    Science.gov (United States)

    Ether, John A.

    This tipsheet reports that the first series of books written especially to help prepare teachers of minorities and the disadvantaged were general books of readings. Among these is "The Disadvantaged Learner" by Staten Webster. Over 600 pages in length, it is loosely organized around three themes: knowing the disadvantaged, understanding the…

  7. Productiekosten van kuikenvlees : een internationale vergelijking

    NARCIS (Netherlands)

    Horne, van P.L.M.

    2009-01-01

    In dit rapport worden de kostprijzen van kuikenvlees in 2007 in verschillende EU-landen vergeleken met Brazilië, Thailand en de Verenigde Staten. Voor alle genoemde landen is een doorkijk gemaakt naar het jaar 2012. Per land zijn de ontwikkelingen op het gebied van dierenwelzijn, milieu en voedselve

  8. Short term toxicity of bis(tri-n-butyltin)oxide in flounder(Platichthys flesus) ; pathology and immune function

    NARCIS (Netherlands)

    Grinwis GCM; van den Brandhof EJ; Dormans JAMA; Engelsma M; Kuiper R; Leewis R; van Loveren H; Wester PW; Vaal MA; Vethaak AD; Vos JG; LWD; LPI; ECO; UU; RIKZ

    1997-01-01

    Veldonderzoeken uitgevoerd in diverse verontreinigde kustwateren in zowel Europa als de Verenigde Staten laten een duidelijke relatie tussen vervuiling en een toegenomen prevalentie van tumoren en infectieziekten bij vissen zien. Een van de chemische verbindingen in de veelheid van xenobiotica die

  9. 75 FR 49486 - Environmental Impacts Statements; Notice Of Availability

    Science.gov (United States)

    2010-08-13

    .... 20100310, Final EIS, BLM, CA, Chevron Energy Solutions Lucerne Valley Solar Project, Proposing To Develop a 45-megawatt (MW) Solar Photovotaic (PV) Plant and Associated Facilities on 516 Acres of Federal Land... Bridge across the Arthur Kill between Staten Island New York and Elizabeth, New Jersey, Funding and...

  10. Finance middle managers and financial statement fraud

    NARCIS (Netherlands)

    Linke, Kristina Gisela Babette

    2012-01-01

    Verslaggevingsfraude is het manipuleren van de boekhouding om betere cijfers te laten zien. Kristina Linke onderzocht deze vorm van fraude, waarbij zij vooral keek naar de rol van de controller. Dat gebeurde aan de hand van 244 aanklachten in de periode 2000-2006 in de Verenigde Staten. Uit het onde

  11. An Update on the Potential of North American Mosquitoes (Diptera: Culicidae) to Transmit West Nile Virus

    Science.gov (United States)

    2007-11-02

    thebird-mammal feeding ratio in amosquito vector of human encephalitis. Science (Wash. DC) 161: 67Ð68. Goddard, L. B., A. E. Roth , W. K. Reisen, and T. W...Staten Island, New York, 2000. Emerg. Infect. Dis. 7: 722Ð725. Lanciotti, R. S., J. T. Roehrig, V. Deubel , J. Smith,M. Parker, K. Steele, B. Crise, K. E

  12. Balans van 25 jaar arbeids- en organisatiepsychologie : nieuwe thema's en methoden, maar praktische relevantie onder druk

    NARCIS (Netherlands)

    Smulders, P.; Schouteten, R.

    2009-01-01

    Op basis van reviewartikelen, trend- en inhoudsanalyses poogt dit artikel een overzicht te geven van 25 jaar A&O-psychologie. Daarbij gaat de aandacht uit naar zowel nationale als internationale ontwikkelingen. Geconcludeerd wordt dat er grote verschillen bestaan tussen de Verenigde Staten, het Vere

  13. CyberStorm III

    NARCIS (Netherlands)

    Luiijf, H.A.M.; et al

    2010-01-01

    Projectteam Cyber Storm III - De Verenigde Staten organiseerden de afgelopen jaren een reeks grootschalige ICT-crisisoefeningen met de naam Cyber Storm. Cyber Storm III is de derde oefening in de reeks. Het scenario van Cyber Storm III staat in het teken van grootschalige ICT-verstoringen, waarbij n

  14. RMP Evaluations, Course Easiness, and Grades: Are They Related?

    Science.gov (United States)

    Rizvi, Syed A.

    2015-01-01

    This paper investigates the relationship between the student evaluations of the instructors at the RateMyProfessors.com (RMP) website and the average grades awarded by those instructors. As of Spring 2012, the RMP site included evaluations of 538 full-and part-time instructors at the College of Staten Island (CSI). We selected the evaluations of…

  15. Byudvikling og boligplanlægning i Sydafrika

    DEFF Research Database (Denmark)

    Eskemose Andersen, Jørgen; Andreasen, Jørgen

    1996-01-01

    er der udsigt til en helt ny æra i by- og boligudviklingen. En ambitiøs boligstrategi er udformet og der påregnes at bygge over en million boliger til lav indkomst borgere over de næste 5 år. Strategien satser på et samarbejde mellem staten, civilsamfundet og den private sektor. Udgangspunktet er...

  16. Himmels og jordisk jern i Grønlands forhistorie

    DEFF Research Database (Denmark)

    Appelt, Martin; Haack, Henning; Jensen, Jens Fog

    2015-01-01

    , Grønlands Nationalmuseum & Arkiv og Statens Naturhistoriske Museer ved brug af en drone med udstyr til luftfotografering dokumenterede jernmeteoritternes placering i det nordgrønlandske landskab (fig.1). Feltundersøgelserne er blevet suppleret med analyser af jernredskaber fra Nationalmuseets samlinger...

  17. Inertiens havn 1

    DEFF Research Database (Denmark)

    Juel-Christiansen, Carsten

    2003-01-01

    Bidrag til Statens Kunstfonds web-galleri, som indeholder et katalog af angrebsvinkler, og ideer, strategier, drømme og poetiske udsagn om de danske havnefronter. Bidraget vedrører Kalundborg og har været fysisk udstillet jul-aug på Kalundborg Bibliotek...

  18. Zikavirusepidemien

    DEFF Research Database (Denmark)

    Kronborg, Gitte; Fomsgaard, Anders

    2016-01-01

    of the newborns. Imported cases of Zika virus infection to North America, Europe and Denmark have been described. The infection in itself is mild and self-limiting. The available diagnostic methods are under development, validation and evaluation. In Denmark, some promising diagnostics are available at Statens...

  19. Wiersma, A. . A study of the teaching methods of high school history teachers

    NARCIS (Netherlands)

    Vos, Rene

    2012-01-01

    Dit artikel is geschreven door Ashley Wiersma, docent geschiedenis op Kalamazoo Central High School in de Verenigde Staten. Het artikel beschrijft een onderzoek naar de manier waarop geschiedenislessen in het middelbaar onderwijs worden gegeven. Ze stelt dat de meeste geschiedenisdocenten nog op een

  20. Adverse reactions to the Bacillus Calmette-Guérin (BCG) vaccine in new-born infants-an evaluation of the Danish strain 1331 SSI in a randomized clinical trial

    DEFF Research Database (Denmark)

    Nørrelykke Nissen, Thomas; Birk, Nina Marie; Kjærgaard, Jesper;

    2016-01-01

    OBJECTIVE: To evaluate adverse reactions of the Bacillus Calmette-Guérin (BCG) Statens Serum Institut (SSI) (Danish strain 1331) used as intervention in a randomized clinical trial. DESIGN: A randomized clinical multicenter trial, The Danish Calmette Study, randomizing newborns to BCG or no inter...

  1. Raman af hvide pigmenter

    DEFF Research Database (Denmark)

    Reeler, Nini Elisabeth Abildgaard; Nielsen, Ole Faurskov; Sauer, Stephan P. A.;

    2013-01-01

    Et samspil mellem kunst og kemi. I et samarbejde mellem Statens Museum for Kunst og Kemisk Institut på KU er Ramanspek-troskopi brugt til at definere sammensætningen af blandinger af blyhvidt og calcit i maleriers hvide pigmenter....

  2. Stiefkind der Staatengemeinschaft : Die Anerkennungspolitik der DDR in Westeuropa 1949 - 1973

    NARCIS (Netherlands)

    Horstmeier, Carel

    2014-01-01

    Stiefkind van de internationale gemeenschap. De erkenningspolitiek van de DDR in West-Europa 1949-1973De Duitse Democratische Republiek (DDR) was vanaf haar oprichting in 1949 internationaal geïsoleerd. Alleen de 11 andere communistische staten wilden haar diplomatiek erkennen. Dit proefschrift onde

  3. 克莉丝汀娜·阿奎莱拉(英文)

    Institute of Scientific and Technical Information of China (English)

    2005-01-01

    After Britney Spears,Christina Aguilera was the most popular female singer of the late '90s teen pop reviva .Christina was born on December 18,1980,in Staten Island,NY.Her parents divorced when she was young.Christina's goal almost since birth

  4. Archieven tussen 'arcana imperii' en 'open government'

    NARCIS (Netherlands)

    Jeurgens, C.

    2012-01-01

    Vlak na zijn aantreden als president van de Verenigde Staten verklaarde Barack Obama dat zijn regering een nooit eerder vertoonde openheid zal scheppen. Met de retorische bevlogenheid die zo kenmerkend is voor Obama hield hij zijn gehoor voor: "We will work together to ensure the public trust and es

  5. Beïnvloedt negatief nieuws de aantrekkelijkheid van grote accountantskantoren voor potentiële werknemers?

    NARCIS (Netherlands)

    Vorst, C.S.; van Raak, J.J.F.; van Triest, S.P.

    2015-01-01

    Onderzoek in de Verenigde Staten (Bagley et al., 2012) onder studenten accountancy laat zien dat studenten die een voorkeur hebben voor Big 4-kantoren meer belang hechten aan de reputatie van een kantoor en aan de erkenning die het werken bij een prestigieus kantoor levert, en minder aan sfeer en we

  6. East African Taarab as a contemporary mediator of the diversity an vitality of a musical tradition within Islamic Culture

    DEFF Research Database (Denmark)

    Kirkegaard, Annemette

    2007-01-01

    Artiklen diskuterer hvordan musikkulturen, taarab, i Zanzibar gennem en snart ethundrede år lang periode har været i en fortsat forhandling mellem et religiøst og et sekulært meningsindhold. Gennem tiden efter østatens selvstændighed i 1963 og frem til begyndelsen af det 21. århundrede har disse ...

  7. Et godt sted at græde og le hos Helle Helle

    DEFF Research Database (Denmark)

    Hansen, Per Krogh

    2014-01-01

    Da Helle Helle (f. 1965) i 2010 blev indstillet af Statens Kunstfonds repræsentantskab til at modtage livsvarig kunstnerydelse, lød begrundelsen, at hun var ”en af Danmarks vigtigste fortolkere af middelklassen og den danske provins.” Og sådan er hun generelt også blevet modtaget og fortolket: Som...

  8. Preeclampsia research in Denmark

    DEFF Research Database (Denmark)

    Klemmensen, Åse Kathrine

    2005-01-01

    Ph.d.-studiet er udført i samarbejde med Gynækologisk Obstetrisk Afdeling, H:S Hvidovre Hospital, og Afsnittet for Perinatal og Ernæringsepidemiologi, Afdelingen for Epidemiologisk Forskning, Statens Serum Institut. Arbejdet omfatter tre dele, en spørgeskemaundersøgelse vedrørende præeklampsi (PE...

  9. I en højere sags tjeneste

    DEFF Research Database (Denmark)

    Langsted, Lars Bo; Jakobsen, Søren Sandfeld

    2014-01-01

    Artiklen behandler ud fra en retsdogmatisk metode nogle af de grundlæggende problemstillinger, regler, principper og hensynsafvejninger, der gælder, når staten eller private virksomheder vil gennemføre overvågning af borgerne og dermed gøre indgreb i retten til privatlivets fred. Særlig fokus er ...

  10. ALT der er fortalt og ALT vi ved

    DEFF Research Database (Denmark)

    Toft, Herdis

    Rapport om en biblioteksforestilling udviklet i et samarbejde mellem Viborg Bibliotekerne og Carte Blanche, Egnsteater i Viborg, støttet af Statens Kunstråds Tværæstetiske Pulje og Kulturstyrelsen. I rapporten redegøres for projektets ide, design, forløb og evaluering. Afsnit omhandler Den poetiske...

  11. Encouraging Enrollment and Retention of Women in Computer Science Classes.

    Science.gov (United States)

    Sturm, Deborah; Moroh, Marsha

    Women computer science students at the College of Staten Island (CSI) in New York have a substantially higher pass rate than their male classmates; however, their enrollment and retention rates are low. During the last year and a half women on the computer science faculty at CSI developed two projects designed to increase the enrollment and…

  12. Commander in chief : FDR's battle with Churchill, 1943

    NARCIS (Netherlands)

    Hamilton, Charles Nigel

    2016-01-01

    Commander in Chief is een deelbiografie van president Franklin Delano Roosevelt waarin Roosevelts rol als opperbevelhebber van de gewapende strijdkrachten van de Verenigde Staten in de Tweede Wereldoorlog het hoofdthema is. Het boek concentreert zich op het jaar 1943: een jaar waaraan biografen van

  13. Zeetransport van snijbloemen: ”If we get this quality more, we will sell a lot” : werkpakket productkwaliteit : eindrapportage

    NARCIS (Netherlands)

    Harkema, H.; Mensink, M.G.J.

    2005-01-01

    Het onderzoeksproject Zeetransport Snijbloemen had als doel een distributieconcept te ontwikkelen voor snijbloemen op basis van zeecontainertransport. Ter afbakening van het project lag de focus op de Verenigde Staten. Het vervoer naar de V.S. van snijbloemen tegen een lagere prijs (zeetransport in

  14. Et håndtryk

    DEFF Research Database (Denmark)

    Eriksen, Karen Westphal; Schytz Juul, Mathilde

    2010-01-01

    Hør Karen Westphal Eriksen fortælle om udvalgte værker og temaer fra udstillingen "Et håndtryk". Udstillingen omhandler dansk-fransk avantgardekunst og er et samarbejde mellem Fyns Kunstmuseum og Statens Museum for Kunst. Udstillingen kan ses på Fyns Kunstmuseum frem til februar 2011...

  15. The SEEK Mentoring Program: An Application of the Goal-Setting Theory

    Science.gov (United States)

    Sorrentino, Diane M.

    2007-01-01

    This article describes a pilot academic mentoring program carried out over 1 semester in the SEEK Program at the College of Staten Island, CUNY. The program was utilized to provide a resource for students whose overall grade point average was below 2.5, placing them at risk for academic dismissal. A goal-setting approach was used to aid the…

  16. Cryptosporidium en Giardia in Nederlandse zwembaden

    NARCIS (Netherlands)

    Schets FM; Engels GB; Leenen EJTM; MGB

    2003-01-01

    Zwembad gerelateerde explosies van cryptosporidiose zijn regelmatig gerapporteerd in Groot-Brittannie en de Verenigde Staten. De bron van de explosie kon soms achterhaald worden doordat Cryptosporidium oocysten in het zwembadwater of in het terugspoelwater van de zwembadfilters konden worden gedete

  17. Hvad protokollen gemte

    DEFF Research Database (Denmark)

    Bonderup, Gerda

    2007-01-01

    Protokollen er ganske speciel for Danmarks historie, idet den indeholder de dybeste hemmeligheder om de værste forbrydelser mod majestæten, staten og moralen. Det måtte ikke komme offentligheden for øre bestemte kongen i 1799....

  18. Anmerkungen zu Goethe : eine psychoanalytische Untersuchung über Goethe als Repräsentant deutscher Kultur

    NARCIS (Netherlands)

    Kaus, Rainer J.

    1994-01-01

    De oorspronkelijke aanleiding tot dit onderzoek was de invloedrijke psychoanalytische studie in twee delen van K.R. Eissler, Goethe: A Psychoanalytic Study 1775-1786, oorspronkelijk verschenen in de Verenigde Staten (Detroit: Wayne State UP, 1963), in Duitse vertaling bij uitgeverij Stroemfeld/Roter

  19. Geografische daderprofilering ; Een inventarisatie van randvoorwaarden en succesfactoren

    NARCIS (Netherlands)

    Brake, G.M. te; Eikelboom, A.R.

    2008-01-01

    In deze uitgave wordt verslag gedaan van een onderzoek naar een in de Verenigde Staten ontwikkelde methode om het woongebied van een vermoedelijke dader van een reeks van delicten te identificeren: geografische daderprofilering. Aan de hand van informatie over de locaties van delicten wordt met behu

  20. Et lykkeligt fornuftsægteskab?

    DEFF Research Database (Denmark)

    Frausing, Mikael

    2010-01-01

    Artiklen baserer sig på undersøgelser af Turistforeningen for Danmarks virke med hovedvægt på perioden 1923-1945. Nedsættelsen af „Udenrigsministeriets Udvalg for Turistpropaganda i Udlandet“ i 1934 betød en gennemgribende forandring, hvor staten for første gang involverede sig aktivt i Turistfor...

  1. 75 FR 78722 - Intent To Prepare Programmatic Environmental Assessment Statement for the Nationwide...

    Science.gov (United States)

    2010-12-16

    ... Boulevard, Francisco, CA MA 02109-1027 29401-1817 Portsmouth, VA 94130-9309 23703-2199 Tampa-St. San Diego..., San Diego, CA Drive, Staten Water St., St. Petersburg, 92101-1028 Island, NY Sault Ste., FL 33701-5099... 70005 AK 99501-1946 38105-1502 Lake Michigan, Miami, 100 Guam, PSC 455, San Juan, 5 2420 S. Lincoln...

  2. Mediation en de vaststellingsovereenkomst: aantasting en afdwingbaarheid naar Nederlands en Amerikaans recht

    NARCIS (Netherlands)

    M.S. van Muijden

    2007-01-01

    textabstractDit onderzoek wordt verricht naar aanleiding van de sterk toegenomen belangstelling voor mediation in Nederland. In navolging van de Verenigde Staten, waar de moderne mediationmethode haar wortels heeft, is mediation sinds het midden van de jaren negentig in Nederland in opmars. Vooral i

  3. Nationalisering ad bagdøren?

    DEFF Research Database (Denmark)

    Thomsen, Steen

    2009-01-01

    Et alternativ til lukning eller indirekte nationalisering er at etablere tidsbegrænsede investeringsfonde drevet på kommerciel basis af private, men med staten som medinvestor, således at privat kapital suppleres af offentlig, mens det private initiativ bevares...

  4. Atlantis Lost : The American Experience with De Gaulle, 1958-1969

    NARCIS (Netherlands)

    Reyn, Sebastian

    2010-01-01

    Geschiedkundigen hebben ruim aandacht besteed aan de markante buitenlandpolitiek van Charles de Gaulle. Dat geldt niet voor de vaak felle reacties die hij losmaakte. Op grond van uitvoerig onderzoek in Amerikaanse archieven zijn de reacties in de Verenigde Staten op De Gaulle nu door Sebastian Reyn

  5. Modellering van de verwijdering van Cryptosporidium parvum,Giardia lamblia en enterovirussen in spaarbekkens

    NARCIS (Netherlands)

    Ratsak CH; MGB

    1996-01-01

    De protozoa Cryptosporidium en Giardia hebben de laatste decennia in de Verenigde Staten en in Groot-Brittannie een aanzienlijk aantal grote en kleine epidemieen van maag-darminfecties via drinkwater veroorzaakt. Wiskundige modellen kunnen worden gebruikt om de verwijdering van pathogene micro-o

  6. Show and Tell

    DEFF Research Database (Denmark)

    2013-01-01

    /DK), Pernille With Madsen, Emil Alenius, Andrés Galeano (E/DE), Kasper Vang & Mads Forsby, Nanna Lysholt Hansen og Molly & Me (Molly Haslund & Catherine Hoffmann (UK)) Kurateret af Judith Schwarzbart og Sanne Krogh Groth Produceret af studerende ved Performance-design Programmet var støttet af Statens Kunstråd...

  7. Information Literacy in the Study of American Politics: Using New Media to Teach Information Literacy in the Political Science Classroom

    Science.gov (United States)

    Cope, Jonathan; Flanagan, Richard

    2013-01-01

    Students have access to a vast amount of information about American politics through new media outlets (e.g., the Internet). We survey the perils and promise of this new landscape through a case study of a political science class at the College of Staten Island, City University of New York (CUNY), that examined congressional races in the 2010…

  8. Securitisatie : Hoe nu verder?

    NARCIS (Netherlands)

    Vink, D.

    2009-01-01

    Securitisatie is een bekende en veelgebruikte techniek die is ontwikkeld voor de financiering van een verzameling van activa die door hun eigenlijke aard niet-verhandelbaar zijn. De securitisatietransacties die risicovolle subprimehypotheken uit de Verenigde Staten als onderpand hebben zijn echter z

  9. Credit Cards on Campus: Academic Inquiry, Objective Empiricism, or Advocacy Research?

    Science.gov (United States)

    Manning, Robert D.; Kirshak, Ray

    2005-01-01

    Professors John M. Barron and Michael E. Staten's article in Vol. 34, No. 3 of this journal, "Usage of Credit Cards Received through College Student-Marketing Programs," purports to "provide benchmark measures of college student credit card usage." Based on empirical analyses of proprietary industry data, they conclude that "There is no…

  10. Net als in de film

    NARCIS (Netherlands)

    Visser, D.J.G.; Vrendenbarg, C.J.S.

    2013-01-01

    Een MOOC is een relatief nieuw fenomeen dat is overgewaaid uit de Verenigde Staten. De “MOOC mania” ontstond daar zo’n twee jaar geleden aan Stanford University, toen hoogleraren Thurn en Norvig de gratis online cursus getiteld ‘An Introduction to Artificial Intelligence’ aankondigden op YouTube. Ee

  11. Who shall be raja? Patronage democracy in north Sumatra, Indonesia

    NARCIS (Netherlands)

    Simandjuntak, D.R.P.

    2010-01-01

    Het einde van de Koude Oorlog markeerde een periode van nieuwe democratisering. Autoritaire staten werden geforceerd om te decentraliseren. Decentralisatie wordt gezien als middel om de overheidsadministratie efficiënter en de leiders meer aansprakelijk te maken. Het moet bijdragen aan good governan

  12. Hvad skal vi med et naturhistorisk museum?

    DEFF Research Database (Denmark)

    Kjærgaard, Peter C.

    2016-01-01

    I Danmark har vi nationale museer for kunsten, kulturen og naturen. Vi er i fuld gang med at lave et nyt, stort supermuseum for naturhistorien. Hvad skal vi egentlig med det? Efter et år på posten som direktør for Statens Naturhistoriske Museum gør Peter C. Kjærgaard status med en personlig...

  13. ADAM in Holland? : Verslag van de Pilot Monitoring van drugsgebruik onder arrestanten bij Politie Haaglanden

    NARCIS (Netherlands)

    Broek, H. van den; Klerks, P.; Otter, P. den; Zandhuis, E.

    2000-01-01

    Het ADAM-project (Arrestee Drug Abuse Monitoring) afkomstig uit de Verenigde Staten houdt in dat arrestanten op vrijwillige basis meewerken aan een interview over hun drugsgebruik en een urinemonster afstaan dat op drugs wordt getest. Om na te gaan of deze procedure ook in Nederland uitvoerbaar is,

  14. EnergyLab Nordhavn – Progress and Physical Implementation

    DEFF Research Database (Denmark)

    Greisen, Christoffer; Honoré, Kristian; Foteinaki, Kyriaki

    EnergyLab Nordhavn is a large-scale integrated research and demonstration project that contributes to the grand challenge of transforming the energy system to efficiently integrate a large share of renewable energy. The project focuses on a cost-effective future smart energy system that integrates...... laboratory and an environment for strong research-based innovation in smart energy technologies, innovative business models and energy management tools for the future sustainable low-energy city districts. Particularly exciting is the synergy between • the physical density of the environment in Nordhavn...... • the “settler attitude” of the new local population • new trends of co-creation and participation. • new tools creating awareness on carbon footprint and other environmental impact. EnergyLab Nordhavn partners are DTU BYG, DTU MEK, DTU CEE, Københavns Kommune, DONG Energy Electricity Distributions, HOFOR, By...

  15. Centrifuge modelling of large diameter pile in sand subject to lateral loading

    DEFF Research Database (Denmark)

    Leth, Caspar Thrane

    and cyclic behaviour of large diameter rigid piles in dry sand by use of physical modelling. The physical modelling has been carried out at Department of Civil Engineering at the Danish Technical University (DTU.BYG), in the period from 2005 to 2009. The main centrifuge facilities, and especially...... the equipment for lateral load tests were at the start of the research in 2005 outdated and a major part of the work with the geotechnical centrifuge included renovation and upgrading of the facilities. The research with respect to testing of large diameter piles included:  Construction of equipment...... with embedment lengths of 6, 8 and 10 times the diameter. The tests have been carried out with a load eccentricity of 2.5 m to 6.5 m above the sand surface. The present report includes a description of the centrifuge facilities, applied test procedure and equipment along with presentation of the obtained results....

  16. Kynjaflækja hinsegin mæðra. Að afbyggja kynjakerfið og gagnkynhneigt forræði frá jaðrinum

    OpenAIRE

    Svandís Anna Sigurðardóttir 1982

    2011-01-01

    Kyngervi og kynhneigð haldast í hendur og eru félagslega mótaðar breytur sem eru hluti af tvíhyggjukerfum. Yfirleitt gerir fólk sér ekki grein fyrir áhrifunum sem það verður fyrir af þessum kerfum né þátttöku sinni í að viðhalda þeim, þrátt fyrir að þau geti verið þvingandi, fordómafull og útilokandi. Í þessari ritgerð skoða ég hugmyndafræði og kenningar um kyngervi, kynhneigð og kynjahlutverk, hvernig þetta tengist og vinnur saman til að byggja upp feðraveldi og gagnkynhneigt forræði sem byg...

  17. Danish Sector Guide for Calculation of the Actual Energy Consumption

    DEFF Research Database (Denmark)

    Mortensen, Lone Hedegaard

    2016-01-01

    , the innovation network for sustainable construction, InnoBYG started work on a Danish sector guide for the calculation of actual energy consumption in relation to upgrading of buildings. The focus was to make a common guide for energy calculations that can be used by consultants performing calculations......Energy calculations have for a long time been a controversial topic as building owners do not necessarily achieve the promised energy savings after a building upgrade, but is this due to incorrect calculations or rather the evidence of misunderstandings in the communication? In Denmark...... of the energy calculation for building owners and developers. This paper describes the process that leads to the sector guide and briefly explains the content in both the technical guide and the communication paper. Finally the paper discusses some of the known dilemmas related to the measured energy...

  18. B 150 civil engineering futures

    DEFF Research Database (Denmark)

    theme in twentieth century architecture. Together, civil engineer Peter Rice and architect Ian Ritchie created a paradigm shift with their revolutionary ideas for glass facades supported by cables. Glued and bolted constructions made entirely of glass are now a reality in small-scale projects, yet...... related to sustainability – a Workshop on Traffic. The workshop discussed traffic prognoses and the way they are used in the preparation of urban transport and traffic strategies. Civil engineer Jonas Eliasson spoke about the experience in Sweden of developing a database for traffic prognoses. The main...... to develop a technically advanced form of aesthetics. The Master Class in low energy buildings was led by civil engineer, Svend Svendsen, a Professor at DTU Byg. Together with colleagues and students, he has achieved an extensive knowledge of Integrated Design. In fact, the situation is that our knowledge...

  19. 从婴儿车到轮椅——探索不同生活阶段的消费行为

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    人生的不同阶段,尤其是各个阶段之间的转换.当体现为消费者的消费行为时,便具备了很高的重要性。如今的现代生活囊括了17种不同的生活阶段。战略学,组织学和领导学博士,以及丹麦peigruppen集团顾问Louise Byg Kongsholm在她的著作《从婴儿车到轮椅》(From Pram to Wheel Chair)中,为人们勾勒出了这十七个场景。

  20. A Study of E+A Galaxies Through SDSS-MaNGA Integral Field Spectroscopy

    Science.gov (United States)

    Wally, Muhammad; Weaver, Olivia A.; Anderson, Miguel Ricardo; Liu, Allen; Falcone, Julia; Wallack, Nicole Lisa; James, Olivia; Liu, Charles

    2017-01-01

    We outline the selection process and analysis of sixteen E+A galaxies observed by the Mapping Nearby Galaxies at the Apache Point Observatory (MaNGA) survey as a part of the fourth generation of the Sloan Digital Sky Survey (SDSS-IV). We present their Integral field spectroscopy and analyze their spatial distribution of stellar ages, metallicities and other stellar population properties. We can potentially study the variation in these properties as a function of redshift. This work was supported by the Alfred P. Sloan Foundation via the SDSS-IV Faculty and Student Team (FAST) initiative, ARC Agreement #SSP483 to the CUNY College of Staten Island. This work was also supported by grants to The American Museum of Natural History, and the CUNY College of Staten Island through The National Science Foundation.

  1. Multiple sclerosis after infectious mononucleosis

    DEFF Research Database (Denmark)

    Nielsen, Trine Rasmussen; Rostgaard, Klaus; Nielsen, Nete Munk

    2007-01-01

    BACKGROUND: Infectious mononucleosis caused by the Epstein-Barr virus has been associated with increased risk of multiple sclerosis. However, little is known about the characteristics of this association. OBJECTIVE: To assess the significance of sex, age at and time since infectious mononucleosis......, and attained age to the risk of developing multiple sclerosis after infectious mononucleosis. DESIGN: Cohort study using persons tested serologically for infectious mononucleosis at Statens Serum Institut, the Danish Civil Registration System, the Danish National Hospital Discharge Register, and the Danish...... Multiple Sclerosis Registry. SETTING: Statens Serum Institut. PATIENTS: A cohort of 25 234 Danish patients with mononucleosis was followed up for the occurrence of multiple sclerosis beginning on April 1, 1968, or January 1 of the year after the diagnosis of mononucleosis or after a negative Paul...

  2. Electronic Data Interchange (EDI): Using Electronic Commerce to Enhance Defense Logistics

    Science.gov (United States)

    1991-01-01

    AD-A238 559 Electronic Data Interchange (EDI) Using Electronic Commerce to Enhance Defense Logistics Judith E. Payne, Robert H. Anderson N STATEN= A... electronic commerce to enhance defense logistics / Judith L. Payne and Robert H, Anderson. "Prepared for the Assistant Sccretary of Defense (Production and...by RAND 1700 Main Street, P.O. Box 2138, Santa Monica, CA 90407-2138 | ,! R-4030-P&L Electronic Data Interchange (EDI) Using Electronic Commerce to

  3. Misty – museets nye dinosaur

    DEFF Research Database (Denmark)

    Lindow, Bent Erik Kramer

    2014-01-01

    I november 2013 fi k Statens Naturhistoriske Museum en 16 meter lang julegave – det meget velbevarede skelet af en langhalset dinosaur med kælenavnet ’Misty’. Købet af det enorme skelet var muligt takket være en meget generøs gave fra Det Obelske Familiefond. Denne artikel ser nærmere på Misty......, hvad man ved om langhalsede dinosaurer, og hendes fremtidige betydning for museets forskning og formidling....

  4. Serious Games

    DEFF Research Database (Denmark)

    Christensen, Jens

    Serious Games er et nyt it-forretningsområde, der siden årtusindskiftet er vokset frem, først i USA og dernæst i Vesteuropa og and i-lande. Til forskel fra computerspil er serious games ikke underholdning, men tænkt som et værktøj til støtte for statens og erhvervslivets forskellige funktioner. D...

  5. United States Air Force Research Initiation Program for 1988. Volume 3

    Science.gov (United States)

    1990-04-01

    Staten Island, College of - 1 Wayne State University - 1 Syracuse University - 1 Wesleyan College - 1 Taylor University - 1 West Florida, University of...University of - 4 Wilberforce University - 1 Towson State University - 1 Wisconsin-Madison, Univ. of - 1 Trinity University - 1 Wright State University - 5...combustion) Specialty: Mechanical Engineering Dr. Wayne A. Eckerle Dr. Cheng-Hsiao Wu (1987) Clarkson University University of Missouri Sx ialty: Experimental

  6. Guanidino Groups Greatly Enhance the Action of Antimicrobial Peptidomimetics Against Bacterial Cytoplasmic Membranes

    Science.gov (United States)

    2014-05-28

    defibrinated horseblood (Statens Seruminstitut REF23699) to ensure growth of Bacillus cereus and Streptococcus pyogenes. Brain Heart Infusion (CM1135...Institute, Copenhagen, Denmark]. i B. cereus = Bacillus cereus ATCC 11778. Table 2 Structural parameters of crystal monolayer lattice. Sample Peak position (Å...that causes 10% hemolysis, hRBCs = human red blood cells, ND = not determined. b Escherichia coli ATCC 25922. c Escherichia coli AAS-EC-009 [Extended

  7. Forøget egenkapital i banken - en ulempe for banken og dens kunder?

    DEFF Research Database (Denmark)

    Raaballe, Johannes

    2013-01-01

    . Danske bankers internationale konkurrenceevne vil ikke lide skade, måske tværtimod. De største bankers rentabilitet vil dog forringes en smule, men det skyldes, at højere egenkapital i disse banker indebærer, at disse banker da ikke længere vil modtage et ”too big to fail” subsidium fra staten. Vil...

  8. Præstation - nøglen til det gode liv?

    DEFF Research Database (Denmark)

    Boie, Mette Alma Kjærsholm; Wiberg, Merete

    2014-01-01

    Præstation – nøglen til det gode liv? Kapitlet analyserer præstationsbegrebet som etisk værdi, idet det diskuteres hvordan kravet om præstation både påvirker og udfordrer det etiske miljø i skolen. Det diskuteres, hvordan lærernes forståelse af ’det gode liv’ udfordres, i og med statens krav om p...

  9. Patent Statistics and IPR Laws Update Online

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    Patent Statistics Beginning from No.2 of 2005 of China Patents & Trademarks, the Statistics on Patent Applications & Grants in China, previously published under the column of Statistics, will be updated online, including the monthly Statistics on Patent Applications by Patent Category, the Patent Grants by Patent Category, the Domestic Patent Applications by Province, and the Overseas Patent Applications by Country, and their yearly statistics at www.cpt.cn or www.cpahkltd.com/cn/ Publications/staten.htm...

  10. Kunstmuseet som læringsrum

    DEFF Research Database (Denmark)

    Bernhardt, Nana

    2016-01-01

    Hvordan kan et kunstmuseum være en værdifuld kulturskabende og vidensbærende læringsaktør og hjælpe til at bringe verden ind i skolen og skolen ud i verden? Artiklen forsøger at besvare spørgsmålene gennem praksisnære eksempler fra museumsundervisningen på Statens Museum for Kunst....

  11. Haw

    DEFF Research Database (Denmark)

    Højrup, Thomas

    2008-01-01

       Den 26. oktober vil for eftertiden blive en skelsættende dato i dansk fiskeri. Indtil da var dansk fiskeri baseret på en af staten beskyttet fri fangstret - og havde været det i størstedelen af det andet årtusinde e.kr. Denne nat blev det besluttet for fremtiden at basere fiskeriet på privat...

  12. Thorupstrand Kystfiskerlaug og Han herred Havbåde

    DEFF Research Database (Denmark)

    Højrup, Thomas

    2009-01-01

       Den 26. oktober vil for eftertiden blive en skelsættende dato i dansk fiskeri. Indtil da var dansk fiskeri baseret på en af staten beskyttet fri fangstret - og havde været det i størstedelen af det andet årtusinde e.kr. Denne nat blev det besluttet for fremtiden at basere fiskeriet på privat...

  13. 香蕉枯萎病拮抗内生菌的分离、筛选及盆栽防效试验%Isolation, screen and potted test of an endophytic bacterial against Fusarium oxysporum.

    Institute of Scientific and Technical Information of China (English)

    谢颖; 张孝峰; 王瑀莹; 张俊威; 骆焱平

    2011-01-01

    Endophytic bacteria were isolated from Codiaeum variegatum, Alpinia oxyphylla, Cinnamomum burmannii, Areca catechu, Cocos nucifera, Artocarpus heterophyllus through surface disinfection method. 91 endophytes were isolated, which included 38 endophytic fungi, 45 endophytic bacteria and 8 endophytic actinomycetes. Antagonistic activity tried against Fusarium oxysporum f. sp. cabense. The results showed that: the inhibitory effect is not satisfactory about endophytic fungi and endophytic actinomycetes, the antagonistic bacteria YXG2 -3 was the best, inhibition zone reached up to 20 ram; followed by BYG2 -5,BYJ5 -1 ,YXJ2 -2. the potted plant was test about 4 strains of endophytic bacteria, control effect of YXG2 -3 were 63.8%, which were highly signif- icant compared with other bacteria.%采用组织表面消毒法分离变叶木、益智、阴香、槟榔、椰子和菠萝蜜6种植物的内生菌,获得91株内生菌,其中内生细菌45株,内生真菌38株,内生放线菌8株。以香蕉枯萎病菌(Fusarium oxysporumf.sp.cubense)为靶标菌,对分离的内生菌株进行皿内拮抗活性筛选,发现内生真菌、内生放线菌抑菌效果不理想,内生细菌YXG2—3拮抗效果最好,抑菌带达20mm,其次是BYG2—5、BYJ5—1、YXJ2—2。对4株内生细菌进行盆栽试验,发现菌株YXG2—3防效最好,达到63.8%,与其他处理达极显著水平。

  14. Økonomiske og miljømæssige konsekvenser af markedsordningerne i EU´s landbrugsreform

    DEFF Research Database (Denmark)

    Andersen, J. M.; Bruun, H. G.; Jensen, J. D.;

    Rapporten bidrager til belysningen af de økonomiske og miljømæssige konsekvenser af markedsordningerne i EU¡¦s landbrugsreform - Agenda 2000. Reformen er planlagt fuldt ud gennemført i år 2006, og til den tid forventes Vandmiljøplan II at være fuldt u......økonomiske og samfundsøkonomiske konsekvenser er estimeret via hhv. ESMERALDA (udviklet og vedligeholdt af Statens Jordbrugs- og Fiskeriøkonomiske Institut) og ADAM (udviklet og vedligeholdt af Danmarks Statistik)...

  15. Does the lead white on graphic art have a dark future?

    DEFF Research Database (Denmark)

    Vila, Anna; Ryhl-Svendsen, Morten; Buti, David

    the formation, in a very short time, of different types of dark spots on the lead white highlights. A recent systematic survey at SMK and the Danish Royal Library (RL) mapped the occurrence and degree of degradation on graphic art and photography and allowed to classify the lead white phenomena. Watercolor mock...... in the formation of lead sulphide (galena, PbS) [3]. Although the galena is the most frequently found degradation product associated to lead carbonate, brown lead dioxide (plattnerite, PbO2) can also be detected. Records from the last ten years on the Statens Museum for Kunst (SMK) graphic art collection revealed...

  16. Zikavirusepidemien

    DEFF Research Database (Denmark)

    Kronborg, Gitte; Fomsgaard, Anders

    2016-01-01

    Zika virus is endemic in several parts of the world. February 1, 2016 Zika virus was declared a public health emergency by the WHO. This declaration is mainly due to a convincing association between Zika virus infection during pregnancy and birth defects, like microcephaly, among some...... of the newborns. Imported cases of Zika virus infection to North America, Europe and Denmark have been described. The infection in itself is mild and self-limiting. The available diagnostic methods are under development, validation and evaluation. In Denmark, some promising diagnostics are available at Statens...

  17. La senda revolucionaria del liberalismo doceañista en España y México, 1820-1824

    OpenAIRE

    Frasquet, Ivana

    2008-01-01

    In this work we study the significance of the doceañista liberalism in the transformation of the Spanish monarchy, and in the construction of the Mexican State-nation from 1821. For that purpose, from the historical methodology we discuss the idea of «doceañista liberalism» while at the same time focusing on the relevance it acquired in the debates of the Mexican constituent Congress of 1822.

    En este estudio intentamos abordar la significación del liberalismo doceañista en ...

  18. Ny Mycoplasma Hyosynoviae vaccine forebygger ikke halthed

    DEFF Research Database (Denmark)

    Nielsen, Elisabeth Okholm; Lauritsen, Klara Tølbøll; Jungersen, Gregers

    Vaccination af smågrise mod Mykoplasma-ledbetændelser viste sig ikke at kunne forebyggede halthed hos slagtesvin. Smitte med Mycoplasma hyosynoviae (M. hyosynoviae) er ofte årsag til ledbetændelse hos slagtesvin. Der er ingen kommerciel vaccine til grise, der beskytter mod mykoplasma......-ledbetændelse. I et forskningsprojekt har forskere på Danmarks Tekniske Universitet udviklet en vaccine mod M. hyosynoviae. Vaccinen indeholder et hjælpestof, der er udviklet af Statens Seruminstitut. Den nye vaccine er testet i en slagtesvinebesætning. I alt 399 smågrise blev vaccineret med enten vaccine eller...

  19. Health literacy genom arbetsintegrerat lärande

    DEFF Research Database (Denmark)

    Eklund Karlsson, Leena; Crondahl, Kristine

    2014-01-01

    Statens offentliga utredningar har föreslagit en strategi där målet var att stänga välfärdsgapet mellan romer och andra grupper. Detta påstås dock att skulle ta minst en generation, eller 20 år och är en satsning på landsbasis. I detta kapitel beskrivs ett projekt med samma målsättning, fastän på...... romers health literacy vilket fungerade som en katalysator för empowerment....

  20. The construction of identities, a task attributed to the school and the teachers

    Directory of Open Access Journals (Sweden)

    Francisco Rodríguez Lestegás

    2008-04-01

    Full Text Available The traditional conceptualization of a collective identity linked to a state-nation is being seriously questioned. The vindication of specific identities on the part of several regional, ethnic or cultural groups coexists with a globalisation process that tends towards cultural standardization and the uniformity of ways of life and shared values. This paper deals with the process of incorporation of the knowledge of Europe into the school culture and the outstanding role of the school and the teachers in the construction of an intercultural European identity based on the acceptance of multiple simultaneous identities.

  1. Wooden Supports in 12th–16th-Century European Paintings

    DEFF Research Database (Denmark)

    2016-01-01

    Jacqueline Marette's Connaissance des primitifs par l'étude du bois du XIIe au XVIe siècle' (1961) is a unique resource on the history of painting techniques that combines scholarship in art history, conservation, and wood science. With support from the Getty Foundation's Panel Paintings Initiative......, the Centre for Art Technological Studies and Conservation (CATS) based at the Statens Museum for Kunst in Copenhagen, Denmark, released a new English translation of Marette's book as a free online publication, making this key reference tool accessible to a wider array of scholars. This expanded publication...

  2. Prosjektering og analyse av Nordøyvegen bru 3

    OpenAIRE

    Lauknes, Andreas; Arild, Audun

    2016-01-01

    Rapporten tar for seg prosjektering av en etteroppspent betongbru, der beregninger og dimensjoneringen er i henhold til det Europeiske regelverket, nasjonale tillegg og Håndbøker fra Statens vegvesen. Brua som skal dimensjoneres og bli gjort kapasitetskontroll for er Nordøyvegen bru 3, som skal bygges som en del av et større fastlandsprosjekt for nordøyene i Haram kommune. Brua skal bygges som en bjelke-/platebru, og konstruksjonsmetoden er fritt frambygg med totalt syv byggefaser. Den består...

  3. Operable Unit C Remedial Investigation Sampling and Analysis Plan

    Science.gov (United States)

    1994-05-02

    RI will be brought to the attention of the Well Abandonmetnt Team so they can be properly decommissioned . 1.3 Updates to the OU C RI SAP As the current...OUcsA•2I•r2944a 5.1-7 TABLE 5.1-2. (Continued) DATA QUALITY OBJECTIVES FOR PFR 65 Problen Statenent If hazardous materials were disposed at PRL 65, the...Summary: Decommissioning plans for BW-6, BW-16, and boring DEB-C1 (possible conduits for contaminant migration) should be provided. Response: Text has been

  4. Opportunities for offshore wind energy at the East Coast [of North America]; Offshore wind kansen aan de oostkust [van Noord-Amerika

    Energy Technology Data Exchange (ETDEWEB)

    Van der Meij-Kranendonk, J. [TWA Netwerk, Washington (United States)

    2012-01-15

    This report of the 5th North American Offshore Wind Executive Forum of 23 January 2012 offers an overview of the state of affairs with regard to offshore wind energy in the states of Maryland, Maine New Jersey, Virginia, North Carolina and the Great Lakes [Dutch] Dit verslag van het 5th North American Offshore Wind Executive Forum op 23 januari 2012 geeft een overzicht van de situatie op het gebied van offshore windenergie in de staten Maryland, Maine, New Jersey, Virginia, North Carolina en de Great Lakes.

  5. Kombineret dagslys og intelligent LED belysning - få dagslys ind i bygningerne

    DEFF Research Database (Denmark)

    Dam-Hansen, Carsten; Corell, Dennis Dan; Thorseth, Anders;

    the following partners: DTU Fotonik, Statens Byggeforsknings‐institut, Rambøll Danmark, Energirådgiveren and Philips Lighting Denmark. The project has been led by DTU Fotonik, Senior scientist, Ph.d. Carsten Dam‐Hansen The project was financed by the Danish Energy Association through Elforsk’s PSO program......, under actions 1. Buildings, 3. Lighting and 5. Power and control electronics. The project has no. PSO 342‐044 and PSO 344‐ 007. It was initiated in February 2010 and was ended in March 2013. In the first part of the report a short resume of the project is given, describing the background and aim...

  6. El Sistema inspirerede projekter

    DEFF Research Database (Denmark)

    Holst, Finn; Chemi, Tatiana

    Rapporten er resultat af pilotprojektet ”Forundersøgelse El Sistema DK” gennemført af Ph.D. Finn Holst (DPU, Aarhus Universitet) og Ph.D. Tatiana Chemi (Aalborg Universitet) i 2015. I rapporten indgår desuden bidrag fra Sofie Holm, Sara Fink Søndergaard og Stine Møgelbjerg Johansen. Pilotprojektet...... er gennemført for DMKLs El Sistema-udvalg med støtte fra Statens Kunstfond, Projektstøtteudvalget for Musik....

  7. Typing of vancomycin-resistant enterococci from Danish hospitals

    DEFF Research Database (Denmark)

    Lester, Camilla H.; Olsen, Stefan S.; Schønheyder, Henrik Carl;

    2009-01-01

    complex 17 (CC17) has been associated with nosocomial outbreaks in five continents. The aim of the present study was to elucidate the molecular epidemiology of VRE in Denmark. Methods: From January 2005 through October 2008, 61 vancomycin resistant enterococcal isolates causing invasive as well as non......-invasive infections were referred by seven of the 15 Danish departments of clinical microbiology to Statens Serum Institut. All isolates were identified to species level by PCR, MICs of vancomycin were determined (Trek Diagnostic Systems, UK), and the presence of vanA, vanB and vanC genes were detected by PCR. Multi...

  8. Nuclear program of Iran. Towards de-escalation of a nuclear crisis. Advisory letter; Nucleair programma van Iran. Naar de-escalatie van een nucleaire crisis. Briefadvies

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2012-04-15

    The Dutch government, partly at the request of the House of Representatives (Second Chamber), the AIV asked to give an opinion about the position of Iran in the region and the role of the nuclear program of Iran in the geopolitical relations, in view of the most recent developments [Dutch] De Nederlandse regering heeft, mede op verzoek van de Tweede Kamer der Staten-Generaal, de AIV gevraagd advies uit te brengen over de positie van Iran in de regio en de rol van het nucleaire programma van Iran in de geopolitieke verhoudingen hierin, mede gelet op de meest recente ontwikkelingen.

  9. Terra nullius, Inuit Habitation and Norse Occupation – With Special Emphasis on the 1933 East Greenland Case

    Directory of Open Access Journals (Sweden)

    Peter Thomas Ørebech

    2016-05-01

    Full Text Available Sovereignty acquired by occupation entails “recognize[d] title based on discovery,” “a reasonable period [of] … effective occupation of the region claimed to be discovered” and “the continuous and peaceful display of State authority.” Only terra nullius is subject to occupation. A territory inhabited by indigenous groups that sustain social and political organization may impede an occupying power because the terra nullius requirement fails. While sovereignty over thinly populated areas are often lax, case law requires less public involvement in these sparsely inhabited areas. This study reveals that the Dano-Norwegian Kings regarded the Inuit as “our subjects.” The Kings’ pretention of absolutum dominium and jurisdiction involved both the Norse and Inuit ethnic groups and “bygð ok ubygð” (settled and unsettled land. The exodus of the Norse peoples in 1450 AD for 200 years did not undermine the acquired sovereignty of the Dano-Norwegian Crown, which as a result, spoiled the 1931 Norwegian pretentions to legally occupy East-Greenland. Denmark's triumph in the 1933-East Greenland case resulted from a “zero-sum principle.” More than a 100 years earlier, the Danish Kingdom lost a succession of countries and dependencies. The 1814 Kiel Treaty transferred mainland Norway to Sweden, but explicitly states that none of the ancient Norwegian dependencies, Greenland, Iceland and Faroe Islands would follow suit. Thus, these territories remained part of the Kingdom of Denmark.

  10. Changes in rice allelopathy and rhizosphere microflora by inhibiting rice phenylalanine ammonia-lyase gene expression.

    Science.gov (United States)

    Fang, Changxun; Zhuang, Yuee; Xu, Tiecheng; Li, Yingzhe; Li, Yue; Lin, Wenxiong

    2013-02-01

    Gene expression of phenylalanine ammonia-lyase (PAL) in allelopathic rice PI312777 was inhibited by RNA interference (RNAi). Transgenic rice showed lower levels of PAL gene expression and PAL activity than wild type rice (WT). The concentrations of phenolic compounds were lower in the root tissues and root exudates of transgenic rice than in those of wild type plants. When barndyardgrass (BYG) was used as the receiver plant, the allelopathic potential of transgenic rice was reduced. The sizes of the bacterial and fungal populations in rice rhizospheric soil at the 3-, 5-, and 7-leaf stages were estimated by using quantitative PCR (qPCR), which showed a decrease in both populations at all stages of leaf development analyzed. However, PI312777 had a larger microbial population than transgenic rice. In addition, in T-RFLP studies, 14 different groups of bacteria were detected in WT and only 6 were detected in transgenic rice. This indicates that there was less rhizospheric bacterial diversity associated with transgenic rice than with WT. These findings collectively suggest that PAL functions as a positive regulator of rice allelopathic potential.

  11. Solar/electric heating systems for the future energy system

    DEFF Research Database (Denmark)

    Furbo, Simon; Dannemand, Mark; Perers, Bengt

    The project “Solar/electric heating systems in the future energy system” was carried out in the period 2008‐2013. The project partners were DTU Byg, DTU Informatics (now DTU Compute), DMI, ENFOR A/S and COWI A/S. The companies Ajva ApS, Ohmatex ApS and Innogie ApS worked together with the project...... partners in two connected projects in order to develop solar/electric heating systems for laboratory tests. The project was financed by the Danish Agency for Science, Technology and Innovation under the Danish Council for Strategic Research in the program Sustainable Energy and Environment. The DSF number...... of the project is 2104‐07‐0021/09‐063201/DSF. This report is the final report of the project. The aim of the project is to elucidate how individual heating units for single family houses are best designed in order to fit into the future energy system. The units are based on solar energy, electrical heating...

  12. Case of early-disseminated Rhizopus microsporus var. microsporus mucormycosis in a renal transplant patient

    Directory of Open Access Journals (Sweden)

    Sharma D

    2016-06-01

    Full Text Available Dikshya Sharma,1 Kumud Dahal,2 Bandana Pathak,3 Udip Dahal4 1Staten Island University Hospital, Staten Island, NY, 2University of Illinois College of Medicine, 3OSF Saint Francis Medical Center, Peoria, IL, 4University of Utah, Salt Lake City, UT, USA Abstract: Mucormycosis is a rare infection caused by the ubiquitous filamentous fungi of the order Mucorales and class Zygomycetes. These species are vasotropic, causing rapid onset of tissue infarctions and necrosis and subsequent thrombosis by invading vascular bed. The disease spectrum ranges from involvement of skin, sinuses, lung, and brain to disseminated and mostly fatal infections, especially in immunocompromised hosts. Here, we present a case of a fatal disseminated mucormycosis in a 56-year-old female who had deceased donor renal allograft transplantation ~2 weeks prior to presentation. She presented with shortness of breath and dry cough. Despite being on broad-spectrum antibiotics/antifungals and proper management by transplant, infectious disease, and primary team, she died within 3 weeks of admission. Autopsy showed disseminated mucormycosis of lungs and thyroid. Disseminated infection within 2 weeks of solid organ transplantation in this patient was one of the rare features of mucormycosis. Keywords: Zygomycetes, immunocompromised, transplant

  13. A critical review on the consensus around the «Westphalian system»

    Directory of Open Access Journals (Sweden)

    Luís Moita

    2012-01-01

    Full Text Available The Thirty Years’ War, which devastated Europe between 1618 and 1648, was a complex conflict: it was a religious war; it involved the main powers of the time, dynasty rivalries and rebellions from princes against the Emperor of the Holy Roman-German Empire. There is a consensus in viewing the Peace of Westphalia, which ended the war, as a decisive moment in the history of international relations and the majority of authors considers it the starting point of the modern State-Nation system, sovereign states which have jurisdiction over a territory, which were usually secular and related to one another according to the principle of the balance of power. A critical review of this consensus leads to question each of the above mentioned topics and conclude that the common interpretation has retrospectively transposed political processes which took place only later. In fact, it is likely that, in the 17th century, the pre-modern princely State is still dominant, which will then lead to the modern State-Nation system, a consequence of the emergence of industrial society and nationalism. One may even consider that the Peace of Westphalia delayed the constitution of national States, as far as Germany is concerned. Therefore, to use the terms “Westphalian state” and “Westphalian system” seems rather unadvisable.

  14. Is kidney function affecting the management of myocardial infarction? A retrospective cohort study in patients with normal kidney function, chronic kidney disease stage III–V, and ESRD

    Directory of Open Access Journals (Sweden)

    Saad M

    2016-01-01

    Full Text Available Marc Saad,1 Boutros Karam,1 Geovani Faddoul,2 Youssef El Douaihy,1 Harout Yacoub,1 Hassan Baydoun,3 Christine Boumitri,1 Iskandar Barakat,1 Chadi Saifan,4 Elie El-Charabaty,4 Suzanne El Sayegh4 1Department of Internal Medicine, Staten Island University Hospital, Staten Island, 2Department of Nephrology, Icahn School of Medicine, New York, NY, 3Department of Cardiology, Tulane University Medical Center, New Orleans, LA, 4Department of Nephrology, Staten Island University Hospital, Staten Island, NY, USA Abstract: Patients with chronic kidney disease (CKD are three times more likely to have myocardial infarction (MI and suffer from increased morbidity and higher mortality. Traditional and unique risk factors are prevalent and constitute challenges for the standard of care. However, CKD patients have been largely excluded from clinical trials and little evidence is available to guide evidence-based treatment of coronary artery disease in patients with CKD. Our objective was to assess whether a difference exists in the management of MI (ST-segment elevation myocardial infarction and non-ST-segment elevation myocardial infarction among patients with normal kidney function, CKD stage III–V, and end-stage renal disease (ESRD patients. We conducted a retrospective cohort study on patients admitted to Staten Island University Hospital for the diagnosis of MI between January 2005 and December 2012. Patients were assigned to one of three groups according to their kidney function: Data collected on the medical management and the use of statins, platelet inhibitors, beta-blockers, and angiotensin converting enzyme inhibitors/angiotensin receptor blockers were compared among the three cohorts, as well as medical interventions including: catheterization and coronary artery bypass graft (CABG when indicated. Chi-square test was used to compare the proportions between nominal variables. Binary logistic analysis was used in order to determine associations

  15. Antibacterial activity of eight Iranian plant extracts against methicillin and cefixime restistant Staphylococcous aureus strains

    Institute of Scientific and Technical Information of China (English)

    Morteza Shojaei Moghadam; Susan Maleki; Esmaeil Darabpour; Hossein Motamedi; Seyyed Mansour Seyyed Nejad

    2010-01-01

    Objective:To assess the antibacterial activity of eight Iranian plant extracts against Staphylococcus aureus (S. aureus)strains which were isolated from infected patients.Methods:The studied strains were isolated from urine, stool, blood and wound of infected patients and identified by biochemical tests. In further, the antibacterial activity of 8 ethanolic local plant extracts includingQuerqus brantii (Q. brantii),Ziziphus spina-christi (Z. spina-christi),Peganum harmala(P. harmala),Oliveira decumbens (O. decumbens),Galium tricornutum(G. tricornutum), Vitex pseudonegundo (Vi. pseudo negundo),Salvia officinalis (S. officinalis) ,Vaccaria pyramidata (V.pyramidata)were then evaluated using agar disc diffusion method.Results:A total of 9 isolates were isolated and identified asS. aureus. Antibacterial profile of the strains showed that the strains were resistant to methicillin and cefixime. The highest antibacterial activity against the studied strains were belong toQ. brantii,P. harmala,Z. spina-christi andO. decumbens vent extracts with 11-40 mm, 15-28 mm, 8-26 mm and 10-20 mm of diameters, respectively. Intermediate antibacterial activity was exhibited byG. tricornutum andVi. pseudo negundo against some of the studied strains with 7-20 mm and 7-13 mm of diameters, respectively. Noteworthy, out of 9 studied strains; 6 and 2 of them were resistant to theG. tricornutum andVi. pseudo negundo extracts, respectively. TheS. officinalis andVa. pyramidata, however, showed no antibacterial activity against the studied strains.Conclusions: TheQ. brantii,P. harmala,Z. spina-christi andO. decumbens extracts were shown to possess strong antibacterial activity against methicillin and cefixime resistant S. aureus strains and can be considered as the promising natural antibiotics for treating the studied strains.

  16. Lethal response of the dengue vectors to the plant extracts from family Anacardiaceae

    Institute of Scientific and Technical Information of China (English)

    Ali Yousaf; Wan Fatma Zuharah

    2015-01-01

    Objective:To explore the larvicidal activities of different plant parts ofMelanochyla fasciculiflora(M. fasciculiflora),Gluta renghas(G. renghas),Anacardium occidentale and Mangifera indica from family Anacardiaceae against the laboratory and field strains of dengue vectorsAedes aegyptiandAedes albopictus(Ae. albopictus). Methods: Leaves and bark parts of study plants were collected from Taman Nageri, Bukit Pancor and Teluk Bahang National Park, Penang, Malaysia. Leaves and stem barks were separated, air dried, ground and extracted with methanol by Soxhlet apparatus. Crude extract was obtained by evaporating the extra solvent in rotary evaporator. The 4th instar larvae from laboratory and field strains were exposed to 50-1 300 mg/L concentrations according to World Health Organization standard larval bioassay. Larval mortality was recorded after 24 h of exposure. Results: Highest larvicidal activity was exhibited byG. renghas bark extract againstAe. albopictus laboratory strain at 600 mg/L.G. renghas also showed the highest larvicidal activities for other strains as compared to other plant extracts, followed byMangifera indica andM. fasciculilfora andAnacardium occidentale. Conclusions:Ae.albopictus has been found to be more susceptible as compare toAedes aegypti in both laboratory and field strains in this study.G. renghas andM. fasciculiflora were tested for the first time and exhibited prompting larvicidal activities against dengue vectors. These results revealed that all the plants especiallyG. renghas andM. fasciculilfora have the higher larvicidal activities and can be used for the control of dengue vector as a new environment friendly, target specific and low cost phytochemical.

  17. Specific T-cell epitopes for immunoassay-based diagnosis of Mycobacterium tuberculosis infection

    DEFF Research Database (Denmark)

    Brock, I; Weldingh, K; Leyten, EM;

    2004-01-01

    Specific T-cell epitopes for immunoassay-based diagnosis of Mycobacterium tuberculosis infection.Brock I, Weldingh K, Leyten EM, Arend SM, Ravn P, Andersen P. Department of Infectious Disease Immunology, Statens Serum Institute, Artillerivej 5, DK-2300 Copenhagen S, Denmark. The currently used...... method for immunological detection of tuberculosis infection, the tuberculin skin test, has low specificity. Antigens specific for Mycobacterium tuberculosis to replace purified protein derivative are therefore urgently needed. We have performed a rigorous assessment of the diagnostic potential of four...... recently identified antigens (Rv2653, Rv2654, Rv3873, and Rv3878) from genomic regions that are lacking from the Mycobacterium bovis bacillus Calmette-Guerin (BCG) vaccine strains as well as from the most common nontuberculous mycobacteria. The fine specificity of potential epitopes in these molecules...

  18. Comparison of the Denka Seiken slide agglutination method to the quellung test for serogrouping of Streptococcus pneumoniae isolates.

    Science.gov (United States)

    Shutt, Cheryl K; Samore, Matthew; Carroll, Karen C

    2004-03-01

    This study compared a slide agglutination test (Denka Seiken, Tokyo, Japan) to the "gold standard" quellung reaction (Pneumotest; Statens Serum Institut, Copenhagen, Denmark) for the serogrouping of pneumococci. Two hundred clinical isolates of Streptococcus pneumoniae were used for the comparison. Each assay was performed according to the manufacturer's instructions. There was an overall agreement of 95.7% between the two methods. Only 4 of 10 isolates of serogroup 22 were detected with the slide agglutination assay. Two isolates that were untypeable by the Pneumotest method were typed as serogroups 6 and 31 by the slide agglutination method. The Pneumotest method was unable to type 22 isolates, and the slide agglutination method was unable to type 16 isolates. The slide agglutination method compares favorably with the Pneumotest method and is easier to perform and to interpret.

  19. Innovation on Smart Grids and energy storage. IA Special; Innovation on Smart Grids and energy storage. IA Special

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2012-11-15

    In this special edition of the Innovation Network Attache a large number of short articles on aspects of ICT aspects of intellligent energy networks, the security and integrity of the use and control of those networks, and energy storage. In this special an overview is given of the most important developments in Israel, Russian Federation, Brazil, Netherlands, France, Germany, Singapore, Japan, Taiwan, China, South Korea, India, United States and Canada [Dutch] In deze special van het Innovation Attache Netwerk een groot aantal korte artikelen over de ICT aspecten van intellligente energie netten, de veiligheid en integriteit van het gebruik en sturing ervan, en energie opslag. In de special een overzicht van in het oog springende ontwikkelingen in de landen Israel, Rusland, Brazilie, Nederland, Frankrijk, Duitsland, Singapore, Japan, Taiwan, China, Zuid-Korea, India, Verenigde Staten en Canada.

  20. Autism Spectrum Disorders and Maternal Serum α-Fetoprotein Levels During Pregnancy

    DEFF Research Database (Denmark)

    Abdallah, Morsi; Grove, Jakob; Hougaard, David M

    2011-01-01

    Objective: Numerous studies have been trying to disentangle the complex pathophysiology of autism spectrum disorders (ASD). In our study, we explored the potential role of maternal serum (MS) α-fetoprotein (AFP) in the prediction and the pathophysiology of ASD. Methods: A total of 112 patients...... with ASD and 243 control subjects were included in a case–control study using a historic birth cohort maintained at Statens Serum Institute. Measurements of MS-AFP were obtained from a multicentre screening program, whereas clinical data were obtained from nationwide registers. Association between MS-AFP...... and ASD status was analyzed using a logistic regression model and nonparametric tests. Results: Crude, but not adjusted estimates, showed that MS-AFP levels were slightly, but significantly, higher in mothers of children with ASD, compared with their control subject counterparts. People with ASD had...

  1. Autism Spectrum Disorders and Maternal Serum alpha-Fetoprotein Levels During Pregnancy

    DEFF Research Database (Denmark)

    Abdallah, Morsi; Grove, Jakob; Hougaard, David M

    2011-01-01

    Objective: Numerous studies have been trying to disentangle the complex pathophysiology of autism spectrum disorders (ASD). In our study, we explored the potential role of maternal serum (MS) alpha-fetoprotein (AFP) in the prediction and the pathophysiology of ASD. Methods: A total of 112 patients...... with ASD and 243 control subjects were included in a case-control study, using a historic birth cohort maintained at Statens Serum Institute. Measurements of MS-AFP were obtained from a multicentre screening program, whereas clinical data were obtained from nationwide registers. Association between MS-AFP...... and ASD status was analyzed using logistic regression models and nonparametric tests. Results: Crude, but not adjusted, estimates showed that MS-AFP levels were slightly, but significantly, higher in mothers of children with ASD, compared with their control subject counterparts. People with ASD had...

  2. Rapid, Vehicle-Based Identification of Location and Magnitude of Urban Natural Gas Pipeline Leaks.

    Science.gov (United States)

    von Fischer, Joseph C; Cooley, Daniel; Chamberlain, Sam; Gaylord, Adam; Griebenow, Claire J; Hamburg, Steven P; Salo, Jessica; Schumacher, Russ; Theobald, David; Ham, Jay

    2017-04-04

    Information about the location and magnitudes of natural gas (NG) leaks from urban distribution pipelines is important for minimizing greenhouse gas emissions and optimizing investment in pipeline management. To enable rapid collection of such data, we developed a relatively simple method using high-precision methane analyzers in Google Street View cars. Our data indicate that this automated leak survey system can document patterns in leak location and magnitude within and among cities, even without wind data. We found that urban areas with prevalent corrosion-prone distribution lines (Boston, MA, Staten Island, NY, and Syracuse, NY), leaked approximately 25-fold more methane than cities with more modern pipeline materials (Burlington, VT, and Indianapolis, IN). Although this mobile monitoring method produces conservative estimates of leak rates and leak counts, it can still help prioritize both leak repairs and replacement of leak-prone sections of distribution lines, thus minimizing methane emissions over short and long terms.

  3. Violence and displacement: Towards a regional and local interpretation. The case of Risaralda and its capital Pereira

    Directory of Open Access Journals (Sweden)

    Luis Adolfo Martínez Herrera

    2006-07-01

    Full Text Available This dissertation tries to make an analysis about phenomenons of violence in the region of Risaralda and your capital Pereira. The established reflection is made by means of a historical view, a violence characterization and some of your causal explanations, a reflection where the main reference is the territory and your manifold scenes that conjugate actors crossing, interests and territorial dominions, besides, a migratory process by violence (displacement by violence that materializes the sequels of conflict, and finally, by means of a local view that recognizes in the globalized societies, new non regulated scenes of conflict by the state-nation. This analysis permits to recognize the territorial topics of control and dominion and it identifies some of the structural explanations that show continuities and discontinuities that have an effect on population of the region in a differentiated way. The reflection provokes new questions to guide next investigations in the region.

  4. Recreational drugs, methadone and protease inhibitors.

    Science.gov (United States)

    Timour, K

    1998-01-01

    The Treatment Education Project, an initiative of the Staten Island AIDS Task Force, often responds to requests for information on the effects of recreational drugs on people taking anti-HIV medications. There is very little research on the topic because the drugs are illegal and the effects tested with chemically pure street drugs are not likely to mirror those in the population using varied strengths and qualities of the drugs. There have been some controlled studies with methadone, and there is a trial underway to test the use of Marinol and marijuana with Crixivan. The Treatment Education Project also provides counseling, maintains Internet sites in both English and Spanish, and sets up treatment libraries. They also provide workshops for social service agencies and staff.

  5. Evaluation of an immunochromatographic assay for rapid identification of Mycobacterium tuberculosis complex in clinical isolates.

    Science.gov (United States)

    Marzouk, Manel; Kahla, Imen Ben; Hannachi, Naila; Ferjeni, Asma; Salma, Walid Ben; Ghezal, Samira; Boukadida, Jalel

    2011-04-01

    Identification of Mycobacterium tuberculosis complex (MTC) remains slow. Over the years, several new technologies have been proposed to accelerate and simplify the detection of MTC. In this context, we evaluated an immunochromatographic assay (ICA) (BIO-LINE SD Ag MPT64 TB) for rapid identification of MTC, based on detection of a specific MPT64 antigen of MTC. We have tested it on i) mycobacterial cultures: 210 MTC strains and 28 nontuberculous mycobacteria; ii) M. bovis bacille Calmette-Guérin strain SSI (Statens Serum Institut, Denmark); and iii) 22 microorganisms other than mycobacteria, isolated from cultures. We concluded that this kit has an excellent specificity (100%) and sensitivity (99%) from isolated cultures. The ICA (BIO-LINE SD Ag MPT64 TB) allows excellent MTC identification from clinical isolates. It is a rapid, simple, and inexpensive test, and has a definite contribution in the rapid laboratory diagnosis of tuberculosis.

  6. New national Biobank of The Danish Center for Strategic Research on Type 2 Diabetes (DD2)

    DEFF Research Database (Denmark)

    Christensen, Henry; Nielsen, Jens Steen; Sørensen, Karina Meden;

    2012-01-01

    Long-term storage of biological samples from patients has become increasingly important in studies of disease control and treatment. The first nationwide Danish diabetes project, ie, The Danish Center for Strategic Research in Type II Diabetes (DD2), aims to improve treatment and the long...... received at the biobank, samples are frozen without further treatment. From each patient, 24 cryostorage tubes are stored. Each tube is labeled with a barcode that links the data to other information available in a clinical databank registry. When patients are enrolled in DD2, a questionnaire is filled out...... and a quality monitoring system ensures that patients, samples, and questionnaires can be linked together at all times. The biobank is located at Vejle Hospital and the Danish National Biobank at Statens Serum Institut. As of the end of March 2012, samples from 1186 patients have been stored, and currently...

  7. A Comparison of Radio-loud and Radio-quiet E+A Galaxies

    Science.gov (United States)

    Camacho, Yssavo; Wallack, Nicole; Learis, Anna; Liu, Charles

    2015-01-01

    E+A galaxies are systems undergoing an important evolutionary transition. Their optical spectra show significant numbers of A-type stars in an elliptical galaxy that has little to no star formation (SF). These galaxies have likely experienced a recent starburst (types. We find that the radio-loud and radio-quiet samples exhibit statistically insignificant differences in the optical, near-infrared, and mid-infrared bands. We also compare the two samples on a (J-H) vs. (H-K) color-color diagram. This work was supported by the National Science Foundation via grant AST-1004583 to the CUNY College of Staten Island, and grant AST-1004591 to the American Museum of Natural History.

  8. Radioecology in hte Arctic: Activities of the new environmental protection unit of the NRPA in Tromsoe[Norwegian RadiationProtection Authority

    Energy Technology Data Exchange (ETDEWEB)

    Gerland, S.; Lind, B. [Norwegian Radiation Protection Authority, Polar Environmental Centre, Environmental Proctection Unit, Tromsoe (Norway)

    2002-04-01

    In August 1999, the Norwegian Radiation Protection Authority (Statens straelevern) established an Environmental Protection Unit in the Polar Environmental Centre in Tromsoe, northern Norway. Major tasks of the three persons at the unit include monitoring and research in both marine and terrestrial environments in northern Eurasian areas and the Arctic. This includes field and laboratory work, collaboration with the other institutions within the Polar Environmental Centre (e.g. the Norwegian Polar Institute), and integrating studies within the AMAP programme. The Environmental Protection Unit was recently involved in fieldwork in Kongsfjorden (Svalbard), an international cruise to the Fram Strait, a technetium monitoring program in the Western Barents Sea, and radiation measurements on the site in the Barents Sea where the Russian submarine 'Kursk' sunk. (LN)

  9. They fight because we let them! Applying a situational crime prevention model to barroom violence.

    Science.gov (United States)

    Graham, Kathryn

    2009-03-01

    This paper draws on situational crime prevention and social interactionist theories to develop a theoretical model for preventing aggression and injury in licensed drinking establishments. The model includes six components: (i) the presence of willing participants; (ii) the role of guardians, handlers and place managers; (iii) environmental deterrents of aggression; (iv) environmental precipitators of aggression; (v) theories regarding the effects of alcohol that contribute to increased risk of aggression; and (vi) social interaction theory relevant to the process of aggressive incidents in drinking establishments. The model provides a basis for developing a range of strategies to reduce barroom aggression that includes but is not restricted to addressing the role of alcohol. The paper discusses how these strategies can be developed and implemented through interventions, programs, policies or regulations at the level of the drinking establishment, the community level or the state/national level.

  10. The Constitution of Partnering

    DEFF Research Database (Denmark)

    Gottlieb, Stefan Christoffer

    promoveret af branchen og af staten som et væsentligt led i udviklingen af byggeriets arbejdsformer. Med et udgangspunkt i en Foucauldiansk analyse af dispositiver, rum og orden bidrager afhandlingen med en ny differentieret forståelse af mulighederne for at håndtere branchens modsætningsfyldte fornyelse...... om, hvordan partnering som koncept er fremkommet og har udviklet sig og hvilke konstitutive effekter partnering har på byggeriets praksis. Det teoretiske udgangspunkt i Foucault begrundes i behovet for at fastholde en mangefacetteret og historisk analyse af partnering i modsætning til de...... fremherskende endimensionelle og rationelle forståelser, som ikke svarer til den oplevede og observerede praksis i byggebranchen. I afhandlingens første del diskuteres den analytiske anvendelse af et teoretisk nøglebegreb fra Foucault i analysen af partnering; dispositivet. Hermed forstås de bagvedliggende...

  11. Practical usage of computer-supported outbreak detection in five European countries.

    Science.gov (United States)

    Hulth, A; Andrews, N; Ethelberg, S; Dreesman, J; Faensen, D; van Pelt, W; Schnitzler, J

    2010-09-09

    This paper discusses computer-supported outbreak detection using routine surveillance data, as implemented at six institutes for infectious disease control in five European countries. We give an overview of the systems used at the Statens Serum Institut (Denmark), Health Protection Agency (England, Wales and Northern Ireland), Robert Koch Institute (Germany), Governmental Institute of Public Health of Lower Saxony (Germany), National Institute for Public Health and the Environment (the Netherlands) and Swedish Institute for Infectious Disease Control (Sweden). Despite the usefulness of the algorithms or the outbreak detection procedure itself, all institutes have experienced certain limitations of the systems. The paper therefore concludes with a list of recommendations for institutes planning to introduce computer-supported outbreak detection, based on experiences on the practical usage of the systems. This list--which concerns usability, standard operating procedures and evaluation--might also inspire improvements of systems in use today.

  12. Study Fails to Link ILL Usage Patterns to Liaison Activities. A Review of: Leykam, Andrew. “Exploring Interlibrary Loan Usage Patterns and Liaison Activities: The Experience at a U.S. University.” Interlending & Document Supply 36.4 (2008: 218-24.

    Directory of Open Access Journals (Sweden)

    Scott Marsalis

    2009-06-01

    Full Text Available Objective - To investigate Interlibrary Loan (ILL usage patterns, and connect them to liaison activities beyond collection development.Design – Pattern analysis of ILL requests.Setting – Library of The College of Staten Island, a mid-size, public university with predominantly undergraduate enrolment.Subjects – 4,875 identifiable requests over a three-year period.Methods – A data set of requests for ILLs of monographs over a period of three years was acquired from OCLC resource sharing statistics. This data was manually reviewed to remove duplicate records of the same request, but not multiple requests for the same item. The data included requestor status, department, publication date and subject classification of requested items.Main Results – Differences in use across user statuses and departments were identified.Conclusion – Usage Patterns can accurately illustrate trends in the borrowing behaviour of patrons, and be used to inform liaison librarians about user needs.

  13. Recurrent invasive pneumococcal disease in children

    DEFF Research Database (Denmark)

    Ingels, Helene; Lambertsen, Lotte; Harboe, Zitta B;

    2014-01-01

    %, and 78% of the cases would have been covered by the 7-, 10-, and 13-valent pneumococcal conjugate vaccines, respectively. Conclusions: Of children with an IPD episode, 2.4% experienced rIPD, and an underlying disease was documented in 66% of these children. Investigation of underlying conditions...... laboratory-confirmed cases of IPD in children aged 0-15 y were identified from the Neisseria and Streptococcus Reference Laboratory, Statens Serum Institut, Denmark for the period 1980-2013. rIPD was defined as isolation of Streptococcus pneumoniae from any normally sterile site ≥ 30 days after an initial...... positive culture. Clinical data were obtained for all children with rIPD. Results: Of all children with IPD, 2.4% (59/2418) experienced at least 1 episode of rIPD, and an underlying condition was documented in 39 (66%). Immune deficiency due to transplantation (n = 9) was the most common disease; however...

  14. Social- og sundhedsprofessioner, videnskab, teknologier og nye udfordringer

    DEFF Research Database (Denmark)

    Larsen, Kristian

    2015-01-01

    , organisationsstudier mv. De primære empiriske tilgange udgøres af fokusgruppeinterviews af faggrupperne, men der indgår også review af relevant forskning, dokumentanalyser (fra professionerne, uddannelserne, erhverv/klinik og policy dokumenter) herunder historisk kildemateriale. Transskriberinger er blevet forelagt på...... praksisteori (1977, 1990), studier af social lidelse (1999) herunder distinktionen mellem statens højre og venstre hånd (Bourdieu 2010; Arnholtz Hansen og Hammerslev 2010; Wacquant 2009). Der indgår også en del inspiration fra sociologiens klassikere som Weber (1995/1920) fra professionsforskere (fx Abbott...... aktive brugere, klienter og patienter både indgår som med- og modspillere i professionernes bestræbelser på at fastholde og styrke autoriteten. I de fleste policy dokumenter, undervisningsmaterialer og lærebøger beskrives brugere, klienter og patienter som objekter for intervention om end der er...

  15. Implementation of wind energy in relation with the Crisis and Recovery Law and the Electricity Law 1998. Annex 4 to 'Fast fitting-in of wind energy?'; Uitvoering windenergie in relatie tot Crisis- en herstelwet en Elektriciteitswet 1998. Bijlage 4 bij 'Windenergie sneller ingepast?'

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2010-09-15

    For the Dutch provinces of Groningen, Drenthe, Friesland, Overijssel, Gelderland, Utrecht, Flevoland, Noord Brabant, Limburg, Zeeland, Zuid Holland and Noord Holland it is described how the Provincial States of the provinces apply the implementation of Article 9 of the 1998 Electricity Law with respect to wind energy. It is also described what the constraints are, what the conclusion is and what recommendations are given in order to stimulate the implementation in the spirit of the Crisis and Recovery Act. [Dutch] In dit rapport wordt voor de provincies Groningen, Drenthe, Friesland, Overijssel, Gelderland, Utrecht, Flevoland, Noord Brabant, Limburg, Zeeland, Zuid Holland, en Noord Holland beschreven hoe de Provinciale Staten van de provincies toepassing geven aan de uitvoering van artikel 9e van de Elektriciteitswet voor het onderdeel windenergie. Ook wordt beschreven welke belemmeringen er zijn, wat de conclusie is en welke aanbevelingen zijn gegeven om de toepassing in de geest van de Crisis- en Herstel Wet te bevorderen.

  16. 大自然容忍经遗传工程改造的昆虫吗?

    Institute of Scientific and Technical Information of China (English)

    Trevor Thieme; 蓝彧祥

    2002-01-01

    过去7年以来,美国农业部动植物卫生检查处技术援助实验室主任罗伯顿·斯特顿(Robert Staten)和加州大学的同事们一直在修理棉红铃虫的DNA,棉红铃虫是一种与柠檬种子大小差不多、正在毁坏整个美国西南部棉花作物的令人讨厌的昆虫。例如,加州的帝国流域曾经是10万余英亩棉花的基地,但现已

  17. Constitutionalism, State and territory in the globalization context

    Directory of Open Access Journals (Sweden)

    William Guillermo Jiménez

    2012-12-01

    Full Text Available Globalization shows that the national State is losing the monopoly in the production of law, and this generates changes concerning the environment of application of the state legal arrangements and the role of the territory as the limit thereof. The object of this work is to offer a panorama about of the law globalization impacts on the State, the constitutional theory and the territory. The study is performed by means of the documentary review technique by using the consultation of diverse sources. Our conclusion is that the Westphalian model of State-nation has been weakened; however, globalization needs the State to be able to operate. Law has been deterritorialized and the territory continues to be a fundamental element for the contemporary State.

  18. Magt, medborgerskab og muslimske friskoler

    DEFF Research Database (Denmark)

    Ihle, Annette Haaber

    større forskningsfelt, som studiet af religiøst baserede skoler, til forskel fra, hvad der er gældende i Danmark, udgør i Sverige, Holland, England og USA. Den konfessionelle skole som rum for samfundsmæssige identitetskonstruktioner har derimod, så vidt vides, aldrig tidligere været genstand for hverken...... samfund. Dermed er både staten og den brede offentlighed aktive i skabelsen af islam som praksis i den muslimske friskole. De efterfølgende arbejdspapirer vil afdække de forståelser af medborgerskab, der konstrueres i tre muslimske friskolers hverdag, af forældre, personale og elever, ved at analysere de...

  19. Specific T-cell epitopes for immunoassay-based diagnosis of Mycobacterium tuberculosis infection

    DEFF Research Database (Denmark)

    Brock, I; Weldingh, K; Leyten, EM

    2004-01-01

    Specific T-cell epitopes for immunoassay-based diagnosis of Mycobacterium tuberculosis infection.Brock I, Weldingh K, Leyten EM, Arend SM, Ravn P, Andersen P. Department of Infectious Disease Immunology, Statens Serum Institute, Artillerivej 5, DK-2300 Copenhagen S, Denmark. The currently used...... method for immunological detection of tuberculosis infection, the tuberculin skin test, has low specificity. Antigens specific for Mycobacterium tuberculosis to replace purified protein derivative are therefore urgently needed. We have performed a rigorous assessment of the diagnostic potential of four...... selected and combined the specific peptide stretches from the four proteins not recognized by M. bovis BCG-vaccinated individuals. These peptide stretches were tested with peripheral blood mononuclear cells obtained from patients with microscopy- or culture-confirmed tuberculosis and from healthy M. bovis...

  20. The role of geospatial data in management of Croatian national parks

    Directory of Open Access Journals (Sweden)

    Zoran ŠIKIĆ

    2013-12-01

    Full Text Available Nature protection, especially protection of most valuable parts enclosed in national parks and nature parks is today unthinkable without quality and updated geospatial data organized in efficient geographical information systems. Due to the fact that modern management today is based on geospatial information it resulted with definition of spatial data infrastructure concept. On the national level nature protection is also enclosed with national spatial data infrastructure so that creation and usage of geospatial information hast to be conducted in synergy between the stakeholders of the national infrastructure. For the purpose of synergetic cooperation models development and solving of present problems, Ministry of culture – Nature protection directorate, State geodetic administration and State institute for nature protection have in cooperation with the Norwegian mapping and cadastre authority (Statens kartverk accomplished PAMS (Protected Area Management System project on the location of National park Kornati. Results and findings accomplished through this project are presented in this article.

  1. Portable X-ray Fluorescence and Infrared Fluorescence Imaging Studies of Cadmium Yellow Alteration in Paintings by Edward Munch and Henri matisse in Oslo, Copenhagen, and San Francisco

    DEFF Research Database (Denmark)

    Mass, Jennifer; Uffelman, Erich; Buckley, Barbara

    2016-01-01

    of their chemical degradation, is of particular concern. The alteration of these pigments causes chalking, flaking, fading, and darkening of the yellow paints, leading to irreversible changes in the physical and chemical structure of the paint layer and dramatically altering the appearance of the work. Standoff...... of the pigment? Does it reliably discriminate among intact versus altered cadmium yellow pigments? To answer these questions, the methods were tested on Henri Matisse’s Le Bonheur de vivre (1905–1906, the Barnes Foundation, Philadelphia) and oil sketches for this work in the San Francisco Museum of Modern Art...... and the Statens Museum for Kunst, Copenhagen. They were also tested on Edvard Munch’s The Scream (ca. 1910?, Munch Museum, Oslo). It was found that ultraviolet-induced visible fluorescence has the best ability to discriminate between altered and unaltered cadmium yellow paints (even before alteration is visible...

  2. pXRF and IR Fluorescence Imaging Studies of CdS Alteration in Paintings by Edvard Munch and Henri Matisse in Oslo, Copenhagen, and San Francisco

    DEFF Research Database (Denmark)

    Vila, Anna; Wadum, Jørgen; Mass, Jennifer

    2014-01-01

    of their chemical degradation, is of particular concern. The alteration of these pigments causes chalking, flaking, fading, and darkening of the yellow paints, leading to irreversible changes in the physical and chemical structure of the paint layer, and dramatically altering the appearance of the work. Standoff...... it reliably discriminate among intact versus altered cadmium yellow pigments? To answer these questions, the methods were tested on Henri Matisse’s Le Bonheur de vivre (1905-6 The Barnes Foundation, Philadelphia) and oil sketches for this work in The Museum of Modern Art, San Francisco, and The Statens Museum...... for Kunst, Copenhagen. They were also tested on Edvard Munch’s The Scream (c. 1910, Munch Museum, Oslo). It was found that ultraviolet-induced visible fluorescence has the best ability to discriminate between altered and unaltered cadmium yellow paints (even before alteration is visible to the unaided eye...

  3. Leadership pipeline i den offentlige sektor

    DEFF Research Database (Denmark)

    Dahl, Kristian Aagaard; Molly-Søholm, Thorkil

    en rejse ind i hjertet af offentlig ledelse med fokus på lederniveauerne: topchef, funktionel chef, leder af ledere og leder af medarbejdere. Med afsæt i righoldige eksempler og fortællinger fra virkeligheden introduceres læseren for ledelsesteorien den Offentlige Leadership Pipeline, som giver...... enkelte lederniveauer og udvikle ledertalenter. Teorien byder på et detaljeret ledelsesgrundlag, hvorudfra den offentlige organisation kan bygge en professionel værdikæde for ledelse ved at forme lederprofiler, -rekruttering, -uddannelse, -evaluering m.m. Leadership Pipeline i den offentlige sektor er...... baseret på et treårigt dansk praksisorienteret forskningsprojekt med deltagelse af 15 offentlige organisationer, som repræsenterer kommunerne, regionerne og staten. Projektet har videreudviklet en af de sidste 10 års mest indflydelsesrige ledelseteorier i de største private organisationer, Leadership...

  4. Genetic susceptibility and genotype-phenotype association in 588 Danish children with inflammatory bowel disease

    DEFF Research Database (Denmark)

    Jakobsen, C; Cleynen, I; Andersen, Susanne Pia;

    2014-01-01

    AIM: To investigate the association between known inflammatory bowel disease (IBD)-associated genetic variants and development of paediatric IBD, and specific clinical sub-phenotypes. MATERIAL AND METHODS: In this case-control study we included IBD patients ... retrieved and clinical information was extracted. DNA was obtained from Guthrie cards from the Danish National Neonatal Screening Biobank (PKU-biobanken) at Statens Serum Institut and from blood samples. RESULTS: A total of 588 IBD patients (244 Crohn's disease (CD), 318 ulcerative colitis (UC) and 26 IBD...... associated with disease localisation, medical treatment or surgery after correcting for multiple analyses. CONCLUSION: We found an association between CD and three previously published genetic variants and replicated the association with the paediatric specific ZMIZ1 gene. No Bonferroni corrected significant...

  5. "Floating signifiers": Negotiating the meaning of national in Montenegro, at the Internet chat room Café del Montenegro

    Directory of Open Access Journals (Sweden)

    Čarna Brković

    2016-03-01

    Full Text Available The paper represents the analysis of the narratives that deal with the sentiment of national belonging in Montenegro within the chat room Café del Montenegro. The practice of the Internet chat room users is perceived as cultural engagement – „practicing" the State and the emotion of national identification of its own kind. By writing, arguing, negotiating the meaning of the state and nation an abundance of different and broken knowledge’s are created- many histories, geographies, ethics and politics are offered. On the one hand, these directly undermines, jeopardizes and questions the power of the State narrative, hitherto negotiating the nation, the State, authentic devotion, simultaneously manufacturing the state-nation as a reality. The result of mutual correspondence in the chat room is persistent negotiation of the meaning of national categories in Montenegro over the years.

  6. Spectral Analysis, Synthesis, & Energy Distributions of Nearby E+A Galaxies Using SDSS-IV MaNGA

    Science.gov (United States)

    Weaver, Olivia A.; Anderson, Miguel Ricardo; Wally, Muhammad; James, Olivia; Falcone, Julia; Liu, Allen; Wallack, Nicole; Liu, Charles; SDSS Collaboration

    2017-01-01

    Utilizing data from the Mapping Nearby Galaxies at APO (MaNGA) Survey (MaNGA Product Launch-4, or MPL-4), of the latest generation of the Sloan Digital Sky Survey (SDSS-IV), we identified nine post-starburst (E+A) systems that lie within the Green Valley transition zone. We identify the E+A galaxies by their SDSS single fiber spectrum and u-r color, then confirmed their classification as post-starburst by coding/plotting methods and spectral synthesis codes (FIREFLY and PIPE3D), as well as with their Spectral Energy Distributions (SEDs) from 0.15 µm to 22 µm, using GALEX, SDSS, 2MASS, and WISE data. We produced maps of gaussian-fitted fluxes, equivalent widths, stellar velocities, metallicities and age. We also produced spectral line ratio diagrams to classify regions of stellar populations of the galaxies. We found that our sample of E+As retain their post-starburst properties across the entire galaxy, not just at their center. We detected matching a trend line in the ultraviolet and optical bands, consistent with the expected SEDs for an E+A galaxy, and also through the J, H and Ks bands, except for one object. We classified one of the nine galaxies as a luminous infrared galaxy, unusual for a post-starburst object. Our group seeks to further study stellar population properties, spectral energy distributions and quenching properties in E+A galaxies, and investigate their role in galaxy evolution as a whole. This work was supported by the Alfred P. Sloan Foundation via the SDSS-IV Faculty and Student Team (FAST) initiative, ARC Agreement #SSP483 to the CUNY College of Staten Island. This work was also supported by grants to The American Museum of Natural History, and the CUNY College of Staten Island through from National Science Foundation.

  7. Decentraliserad äldreomsorg under förvaltning

    Directory of Open Access Journals (Sweden)

    David Feltenius

    2012-01-01

    Full Text Available

    Äldreomsorgen i Sverige från tidigt 1980-tal och framåt präglas av en decentralisering av makt och ansvar från central till lokal nivå. Från slutet av 1990-talet och framåt finns det emellertid tecken på att den statliga styrningen intensifierats genom regeringens utarbetande av handlings- och utvecklingsplaner. I studien undersöks under vilka former denna styrning äger rum. Handlar det om en styrning genom ”mjuka” typer av styrmedel, eller ”hårda” styrmedel som lagstiftning? Hur skall valet av styrmedel förklaras? Enligt litteraturen om governance kan staten svårligen återgå till att styra genom traditionella styrmedel som lagstiftning. Istället kan det förväntas att staten använder ”mjuka” typer av styrmedel som ”information”, ”överenskommelser” och ”projektpolitik”. Detta antagande erhåller stöd från slutsatserna av en empirisk studie av regeringens handlings- och utvecklingsplaner. Studien visar dessutom att regeringens val av dessa styrmedel kan förklaras i termer av en kompromiss mellan två disparata mål: Å ena sidan att åstadkomma en ökad statlig styrning för att komma till rätta med de problem som fanns inom äldreomsorgen, å andra sidan att respektera den ansvarsfördelning som upprättats mellan stat och kommun. Denna slutsats har dragits utifrån intervjuer med nyckelaktörer i arbetet med att utforma handlings- och utvecklingsplanerna.

  8. Overvågning af aviær influenza i vilde fugle i Danmark 2013

    DEFF Research Database (Denmark)

    Hjulsager, Charlotte Kristiane; Krog, Jesper Schak; Madsen, Jesper J.;

    Overvågningen af aviær influenza (AI) virus i vilde fugle i Danmark i 2012 er udført i samarbejde mellem Fødevarestyrelsen (FVST), Veterinærinstituttet, Danmarks Tekniske Universitet (DTU-VET) og Statens Naturhistoriske Museum, Københavns Universitet (SNM) i henhold til ”Aftale mellem Fødevaresty......Overvågningen af aviær influenza (AI) virus i vilde fugle i Danmark i 2012 er udført i samarbejde mellem Fødevarestyrelsen (FVST), Veterinærinstituttet, Danmarks Tekniske Universitet (DTU-VET) og Statens Naturhistoriske Museum, Københavns Universitet (SNM) i henhold til ”Aftale mellem...... Fødevarestyrelsen og Veterinærinstituttet om overvågning af aviær influenza i vilde fugle i Danmark i 2012” (bilag 4). Overvågning af AI på EU niveau går tilbage til 2002, og Danmark er underlagt EU kommissionens bestemmelser for udformning af overvågningen, der dog har skiftet gennem årene i takt med indhøstede...... erfaringer. I 2012 blev der udført passiv overvågning af døde vilde fugle, der blev fundet i naturen på lokaliteter, der fordelte sig over det meste af landet. Der blev testet 18 fugle, og ingen af disse var positive for HPAI. To prøver var positive for LPAI virus, men disse virus var ikke af influenza A H5...

  9. Overvågning af aviær influenza i vilde fugle 2012 i Danmark

    DEFF Research Database (Denmark)

    Hjulsager, Charlotte Kristiane; Trebbien, Ramona; Madsen, Jesper J.;

    Overvågningen af aviær influenza (AI) virus i vilde fugle i Danmark i 2012 er udført i samarbejde mellem Fødevarestyrelsen (FVST), Veterinærinstituttet, Danmarks Tekniske Universitet (DTU-VET) og Statens Naturhistoriske Museum, Københavns Universitet (SNM) i henhold til ”Aftale mellem Fødevaresty......Overvågningen af aviær influenza (AI) virus i vilde fugle i Danmark i 2012 er udført i samarbejde mellem Fødevarestyrelsen (FVST), Veterinærinstituttet, Danmarks Tekniske Universitet (DTU-VET) og Statens Naturhistoriske Museum, Københavns Universitet (SNM) i henhold til ”Aftale mellem...... Fødevarestyrelsen og Veterinærinstituttet om overvågning af aviær influenza i vilde fugle i Danmark i 2012” (bilag 4). Overvågning af AI på EU niveau går tilbage til 2002, og Danmark er underlagt EU kommissionens bestemmelser for udformning af overvågningen, der dog har skiftet gennem årene i takt med indhøstede...... erfaringer. I 2012 blev der udført passiv overvågning af døde vilde fugle, der blev fundet i naturen på lokaliteter, der fordelte sig over det meste af landet. Der blev testet 18 fugle, og ingen af disse var positive for HPAI. To prøver var positive for LPAI virus, men disse virus var ikke af influenza A H5...

  10. Da universidade autônoma ao ensino superior operacional: considerações sobre a crise da universidade e a crise do Estado nacional From the autonomous university to the operational higher education: considerations on the crisis of the university and the crisis of the national State

    Directory of Open Access Journals (Sweden)

    Luís Antonio Groppo

    2011-03-01

    Full Text Available Resgatando a relação entre o Estado nacional e a universidade moderna, comenta-se sobre a criação do mito-realidade da nação em consonância com o mito-realidade da universidade- instituição, a qual estaria destinada a pensar sua nação e sua época de modo autônomo. Após apresentar as crises da universidade - de hegemonia, de legitimidade e institucional - o artigo busca relacionar a mais séria destas crises, a institucional, que ameaça tornar a universidade-instituição autônoma em universidade operacional, com a crise daquele Estado nacional, no contexto da globalização do capital. Finda apresentando os principais contornos da crise institucional da universidade no Brasil contemporâneo.Rescuing the relation between the State-nation and the modern university, is commented on the creation of the myth-reality of the nation in accord with the myth-reality of the institution university, which would be destined to think its nation and its time in autonomous way. After to present the crises of the university - of hegemony, of legitimacy and institutional - the article searches to relate the most serious of these crises, the institutional one, that threat to become the university institution-autonomous in operational university, with the crisis of that State-nation, in the context of the globalization of the capital. It ends presenting the main contours of the institutional crisis of the university in Brazil contemporary.

  11. Treatment of relapsing Clostridium difficile infection using fecal microbiota transplantation

    Directory of Open Access Journals (Sweden)

    Pathak R

    2013-12-01

    Full Text Available Rahul Pathak,1 Hill Ambrose Enuh,1 Anish Patel,1 Prasanna Wickremesinghe21Department of Internal Medicine, New York Medical College, Internal Medicine Program at Richmond University Medical Center, Staten Island, NY, USA; 2Department of Gastrointestinal Medicine, New York Medical College, Internal Medicine Program at Richmond University Medical Center, Staten Island, NY, USABackground: Clostridium difficile infection (CDI has become a global concern over the last decade. In the United States, CDI escalated in incidence from 1996 to 2005 from 31 to 64/100,000. In 2010, there were 500,000 cases of CDI with an estimated mortality up to 20,000 cases a year. The significance of this problem is evident from the hospital costs of over 3 billion dollars annually. Fecal microbiota transplant (FMT was first described in 1958 and since then about 500 cases have been published in literature in various small series and case reports. This procedure has been reported mainly from centers outside of the United States and acceptance of the practice has been difficult. Recently the US Food and Drug Administration (FDA labeled FMT as a biological drug; as a result, guidelines will soon be required to help establish it as a mainstream treatment. More US experience needs to be reported to popularize this procedure here and form guidelines.Method: We did a retrospective review of our series of patients with relapsing CDI who were treated with FMT over a 3-year period. We present our experience with FMT at a community hospital as a retrospective review and describe our procedure.Results: There were a total of 12 patients who underwent FMT for relapsing C. difficile. Only one patient failed to respond and required a second FMT. There were no complications associated with the transplant and all patients had resolution of symptoms within 48 hours of FMT.Conclusion: FMT is a cheap, easily available, effective therapy for recurrent CDI; it can be safely performed in a

  12. New national Biobank of The Danish Center for Strategic Research on Type 2 Diabetes (DD2

    Directory of Open Access Journals (Sweden)

    Christensen H

    2012-09-01

    Full Text Available Henry Christensen,1 Jens Steen Nielsen,2 Karina Meden Sørensen,3 Mads Melbye,3 Ivan Brandslund1,41Department of Clinical Biochemistry, Vejle Hospital, Vejle, Denmark; 2The Danish Centre for Strategic Research in Type 2 Diabetes (DD2, Department of Endocrinology M, Diabetes Research Centre, Odense University Hospital, Odense, Denmark; 3Department of Epidemiology Research, Statens Serum Institut, Copenhagen, Denmark; 4Institute of Regional Health Research, University of Southern Denmark, Odense, DenmarkAbstract: Long-term storage of biological samples from patients has become increasingly important in studies of disease control and treatment. The first nationwide Danish diabetes project, ie, The Danish Center for Strategic Research in Type II Diabetes (DD2, aims to improve treatment and the long-term outcome of patients with newly diagnosed type 2 diabetes (T2D. The DD2 project includes establishment of a biobank with samples from 50,000 patients with newly diagnosed T2D. This paper describes how blood and urine samples from 10,000 patients per year are collected, handled, and stored. The biobank includes whole blood, DNA, and plasma and urine samples, all frozen at −80°C. Sampling tubes have been standardized and are sent to hospital outpatient clinics and general practitioners where samples are taken, handled, aliquoted, and returned by mail overnight in standardized cryostorage tubes. When received at the biobank, samples are frozen without further treatment. From each patient, 24 cryostorage tubes are stored. Each tube is labeled with a barcode that links the data to other information available in a clinical databank registry. When patients are enrolled in DD2, a questionnaire is filled out and a quality monitoring system ensures that patients, samples, and questionnaires can be linked together at all times. The biobank is located at Vejle Hospital and the Danish National Biobank at Statens Serum Institut. As of the end of March 2012

  13. Prøveprosjekt med mammografiscreeening i fire fylker; organisering og gjennomføring

    Directory of Open Access Journals (Sweden)

    Steinar Østerbø Thoresen

    2009-10-01

    Full Text Available  SAMMENDRAGRandomiserte kontrollerte studier har vist at systematisk mammografiscreening i aldersgruppen 50 til 69 årreduserer dødeligheten av brystkreft med omlag 30%. I 1994 ble det av Sosial- og helsedepartementetbesluttet å iverksette et prøveprosjekt med mammografi i fire fylker. Prosjektet omfatter kvinner i alderen50-69 år og skal pågå i fire år med to screeningrunder. Utvalgte fylker er Akershus, Hordaland, Oslo ogRogaland. Det er valgt en fylkeskommunal modell i samarbeid med Kreftregisteret, Statens helseundersøkelser(SHUS og Statens strålevern. Kreftregisteret har den nasjonale prosjektledelse, mens SHUS haransvar for invitasjoner, svarbrev samt innkjøp og drift av busser. Prosjektet skal evalueres både frakostnadsiden og informasjonsvirksomheten. Det utføres to-bilde mammografi med dobbelt tyding. Detførste driftsåret var 1996. Oppmøte før purring ligger på omlag 77%. Det er påvist 337 krefttilfeller.Svulstene er overveiende meget små og uten spredning til lymfeknuter i armhulen. Det har vært få driftsproblemer,og tiltaket er svært godt mottatt blant de inviterte kvinner.Thoresen SØ. Mammography screening in four Norwegian counties: a pilot project.Nor J Epidemiol ENGLISH SUMMARYOrganised breast cancer screening by mammography can reduce mortality from breast cancer substantially.In Norway a pilot project in four counties was startet in 1996, including 160 000 women in the age group50 to 69 years. Two-view mammography and double reading are performed. So far the attendance rate is77%, before reminders are sent to the women. The attendance rate in the mobile units are high. A total of337 breast cancers have been identified, which is seven out of 1000 screened. The positive predictive valueis 13%. The majority of the invasive tumors are small and without nodal involvement. The pilot project isscheduled for four years and will also be evaluated form the cost/benefit side.1997; 7 (2: 179-182.

  14. Atmospheric emissions from a passenger ferry with selective catalytic reduction.

    Science.gov (United States)

    Nuszkowski, John; Clark, Nigel N; Spencer, Thomas K; Carder, Daniel K; Gautam, Mridul; Balon, Thomas H; Moynihan, Paul J

    2009-01-01

    The two main propulsion engines on Staten Island Ferry Alice Austen (Caterpillar 3516A, 1550 hp each) were fitted with selective catalytic reduction (SCR) aftertreatment technology to reduce emissions of oxides of nitrogen (NOx). After the installation of the SCR system, emissions from the ferry were characterized both pre- and post-aftertreatment. Prior research has shown that the ferry operates in four modes, namely idle, acceleration, cruise, and maneuvering modes. Emissions were measured for both engines (designated NY and SI) and for travel in both directions between Manhattan and Staten Island. The emissions characterization used an analyzer system, a data logger, and a filter-based particulate matter (PM) measurement system. The measurement of NOx, carbon monoxide (CO), and carbon dioxide (CO2) were based on federal reference methods. With the existing control strategy for the SCR urea injection, the SCR provided approximately 64% reduction of NOx for engine NY and 36% reduction for engine SI for a complete round trip with less than 6.5 parts per million by volume (ppmv) of ammonia slip during urea injection. Average reductions during the cruise mode were 75% for engine NY and 47% for engine SI, which was operating differently than engine NY. Reductions for the cruise mode during urea injection typically exceeded 94% from both engines, but urea was injected only when the catalyst temperature reached a 300 degrees C threshold pre- and postcatalyst. Data analysis showed a total NOx mass emission split with 80% produced during cruise, and the remaining 20% spread across idle, acceleration, and maneuvering. Examination of continuous NOx data showed that higher reductions of NOx could be achieved on both engines by initiating the urea injection at an earlier point (lower exhaust temperature) in the acceleration and cruise modes of operation. The oxidation catalyst reduced the CO production 94% for engine NY and 82% for engine SI, although the high CO levels

  15. Necrotizing RPGN with linear anti IgG deposits in a patient with history of granulomatosis with polyangiitis: a case report

    Directory of Open Access Journals (Sweden)

    Parekh N

    2014-11-01

    Full Text Available Ninad Parekh, Edward Epstein, Suzanne El-Sayegh Department of Medicine, Division of Nephrology, Staten Island University Hospital, Staten Island, NY, USA Introduction: Diagnosing the etiology of a rapidly progressive glomerulonephritis is of vital importance to guide appropriate therapeutic management. This case highlights the complexity involved in establishing diagnosis when presentation is atypical. In certain cases diagnosis cannot be established based on clinical presentation or biopsy findings alone, and critical analysis of biopsy findings in context of clinical presentation is crucial to guide the clinical decision-making process.Case presentation: A 47-year-old Hispanic male with history of granulomatosis with polyangiitis (GPA in remission on azathioprine, presented with fatigue and lethargy. Physical examination was unremarkable. Laboratory data revealed elevated creatinine and otherwise normal electrolytes. Urinalysis showed numerous dysmorphic red blood cells with few red cell casts. His serologic results were all negative except anti-proteinase-3 antibody at very low titers. Kidney biopsy showed necrotizing crescentic glomerulonephritis with linear immunoglobulin G staining along the basement membrane.Conclusion: This case presented conflicting serologic and histopathologic findings. The presence of anti-proteinase-3 antibody supported diagnosis of recurrence of GPA. However, linear staining of immunoglobulin G (IgG on immunofluorescence (IF staining of renal biopsy supported anti-glomerular basement membrane (GBM disease. The treatment of anti-GBM disease and GPA both involve immunosuppression with prednisone and cyclophosphamide. However, patients with anti-GBM disease are also treated with plasmapheresis early in the disease presentation to prevent further damage. The patient with GPA, on the other hand, was shown to benefit from plasmapheresis only in the case of severe renal disease (serum creatinine level more than 5 mg/dL or

  16. Turtelduer?: Medier, stat og politik i Central- og Østeuropa. Medieforandring i Central- og Østeuropa: Udvikling af en analysemodel

    Directory of Open Access Journals (Sweden)

    Karol Jacubowicz

    1996-09-01

    Full Text Available Den polske medieforsker, Karol Jakubowicz, tager os med på en rundtur i de tidligere kommunistiske lande i Øst- og Centraleuropa. Hvordan går det med pressefriheden og mediernes løsrivelse fra staten? spørger han. Han opstiller følgende kriterier for frie medier: Differentiering, professiona- lisering af journalister, demonopolisering, decentralisering og en grad af demokratisering. Ifølge Jakubowicz er der en tæt sammenhæng mellem de politiske og økonomiske reformer, et land har gennemgået, og medier- nes frigørelsesproces. De tidligere kommunistiske lande grupperes efter, hvilket stade medieudviklingen er nået til og de politiske og økonomiske forhindringer for medieudviklingen opregnes. Den gennemgående tendens i det østeuropæiske medielandskab er "italienske tilstande", dvs. udbredt statslig kontrol med medierne, stærke partitilhørsforhold og integration mellem medier og den politiske elite, konkluderer Jakubowicz. Artiklen har før været publiceret i tidsskriftet Javnost/The Public.

  17. A comparative study of three extraction protocols of DNA from nails: Potential use in the diagnosis of onychomycoses.

    Science.gov (United States)

    Kotrotsiou, T; Chatzimichaloglou, A; Nasr, A; Spandou, E; Patsatsi, A; Sotiriadis, D; Vyzantiadis, T-A

    2017-03-01

    Molecular techniques can be useful adjuncts to the diagnosis of onychomycoses. However, the nail presents difficulties in the extraction of its DNA. The comparison of three extraction protocols of DNA from nails and their ranking for possible use in the molecular diagnosis of onychomycoses are described. Extraction was performed on weighed nail clippings of equal size from positive (31) or negative (14) samples, according to the culture result. At Prot1, the extraction was performed according to Tahir and Watson, with an additional step implementing silica columns. At Prot2, the methodology proposed by the Statens Serum Institute of Copenhagen was used. At Prot3, DNA was extracted by the use of magnetic separation after homogenisation with glass beading. The evaluation parameters were DNA purity, DNA concentration, total DNA yield/g of tissue, cost and duration. The multiples of the means of medians of the first three parameters, for each protocol, were calculated. Prot3 showed the highest DNA purity. Prot2 presented the highest DNA concentration and DNA yield/g of tissue, while it was the cheapest and shortest. In total, the three protocols were graded as Prot2>Prot1>Prot3. The second method, although had a lower DNA purity, presented the higher DNA concentration and DNA yield, while its duration and cost were also favourable.

  18. Ella-V and technology usage technology usage in an english language and literacy acquisition validation randomized controlled trial study

    Directory of Open Access Journals (Sweden)

    Roisin P. Corcoran

    2014-12-01

    Full Text Available This paper describes the use of technology to provide virtual professional development (VPD for teachers and to conduct classroom observations in a study of English Language Learner (ELL instruction in grades K–3. The technology applications were part of a cluster randomized control trial (RCT design for a federally funded longitudinal validation study of a particular program, English Language and Literacy Acquisition-Validation, ELLA- V, to determine its degree of impact on English oral language/literacy, reading, and science across 63 randomly assigned urban, suburban, and rural schools (first year of implementation. ELLA-V also examines the impact of bimonthly VPD for treatment teachers compared to comparison group teachers on pedagogical skills, measured by sound observation instruments, and on student achievement, measured by state/national English language/literacy/reading tests and a national science test. This study features extensive technology use via virtual observations, bimonthly VPD, and randomly assigned treatment and control schools with students served in English as second language (ESL instructional time. The study design and methodology are discussed relativeto the specialized uses of technology and issues involving the evaluation of technology’s contribution to the intervention of interest and of the efficient, cost-effective execution of the study.

  19. Spatially Resolved Stellar Populations Of Nearby Post-Starburst Galaxies In SDSS-IV MaNGA

    Science.gov (United States)

    Liu, Charles; Betances, Ashley; Bonilla, Alaina Marie; Gonzalez, Andrea; Migliore, Christina; Goddard, Daniel; Masters, Karen; SDSS-IV MaNGA Team

    2016-01-01

    We have selected five galaxies in the Mapping Nearby Galaxies at APO (MaNGA) project of the latest generation of the Sloan Digital Sky Survey (SDSS-IV) identified as post-starburst (E+A) systems, in the transition between "blue cloud" and "red sequence" galaxies. We measure the equivalent widths of the Balmer series, D4000 break, and metal lines across each galaxy, and produce maps of the stellar age, stellar mass, and metallicities of each galaxy using FIREFLY, a full spectral analysis code. We have found that the measured properties of the galaxies overall generally matches well with single-aperture SDSS spectra from which the original post-starburst identifications were made. The variation in the spatial distributions of the stellar populations, in particular the A-stars, give us insight into the details of the transitional E+A quenching phase. This work was supported by the Alfred P. Sloan Foundation via the SDSS-IV Faculty and Student Team (FAST) initiative, ARC Agreement No. SSP483 to the CUNY College of Staten Island.

  20. Measurement of radioactivity in Norway. Annual report 1997; Overvaaking av radioaktivitet i Norge. Aarsrapport 1997

    Energy Technology Data Exchange (ETDEWEB)

    Berg, Thor Chr

    1998-10-01

    The Norwegian Institute for Air Research (NILU) is managing a radioactivity monitoring network commissioned by the Norwegian Pollution Control Authority (Statens forurensningstilsyn). By 1997 the network consists of 28 stations throughout the country, especially tight in Finnmark.In addition there is a station in Russia (Verhetnetulomski). The 29 surveillance stations consist of: 12 ionic chamber instruments, 6 stationary gamma spectrometers for surveillance, 12 part-time gamma spectrometers designed for nutritional radioactivity measurements in co-operation with the Norwegian Food Control Authority (Naeringsmiddeltilsynet), LORAKON. The joint venture with LORAKON uses the gamma spectrometers at the stations for nutritional control for surveillance when they are not active in nutritional radioactivity measurements. The spectrometer detector is taken out of the lead tower and placed in windows at the laboratories. Then the spectrometer is connected to a telecommunication modem. The NILU computer is calling regularly whether the spectrometer is connected or not and uses it immediately when connected. The stations have not registered values that can not be attributed to natural variations in the radiation level or technical irregularities in 1997.

  1. Serotype-Specific Effect of Influenza on Adult Invasive Pneumococcal Pneumonia

    Science.gov (United States)

    Weinberger, Daniel M.; Harboe, Zitta B.; Viboud, Cécile; Krause, Tyra G.; Miller, Mark; Mølbak, Kåre; Konradsen, Helle B.

    2013-01-01

    Background. Influenza affects host susceptibility to pneumococcus. We sought to evaluate whether this relationship varies by pneumococcal serotype using a large epidemiological database covering 3 decades. Methods. Weekly rates of invasive pneumococcal pneumonia (IPP) were obtained from the Danish National Laboratory Surveillance System, and influenza-like illness (ILI) data were collected from Danish sentinel surveillance, Statens Serum Institut, 1977–2007. We fit Poisson regression models for each age and comorbidity group, with predictors for seasonality and secular changes, ILI activity, and serotype. Results. Among individuals with low levels of comorbidities, influenza had the largest impact on IPP incidence among low-invasiveness serotypes (influenza attributable percent: 17.9%, 95% confidence interval [CI], 13.6–21.9) as compared with high-invasiveness serotypes (6.7%, 95% CI, 3.8%–11.7%). Among those with higher levels of comorbidities, the effect of influenza was smaller, but high-invasiveness serotypes increased more than low-invasiveness serotypes (8.9% [95% CI, 6.6–11.8] vs 1.3% [95% CI, −1.6–5.4]. Conclusions. Influenza was associated with the greatest increases in the incidence of disease caused by serotypes with lower invasive potential and among individuals with low levels of comorbid conditions. The importance of influenza for adult IPP varies by serotype and host comorbidity. PMID:23901093

  2. Sammenligning av to blodprøver fra samme person analysert ved to laboratorier

    Directory of Open Access Journals (Sweden)

    Aage Tverdal

    2009-10-01

    Full Text Available  INNLEDNINGEpidemiologiske undersøkelser av lipidnivået hosbefolkningen er helt avhengig av at analysemetodeneholder stabilt nivå over flere år. Dette er lettest å oppnåhvis man hele tiden benytter ett laboratorium, oghjerte-karundersøkelsene til Statens helseundersøkelserhar konsekvent benyttet Klinisk kjemisk avdeling,Ullevål sykehus. Ulike hensyn kan likevel tilsi at andrelaboratorier benyttes. Undersøkelsene til Universiteteti Tromsø som har har vært gjennomført fire ganger iperioden 1973-1995, har vært utført ved Kliniskkjemisk avdeling, Regionsykehuset i Tromsø. Helseundersøkelseni Nord-Trøndelag 1995-1997 harbenyttet Sentrallaboratoriet, Innherred sykehus. I dettearbeidet viser vi hvor store forskjellene blir hvisfeltlagene sender prøver fra samme person til ulikelaboratorier. Vi har undersøkt forskjellene mellomRegionsykehuset i Tromsø og Ullevål sykehus, ogmellom Innherred sykehus og Ullevål sykehus.

  3. Salvage therapies in relapsed and/or refractory myeloma: what is current and what is the future?

    Directory of Open Access Journals (Sweden)

    Thumallapally N

    2016-08-01

    Full Text Available Nishitha Thumallapally,1 Hana Yu,1 Divya Asti,1 Adarsh Vennepureddy,1 Terenig Terjanian2 1Department of Internal Medicine, 2Division of Hematology and Oncology, Staten Island University Hospital, New York, NY, USA Abstract: The treatment landscape for multiple myeloma (MM is evolving with our understanding of its pathophysiology. However, given the inevitable cohort heterogeneity in salvage therapy, response to treatment and overall prognoses tend to vary widely, making meaningful conclusions about treatment efficacy difficult to derive. Despite the hurdles in current research, progress is underway toward more targeted therapeutic approaches. Several new drugs with novel mechanism of action and less toxic profile have been developed in the past decade, with the potential for use as single agents or in synergy with other treatment modalities in MM therapy. As our discovery of these emerging therapies progresses, so too does our need to reshape our knowledge on knowing how to apply them. This review highlights some of the recent landmark changes in MM management with specific emphasis on salvage drugs available for relapsed and refractory MM and also discusses some of the upcoming cutting-edge therapies that are currently in various stages of clinical development. Keywords: multiple myeloma, novel drugs, relapsed and refractory myeloma, salvage chemotherapy 

  4. La senda revolucionaria del liberalismo doceañista en España y México, 1820-1824

    Directory of Open Access Journals (Sweden)

    Frasquet, Ivana

    2008-04-01

    Full Text Available In this work we study the significance of the doceañista liberalism in the transformation of the Spanish monarchy, and in the construction of the Mexican State-nation from 1821. For that purpose, from the historical methodology we discuss the idea of «doceañista liberalism» while at the same time focusing on the relevance it acquired in the debates of the Mexican constituent Congress of 1822.

    En este estudio intentamos abordar la significación del liberalismo doceañista en la transformación de la monarquía hispánica y su trascendencia en la construcción del Estado-nación mexicano a partir de 1821. Para ello interpretamos desde la metodología histórica la noción de «liberalismo doceañista» al tiempo que argumentamos su importancia en los debates del congreso constituyente mexicano de 1822.

  5. A new species of leopard frog (Anura: Ranidae) from the urban northeastern US.

    Science.gov (United States)

    Newman, Catherine E; Feinberg, Jeremy A; Rissler, Leslie J; Burger, Joanna; Shaffer, H Bradley

    2012-05-01

    Past confusion about leopard frog (genus Rana) species composition in the Tri-State area of the US that includes New York (NY), New Jersey (NJ), and Connecticut (CT) has hindered conservation and management efforts, especially where populations are declining or imperiled. We use nuclear and mitochondrial genetic data to clarify the identification and distribution of leopard frog species in this region. We focus on four problematic frog populations of uncertain species affiliation in northern NJ, southeastern mainland NY, and Staten Island to test the following hypotheses: (1) they are conspecific with Rana sphenocephala or R. pipiens, (2) they are hybrids between R. sphenocephala and R. pipiens, or (3) they represent one or more previously undescribed cryptic taxa. Bayesian phylogenetic and cluster analyses revealed that the four unknown populations collectively form a novel genetic lineage, which represents a previously undescribed cryptic leopard frog species, Rana sp. nov. Statistical support for R. sp. nov. was strong in both the Bayesian (pp=1.0) and maximum-likelihood (bootstrap=99) phylogenetic analyses as well as the Structure cluster analyses. While our data support recognition of R. sp. nov. as a novel species, we recommend further study including fine-scaled sampling and ecological, behavioral, call, and morphological analyses before it is formally described.

  6. Chiapas: ¿revolución, guerrilla, movimiento indio o reclamación de democracia, justicia y libertad?

    Directory of Open Access Journals (Sweden)

    Pedro PÉREZ HERRERO

    2009-11-01

    Full Text Available RESUMEN: El artículo demuestra que los asuntos de Chiapas no son: a la causa de todos los males de México; b un problema anacrónico, heredado del pasado (ausencia de mestizaje; c un movimiento indio; d un levantamiento contra la modernidad; o d una agitación que trate de imitar la revolución de 1910; sino que representan un ejemplo dramático de la complejidad de sus tensiones internas, un hecho actual que nos descubre las contradicciones del modelo de desarrollo, del sistema político y del Estado- Nación.ABSTRACT: This article demonstrates that Chiapas affaires are not: a the cause of all the evils in Mexico; b an anachronistic problem inherited from the past (lack of half-breeding; c an indian movement; d a revolt against modernity; or e an agitation that tries to imitate the 1910 revolution; but that represent a dramatic example of the complexity of their internal tensions, a present affaire that shows us the contradictions of the development model, the political system and the State-Nation.

  7. Cloud Immunization and Security for e-Governance Applications

    Directory of Open Access Journals (Sweden)

    Rama Krushna Das

    2013-05-01

    Full Text Available Different e-Governance applications in India are using Cloud for making the services scalable, stretchable and cost effective. Starting from the IT centres being setup at  Panchayat level to the State/National data centres use the Cloud to create a common infrastructure that would be accessible by all. The focus is to enable sharing of resources, ensure security and take technology to the smaller towns and villages. But the major concern is to ensure security. This paper proposes a security solution   by using architectural framework, open source products and immunization algorithm. Our interest is to use Artificial Immune System (AIS with Clonal Selection Algorithm (CLONA for secure transaction of e-Governance services. The porosed Cloud architecture adopts the learning process and follows security optimization techniques. This technique uses spontaneous action-event transactional state of Cloud Immunization and Security (CIS, defined security services such as Authentication, Firewall and Antivirus. With these technique and services the CIS system is empowered to dynamically determine the best clone and the best antibody.  Intruder attacks termed as new antigens when approaches the Cloud, then the cloud system’s antibody known as threat detector follows Hamming Distance calculation to evaluate the threat termed as “affinity”. These affinity alerts and protects the Cloud system through CIS to undertake any kind of future attempt and attacks by the intruders.

  8. Saudi-Arabia`s way in to mineral oil sovereignty from 1932-1992; Saudi-Arabiens Weg zur erdoelpolitischen Souveraenitaet, 1932-1992

    Energy Technology Data Exchange (ETDEWEB)

    Bahadir, S.A. [Inst. fuer Staats- und Versicherungswissenschaft, Bereich Gegenwartsbezogene Orientforschung, Erlangen (Germany); Klinner, A. [Inst. fuer Staats- und Versicherungswissenschaft, Bereich Gegenwartsbezogene Orientforschung, Erlangen (Germany)

    1993-12-31

    Four main phases of the history of Saudi-Arabian mineral oil politics are described, each of which marks one stage on the way to full oil-related sovereignty of the kingdom: 1. finding concession-holders for mineral oil, 2. Cooperation with ARAMCO in order to build up the country`s mineral oil industry, 3. Cooperation with other OPEC-states in nationalising the oil industries, 4. participation in the 2nd Gulf War in order to achieve full sovereignty in matters of energy politics. Special attention is given to the specifically Saudian connection of foreign - and oil politics and the importance of historical ``coincidences`` for the success of Saudi Arabia`s type of mineral oil politics. (orig./UA) [Deutsch] Im folgenden werden vier wesentliche Ereignisse bzw. Phasen in der Geschichte der saudischen Erdoelpolitik dargestellt und jeweils als eine Etappe auf dem Weg zur vollen erdoelpolitischen Souveraenitaet des Koenigreichs interpretiert: 1. die Suche nach Erdoel-Konzessionaeren; 2. die Kooperation mit der ARAMCO zum Ausbau der Erdoelwirtschaft des Landes; 3. die Kooperation mit anderen OPEC-Staten bei der Nationalisierung des Erdoelsektors; und 4. die Beteiligung am 2. Golfkrieg zur Erlangung der vollen erdoelpolitischen Souveraenitaet. Im Vordergrund des Interesses steht dabei die spezifisch-saudische Verflechtung der Aussen- und Erdoelpolitik einerseits und die Bedeutung von ``zufaelligen`` historischen Ereignissen fuer den Erfolg der saudischen Variante der Erdoelpolitik andererseits. (orig./UA)

  9. Ground Zero/Fresh Kills: Cataloguing Ruins, Garbage, and Memory

    Directory of Open Access Journals (Sweden)

    Cinzia Scarpino

    2011-09-01

    Full Text Available The aim of this paper is to show how the rise and fall of the Twin Towers can be read in relation to the rise and fall of the Staten Island Fresh Kills landfill, how their destinies were entwined from the start, and how the immediate cultural response to the collapse of the former and the closing of the latter recurred to the form of catalogues of objects, words, and images. From this angle it will be possible to posit the events within a larger, if somewhat unusual, cultural frame encompassing the history of two different yet complementary symbols of New York up to 2001 (the WTC and Fresh Kills. From Don DeLillo’s Underworld (1997 and Falling Man (2007 through Holman, Steve Zeitlin e Joe Dobkin’s Crisis (2001-2002; from Art Spiegelman’s In the Shadows of No Tower (2004 to Artists Respond’s 9-11 (2002; from the New York Times to Bearing Witness to History, the 2003-2006 retrospective of the Smithsonian Museum, relevant collective or individual responses to the 2001 attacks took the form of a catalogue, a list, a vertical or horizontal juxtaposition of data, objects, and memories, evoking a suggestive parallel to the organizing principle of past relics collected in museums and garbage stratified in sanitary landfills.

  10. Effect of hydrophilic polymers on the wettability, static and dynamic, of solid substrate covered by confluent monolayer of air-damaged SIRC cells.

    Science.gov (United States)

    Eftimov, Petar; Stefanova, Nadezhda; Lalchev, Zdravko; Georgiev, Georgi As

    2015-03-04

    The aim of this study was to evaluate the possible implementation of hydrophilic polymers as recovery agents in air-damaged corneal cells. The sessile bubble technique was implemented to measure the wetting properties of four selected polymers: hydroxyethyl cellulose (HEC), sodium chondroitin sulphate (SCS), hydroxypropyl-methylcellulose (HPMC) and poloxamer F127 (PO12), at equilibrium conditions and in the case of advancing and receding contact angle. For testing the wetting properties of the polymers, glass slides covered with a confluent monolayer of Statens Seruminstitut rabbit cornea (SIRC) cells were used. HEC showed best properties for a broad concentration range, as the polymer showed capability to maintain low values of the static (equilibrium) contact angle (average static contact angle - 36.07˚, compared to average static compact angles of HPMC - 38.44˚, PO12 - 38.92˚ and SCS - 37.85˚), i.e. better wettability. Sessile bubble technique provides quick, relatively simple and reliable approach for testing surface properties of the listed polymers. The nature of the surface damage produced by the exposition of SIRC cells was used as a plausible model of evaporative dry eye syndrome, and thus the results may have clinical implementation.

  11. Fresh Kills leachate treatment and minimization study: Volume 2, Modeling, monitoring and evaluation. Final report

    Energy Technology Data Exchange (ETDEWEB)

    Fillos, J.; Khanbilvardi, R.

    1993-09-01

    The New York City Department of Sanitation is developing a comprehensive landfill leachate management plan for the Fresh Kills landfill, located on the western shore of Staten Island, New York. The 3000-acre facility, owned and operated by the City of New York, has been developed into four distinct mounds that correspond to areas designated as Sections 1/9, 2/8, 3/4 and 6/7. In developing a comprehensive leachate management plan, the estimating leachate flow rates is important in designing appropriate treatment alternatives to reduce the offsite migration that pollutes both surface water and groundwater resources.Estimating the leachate flow rates from Sections 1/9 and 6/7 was given priority using an available model, hydrologic evaluation of landfill performance (HELP), and a new model, flow investigation for landfill leachate (FILL). The field-scale analysis for leachate flow included data collection of the leachate mound-level from piezometers and monitoring wells installed on-site, for six months period. From the leachate mound-head contours and flow-gradients, Leachate flow rates were computed using Darcy`s Law.

  12. Phenotypic and genotypic characterization of Streptococcus agalactiae in pregnant women. First study in a province of Argentina.

    Science.gov (United States)

    Oviedo, P; Pegels, E; Laczeski, M; Quiroga, M; Vergara, M

    2013-01-01

    Group B Streptococcus (GBS) is the leading cause of neonatal infections. Our purpose was to characterize GBS colonization in pregnant women, current serotypes, resistance phenotypes and genes associated with virulence. In Misiones, Argentina, there are no previous data on this topic. Vaginal-rectal swabs from 3125 pregnant women were studied between 2004 and 2010. GBS strains were identified by conventional and serological methods (Phadebact Strep B Test, ETC International, Bactus AB, Sweden). Serotypes were detected using Strep-B Latex (Statens Serum Institut, Denmark). Resistance phenotypes were determined by the double-disk test. Genes were studied by PCR. Maternal colonization was 9.38%. Resistance to erythromycin was 11.6%, and the constitutive phenotype was the predominant one. Serotype Ia was the most frequent, whereas serotypes IV, VI, VII and VIII were not detected. The lmb, bca and hylB genes were detected in more than 79% of the strains. In this study, the colonization rate with GBS and the serotype distribution were compared with studies reported in other areas of the country. The high resistance to erythromycin in Misiones justifies performing antibiotic susceptibility testing. The serotype distribution, the genes encoding putative virulence factors, and the patterns of resistance phenotypes of GBS may vary in different areas. They thus need to be evaluated in each place to devise strategies for prevention.

  13. Radiofrequency ablation using BarRx for the endoscopic treatment of radiation proctopathy: a series of three cases

    Directory of Open Access Journals (Sweden)

    Patel A

    2014-12-01

    Full Text Available Anish Patel, Rahul Pathak, Vrushak Deshpande, Sunil H Patel, Prasanna C Wickremesinghe, Deepak Vadada Department of Gastrointestinal Medicine, Richmond University Medical Center, Staten Island, NY, USA Abstract: Radiation proctopathy is a complication of pelvic radiotherapy, which occurs in patients treated for carcinoma of the prostate, rectum, urinary bladder, cervix, uterus, and testes. If it presents within 6 weeks to 9 months after therapy, it is called acute radiation proctitis/proctopathy (ARP, and if it occurs 9 months to a year after treatment, it is classified as chronic radiation proctitis/proctopathy (CRP. CRP occurs in 5%–20% of patients receiving pelvic radiation, depending on the radiation dose and the presence or absence of chemotherapy. In many cases, CRP resolves spontaneously, but in some, it can lead to persistent rectal bleeding. Other symptoms of CRP include diarrhea, mucoid discharge, urgency, tenesmus, rectal pain, and fecal incontinence. Despite the availability of several therapies, many patients fail to respond, and continue to suffer in their quality of life. Radiofrequency ablation (RFA is a newer endoscopic technique that uses radiofrequency energy to ablate tissue. This is an emerging way to treat radiation proctopathy and other mucosal telangiectasia. We present three cases of radiation proctopathy treated with RFA at our institute and review the literature on treatment modalities for CRP. We were also able to find 16 other cases of CRP that used RFA, and review their literature as well as literature on other treatment modalities. Keywords: radiofrequency ablation, radiation proctopathy, BarRx, Halo catheter

  14. Adverse events following immunisation with bacille Calmette-Guérin vaccination: baseline data to inform monitoring in Australia following introduction of new unregistered BCG vaccine.

    Science.gov (United States)

    Hendry, Alexandra J; Dey, Aditi; Beard, Frank H; Khandaker, Gulam; Hill, Richard; Macartney, Kristine K

    2016-12-24

    In recent years there has been a global shortage of bacille Calmette-Guérin (BCG) vaccine and, from September 2012, unregistered vaccines have needed to be used in Australia (a Danish product initially until the end of 2015, and a Polish product used in some jurisdictions from early 2016). We examined rates and types of adverse events following immunisation (AEFI) with BCG vaccine reported to the Therapeutic Goods Administration between 2009 and 2014 in children aged less than 7 years. Reporting rates of AEFI with BCG vaccine increased from 87 per 100,000 doses (registered Sanofi Pasteur product) in 2009 to 201 per 100,000 doses (unregistered Danish Statens Serum Institute product) in 2014, with Victoria having the highest rate each year. Substantial variation between jurisdictions exists, suggesting differential reporting of BCG vaccine doses administered and/or BCG vaccine-related AEFI. The most commonly reported reactions were abscess (31%), injection site reaction (27%) and lymphadenopathy/lymphadenitis (17%). This study provides baseline data on BCG vaccine safety to inform surveillance. Given the current use of unregistered vaccines in the context of vaccine supply issues, improved recording of both administered BCG vaccine doses and the reporting of BCG vaccine-related AEFI are required to facilitate close monitoring of vaccine safety.

  15. PANDA saves pedestrians from silent hybrid cars; PANDA redt voetgangers van stille hybride

    Energy Technology Data Exchange (ETDEWEB)

    Sattler, B. [Office for Science and Technology, Embassy of the Kingdom of the Netherlands, Washington DC (United States)

    2008-07-15

    The popularity of hybrid cars in the United States is an example of how the application of a new technology can have unintentional negative consequences. The cars are so quiet that pedestrians hardly notice them. Especially (blind) pedestrians, trimmers, cyclists and children are at risk. The National Highway Traffic Safety Administration (NHTSA) sees this as a potential safety problem and wants research. A solution has already been suggested: PANDA, a system with speakers under the wheel spats that make motor sounds, or sound effects from Star Wars. [mk]. [Dutch] De populariteit van hybride auto's in de Verenigde Staten is een voorbeeld van hoe de toepassing van een nieuwe technologie onbedoelde negatieve consequenties met zich meebrengt. De auto's zijn namelijk te stil om door voetgangers opgemerkt te worden. Vooral (blinde) voetgangers, trimmers, fietsers en kinderen lopen risico's. De National Highway Traffic Safety Administration (NHTSA) ziet dit als een potentieel veiligheidsprobleem en wil onderzoek. Een oplossing is ook al voorgesteld: PANDA, een systeem met luidsprekers onder de wielkappen die motorgeluid maken, of geluidseffecten uit Star Wars.

  16. Effect of Principal and Student Gender on New York City High School Performance Outcomes

    Directory of Open Access Journals (Sweden)

    Rupert Green

    2015-07-01

    Full Text Available A mixed-methods study enabled the exploration of New York City high school data, analyzing performance/demographic scores based on principal and/or student gender, boroughs, and other factors found the following: Significant differences in boroughs’ college and career readiness scores, χ2(4, N = 369 = 26.830, p = .00, with (a the highest mean rank of 251 for Staten Island, and the lowest mean rank of 156 for Brooklyn; (b larger socioeconomically integrated schools more successful; (c failure in small Manhattan and Bronx segregated/poverty female-majority schools; and (d male students, F(4, 359 = 2.49, p = .043, partial η2 = .027, attained significantly lower scores. Enrollment was significant, F(1, 457 = 7.215, p < .05 partial η2 = .940, with male principals (M = 746.40, SD = 903.58 leading larger schools. Recommendations include the following: gifted vocational education school, gauging for feminization, more Black/Hispanic principals; and assurance of licensed vocational educators.

  17. Woody plant roots fail to penetrate a clay-lined landfill: Managment implications

    Science.gov (United States)

    Robinson, George R.; Handel, Steven N.

    1995-01-01

    In many locations, regulatory agencies do not permit tree planting above landfills that are sealed with a capping clay, because roots might penetrate the clay barrier and expose landfill contents to leaching. We find, however, no empirical or theoretical basis for this restriction, and instead hypothesize that plant roots of any kind are incapable of penetrating the dense clays used to seal landfills. As a test, we excavated 30 trees and shrubs, of 12 species, growing over a clay-lined municipal sanitary landfill on Staten Island, New York. The landfill had been closed for seven years, and featured a very shallow (10 to 30-cm) soil layer over a 45-cm layer of compacted grey marl (Woodbury series) clay. The test plants had invaded naturally from nearby forests. All plants examined—including trees as tall as 6 m—had extremely shallow root plates, with deformed tap roots that grew entirely above and parallel to the clay layer. Only occasional stubby feeder roots were found in the top 1 cm of clay, and in clay cracks at depths to 6 cm, indicating that the primary impediment to root growth was physical, although both clay and the overlying soil were highly acidic. These results, if confirmed by experimental research should lead to increased options for the end use of many closed sanitary landfills.

  18. Retrieving moisture profiles from precipitable water measurements using a variational data assimilation approach

    Energy Technology Data Exchange (ETDEWEB)

    Guo, Y.R.; Zou, X.; Kuo, Y.H. [National Center for Atmospheric Research, Boulder, CO (United States)

    1996-04-01

    Atmospheric moisture distribution is directly related to the formation of clouds and precipitation and affects the atmospheric radiation and climate. Currently, several remote sensing systems can measure precipitable water (PW) with fairly high accuracy. As part of the development of an Integrated Data Assimilation and Sounding System in support of the Atmospheric Radiation Measurement Program, retrieving the 3-D water vapor fields from PW measurements is an important problem. A new four dimensional variational (4DVAR) data assimilation system based on the Penn State/National Center for Atmospheric Research (NCAR) mesoscale model (MM5) has been developed by Zou et al. (1995) with the adjoint technique. In this study, we used this 4DVAR system to retrieve the moisture profiles. Because we do not have a set of real observed PW measurements now, the special soundings collected during the Severe Environmental Storm and Mesoscale Experiment (SESAME) in 1979 were used to simulate a set of PW measurements, which were then assimilated into the 4DVAR system. The accuracy of the derived water vapor fields was assessed by direct comparison with the detailed specific humidity soundings. The impact of PW assimilation on precipitation forecast was examined by conducting a series of model forecast experiments started from the different initial conditions with or without data assimilation.

  19. Amniotic Fluid Chemokines and Autism Spectrum Disorders: An Exploratory Study Utilizing a Danish Historic Birth Cohort

    DEFF Research Database (Denmark)

    Abdallah, Morsi; Larsen, Nanna; Grove, Jakob

    2012-01-01

    Introduction: Elevated levels of chemokines have been reported in plasma and brain tissue of individuals with Autism Spectrum Disorders (ASD). The aim of this study was to examine chemokine levels in amniotic fluid (AF) samples of individuals diagnosed with ASD and their controls. Material...... and Methods A Danish historic birth cohort (HBC) kept at Statens Serum Institute, Copenhagen was utilized. Using data from Danish nation-wide health registers, a case-control study design of 414 cases and 820 controls was adopted. Levels of MCP-1, MIP-1α and RANTES were analyzed using Luminex xMAP technology...... (elevated 90th percentile adjusted OR: 2.32 [95% CI: 1.17 – 4.61]) compared to controls. An increased risk for infantile autism with elevated MCP-1 was also found (adjusted OR: 2.28 [95% CI: 1.16 – 4.48]). Elevated levels of MCP-1 may decipher an etiologic immunologic dysfunction or play rather an indirect...

  20. Successful Treatment of Disseminated Bacillus Calmette-Guérin Disease in an HIV-Infected Child with a Linezolid-Containing Regimen

    Directory of Open Access Journals (Sweden)

    Srđan Roglić

    2016-01-01

    Full Text Available Upon HIV infection diagnosis, an 8-month-old boy was transferred for evaluation of worsening respiratory distress requiring mechanical ventilation. Pneumocystis jirovecii pneumonia (PCP was diagnosed; the boy also had a nonhealing ulcer at the site of vaccination with Statens Serum Institut (Danish strain Bacillus Calmette-Guérin (BCG vaccine and associated axillary lymphadenopathy. PCP treatment resulted in weaning from mechanical ventilation. Antimycobacterial treatment was immediately attempted but was discontinued because of hepatotoxicity. Over several months, he developed splenic lesions and then disseminated skin and cystic bone lesions. M. bovis was repeatedly cultured from both skin and bone lesions despite various multidrug antimycobacterial regimens which included linezolid. Eventually, treatment with a regimen of rifabutin, isoniazid, ethambutol, and linezolid led to definitive cure. Clinicians should consider a linezolid-containing regimen for treatment of severe disseminated BCG infection, especially if other drug regimens have failed. Although drug toxicity is a particular concern for young children, this patient received linezolid for 13 months without serious toxicity. This case also highlights the need for universal screening among pregnant women to prevent vertical transmission of HIV. Finally, routine immunization with BCG vaccine at birth should be questioned in countries with low and declining burden of tuberculosis.

  1. 果蔗SoSGT1与Gibberella fujikuroi侵染下果蔗叶片蛋白的互作研究%Studies on Interaction between SoSGT1 and Proteins in Leaves of Chewing Cane Infected byGibberella fujikuroi

    Institute of Scientific and Technical Information of China (English)

    林生; 陈婷; 周明明; 陈观水; 林文雄

    2015-01-01

    为了解果蔗(Saccharum officenarumL.)在防御Gibberella fujikuroi过程中与SoSGT1互作的蛋白,利用GST蛋白标签载体pGEX-6p-1与果蔗SoSgt1基因构建pGEX-6p-1-sgt1表达载体,诱导表达GST-SoSGT1融合蛋白,并通过GST pull down技术捕捉到7个与SoSGT1互作蛋白。这些蛋白的功能主要归类为信号转导、抗逆与能量代谢相关蛋白,其中一些蛋白可能与果蔗SoSGT1直接互作,如HSP90与RAR1蛋白,另外一些蛋白与果蔗SoSGT1可能产生次级互作。在G. fujikuroi侵染果蔗‘福农’叶片时,HSP70、14-3-3蛋白、2-半胱氨酸-过氧化物酶与吡哆醇生物合成蛋白的编码基因呈上调表达,初步说明这些蛋白可能与SoSGT1蛋白互作共同参与了果蔗防御梢腐病病原G. fujikuroi的病理过程。%In order to understand the interaction proteins with SoSGT1 during chewing cane (Saccharum officenarum L.) in denfenseGibberella fujikuroi,SoSgt1and vector pGEX-6p-1 was used to construct vector pGEX-6p-1-sgt1, which expressed fusion protein of GST-SoSGT1. Seven proteins were obtained by GST pull down. The function of these proteins was classiifed into signal transduction, stress resistance and energy metabolism, in which might directly interact with SoSGT1, such as HSP90 and RAR1, and others might indirectly interact with SoSGT1. When the leaves of chewing cane ‘Fuan’ were infected byG. fujikuroi, the expression of coding genes of HSP70, 14-3-3 protein, 2-Cys-peroxiredoxin and pyridoxine biosynthesis protein was up-regulated, which indicated that these proteins might interact with SoSGT1 and associate with the resistance of chewing cane toG. fujikuroi.

  2. Molecular analysis of rubella virus in travelers suspected of measles infection in São Paulo, Brazil Análise molecular do vírus da rubéola em turistas suspeitos de infecção por sarampo em São Paulo, Brasil

    Directory of Open Access Journals (Sweden)

    Cristina A. Figueiredo

    2012-10-01

    Full Text Available OBJECTIVE: To identify measles virus genotypes in three cases of travelers suspected of measles infection. METHODS: Samples (blood and urine were collected for serology, virus isolation, and genotyping. Sera were analyzed for IgM antibodies against measles virus and rubella virus by enzyme-linked immunosorbent assay (ELISA (Siemens - Marburg, Germany. Clinical samples (lymphocytes and urine were inoculated into Statens Serum Institute rabbit corneal epithelial cell line- ATCC CL 60 (SIRC and Vero Slam cells. RNA was extracted from clinical samples and cell culture was inoculated and processed by polymerase chain reaction (PCR with oligonucleotides specific for measles virus (MV and rubella virus (RV. RESULTS: All patients showed IgM negative serology for MV and positive IgM for RV. RV belonging to genotypes 1B, 1C, and 1E were isolated from patients who came from Finland, Peru, and Germany, respectively. Genotype 1B has been found in Europe and on the East Coast of South America; 1C has been found in Peru and the West Coast of South America, and 1E, first identified in 1997, now appears to have worldwide distribution. CONCLUSION: Information about RV and MV genotypes circulating in São Paulo is essential for the control of measles, rubella, and congenital rubella syndrome (CRS in Brazil.OBJETIVO: Identificar o genótipo do vírus do sarampo em três viajantes suspeitos de infecção por sarampo. MÉTODOS: Amostras (sangue e urina foram coletadas para sorologia, isolamento viral e genotipagem. As sorologias para pesquisa de IgM para o vírus do sarampo e da rubéola foi realizada utilizando-se o kit de ELISA (Siemens - Marburg, Alemanha. As amostras clínicas (linfócito e urina foram inoculadas na SIRC (Statens Serum Institute rabbit corneal epithelial cell line-ATCC CL 60 e nas células Vero Slam. O RNA foi extraído das amostras clínicas e das células inoculadas e processadas por PCR, utilizando oligonucleotideos específicos para sarampo e

  3. Staphylococcus aureus bacteremia.

    Science.gov (United States)

    Jensen, Allan Garlik

    2003-11-01

    Staphylococcus aureus bacteremia (SAB) is still associated with a high mortality, and knowledge on risk factors and the clinical and the therapeutic aspects of SAB is still limited. This thesis focuses on the clinical aspects of SAB and its metastatic infections. In a study of all patients with bacteremia in Copenhagen County October 1992 through April 1993 (study I) we emphasized previous findings, that S. aureus is one of the most frequent pathogens in bacteremia, and in a case control study also in Copenhagen County 1994-95 (study II) we demonstrated, that not only an inserted central venous catheter and nasal S. aureus carriage but also hyponatremia and anemia are important risk factors for hospital-acquired SAB (study II). Studies on the treatment of SAB have pointed out, that the eradication of a primary is important, but there are only limited clinical studies dealing with antibiotic treatment. By logistic regression analysis, we were able to demonstrate that focus eradication is essential, but also that treatment with dicloxacillin 1 g x 4 or 2 g x 3 are superior to 1 g x 3 (studie III), indicating that the time for serum concentration above the Minimal Inhibitory Concentration (MIC) for the bacteria plays a role in the outcome of SAB treatment. S. aureus osteomyelitis secondary to SAB is frequently observed. No other countries, however, have a centralized registration, which make it possible to evaluate a large number of these patients. Since 1960, The Staphylococcal Laboratory, Statens Serum Institut in Copenhagen, has registrated selected clinical informations from nearly all patients with positive blood cultures of S. aureus. Based on this registration, we were able to show an increased number of S. aureus osteomyelitis among older patients and a decreased number of S. aureus osteomyelitis of femur and tibia among younger infants in the period 1980-90 (study IV). By reviewing the records of a large number of patients with vertebral S. aureus

  4. Er konsum av melk og egg assosiert med risiko for kreft? Foreløpige resultater fra en prospektiv undersøkelse

    Directory of Open Access Journals (Sweden)

    Grethe Albrektsen

    2009-10-01

    Full Text Available  SAMMENDRAGSammenhenger mellom kreftinsidens og konsum av egg og melk er studert i en prospektiv undersøkelse avca. 50 000 personer i alderen 30-69 år. Kostholdsdataene ble samlet inn i forbindelse med andre runde avhjerte- og karundersøkelsene som ble gjennomført av Statens helseundersøkelser i Finnmark, Sogn ogFjordane og Oppland i perioden 1977-83. Gjennomsnittlig oppfølgingstid var 11,8 år. Omlag 2000 personerfikk en kreftdiagnose i løpet av oppfølgingsperioden. Insidensrate-ratioer er beregnet i en log-lineærPoissonregresjon basert på personår under risiko. Vi fant ingen sammenheng mellom total kreftinsidens ogkonsum av melk (glass pr. dag eller egg (antall pr. uke, men for spesifikke krefttyper observerte vi enkelteassosiasjoner. Det arbeides nå med mer detaljerte analyser og med internasjonal publisering av resultatene.Albrektsen G, Heuch I, Jacobsen BK, Kvåle G. Is milk and egg consumption associated with cancerrisk? Preliminary results from a prospective study. Nor J Epidemiol 1997; 7 (2: 205-208.ENGLISH SUMMARYAssociations between cancer incidence and consumption of milk and eggs were examined in a prospectivestudy of about 50,000 persons aged 30-69 years. The mean follow-up period was 11.8 years. About 2000persons were diagnosed with cancer during follow-up. Incidence rate ratios were calculated in a log-linearPoisson regression model of person-years at risk. No relations were found between overall cancer incidenceand consumption of milk (glasses per day or eggs (number per week, but some associations were observedfor specific sites. The analysis of the data is in progress and the results presented are preliminary.

  5. Many and small or large and few? A comparison of the environmental effects of different strategies for the development of hydropower plants.; Mange og smaa eller store og faa? En sammenligning av miljoevirkningene ved ulike strategier for utvikling av vannkraft.

    Energy Technology Data Exchange (ETDEWEB)

    Bakken, Tor Haakon; Sundt, Haakon; Ruud, Audun

    2012-11-01

    This study compared the cumulative environmental impact of 27 small hydro power plants to the environmental impact of an average of three large hydropower plants, which range from the small farms and the average of the major producing about as much energy. Based on the empirical basis used in this study are the environmental impacts of large hydropower fewer and less severe than the cumulative environmental impacts from the 27 small plants. The results are, however marginal in favor of big hydro power plants and suffers from uncertainties due to lack of precision in the raw data, limitations of the methodic of accumulating environmental effects of many small facilities and extensive use of discretion in the transition between the scientific description of the environmental impacts and impact classes (Statens Vegvesen, 2006). The input data in the study has primarily been published available environmental impact assessment (KU). The results must therefore be said to have limited power statement in order to draw general conclusions. The identified environmental effects are to some extent, different from the type and size, so that an individual valuation and political or administrative priorities will to a large extent determine the preferred strategy for the development of hydropower. From 2012 promoted the production stimulating action as a result of common certificate market with Sweden. Small hydro power plants has so far been a priority in Norway, but when Norway implements EU Water Framework Directive in all areas of precipitation, one should be aware of our findings, especially regarding the potential in expanding of existing hydropower plants. (auth)

  6. Clinical, virological and immunological responses in Danish HIV patients receiving raltegravir as part of a salvage regimen

    Directory of Open Access Journals (Sweden)

    Frederik N Engsig

    2010-05-01

    Full Text Available Frederik N Engsig1, Jan Gerstoft1, Gitte Kronborg2, Carsten S Larsen3, Gitte Pedersen4, Anne M Audelin5, Louise B Jørgensen5, Niels Obel11Department of Infectious Diseases, Copenhagen University Hospital, Rigshospitalet, Denmark; 2Department of Infectious Diseases, Copenhagen University Hospital, Hvidovre, Denmark; 3Department of Infectious Diseases, Aarhus University Hospital, Aarhus, Denmark; 4Department of Infectious Diseases, Aalborg University Hospital, Aalborg, Denmark; 5Department of Virology, Statens Serum Institute, Copenhagen, DenmarkBackground: Raltegravir is the first integrase inhibitor approved for treatment of HIV-infected patients harboring multiresistant viruses.Methods: From a Danish population-based nationwide cohort of HIV patients we identified the individuals who initiated a salvage regimen including raltegravir and a matched cohort of HIV-infected patients initiating HAART for the first time. We compared these two cohorts for virological suppression, gain in CD4 count, and time to first change of initial regimen.Results: We identified 32 raltegravir patients and 64 HIV patients who initiated HAART for the first time in the period 1 January 2006 to 1 July 2009. The virological and immunological responses in the raltegravir patients were comparable to those seen in the control cohort. No patients in the two cohorts died and no patients terminated raltegravir treatment in the observation period. Time to first change of initial regimen was considerably shorter for HAART-naïve patients.Conclusion: We conclude that salvage regimens including raltegravir have high effectiveness in the everyday clinical setting. The effectiveness of the regimens is comparable to that observed for patients initiating HAART for the first time. The risk of change in the salvage regimens after initiation of raltegravir is low.Keywords: HIV, raltegravir, salvage regime, efficacy, matched cohort

  7. Impact of Hurricane Sandy on community pharmacies in severely affected areas of New York City: A qualitative assessment.

    Science.gov (United States)

    Arya, Vibhuti; Medina, Eric; Scaccia, Allison; Mathew, Cathleen; Starr, David

    2016-01-01

    Hurricane Sandy was one of the most severe natural disasters to hit the Mid-Atlantic States in recent history. Community pharmacies were among the businesses affected, with flooding and power outages significantly reducing services offered by many pharmacies. The objectives of our study were to assess the impact of Hurricane Sandy on community pharmacies, both independently owned and chain, in the severely affected areas of New York City (NYC), including Coney Island, Staten Island, and the Rockaways, using qualitative methods, and propose strategies to mitigate the impact of future storms and disasters. Of the total 52 solicited pharmacies, 35 (67 percent) responded and were included in our analysis. Only 10 (29 percent) of the pharmacies surveyed reported having a generator during Hurricane Sandy; 37 percent reported being equipped with a generator at the time of the survey approximately 1 year later. Our findings suggest that issues other than power outages contributed more toward a pharmacy remaining operational after the storm. Of those surveyed, 26 (74 percent) suffered from structural damage (most commonly in Coney Island). Most pharmacies (71 percent) were able to reopen within 1 month. Despite staffing challenges, most pharmacies (88 percent) had enough pharmacists/staff to resume normal operations. Overall, 91 percent were aware of law changes for emergency medication access, and 81 percent found the information easy to obtain. This survey helped inform our work toward improved community resiliency. Our findings have helped us recognize community pharmacists as important stakeholders and refocus our energy toward developing sustained partnerships with them in NYC as part of our ongoing preparedness strategy.

  8. A survey of spatially distributed exterior dust lead loadings in New York City.

    Science.gov (United States)

    Caravanos, Jack; Weiss, Arlene L; Blaise, Marc J; Jaeger, Rudolph J

    2006-02-01

    This work documents ambient lead dust deposition values (lead loading) for the boroughs of New York City in 2003-2004. Currently, no regulatory standards exist for exterior concentrations of lead in settled dust. This is in contrast to the clearance and risk assessment standards that exist for interior residential dust. The reported potential for neurobehavioral toxicity and adverse cognitive development in children due to lead exposure prompts public health concerns about undocumented lead sources. Such sources may include settled dust of outdoor origin. Dust sampling throughout the five boroughs of NYC was done from the top horizontal portion of pedestrian traffic control signals (PTCS) at selected street intersections along main thoroughfares. The data (n=214 samples) show that lead in dust varies within each borough with Brooklyn having the highest median concentration (730 microg/ft2), followed in descending order by Staten Island (452 microg/ft2), the Bronx (382 microg/ft2), Queens (198 microg/ft2) and finally, Manhattan (175 microg/ft2). When compared to the HUD/EPA indoor lead in dust standard of 40 microg/ft2, our data show that this value is exceeded in 86% of the samples taken. An effort was made to determine the source of the lead in the dust atop of the PTCS. The lead in the dust and the yellow signage paint (which contains lead) were compared using isotopic ratio analysis. Results showed that the lead-based paint chip samples from intact signage did not isotopically match the dust wipe samples taken from the same surface. We know that exterior dust containing lead contributes to interior dust lead loading. Therefore, settled leaded dust in the outdoor environment poses a risk for lead exposure to children living in urban areas, namely, areas with elevated childhood blood lead levels and background lead dust levels from a variety of unidentified sources.

  9. The Exchange Programme of the Belgian American Educational Foundation: An Institutional Perspective on Scientific Persona Formation (1920-1940.

    Directory of Open Access Journals (Sweden)

    P. Huistra

    2016-12-01

    Full Text Available In this article we propose an institutional perspective on persona formation. Not unlike individual scientists, institutions such as funding bodies took an active interest in shaping the scientific persona. As a case in point, we discuss the Belgian American Educational Foundation (BAEF that sent hundreds of aspiring Belgian scientists to the United States during the Interwar period. The BAEF went to great lengths to optimise its selection procedure and formulated conditions pertaining to both the mental and physical fitness of its grantees. In this way, the BAEF cut off some repertoires of being a scientist and encouraged its fellows to demonstrate certain qualities when in front of the funding body. This, we argue, points to the performative and occasional character of scientific personae. Geschikt om te reizen. Het uitwisselingsprogramma van de Belgian American Education Foundation. Een institutioneel perspectief op de vorming van wetenschappelijke personae (1920-1940. In dit artikel benaderen wij de vorming van personae vanuit een institutioneel perspectief. Net als individuele wetenschappers zijn instituties zoals funding bodies actief betrokken bij het scheppen en in standhouden van wetenschappelijke personae. Als voorbeeld hiervan bespreken wij de Belgian American Educational Foundation (BAEF. In het Interbellum zond de BAEF honderden wetenschappers-in-wording naar de Verenigde Staten. Daarbij getroostte de organisatie zich veel moeite om de selectieprocedure te optimaliseren en stelde zij voorwaarden aan zowel de mentale als fysieke conditie van haar fellows. De BAEF maakte hiermee sommige repertoires van het wetenschapper-zijn onmogelijk, terwijl zij haar fellows aanmoedigde om bepaalde andere kwaliteiten voor het voetlicht te brengen voor de ogen van de funding body. Dit toont aan, zo betogen wij, dat de wetenschappelijke persona gesitueerd en performatief is.

  10. The Exchange Programme of the Belgian American Educational Foundation: An Institutional Perspective on Scientific Persona Formation (1920-1940

    Directory of Open Access Journals (Sweden)

    Pieter Huistra

    2016-12-01

    Full Text Available In this article we propose an institutional perspective on persona formation. Not unlike individual scientists, institutions such as funding bodies took an active interest in shaping the scientific persona. As a case in point, we discuss the Belgian American Educational Foundation (BAEF that sent hundreds of aspiring Belgian scientists to the United States during the Interwar period. The BAEF went to great lengths to optimise its selection procedure and formulated conditions pertaining to both the mental and physical fitness of its grantees. In this way, the BAEF cut off some repertoires of being a scientist and encouraged its fellows to demonstrate certain qualities when in front of the funding body. This, we argue, points to the performative and occasional character of scientific personae. Geschikt om te reizen. Het uitwisselingsprogramma van de Belgian American Education Foundation. Een institutioneel perspectief op de vorming van wetenschappelijke personae (1920-1940In dit artikel benaderen wij de vorming van personae vanuit een institutioneel perspectief. Net als individuele wetenschappers zijn instituties zoals funding bodies actief betrokken bij het scheppen en in standhouden van wetenschappelijke personae. Als voorbeeld hiervan bespreken wij de Belgian American Educational Foundation (BAEF. In het Interbellum zond de BAEF honderden wetenschappers-in-wording naar de Verenigde Staten. Daarbij getroostte de organisatie zich veel moeite om de selectieprocedure te optimaliseren en stelde zij voorwaarden aan zowel de mentale als fysieke conditie van haar fellows. De BAEF maakte hiermee sommige repertoires van het wetenschapper-zijn onmogelijk, terwijl zij haar fellows aanmoedigde om bepaalde andere kwaliteiten voor het voetlicht te brengen voor de ogen van de funding body. Dit toont aan, zo betogen wij, dat de wetenschappelijke persona gesitueerd en performatief is.

  11. “The French Constitutional Council as the Rottweiler of the Republican Ideal in the Language Field: Does Jurisprudence Really Reflect Reality?”

    Directory of Open Access Journals (Sweden)

    Stefan Graziadei

    2012-11-01

    Full Text Available France is known for being a champion of individual rights as well as for its overt hostility to any form of group rights. Linguistic pluralism in the public sphere is rejected for fear of babelization and Balkanization of the country. Over recent decades the Conseil Constitutionnel (CC has, together with the Conseil d’État, remained arguably the strongest defender of this Jacobin ideal in France.In this article, I will discuss the role of France’s restrictive language policy through the prism of the CC’s jurisprudence. Overall, I will argue that the CC made reference to the (Jacobin state-nation concept, a concept that is discussed in the first part of the paper, in order to fight the revival of regional languages in France over recent decades. The clause making French the official language in 1992 was functional to this policy. The intriguing aspect is that in France the CC managed to standardise France’s policy vis-à-vis regional and minority languages through its jurisprudence; an issue discussed in the second part of the paper. But in those regions with a stronger tradition of identity, particularly in the French overseas territories, the third part of the paper argues, normative reality has increasingly become under pressure. Therefore, a discrepancy between the ‘law in courts’ and the compliance with these decisions (‘law in action’ has been emerging over recent years. Amid some signs of opening of France to minorities, this contradiction delineates a trend that might well continue in future.

  12. Screening study for waste biomass to ethanol production facility using the Amoco process in New York State. Appendices to the final report

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-08-01

    The final report evaluates the economic feasibility of locating biomass-to-ethanol waste conversion facilities in New York State. Part 1 of the study evaluates 74 potential sites in New York City and identifies two preferred sites on Staten Island, the Proctor and Gamble and the Arthur Kill sites for further consideration. Part 2 evaluates upstate New York and determines that four regions surrounding the urban centers of Albany, Buffalo, Rochester, and Syracuse provide suitable areas from which to select specific sites for further consideration. A conceptual design and economic viability evaluation were developed for a minimum-size facility capable of processing 500 tons per day (tpd) of biomass consisting of wood or paper, or a combination of the two for upstate regions. The facility would use Amoco`s biomass conversion technology and produce 49,000 gallons per day of ethanol and approximately 300 tpd of lignin solid by-product. For New York City, a 1,000-tpd processing facility was also evaluated to examine effects of economies of scale. The reports evaluate the feasibility of building a biomass conversion facility in terms of city and state economic, environmental, and community factors. Given the data obtained to date, including changing costs for feedstock and ethanol, the project is marginally attractive. A facility should be as large as possible and located in a New York State Economic Development Zone to take advantage of economic incentives. The facility should have on-site oxidation capabilities, which will make it more financially viable given the high cost of energy. This appendix to the final report provides supplemental material supporting the evaluations.

  13. MM5 v3.6.1 and WRF v3.5.1 model comparison of standard and surface energy variables in the development of the planetary boundary layer

    Science.gov (United States)

    Wilmot, C.-S. M.; Rappenglück, B.; Li, X.; Cuchiara, G.

    2014-11-01

    Air quality forecasting requires atmospheric weather models to generate accurate meteorological conditions, one of which is the development of the planetary boundary layer (PBL). An important contributor to the development of the PBL is the land-air exchange captured in the energy budget as well as turbulence parameters. Standard and surface energy variables were modeled using the fifth-generation Penn State/National Center for Atmospheric Research mesoscale model (MM5), version 3.6.1, and the Weather Research and Forecasting (WRF) model, version 3.5.1, and compared to measurements for a southeastern Texas coastal region. The study period was 28 August-1 September 2006. It also included a frontal passage. The results of the study are ambiguous. Although WRF does not perform as well as MM5 in predicting PBL heights, it better simulates energy budget and most of the general variables. Both models overestimate incoming solar radiation, which implies a surplus of energy that could be redistributed in either the partitioning of the surface energy variables or in some other aspect of the meteorological modeling not examined here. The MM5 model consistently had much drier conditions than the WRF model, which could lead to more energy available to other parts of the meteorological system. On the clearest day of the study period, MM5 had increased latent heat flux, which could lead to higher evaporation rates and lower moisture in the model. However, this latent heat disparity between the two models is not visible during any other part of the study. The observed frontal passage affected the performance of most of the variables, including the radiation, flux, and turbulence variables, at times creating dramatic differences in the r2 values.

  14. MM5 v3.6.1 and WRF v3.2.1 model comparison of standard and surface energy variables in the development of the planetary boundary layer

    Science.gov (United States)

    Wilmot, C.-S. M.; Rappenglück, B.; Li, X.

    2014-04-01

    Air quality forecasting requires atmospheric weather models to generate accurate meteorological conditions, one of which is the development of the planetary boundary layer (PBL). An important contributor to the development of the PBL is the land-air exchange captured in the energy budget as well as turbulence parameters. Standard and surface energy variables were modeled using the fifth-generation Penn State/National Center for Atmospheric Research mesoscale model (MM5), version 3.6.1, and the Weather Research and Forecasting (WRF) model, version 3.2.1, and compared to measurements for a southeastern Texas coastal region. The study period was 28 August-1 September 2006. It also included a frontal passage. The results of the study are ambiguous. Although WRF does not perform as well as MM5 in predicting PBL heights, it better simulates most of the general and energy budget variables. Both models overestimate incoming solar radiation, which implies a surplus of energy that could be redistributed in either the partitioning of the surface energy variables or in some other aspect of the meteorological modeling not examined here. The MM5 model consistently had much drier conditions than the WRF model, which could lead to more energy available to other parts of the meteorological system. On the clearest day of the study period MM5 had increased latent heat flux, which could lead to higher evaporation rates and lower moisture in the model. However, this latent heat disparity between the two models is not visible during any other part of the study. The observed frontal passage affected the performance of most of the variables, including the radiation, flux, and turbulence variables, at times creating dramatic differences in the r2 values.

  15. Children diagnosed with congenital cardiac malformations at the national university departments of pediatric cardiology: positive predictive values of data in the Danish National Patient Registry

    Directory of Open Access Journals (Sweden)

    Peter Agergaard

    2011-02-01

    Full Text Available Peter Agergaard1, Anders Hebert2, Jesper Bjerre3, Karina Meden Sørensen4, Charlotte Olesen3, John Rosendal Østergaard31Department of Pediatrics, Viborg Hospital, Viborg, Denmark; 2Department of Pediatrics, Copenhagen University Hospital, Rigshospitalet, Denmark; 3Department of Pediatrics, Aarhus University Hospital, Skejby, Denmark; 4Department of Clinical Biochemistry and Immunology, Statens Serum Institut, Copenhagen, DenmarkIntroduction: The present study was conducted to establish the positive predictive value of congenital cardiac malformation diagnoses registered in the Danish National Patient Registry (NPR, thereby exploring whether the NPR can serve as a valid tool for epidemiologic studies of congenital cardiac malformations.Materials and methods: The study population comprised every individual born from 2000 to 2008 who was registered in the NPR with a congenital cardiac malformation diagnosis and treated at one of the two national departments of pediatric cardiology. Positive predictive values were established comparing NPR information with the clinical record of each individual.Results: A total of 2952 patients with a total of 3536 diagnoses were eligible for validation. Review of their clinical records unveiled no patient without cardiac malformation. In 98% (98%–99% of the cases, the NPR diagnosis could be found as the discharge diagnosis in the patient's clinical record, and in 90% (89%–91% of the cases the NPR diagnosis was considered a true reflection of the patient's actual malformation.Conclusions: Our study verifies that the present study population retrieved from the NPR is a valid tool for epidemiological research within the topic of congenital cardiac malformations, given that the research question is not dependent on a fully established sensitivity of the NPR. Precautions should be made regarding cardiac malformations characterized by low prevalence or poor predictive values, and the reported validity should not be

  16. Assessing ozone-related health impacts under a changing climate.

    Science.gov (United States)

    Knowlton, Kim; Rosenthal, Joyce E; Hogrefe, Christian; Lynn, Barry; Gaffin, Stuart; Goldberg, Richard; Rosenzweig, Cynthia; Civerolo, Kevin; Ku, Jia-Yeong; Kinney, Patrick L

    2004-11-01

    Climate change may increase the frequency and intensity of ozone episodes in future summers in the United States. However, only recently have models become available that can assess the impact of climate change on O3 concentrations and health effects at regional and local scales that are relevant to adaptive planning. We developed and applied an integrated modeling framework to assess potential O3-related health impacts in future decades under a changing climate. The National Aeronautics and Space Administration-Goddard Institute for Space Studies global climate model at 4 degrees x 5 degrees resolution was linked to the Penn State/National Center for Atmospheric Research Mesoscale Model 5 and the Community Multiscale Air Quality atmospheric chemistry model at 36 km horizontal grid resolution to simulate hourly regional meteorology and O3 in five summers of the 2050s decade across the 31-county New York metropolitan region. We assessed changes in O3-related impacts on summer mortality resulting from climate change alone and with climate change superimposed on changes in O3 precursor emissions and population growth. Considering climate change alone, there was a median 4.5% increase in O3-related acute mortality across the 31 counties. Incorporating O3 precursor emission increases along with climate change yielded similar results. When population growth was factored into the projections, absolute impacts increased substantially. Counties with the highest percent increases in projected O3 mortality spread beyond the urban core into less densely populated suburban counties. This modeling framework provides a potentially useful new tool for assessing the health risks of climate change.

  17. Cannabinoid hyperemesis syndrome with extreme hydrophilia

    Directory of Open Access Journals (Sweden)

    Enuh HA

    2013-08-01

    Full Text Available Hilary A Enuh,1 Julia Chin,1 Jay Nfonoyim21Department of Medicine, 2Critical Care Unit, Richmond University Medical Center, Staten Island, NY, USAAbstract: Marijuana is the most widely used recreational drug in the US. Hyperemetic hydrophilic syndrome is a previously described but infrequently recognized condition of cannabinoid abuse with hyperemesis and obsessive hot showering. We present a 47-year-old male known marijuana addict with intractable abdominal pain who could not wait for physical examination, meal, or medication, because of obsessive compulsive warm baths. He had a history of epilepsy and addiction to marijuana, which he took on the day of admission. He presented to the hospital with a seizure, complicated by nausea, vomiting, and severe abdominal pain. His examination was unremarkable, except for mild epigastric tenderness. His laboratory and radiological tests were within normal limits, except for a positive urine drug screen for marijuana and opiates. He took himself immediately to the bathroom and remained under a hot shower with the exception of two 15-minute breaks for the rest of the day. He stated that it made him feel better than medication. Receiving medication and even eating was a problem because of this compulsive showering. Abstinence from marijuana during the hospital stay made the patient's nausea and vomiting resolve significantly. Cannabinoid hyperemesis is a differential diagnosis among patients with intractable nausea, vomiting, and obsessive hot bathing. The syndrome is an unmistakable indication of marijuana addiction. A thorough history and observation is very valuable. Recognition of this entity will reduce unnecessary testing and utilization of health care resources.Keywords: cannabinoid, compulsive bathing, cyclic vomiting, hyperemesis, hydrophilia, marijuana

  18. Screening study for waste biomass to ethanol production facility using the Amoco process in New York State. Final report

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-08-01

    This report evaluates the economic feasibility of locating biomass-to-ethanol waste conversion facilities in New York State. Part 1 of the study evaluates 74 potential sites in New York City and identifies two preferred sites on Staten, the Proctor Gamble and the Arthur Kill sites, for further consideration. Part 2 evaluates upstate New York and determines that four regions surrounding the urban centers of Albany, Buffalo, Rochester, and Syracuse provide suitable areas from which to select specific sites for further consideration. A separate Appendix provides supplemental material supporting the evaluations. A conceptual design and economic viability evaluation were developed for a minimum-size facility capable of processing 500 tons per day (tpd) of biomass consisting of wood or paper, or a combination of the two for upstate regions. The facility would use Amoco`s biomass conversion technology and produce 49,000 gallons per day of ethanol and approximately 300 tpd of lignin solid by-product. For New York City, a 1,000-tpd processing facility was also evaluated to examine effects of economies of scale. The reports evaluate the feasibility of building a biomass conversion facility in terms of city and state economic, environmental, and community factors. Given the data obtained to date, including changing costs for feedstock and ethanol, the project is marginally attractive. A facility should be as large as possible and located in a New York State Economic Development Zone to take advantage of economic incentives. The facility should have on-site oxidation capabilities, which will make it more financially viable given the high cost of energy. 26 figs., 121 tabs.

  19. Los Ayuntamientos de los pueblos indígenas de Chiapas en el siglo XIX y su relación con los asuntos de justicia

    Directory of Open Access Journals (Sweden)

    Palomo Infante, María Dolores

    2009-06-01

    Full Text Available After the promulgation of the gaditanian Constitution in 1812, the formation of town governments, accompanied by new liberal ideologies and the political changes in newly independent Mexico directed to define the new State-Nation, impacted in the way politics and justice were practiced in the indigenous townships of Chiapas. This article analyzes the way how the town halls intervened in judicial affairs that were part of their jurisdiction, but as well as in some other cases as the accused. During the 19th century, the town governments in the indigenous townships resulted to be a competitive space in which power and authority were constantly restructured; a space much more diversified then with respect to ethnic composition, complemented by a constantly growing number of “ladinos”, shaping political and judicial processes.

    El surgimiento de los Ayuntamientos tras la promulgación de la Constitución gaditana de 1812, las nuevas corrientes ideológicas liberales decimonónicas, los cambios políticos producidos en México después de la Independencia y la necesidad de definir al nuevo Estado-nación, provocaron cambios en el ejercicio de la política y la justicia en los pueblos indígenas de Chiapas. Este artículo analiza de qué forma ejercieron los gobiernos locales sus funciones de impartición de justicia en aquellos pleitos que caían bajo su jurisdicción, y cómo participaron en algunos no como jueces sino como implicados en el proceso. Durante el siglo XIX, los Ayuntamientos de los pueblos indígenas de Chiapas fueron espacios conflictivos, donde se reconfiguraron el poder y la autoridad; espacios que estaban ahora mucho más diversificados desde el punto de visto étnico, con la existencia de un número cada vez mayor de ladinos en ellos, lo que determinó tanto los procesos jurídicos como políticos.

  20. Second generation biofuels. France drives in top gear; Tweede generatie biobrandstoffen. Frankrijk in de hoogste versnelling

    Energy Technology Data Exchange (ETDEWEB)

    Polo-Leemreis, J.

    2010-06-15

    In its 2008 directive Europe formulated a target for 2020 for blending biofuels of 5.75%. At the national level France formulated stricter targets: 7% blending in petrol in 2010 and 10% in 2015. The target for diesel blending amounted to 8%. Partly because of this policy, France has become Europe's largest producer of first generation biofuels. Due to France's enthusiasm for first generation biofuels, it is lagging behind in the development of second generation biofuels compared to competitors such as Germany and the United States. Ambitions have now been set high to make up arrears. Both on the national and international level French teams are working on ambitious projects. This article provides an overview of the main French projects for the development of second generation biofuels. The following projects are discussed: Futurol (total budget of 74 million euro), BioTFuel (total budget of 112,7 million euro), GAYA (total budget van 61,4 million euro), Deinol, Global Bioenergies en Memobiol, Biocore, Eurobioref and the international enzyme-genomics project. [Dutch] In zijn richtlijn uit 2008 heeft Europa voor 2020 een doelstelling van 5,75% opgesteld voor bijmenging van biobrandstoffen. Op nationaal niveau heeft Frankrijk strengere doelstellingen geformuleerd: 7% bijmenging in benzine in 2010 en 10% in 2015. Voor diesel was de doelstelling 8% bijmenging. Mede vanwege dit beleid is Frankrijk Europa's grootste producent van eerste generatie biobrandstoffen. Door het Franse enthousiasme voor eerste generatie biobrandstoffen loopt het land voor de ontwikkeling van tweede generatie biobrandstoffen achter op concurrenten als Duitsland en de Verenigde Staten. De ambities zijn nu hoog om deze achterstand zo snel mogelijk weg te werken. Zowel op nationaal als internationaal niveau werken Franse teams aan ambitieuze projecten. Dit artikel geeft een overzicht van de belangrijkste Franse projecten voor de ontwikkeling van tweede generatie biobrandstoffen. Het

  1. Estimation of future methane production from Hellenic landfills

    Energy Technology Data Exchange (ETDEWEB)

    Tsatsarelis, T.; Karagiannidis, A. [Aristotle Univ., Thessaloniki (Greece). Lab. of Heat Transfer and Environmental Engineering

    2009-07-15

    Pollution Control Authority (Statens forurensningstilsyn, SFT) for the calculation of methane emissions from municipal solid waste (MSW) disposal sites. This model is in full compliance both with the Revised Intergovernmental Panel on Climate Change (IPCC) Guidelines for National Greenhouse Gas inventories, as well as the IPCC Good Practice Guidance and Uncertainty Management in National Greenhouse Gas Inventories as approved by the UNFCCC.

  2. Effects of Winter Flooding Peat Soils on Greenhouse Gas Emissions in the Sacramento-San Joaquin Delta

    Science.gov (United States)

    Anderson, F. E.; Pellerin, B. A.; Bergamaschi, B. A.; Sturtevant, C. S.; Verfaillie, J. G.; Knox, S. H.; Baldocchi, D. D.; Fujii, R.

    2013-12-01

    Harvested cornfields make up nearly 80% of cropland intentionally flooded during the winter (October through February) in the Sacramento-San Joaquin Delta to support waterfowl migration along the Pacific Flyway. This area is characterized by peat-rich islands that when flooded have the potential to be a source of methane production and emission, while reducing carbon dioxide respiration. Given the extent of winter flooding in the Delta, we evaluated the greenhouse gas emissions during this period and compared it to conventional winter fallow management. We constructed two eddy covariance towers on Staten Island, one in a cornfield flooded during the winter and the other one in a reference cornfield that remains fallow. Each tower included measurements of carbon dioxide, latent, sensible, and ground heat fluxes, as well as a suite of radiation measurements. A LI-COR Open Path Methane Analyzer (LI-7700) was initially installed at the flooded site and then alternated between the two sites every three to four weeks throughout the study. A second LI-7700 was deployed for continuous measurements at both towers in the winter of 2012/2013. Both fields have been under the same management for growing corn in the summer for the past twenty-five years. After harvest, the residual corn is chopped and then tilled into the soil before the winter season. Methane emissions slowly increased during the winter flooded period in 2011-2012, with maximum emissions (~234 mg-C m-2 day-1) occurring immediately following field drainage in mid-February. Methane emissions during the second winter period (e.g. 2012-2013) were similar to the first season in magnitude and timing, but showed two distinct events where emissions slowly increased followed by a maximum emission pulse and then a rapid decrease. Preliminary data analysis suggests the influence of strong Pacific storms occurring in the beginning of the second flooded season as a source of disturbance and agitating mechanism leading to

  3. The glycosylated Rv1860 protein of Mycobacterium tuberculosis inhibits dendritic cell mediated TH1 and TH17 polarization of T cells and abrogates protective immunity conferred by BCG.

    Science.gov (United States)

    Satchidanandam, Vijaya; Kumar, Naveen; Jumani, Rajiv S; Challu, Vijay; Elangovan, Shobha; Khan, Naseem A

    2014-06-01

    We previously reported interferon gamma secretion by human CD4⁺ and CD8⁺ T cells in response to recombinant E. coli-expressed Rv1860 protein of Mycobacterium tuberculosis (MTB) as well as protection of guinea pigs against a challenge with virulent MTB following prime-boost immunization with DNA vaccine and poxvirus expressing Rv1860. In contrast, a Statens Serum Institute Mycobacterium bovis BCG (BCG-SSI) recombinant expressing MTB Rv1860 (BCG-TB1860) showed loss of protective ability compared to the parent BCG strain expressing the control GFP protein (BCG-GFP). Since Rv1860 is a secreted mannosylated protein of MTB and BCG, we investigated the effect of BCG-TB1860 on innate immunity. Relative to BCG-GFP, BCG-TB1860 effected a significant near total reduction both in secretion of cytokines IL-2, IL-12p40, IL-12p70, TNF-α, IL-6 and IL-10, and up regulation of co-stimulatory molecules MHC-II, CD40, CD54, CD80 and CD86 by infected bone marrow derived dendritic cells (BMDC), while leaving secreted levels of TGF-β unchanged. These effects were mimicked by BCG-TB1860His which carried a 6-Histidine tag at the C-terminus of Rv1860, killed sonicated preparations of BCG-TB1860 and purified H37Rv-derived Rv1860 glycoprotein added to BCG-GFP, but not by E. coli-expressed recombinant Rv1860. Most importantly, BMDC exposed to BCG-TB1860 failed to polarize allogeneic as well as syngeneic T cells to secrete IFN-γ and IL-17 relative to BCG-GFP. Splenocytes from mice infected with BCG-SSI showed significantly less proliferation and secretion of IL-2, IFN-γ and IL-17, but secreted higher levels of IL-10 in response to in vitro restimulation with BCG-TB1860 compared to BCG-GFP. Spleens from mice infected with BCG-TB1860 also harboured significantly fewer DC expressing MHC-II, IL-12, IL-2 and TNF-α compared to mice infected with BCG-GFP. Glycoproteins of MTB, through their deleterious effects on DC may thus contribute to suppress the generation of a TH1- and TH17-dominated

  4. Evaluation of airborne lidar elevation surfaces for propagation of coastal inundation: the importance of hydrologic connectivity

    Science.gov (United States)

    Poppenga, Sandra; Worstell, Bruce B.

    2015-01-01

    Detailed information about coastal inundation is vital to understanding dynamic and populated areas that are impacted by storm surge and flooding. To understand these natural hazard risks, lidar elevation surfaces are frequently used to model inundation in coastal areas. A single-value surface method is sometimes used to inundate areas in lidar elevation surfaces that are below a specified elevation value. However, such an approach does not take into consideration hydrologic connectivity between elevation grids cells resulting in inland areas that should be hydrologically connected to the ocean, but are not. Because inland areas that should drain to the ocean are hydrologically disconnected by raised features in a lidar elevation surface, simply raising the water level to propagate coastal inundation will lead to inundation uncertainties. We took advantage of this problem to identify hydrologically disconnected inland areas to point out that they should be considered for coastal inundation, and that a lidar-based hydrologic surface should be developed with hydrologic connectivity prior to inundation analysis. The process of achieving hydrologic connectivity with hydrologic-enforcement is not new, however, the application of hydrologically-enforced lidar elevation surfaces for improved coastal inundation mapping as approached in this research is innovative. In this article, we propagated a high-resolution lidar elevation surface in coastal Staten Island, New York to demonstrate that inland areas lacking hydrologic connectivity to the ocean could potentially be included in inundation delineations. For inland areas that were hydrologically disconnected, we evaluated if drainage to the ocean was evident, and calculated an area exceeding 11 ha (~0.11 km2) that could be considered in inundation delineations. We also assessed land cover for each inland area to determine the type of physical surfaces that would be potentially impacted if the inland areas were considered as

  5. The glycosylated Rv1860 protein of Mycobacterium tuberculosis inhibits dendritic cell mediated TH1 and TH17 polarization of T cells and abrogates protective immunity conferred by BCG.

    Directory of Open Access Journals (Sweden)

    Vijaya Satchidanandam

    2014-06-01

    Full Text Available We previously reported interferon gamma secretion by human CD4⁺ and CD8⁺ T cells in response to recombinant E. coli-expressed Rv1860 protein of Mycobacterium tuberculosis (MTB as well as protection of guinea pigs against a challenge with virulent MTB following prime-boost immunization with DNA vaccine and poxvirus expressing Rv1860. In contrast, a Statens Serum Institute Mycobacterium bovis BCG (BCG-SSI recombinant expressing MTB Rv1860 (BCG-TB1860 showed loss of protective ability compared to the parent BCG strain expressing the control GFP protein (BCG-GFP. Since Rv1860 is a secreted mannosylated protein of MTB and BCG, we investigated the effect of BCG-TB1860 on innate immunity. Relative to BCG-GFP, BCG-TB1860 effected a significant near total reduction both in secretion of cytokines IL-2, IL-12p40, IL-12p70, TNF-α, IL-6 and IL-10, and up regulation of co-stimulatory molecules MHC-II, CD40, CD54, CD80 and CD86 by infected bone marrow derived dendritic cells (BMDC, while leaving secreted levels of TGF-β unchanged. These effects were mimicked by BCG-TB1860His which carried a 6-Histidine tag at the C-terminus of Rv1860, killed sonicated preparations of BCG-TB1860 and purified H37Rv-derived Rv1860 glycoprotein added to BCG-GFP, but not by E. coli-expressed recombinant Rv1860. Most importantly, BMDC exposed to BCG-TB1860 failed to polarize allogeneic as well as syngeneic T cells to secrete IFN-γ and IL-17 relative to BCG-GFP. Splenocytes from mice infected with BCG-SSI showed significantly less proliferation and secretion of IL-2, IFN-γ and IL-17, but secreted higher levels of IL-10 in response to in vitro restimulation with BCG-TB1860 compared to BCG-GFP. Spleens from mice infected with BCG-TB1860 also harboured significantly fewer DC expressing MHC-II, IL-12, IL-2 and TNF-α compared to mice infected with BCG-GFP. Glycoproteins of MTB, through their deleterious effects on DC may thus contribute to suppress the generation of a TH1- and TH

  6. La crisis del orden neoliberal en Argentina y la respuesta antiglobalización contra el ALCA

    Directory of Open Access Journals (Sweden)

    Manuela Fernández Mayo

    2009-12-01

    Full Text Available El presente artículo es una introducción al estudio económico de la crisis argentina de 2001. Encuadrando la interpretación de la misma dentro de un contexto internacional y latinoamericano del período. Los gobiernos argentinos siguieron al pie de la letra, las exigencias del “Consenso de Washington” y aplicaron todas las medidas de ajuste estructural dictadas por el FMI: liquidación de las empresas nacionales; destrucción de los servicios públicos; total apertura comercial (responsable de la ruina de miles de pequeñas y medianas empresas, etc. Los gobiernos democráticos, profundizaron la destrucción de este Estado-Nación y terminaron consolidando la construcción de la Argentina, como simplemente un "mercado", el “alumno modelo” del neoliberalismo resultó un modelo en todo: en el descaro del latrocinio y en sus efectos sociales. Tras el derrumbe del modelo neoliberal, se extienden las posturas antiglobalización, materializadas con éxito, en la oposición a la entrada en vigor del ALCA en 2005._____________________ABSTRACT:The present article is an introduction to the economic analysis of the Argentinian crisis of 2001, fitting this interpretation in the international and south american context of the period. The Argentine governments followed exactly the exigencies of the "Washington Consensus" and applied all the measures of structural adjustment dictated by the IMF: liquidation of national companies; destruction of public services; full commercial opening (responsible of the ruin of thousands of small and medium companies, etc. Democratic governments deepened the destruction of this State-Nation and ended up consolidating the construction of Argentina, just as a "market", the "exemplary pupil" of neoliberalism was taken as model in everything: in the impudence of thievery and its social effects. After the collapse of neoliberal model, antiglobalization extends to face the coming into force of the ALCA in 2005.

  7. En prospektiv undersøkelse av sammenhengen mellom kosthold og kreft blant middelaldrende kvinner og menn i Norge 1977-1992. Prosjektbeskrivelse

    Directory of Open Access Journals (Sweden)

    Marit Bragelien Veierød

    2009-10-01

    Full Text Available  SAMMENDRAGI USA er det anslått at 30% av alle dødsfall som skyldes kreftsykdom kan tilskrives kosthold i voksen alder(inkludert kostholdets betydning for overvekt. 4 Fra Statens helseundersøkelser sine hjertekarundersøkelseri Finnmark, Sogn og Fjordane og Oppland i 1977-83, foreligger data om kosthold for vel50 000 menn og kvinner i alderen 16-56 år. Kopling mot Kreftregisteret og Statistisk sentralbyrå gir ossmulighet til å se nærmere på sammenhengen mellom kosthold og risiko for kreft i en kohortstudie medkomplett oppfølging med hensyn på forekomst av kreft, død og emigrasjon. I henhold til kontrakten ombruk av den koplete datafila, studerer vi i dette prosjektet sammenhengen mellom kosthold og risiko forkreft i magesekk, bukspyttkjertel, livmorhals, prostata, lunger og hud (malignt melanom. Den statistiskestyrken i epidemilogiske studier som denne, samt hvilken betydning målefeil i kostholdsvariablene har forrisikoestimatene og den statistiske styrken, blir også vurdert. Denne artikkelen gir en nærmere presentasjonav prosjektet og de metodene som benyttes.Veierød MB. A prospective study of diet and cancer in middle-aged women and men in Norway1977-1992. Project description. Nor J Epidemiol 1997; 7 (2: 201-204. ENGLISH SUMMARYThe relationship beteen dietary habits and the incidence of cancer is studied in 50,000 Norwegian men andwomen aged 16-56 years attending a Norwegian health screening in 1977-83. Linkage to the CancerRegistry of Norway and the Central Bureau of Statistics of Norway ensure a complete follow-up until 31December 1992. The cancer sites included in this project are the stomach, pancreas, cervix, prostate, lungand malignant melanoma. Diet was recorded on a semi-quantitative food-frequency questionnaire at thetime of screening, and intake of energy and fats are estimated. The attenuation of effect estimates due tomeasurement errors in the dietary variables will be investigated, as well as the power of the

  8. Evaluation of Airborne Lidar Elevation Surfaces for Propagation of Coastal Inundation: The Importance of Hydrologic Connectivity

    Directory of Open Access Journals (Sweden)

    Sandra Poppenga

    2015-09-01

    Full Text Available Detailed information about coastal inundation is vital to understanding dynamic and populated areas that are impacted by storm surge and flooding. To understand these natural hazard risks, lidar elevation surfaces are frequently used to model inundation in coastal areas. A single-value surface method is sometimes used to inundate areas in lidar elevation surfaces that are below a specified elevation value. However, such an approach does not take into consideration hydrologic connectivity between elevation grids cells resulting in inland areas that should be hydrologically connected to the ocean, but are not. Because inland areas that should drain to the ocean are hydrologically disconnected by raised features in a lidar elevation surface, simply raising the water level to propagate coastal inundation will lead to inundation uncertainties. We took advantage of this problem to identify hydrologically disconnected inland areas to point out that they should be considered for coastal inundation, and that a lidar-based hydrologic surface should be developed with hydrologic connectivity prior to inundation analysis. The process of achieving hydrologic connectivity with hydrologic-enforcement is not new, however, the application of hydrologically-enforced lidar elevation surfaces for improved coastal inundation mapping as approached in this research is innovative. In this article, we propagated a high-resolution lidar elevation surface in coastal Staten Island, New York to demonstrate that inland areas lacking hydrologic connectivity to the ocean could potentially be included in inundation delineations. For inland areas that were hydrologically disconnected, we evaluated if drainage to the ocean was evident, and calculated an area exceeding 11 ha (~0.11 km2 that could be considered in inundation delineations. We also assessed land cover for each inland area to determine the type of physical surfaces that would be potentially impacted if the inland areas

  9. “La República de los Sueños”: De lo racional de la República a lo irracional de los sueños

    Directory of Open Access Journals (Sweden)

    Broullón Acuña, Esmeralda

    2010-02-01

    Full Text Available The Republic of the dreams is an “Atlantic novel” and as such it develops a narrative on the trip and the memory of a family of Spanish origin in the contemporary Brazil. The work investigates the process of immigration and adjustment of a Galician patriarchal and capitalist, predestined to the social success. A consecration that will go up to his last consequences, coming back to his village, of which went out in 1913, to marry the daughter of a nobleman. Founder of a lineage hispanic-brazilian will remain caught in the profit that he itself interweaves on having taken part of the networks and the oligarchic practices that dominate in the country. Thus the authoress re-composes a statement ethnic-historical where she represents the ethnic segmentation of the condition state-nation and institutes the memory and the culture as elements of resistance.

    La República de los sueños es una “novela atlántica” y como tal desarrolla una narrativa sobre el viaje y la memoria de una familia de origen español en el Brasil contemporáneo. La obra indaga el proceso de inmigración y adaptación de un gallego patriarcal y capitalista, predestinado al éxito social. Una consagración que llevará hasta sus últimas consecuencias, retornando a su aldea, de la cual salió en 1913, para casarse con la hija de un hidalgo. Fundador de un linaje hispanobrasileño quedará atrapado en el lucro que él mismo entreteje al participar de las redes y las prácticas oligárquicas que dominan en el país. De este modo la autora recompone un relato etnohistórico donde representa la segmentación étnica del estado-nación e instituye la memoria y la cultura como elementos de resistencia.

  10. Puente Verrazano-Narrows

    Directory of Open Access Journals (Sweden)

    Ammann, -

    1964-05-01

    Full Text Available This outstanding suspension bridge underwent a long process of preparation, and it has finally served to solve a most urgent and intense problem of communication between Brooking and Staten Island. This bridge represents an exceptional engineering achievement firstly because of the 1,298 m span between its two towers, and the two side spans of 370 m; secondly due to the vast amounts of materials involved in its construction. The suspended deck will have two directions of traffic, each consisting of six lanes, the two directions separated by a central division. The anchorage and foundations reach down to a depth of 50 m. The towers supporting the main suspension cables are 210 m high above the mean sea level. Their prefabricated external metal shell contain inside a complex system of thousands of metal cells. The deck hangs from four main suspension cables, each 90 cm in diameter. Hanger cables, each 55 cm in diameter, support the deck. The cable spinning over the main towers was a difficult and highly complicated operation. Details of this are given in the accompanying diagrams. Simultaneous with the construction of the bridge, the main access roads to it have been improved and altered, in order to chanalise the heavy traffic more effectively towards it. The whole project, including the construction of the bridge and alterations to the approaches, has amounted to a total cost of the order of 400 million dollars. The safety of the personnel working on this project has been very carefully studied. Ellaborate arrangements are being rigidly enforced for the protection of human lives. It is hoped that this huge project will be completed within the present year.Esta destacada obra, suspendida, realizada por la Triborough Bridge and Tunnel Authority, cuenta con una larga gestación que por fin culminó en una realidad y, con ella, a dar solución a una angustiosa situación que el tráfico rodado venía creando progresivamente con sus innumerables

  11. Social Reform in Times of Transition. Reflections on Martin Conway’s The Sorrows of Belgium

    Directory of Open Access Journals (Sweden)

    Nico Wouters

    2014-12-01

    genesis of post-war social reform is merely the tip of the iceberg in this regard. It is clear that there is still a lot of room for research, certainly in a comparative perspective with the Netherlands. This concerns topics such as social class-studies from below, but also their agency vis-à-vis the national state during these crucial years of transition. As such, this contribution primarily underscores the importance of a true social history of Belgium for the 1930s-1940s, a history that would be highly relevant in a comparative framework with the Netherlands, most notably when also analysing the interaction between these social evolutions and political reform in 1945-1947. Sociale hervormingen tijdens transitiejaren. Overwegingen bij Martin Conway’s The Sorrows of BelgiumIn zijn boek The Sorrows of Belgium gebruikt Martin Conway de Belgische casus om te kijken naar het herstel van de liberaal-parlementaire staten in Europa tussen 1945 en 1947. Nico Wouters’ bijdrage richt zich op drie elementen die Conway zelf aanhaalt: 1 de belangrijke maar ambivalente rol van het lokale bestuur (steden en gemeenten, 2 het onvermogen om het Belgische patriottisme als bindmiddel voor de natiestaat institutioneel te verankeren en tot slot 3 de kloof tussen verschuivingen in klassenrelaties en politiek-institutionele vernieuwing. Via een oppervlakkige vergelijking met Nederland plaatst zijn bijdrage kanttekeningen bij elk van deze elementen.Zoals Conway aantoont, waren de grotere steden in België laboratoria voor nieuwe politieke stromingen die uiteindelijk de middelpuntvliedende, regionalistische tendensen versterkten. Anderzijds echter, had volgens Wouters het lokale niveau als administratief en institutioneel onderdeel van de staatsorganisatie op korte termijn een omgekeerd effect. De restauratie na de bevrijding kan enkel worden begrepen door in rekening te brengen dat ‘lokale staten’ een dwingend institutioneel raamwerk oplegden en zo de ruimte voor politieke vernieuwing

  12. Sobre la crisis de la democracia (XXIII Conferencias Aranguren

    Directory of Open Access Journals (Sweden)

    Sartorius, Nicolás

    2015-06-01

    Full Text Available Democracy and globalisation: Democracy is currently defined as the political selfgovernance of human’s based on freedom and equality. As such, it is of recent implementation and presents limitations, both geographic and thematic. Throughout a long period of time, its effective realisation has found tremendous obstacles, related to gender-female vote was mainly established after World War I and II; —social class or race— decolonisation is a 20th Century phenomenon. Today, representative democracy has reached new areas within its traditional Statenation framework, such as new technologies and economic globalisation, which have also contributed to its crisis. The unlimited expansion of capital– similar to that of the Universe – has not had an equivalent in the political domain, even in modern democracies, which are still trapped in the narrow limits of the State. These limits will only be surpassed when democracy, as well, expands. II. The Spanish case: The Spanish democratic subsystem, as part of the European democratic system, is young and is a result of a particular balance of power built throughout a convulsed historical process in which dictatorial regimes have been very present. Nowadays, even though the Spanish political regime is a democracy, insufficiencies or limitations are evident and must be specified. These limitations or insufficiencies are shown, amongst others, by a certain geostrategic dependency; a poor productive system not based enough in innovation and science; a lack of social cohesion and excessive economic power; an unresolved territorial problem and a State that finds it hard to be secular. Therefore, there is enough field of action for a new democratic impulse that faces all these challenges and finally turns Spain into a truly advanced DemocracyLa democracia en el sentido contemporáneo del término, como autogobierno político de los seres humanos basado en la libertad y a igualdad, es de muy reciente

  13. Et lykkeligt fornuftsægteskab? Turistforeningen for Danmark mellem hjemstavnsturisme og eksportturisme ca. 1888-1967

    Directory of Open Access Journals (Sweden)

    Mikael Frausing

    2010-11-01

    Full Text Available Artiklen baserer sig på undersøgelser af Turistforeningen for Danmarks virke med hovedvægt på perioden 1923-1945. Nedsættelsen af „Udenrigsministeriets Udvalg for Turistpropaganda i Udlandet" i 1934 betød en gennemgribende forandring, hvor staten for første gang involverede sig aktivt i Turistforeningens organisationog arbejde. Turisme blev herved i højere grad opfattet som et eksporterhverv og indrettet efter sit økonomiske indtjeningspotentiale. Hermed lagdes grunden til den organisation og den turismeopfattelse, som kom til at dominere efterkrigstidens danske turisme, mens tidligere, konkurrerende syn på turismen på sigt marginaliseredes. En gennemgang af Turistforeningens brochurer og udgivelservil i øvrigt demonstrere, at „Danmark som turistland" repræsenteredes i meget forskellige og konkurrerende diskurser, lige fra en hjemstavnsorientering med vægt på oldtid, landskaber og landbokultur til det „moderne Danmark" med levende byliv, uhøjtidelig harmoni, ungdommelighed og social ansvarlighed. Overordnet betød mellemkrigstiden både i organisation og repræsentation en forskydning af turistarbejdet fra provinsens lokale, folkelige forankring til byernes, primært københavnske, erhvervsinteresser.Abstract: A Happy Marriage of Convenience?The Danish National Tourist Organization c.1888-1967Turistforeningen for Danmark was the Danish National Tourist Organization from 1923-1967. It replaced Den danske Turistforening which dissolved in the turmoil following World War I, and was itself replaced in 1967 by Danmarks Turistråd. This article offers an outline of the development of Turistforeningen for Danmark with a main focus on the interwar-period 1923-1939. Through an analysis of the organization's activities to attract foreign visitors as well as to„enhance"the travel of Danes within their own country it is shown, how two distinct understandings of „tourism" co-existed, and was balanced against each other, within the

  14. En kartlegging av forekomsten av forskjellige rusmidler blant norske motorvognførere pågrepet av politiet, med mistanke om påvirket kjøring

    Directory of Open Access Journals (Sweden)

    Kari-Mette Beylich m. fl Beylich m. fl

    2009-10-01

    Full Text Available  SAMMENDRAGSjåfører som mistenkes for påvirket kjøring blir i første omgang vurdert av politiet med henblikk på om det kunskal rekvireres alkoholanalyse eller om det også skal tas prøve med hensyn på andre rusmidler (narkotika,medikamenter med ruspotensial ved Statens rettstoksikologiske institutt (SRI. Rutinemessig vil SRI undersøkedet politiet rekvirerer, men prøvene lagres inntil to år etter at de er analysert. Ved supplerende analyse i ettertidkan man således få et mer fullstendig bilde av hva mistenkte, påvirkede bilførere hadde i kroppen da de avgaprøve. I den foreliggende undersøkelsen ble 1197 prøver fra februar og september 1993 analysert på et bredtspekter av andre rusmidler foruten alkohol, uavhengig av hva politiets mistanke hadde vært. Vi fant da at alkoholalene var til stede i 55 % av prøvene, andre rusmidler alene i 16%, både alkohol og andre rusmidler i 14%, mensverken alkohol eller andre rusmidler ble påvist i 15% av prøvene. Politiets mistanke med hensyn til alkoholpåvirkningble bekreftet av analyseresultatene i 71% av tilfellene, og mistanke om forekomst av andre rusmidler i58% av tilfellene. Tidligere studier og denne undersøkelsen viste at bilførere som mistenkes for påvirket kjøringsynes å representere en gruppe med storbruk av alkohol og misbruk av andre stoff.Beylich K-M, Christophersen AS, Skurtveit S, Bjørneboe A, Mørland J. Frequency of different drugs in  ENGLISH SUMMARYDrivers apprehended under the suspicion of drunken or drugged driving are primarily evaluated by the police withregard to whether alcohol or drugs should be looked for in the blood samples taken shortly after apprehension.Until March 1996 all blood samples were sent to the National Institute of Forensic Toxicology (NIFT, for analysis.NIFT routinely perform only those analyses requested, but the samples are stored for up to two years afteranalysis. By later additional analyses of this material one could obtain a more

  15. Air pollution exposure in Oslo, Drammen, Bergen and Trondheim. Calculations of NO{sub 2}, PM{sub 10} and PM{sub 2,5} for the winter 1995 to 1996; Eksponering til luftforurensing i Oslo, Drammen, Bergen og Trondheim. Beregninger av NO{sub 2}, PM{sub 10} og PM{sub 2,5} for vinteren 1995-1996

    Energy Technology Data Exchange (ETDEWEB)

    Sloerdal, Leif Haavard

    1998-07-01

    The Norwegian Institute for Air Research (NILU) commissioned by the Norwegian Pollution Control Authority (Statens forurensningstilsyn), has calculated human exposure values to NO{sub 2}, PM{sub 1}0 and PM{sub 2},5 in the cities of Oslo, Drammen, Bergen and Trondheim. In Oslo, Drammen and Bergen the calculations are made for the winter 1995 to 1996. For Trondheim the necessary meteorological data were missing and the calculations are therefore made for the winter of 1994 to 1995. In the project only simplified exposure calculations are carried out where estimated ground concentrations and population distribution information at the km{sub 2} level are connected. The calculations are then made as if everyone have been outside at the home address during the entire estimation period, termed ''potential exposure''. The population exposure load is estimated for excesses of various air quality criteria and the results are presented. In addition values for the worst hour and/or the worst day of exposure for each of the four cities are presented. The term worst is defined as the hour or the day in the simulation period where the most number of people are exposed to concentrations exceeding the threshold values for air quality recommended by the Norwegian Pollution Control Authority. For NO{sub 2} these threshold figures are 100 microgram/m{sup 3} for hour values and 75 microgram/m{sup 3} for day values. For PM{sub 1}0 and PM{sub 2},5 criteria for hour values do not exist while day values are now stipulated as 35 microgram/m{sup 3} for PM{sub 1}0 and 20 microgram/m{sup 3} for PM{sub 2},5. The calculated maximum concentrations may not coincide with these values. The report gives results for exposure estimates for NO{sub 2}, PM{sub 1}0 and PM{sub 2},5 in the cities and evaluates the significance of regional background levels, traffic and heating emissions in contributions to the total population exposure load. The exposure to NO{sub 2} is largest in Bergen

  16. Des millets aux nations From millets to nations: the construction of national identities in the novel You too, are you Greek? by Vassilios Christopoulos

    Directory of Open Access Journals (Sweden)

    Nicolas Pitsos

    2012-05-01

    Full Text Available L’auteur de ce roman construit son intrigue sur l’histoire de plusieurs familles d’une part au moment de l’effondrement d’un monde, celui des millets de l’Empire ottoman fondé sur le principe de l’identification des individus en fonction de leurs croyances religieuses et, d’autre part, lors de la mise en place d’une nouvelle organisation politique, celle des États-nations obsédés par l’idée de la définition de l’individu sur la base de critères nationaux. L'exemple narratif dominant est celui du passage du millet des Roums à la nation des Grecs. Il s’agit d’un roman polyphonique quant à l’expression d’expériences traumatisantes issues de politiques de nettoyage ethnique et culturel, menées par les différentes parties impliquées dans les événements qui agitent l’Empire ottoman à la fin du XIXe et au début du XXe siècle. Dans ce sens, l’écriture de ce roman s’oppose aux lectures exclusivistes de l’événement historique, largement diffusées par les mythologies nationales balkaniques visant à exalter les souffrances de nos compatriotes et de nos coreligionnaires, tout en effaçant ou occultant les destins tragiques des Autres.The author of this novel puts in plot the history of various families, at the moment of the fall from one hand, of an entire world, this of ottoman empire’s millets, based on the principle of individual identification following their religious beliefs and during the establishment on the other hand, of a new political organization, this of State-Nations, obsessed by the idea of individual definition on the basis of national criteria. The predominant narrative paradigm is this of the Roum millet transition towards the Greeks' nation. It is about a polyphonic novel, regarding to the expression of traumatic experiences issued by the ethnic and cultural cleansing policies, conducted by the different actors implicated in the events which stirred up trouble in the ottoman

  17. Aportes para la Historia de la Historiografía Médico Veterinaria Venezolana - Contribution to History of Venezuela’s Veterinary Medicine Historiography. 1934-2009

    Directory of Open Access Journals (Sweden)

    Trujillo Mascia, Naudy

    2010-03-01

    Marc Bloch, Lucian Febvre and Pierre Vilar's Annales Historiografical School represented in Venezuela by Barquisimeto Historiographical School founded by Federico Brito Figueroa and Reinaldo Rojas; these both philosophical schools promote the vision of the Social History and the Synthesis or Total History Methodic Procedure using primarily the Progressive, Regressive and Comparative Historical Methods and the Documentation, Statistics, Interviews, Geohistory and Historical Inference Techniques. The investigation yielded as result the discovery of a significant number of works and publications dealing with the history of Venezuelan veterinary medicine since their beginnings as empirical activity until their development as a profession; and that such works have supported the formation of new veterinarians and that they have promoted the national medicalveterinary identity as a way of enhancing the social importance of the profession and its contribution to the construction of the State-Nation in Venezuela.

  18. Memoria e identidad

    Directory of Open Access Journals (Sweden)

    Julio De Zan

    2008-12-01

    of the founding deeds of the state-nation in the remote past, but is bound instead to other tragic events of the recent history of the society in which we live (6. In postmodern societies we witness a redefinition of traditional identity policies and a formation of new post-national identities bound to the tragic memory of genocides and to the moral and political commitment of "nevermore" (7.

  19. Aquifer geochemistry at potential aquifer storage and recovery sites in coastal plain aquifers in the New York city area, USA

    Science.gov (United States)

    Brown, C.J.; Misut, P.E.

    2010-01-01

    The effects of injecting oxic water from the New York city (NYC) drinking-water supply and distribution system into a nearby anoxic coastal plain aquifer for later recovery during periods of water shortage (aquifer storage and recovery, or ASR) were simulated by a 3-dimensional, reactive-solute transport model. The Cretaceous aquifer system in the NYC area of New York and New Jersey, USA contains pyrite, goethite, locally occurring siderite, lignite, and locally varying amounts of dissolved Fe and salinity. Sediment from cores drilled on Staten Island and western Long Island had high extractable concentrations of Fe, Mn, and acid volatile sulfides (AVS) plus chromium-reducible sulfides (CRS) and low concentrations of As, Pb, Cd, Cr, Cu and U. Similarly, water samples from the Lloyd aquifer (Cretaceous) in western Long Island generally contained high concentrations of Fe and Mn and low concentrations of other trace elements such as As, Pb, Cd, Cr, Cu and U, all of which were below US Environmental Protection Agency (USEPA) and NY maximum contaminant levels (MCLs). In such aquifer settings, ASR operations can be complicated by the oxidative dissolution of pyrite, low pH, and high concentrations of dissolved Fe in extracted water.The simulated injection of buffered, oxic city water into a hypothetical ASR well increased the hydraulic head at the well, displaced the ambient groundwater, and formed a spheroid of injected water with lower concentrations of Fe, Mn and major ions in water surrounding the ASR well, than in ambient water. Both the dissolved O2 concentrations and the pH of water near the well generally increased in magnitude during the simulated 5-a injection phase. The resultant oxidation of Fe2+ and attendant precipitation of goethite during injection provided a substrate for sorption of dissolved Fe during the 8-a extraction phase. The baseline scenario with a low (0.001M) concentration of pyrite in aquifer sediments, indicated that nearly 190% more water

  20. Return rates of European graduate students in the US : How many and who return, and when ? Terugkeer van Europese doctoraatsstudenten in de VS : hoeveel keren er terug en wanneer ?

    Directory of Open Access Journals (Sweden)

    Linda Van Bouwel

    2012-12-01

    meebrengen, kan de Europese economie hier wel bij varen. In deze context bestuderen we de migratiebeslissingen van een steekproef van Europese economiestudenten die hun doctoraat in de VS behaald hebben. Ten eerste observeren we dat een hoog percentage verkiest in de VS te blijven : 64 % werkt momenteel nog steeds in de VS, terwijl slechts 24 % terugkeert naar hun thuisland, en een additionele 10 % zich elders in Europa vestigt. Ten tweede zien we dat de meerderheid van zij die momenteel thuis of in Europa werken, daar ook al werkten vlak na hun afstuderen. Binnen Europa is het Verenigd Koninkrijk de meest populaire bestemming voor doctoraatshouders die ervoor kiezen niet naar hun land van herkomst terug te keren. Ten slotte zijn er mogelijks argumenten om meer fondsen vrij te maken voor Europese studenten die in de Verenigde Staten hun doctoraat willen behalen, aangezien studenten die door hun thuisland gefinancierd worden meer kans maken om terug te keren.

  1. Forekomst av alkohol og andre rusmidler i blodprøver fra førere involvert i trafikkulykker

    Directory of Open Access Journals (Sweden)

    Anders Bjørneboe m.fl

    2009-10-01

    Full Text Available  SAMMENDRAGBilkjøring stiller store krav til førernes sansing, oppmerksomhet, informasjonsbearbeiding og evne til åreagere. Førere som er under innflytelse av sentralnervøst aktive stoffer, vil derfor være en potensiell fare itrafikken. I perioden 1.8–31.12. 1993 identifiserte Statens rettstoksikologiske institutt (SRI 394 ulykkesføreresom politiet hadde rekvirert analyser av med hensyn på narkotiske stoff/sentralnervøst aktive medikamenter(andre rusmidler og/eller alkohol. Blodprøver fra disse førerne ble analysert med hensyn på alkohol og etutvidet repertoar av andre rusmidler ved SRI. Da polititjenestemenn og medtrafikanter ofte ikke vil oppdagepåvirkning av andre rusmidler enn alkohol, dels pga. manglende alkohollukt, vil andre rusmidler som ulykkesårsakvære noe underrepresentert i dette materialet sammenliknet med alkohol. Hos 299 av ulykkesførerneble det påvist alkohol og/eller andre rusmidler. 44 førere hadde tatt inn både alkohol og andre rusmidler, mensalkohol og andre rusmidler ble påvist alene i henholdsvis 204 og 51 saker. Totalt ble benzodiazepiner,cannabis, opiater og amfetamin påvist i henholdsvis 54, 30, 17 og 16 saker. Av de 95 som hadde tatt inn andrerusmidler, hadde 34 tatt inn mer enn ett rusmiddel (alkohol ikke medregnet og i 72 av tilfellene ble analysefunnenevurdert (AB og JM til sannsynligvis å ha gitt sentralnervøs påvirkning. Risikoøkningen for trafikkulykkeved nylig bruk av cannabisstoffer og diazepam i høydose ble estimert til å kunne tilsvare en blodalkoholkonsentrasjonpå 1-1,5 promille. Alkohol er det rusmiddel som oftest påvises hos ulykkesførere, menforekomsten av benzodiazepiner, cannabis og amfetamin er såvidt høy blant ulykkesførere at disse stoffenemå anses å være et alvorlig trafikksikkerhetsproblem.Bjørneboe A, Beylich K-M, Christophersen AS, Fosser S, Glad A, Mørland J.Prevalence of alcohol and other intoxicants in blood samples from drivers involved in road

  2. Reindeer pastoralism in Sweden 1550-1950

    Directory of Open Access Journals (Sweden)

    Lennart Lundmark

    2007-04-01

    during hundreds of years. To a large extent these long-term external influences have made reindeer pastoralism what it is today. That aspect should not be overlooked when assessing the future prospects of reindeer pastoralism in Scandinavia.Renskötseln i Sverige 1550-1950Abstract in Swedish / Sammanfattning: Först vid mitten av 1500-talet finns det källmaterial som ger oss en tämligen detaljerad bild av renskötseln i Sverige. Vid den tiden levde samerna i en jakt- , fiske- och samlarekonomi. En familj hade normalt 10-20 renar som främst utnyttjades vid transporter. Tamrenarna kunde också mjölkas och fungera som lockdjur vid vildrensjakt. Under senare delen av 1500-talet köpte svenska staten och handelsmän stora mängder pälsverk av samerna. Den vanligaste betalningen var smör och mjöl. Detta skapade ett välstånd som ledde till en betydande folkökning i svenska lappmarken. Befolkningen blev för stor för att rymmas inom ramarna för en jaktochfiskeekonomi. En kris i början av 1600-talet blev startpunkten för övergången till en storskalig rennomadism.Fram till mitten av 1700-talet var den intensiva renskötseln framgångsrik. Men renskötseln blev efterhand alltför intensiv. Under senare delen av 1700-talet började det spridas sjukdomar i de tätt sammanhållna hjordarna. De första decennierna av 1800-talet innebar en allvarlig kris i renskötseln. Antalet renskötande fjällsamer minskade kraftigt, främst genom utvandring till norska kusten. Den intensiva renskötseln med mjölkning av renarna började ersättas av en extensiv renskötsel inriktad på köttproduktion de sista decennierna av 1800-talet. I norr var naturförhållandena och influenser från Kautokeino-samerna en viktig faktor, i söder utvecklades renskötseln i extensiv riktning främst därför att marknaden för renkött kom närmare renskötarna. Under 1920-talet upphörde mjölkningen av renar i Sverige, utom i några enstaka familjer. Då hade förflyttningarna av samer fr

  3. Sociedad racional y educación: la génesis de la racionalidad educativa modernista

    Directory of Open Access Journals (Sweden)

    Guillermo Miranda Camacho

    2005-06-01

    desigualdad y en una visión meritocrática en la sociedad racional, como la ha denominado Touraine (1993.

     

    Abstract. The objective of this article is to explore some aspects related to the origin of modern education rationality. The study is based on the analysis of different dimensions of the dialectical interaction historically established between the rational logic behind the structural changes of the capitalist society and the construction of the modern liberal education perspective. With the purpose of defining the keys to the process, the first section provides a brief reference to the foundations of the origin of rational thinking and those of modernity, which was caused by the secularization process suffered by the universe of the renaissance culture. In the second part we discuss some dimensions of illustrations and the encyclopedia as basic cultural and education projects in the rational organization of society in the XVIII century. The third section explores some dimensions of the connection between capitalist modernization and educational rationality through some of the main historical factors: the creation of State-nations, nationality and citizenship, the rationality of liberal capitalism, the universality and ethnocentrism of the elite culture, the instrumental reason and the view of progress as technical evolution. In addition, we highlight the State’s adoption of education as part of the construction of the public sphere by emphasizing the rational and legitimating role that lies at the basis of these historical processes. Finally, the fourth section analyzes how the creation of modern rationality takes on a historical view of social progress neglecting humanistic ethics. This process influences the emergence of an educational rationality based on the ideological justification of inequality and on a meritocratic view of the rational society, as Tourine has defined it (1993.

  4. Monitoring of long range transported pollutants. Annual report for 1997; Overvaaking av langtransportert forurenset luft og nedboer. Atmosfaerisk tilfoersel, 1997

    Energy Technology Data Exchange (ETDEWEB)

    Luekewille, A.; Manoe, S.; Toerseth, K

    1998-05-01

    reductions in Europe the values strongly decreased from 1988 to 1997. In all counties except Finnmark, dry deposition of sulphur compounds in 1997 was assessed to be 5-17% of the total deposition during winter and 19-41% during the growing season. Generally the contribution of dry deposition to total deposition was higher for nitrogen than for sulphur compounds. The largest annual mean concentrations of lead, cadmium and zinc in precipitation were measured in southern Norway. Then concentrations decreased by about 60-80% over the period 1978 to 1997. Due to emissions in Russia the levels of arsenic, copper, nickel and cobalt were relatively high in Soer-Varanger. Ozone concentrations vary significantly over the year with the highest monthly averages in March and April. In 1997 concentration levels frequently exceeded the recommended air quality guidelines. The air quality guideline given by Norwegian Pollution Control Authority (Statens forurensningstilsyn) for protection of human health (100 microgram/m{sub 3} as hourly mean) was exceeded at all sites. Three sites experienced hourly average values above the ECE critical level for protection of vegetation of 140 microgram/m{sub 3}. The critical level of 50 microgram/m{sub 3} as mean value during the growing season was exceeded at all sites. Similarly was the critical level of 60 microgram/m{sub 3} as mean value during the growing season exceeded at all sites. The critical level for accumulated ozone exposure above the threshold of 80 microgram,/m{sub 3} (40 ppb), (termed AOT40) was for crops exceeded at eight sites. The critical level for forests was not exceeded at any site. There was a significant reduction in the levels of mercury in air during the period 1992 to 1997. Concentration of lead, cadmium and zinc increased over the same period. This is opposite to the trend observed in precipitation chemistry and may b caused by an increased influence of emissions in Eastern Europe. The air concentration of alpha

  5. Monitoring of long range transported pollutants. Annual report for 1997; Overvaaking av langtransportert forurenset luft og nedboer. Atmosfaerisk tilfoersel, 1997

    Energy Technology Data Exchange (ETDEWEB)

    Luekewille, A.; Manoe, S.; Toerseth, K

    1998-05-01

    reductions in Europe the values strongly decreased from 1988 to 1997. In all counties except Finnmark, dry deposition of sulphur compounds in 1997 was assessed to be 5-17% of the total deposition during winter and 19-41% during the growing season. Generally the contribution of dry deposition to total deposition was higher for nitrogen than for sulphur compounds. The largest annual mean concentrations of lead, cadmium and zinc in precipitation were measured in southern Norway. Then concentrations decreased by about 60-80% over the period 1978 to 1997. Due to emissions in Russia the levels of arsenic, copper, nickel and cobalt were relatively high in Soer-Varanger. Ozone concentrations vary significantly over the year with the highest monthly averages in March and April. In 1997 concentration levels frequently exceeded the recommended air quality guidelines. The air quality guideline given by Norwegian Pollution Control Authority (Statens forurensningstilsyn) for protection of human health (100 microgram/m{sub 3} as hourly mean) was exceeded at all sites. Three sites experienced hourly average values above the ECE critical level for protection of vegetation of 140 microgram/m{sub 3}. The critical level of 50 microgram/m{sub 3} as mean value during the growing season was exceeded at all sites. Similarly was the critical level of 60 microgram/m{sub 3} as mean value during the growing season exceeded at all sites. The critical level for accumulated ozone exposure above the threshold of 80 microgram,/m{sub 3} (40 ppb), (termed AOT40) was for crops exceeded at eight sites. The critical level for forests was not exceeded at any site. There was a significant reduction in the levels of mercury in air during the period 1992 to 1997. Concentration of lead, cadmium and zinc increased over the same period. This is opposite to the trend observed in precipitation chemistry and may b caused by an increased influence of emissions in Eastern Europe. The air concentration of alpha

  6. Tatarzy Krymscy - naród czy mniejszość etniczna: w poszukiwaniu nowej drogi odrodzenia narodowego

    Directory of Open Access Journals (Sweden)

    Swietlana Czerwonnaja

    2016-01-01

    Full Text Available The Crimean tatars – a nation or an ethnic minority: in search for a new way of national revival The Russian Empire, increasing its aggressive expansion to all sites of the world, conquered the Crimean Khanate in 1783. This Khanate was the only one of its kind link connecting the European (Christian and Asian (Islamic civilizations. It was the state of high multilateral culture with strong – in the beginning of the New Times – secularism trends and democratic bases of social and political life (there was no serfdom, the equality of rights existed on the high level, tolerance with regard to religious and ethnic communities dominated, and these communities-minorities co-existed and developed on the Peninsula – in the Tatar Crimea – in the peace. Within the framework of the Crimean Khanate the process of ethnic genesis of the Crimean-Tatar people as an ethnic-cultural subject was completed, although many differences of tribal origin and regional character remained within this unity and expressed in the heterogeneity of the anthropologic types, of every-day life’s tradition and of dialects spread between the Tatars living in the North Crimean steppe, in the Mountains (highland and on the South Coast of the Peninsula. That ethnic community (Crimean Tatars was a nation in the modern meaning of this word, it had its own state, intellectual elite, high organization and culture. The destruction of this state-nation by the Russian Empire and the systematic genocide if the Crimean Tatars during next two centuries, reached its culmination in the act of the total deportation on May 18th 1944, are the treasons and international-large crimes. The annexation of the Crimea by the Russian Federation on March 2014 (its tearing away from the Ukrainian state and military occupation means the continuation of this felonious policy, which the Crimean Tatars resist, displaying bravery in the very difficult condition.   Tatarzy Krymscy - naród czy

  7. Assessment and application of a molecular diagnostic method on the detection of four types of diarrheagenic Escherichia coli%4种致泻性大肠埃希菌分子诊断方法的评估及其在监测中的应用

    Institute of Scientific and Technical Information of China (English)

    黄峥; 许浩; 郭家胤; 黄晓兰; 李颖; 侯琪; 王爱敏; 王传清; 金汇明

    2013-01-01

    目的 评估和建立用于常规监测4种致泻性大肠埃希菌(DEC)的分子诊断方法,并应用于上海市腹泻人群DEC的监测.方法 使用丹麦SSI分子诊断试剂盒对DEC参考菌株进行验证试验及制定DEC-PCR诊断、分离的操作规程(DEC-PCR-SOP),并检测2012年6-9月上海市3家临床医院腹泻病例粪便标本.结果 经26株DEC参比菌株验证,SSI分子诊断试剂盒的特异性为100%; 1887份腹泻病例标本共分离得到218株DEC(乳糖阳性181株,乳糖阴性37株),其中致病性大肠埃希菌(EPEC) 118株、产毒性大肠埃希菌(ETEC)90株、侵袭性大肠埃希菌(EIEC)9株、产志贺毒素大肠埃希菌(STEC)1株、志贺菌18株,总阳性率为l1.6%;监测地区DEC腹泻病例中以EPEC占优势,而EPEC腹泻病例中又以2岁以下婴幼儿为主;外籍DEC病例以ETEC占优势,新生儿ETEC病例占5岁以下低年龄组腹泻病例的1/3.结论 经评估DEC-PCR-SOP用于4种DEC常规监测的数据结果可信.国内食源性监测网络实验室应不断完善4种DEC诊断和参比能力.%Objective To establish and evaluate a molecular diagnostic method for routine monitoring of four types of diarrheagenic Escherichia (E.) coli (DEC) and to study the distribution of four types of DEC isolated from diarrheal patients in Shanghai.Methods DEC-PCR standard operation procedure (SOP) had been developed for DEC detection and isolation,using the Statens Serum Institute (SSI) DEC PCR kits with multiplex PCR technique after verification tests on reference strains.Diarrhea specimens from 3 clinical hospitals in Shanghai were tested from June to September,2012.Results Specificity of the PCR kit was 100% by verification on the 26 DEC reference strains.A total number of 218 DEC isolates,including 181 fermented lactose and 37 unfermented lactose were identified from the 1887 stool specimens of diarrhea patients,with positive rate as 11.6%.The most common pathogen (54.1%,118/218) was

  8. Climate, energy and poverty reduction; Klimaat, energie en armoedebestrijding

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2008-11-15

    sharing in this area, but also making an appropriate contribution to the financing. [Dutch] Tot nu toe heeft in het internationale klimaatbeleid en -onderzoek sterk de nadruk gelegen op het verminderen van de uitstoot en het vastleggen van broeikasgassen, gewoonlijk aangeduid met de term mitigatie. Zelfs bij een onmiddellijk begin van een programma van mitigatie zullen de eerstvolgende decennia de temperaturen in de verschillende delen van de wereld echter alleen nog maar stijgen waardoor de andere verschijnselen en effecten van klimaatverandering zich in onverminderde mate zullen voordoen. Dit houdt in dat naast het terugdringen van (de verschijnselen van) klimaatverandering ook aanpassing aan de gevolgen daarvan noodzakelijk is, adaptatie. Dat wil zeggen dat een geheel aan (infrastructurele) voorzieningen en ook andere maatregelen tot stand zal moeten komen, niet met het doel om de verschijnselen van klimaatverandering te voorkomen, maar om aan de nadelige, feitelijke en toekomstige effecten van deze verschijnselen het hoofd te bieden. Geconstateerd wordt dat naast mitigatie, adaptatie een zeer urgent probleem is. De gevolgen van klimaatverandering openbaren zich op dit moment vooral in kwetsbare ontwikkelingslanden, die het minst hebben bijgedragen aan het probleem. Zij vormen tegelijk een bedreiging voor het bereiken van de Millennium Development Goals. Op de geindustrialiseerde landen rust naar geldend internationaal recht een verantwoordelijkheid om kwetsbare ontwikkelingslanden te ondersteunen om de gevolgen van klimaatverandering te bestrijden en zodoende de kans op daarmee samenhangende schade te verminderen. Deze verantwoordelijkheid vloeit met name voort uit de algemene plicht van staten tot samenwerking, het beginsel van gemeenschappelijke maar verschillende verantwoordelijkheden ('common but differentiated responsibilities') en het beginsel van intergenerationele billijkheid, dat wil zeggen de plicht rekening te houden met de belangen van