WorldWideScience

Sample records for burster lmxb xb

  1. The periodic bursters XB1323-619 and GS1826-24: longterm evolution of the nuclear burning regime and comparison with theory

    OpenAIRE

    Balucinska-Church, M.; Reed, D.; Church, M. J.

    2007-01-01

    The majority of X-ray burst sources do not display a burst rate that increases with luminosity as expected, but this is seen in the two clocked bursters XB1323-619 and GS1826-24. We present a detailed investigation of these two sources which in the case of the first source, spans 18 years. Based on measurements of the burst rate, X-ray luminosity, the alpha-parameter and the two time constants generally present in the burst decays, we demonstrate the importance of the rp nuclear burning proce...

  2. A space charge model for electrophonic bursters

    CERN Document Server

    Beech, M

    1999-01-01

    The sounds accompanying electrophonic burster meteors are characteristically described as being akin to short duration ``pops'' and staccato--like ``clicks''. As a phenomenon distinct from the enduring electrophonic sounds that occasionally accompany the passage and ablation of large meteoroids in the Earth's lower atmosphere, the bursters have proved stubbornly difficult to explain. A straightforward calculation demonstrates that in contradistinction to the enduring electrophonic sounds, the electrophonic bursters are not generated as a consequence of interactions between the meteoroid ablation plasma and the Earth's geomagnetic field. Here we present a novel and hitherto unrecorded model for the generation of short--duration pulses in an observer's local electrostatic field. Our model is developed according to the generation of a strong electric field across a shock wave propagating in a plasma. In this sense, the electrophonic bursters are associated with the catastrophic disruption of large meteoroids in ...

  3. A space charge model for electrophonic bursters

    OpenAIRE

    Beech, M.; Foschini, L.

    2001-01-01

    The sounds accompanying electrophonic burster meteors are characteristically described as being akin to short duration ``pops'' and staccato--like ``clicks''. As a phenomenon distinct from the enduring electrophonic sounds that occasionally accompany the passage and ablation of large meteoroids in the Earth's lower atmosphere, the bursters have proved stubbornly difficult to explain. A straightforward calculation demonstrates that in contradistinction to the enduring electrophonic sounds, the...

  4. The evolution of Rapid Burster outbursts

    NARCIS (Netherlands)

    Guerriero, R; Fox, DW; Kommers, J; Lewin, WHG; Rutledge, R; Moore, CB; Morgan, E; Van Paradijs, J; Van der Klis, M; Bildsten, L; Dotani, T

    1999-01-01

    We describe the evolutionary progression of an outburst of the Rapid Burster. Four outbursts have been observed with the Rossi X-Ray Timing Explorer between 1996 February and 1998 May, and our observations are consistent with a standard evolution over the course of each. An outburst can be divided i

  5. Gamma-ray bursters at cosmological distances

    Science.gov (United States)

    Paczynski, B.

    1986-01-01

    It is proposed that some, perhaps most, gamma-ray bursters are at cosmological distances, like quasars, with a redshift of about 1 or 2. This proposition requires a release of supernova-like energy of about 10 to the 51st ergs within less than 1 s, making gamma-ray bursters the brightest objects known in the universe, many orders of magnitude brighter than any quasars. This power must drive a highly relativistic outflow of electron-positron plasma and radiation from the source. It is proposed that three gamma-ray bursts, all with identical spectra, detected from B1900 + 14 by Mazets, Golenetskii, and Gur'yan and reported in 1979, were all due to a single event multiply imaged by a gravitational lens. The time intervals between the successive bursts, 10 hr to 3 days, were due to differences in the light travel time for different images.

  6. Timing and spectral study of XB 1254-690 using new RXTE PCA data

    CERN Document Server

    Mukherjee, Arunava; 10.1111/j.1365-2966.2010.17872.x

    2011-01-01

    We have analyzed the new Rossi X-ray Timing Explorer Proportional Counter Array data of the atoll neutron star (NS) low-mass X-ray binary (LMXB) system XB 1254-690. The colour-colour diagram shows that the source was in the high-intensity banana state. We have found two low-frequency candidate peaks with single trial significances of ~ 2.65 X 10^{-8} and ~ 7.39 X 10^{-8} in the power spectra. After taking into account the number of trials, the joint probability of appearance of these two peaks in the data set only by chance is ~ 4.5 X 10^{-4}, and hence a low-frequency QPO can be considered to be detected with a significance of ~ 4.5 X 10^{-4}, or, ~ 3.5\\sigma for the first time from this source. We have also done the first systematic X-ray spectral study of XB 1254-690, and found that, while one-component models are inadequate, three-component models are not required by the data. We have concluded that a combined broken-powerlaw and Comptonization model best describes the source continuum spectrum among 19 t...

  7. Hunting for the Xb via radiative decays

    Science.gov (United States)

    Li, Gang; Wang, Wei

    2014-06-01

    In this paper, we study radiative decays of Xb, the counterpart of the famous X (3872) in the bottomonium-sector as a candidate for meson-meson molecule, into the γϒ (nS) (n = 1 , 2 , 3). Since it is likely that the Xb is below the BBbar* threshold and the mass difference between the neutral and charged bottom meson is small compared to the binding energy of the Xb, the isospin violating decay mode Xb → ϒ (nS)π+π- would be greatly suppressed. This will promote the importance of the radiative decays. We use the effective Lagrangian based on the heavy quark symmetry to explore the rescattering mechanism and calculate the partial widths. Our results show that the partial widths into γϒ (nS) are about 1 keV, and thus the branching fractions may be sizeable, considering the fact the total width may also be smaller than a few MeV like the X (3872). These radiative decay modes are of great importance in the experimental search for the Xb particularly at hadron collider. An observation of the Xb will provide a deeper insight into the exotic hadron spectroscopy and is helpful to unravel the nature of the states connected by the heavy quark symmetry.

  8. The appearance of non-spherical systems. Application to LMXB

    CERN Document Server

    Rozanska, A; Madej, J; Adhikari, T P; You, B

    2016-01-01

    We study the appearance of the neutron star - accretion disk system as seen by a distant observer in the UV/X-ray domain. The observed intensity spectra are computed assuming non-spherical geometry of the whole system, in which outgoing spectrum is not represented by the flux spectrum, the latter being valid for spherically symmetric objects. Intensity spectra of our model display double bumps in UV/X-ray energy domains. X-ray spectra of such a type were often observed in LMXB with accretion disk, ultra luminous X-ray sources, and accreting black hole systems with hot inner compact corona. Our model naturally explains high energy broadening of the disk spectrum observed in some binaries. We attempted to fit our model to X-ray data of XTE~J1709-267 from {\\it XMM-Newton}. Unfortunately, the double intensity bump predicted by our model for LMXB is located in soft X-ray domain, uncovered by existing data for this source.

  9. Hunting for the Xb via radiative decays

    International Nuclear Information System (INIS)

    In this paper, we study radiative decays of Xb, the counterpart of the famous X(3872) in the bottomonium-sector as a candidate for meson–meson molecule, into the γϒ(nS) (n=1,2,3). Since it is likely that the Xb is below the BB¯⁎ threshold and the mass difference between the neutral and charged bottom meson is small compared to the binding energy of the Xb, the isospin violating decay mode Xb→ϒ(nS)π+π− would be greatly suppressed. This will promote the importance of the radiative decays. We use the effective Lagrangian based on the heavy quark symmetry to explore the rescattering mechanism and calculate the partial widths. Our results show that the partial widths into γϒ(nS) are about 1 keV, and thus the branching fractions may be sizeable, considering the fact the total width may also be smaller than a few MeV like the X(3872). These radiative decay modes are of great importance in the experimental search for the Xb particularly at hadron collider. An observation of the Xb will provide a deeper insight into the exotic hadron spectroscopy and is helpful to unravel the nature of the states connected by the heavy quark symmetry.

  10. Production of the $X_b$ in $\\Upsilon(5S, 6S)\\to \\gamma X_b$ radiative decays

    CERN Document Server

    Wu, Qi; Shao, Fenglan; Wang, Qianwen; Wang, Ruiqin; Zhang, Yawei; Zheng, Ying

    2016-01-01

    In this work, we investigate the production of $X_b$ in the process $\\Upsilon(5S,6S)\\to \\gamma X_b$, where $X_b$ is assumed to be the counterpart of $X(3872)$ in the bottomonium sector as a $B {\\bar B}^*$ molecular state. We use the effective Lagrangian based on the heavy quark symmetry to explore the rescattering mechanism and calculate their production ratios. Our results have shown that the production ratios for the $\\Upsilon(5S,6S) \\to \\gamma X_b$ are orders of $10^{-5}$ with reasonable cutoff parameter range $\\alpha \\simeq 2\\sim 3$. The sizeable production ratios may be accessible at the future experiments like forthcoming BelleII, which will provide important clues to the inner structures of the exotic state $X_b$.

  11. XB-70A during startup and ramp taxi

    Science.gov (United States)

    1968-01-01

    The XB-70 was the world's largest experimental aircraft. Capable of flight at speeds of three times the speed of sound (2,000 miles per hour) at altitudes of 70,000 feet, the XB-70 was used to collect in-flight information for use in the design of future supersonic aircraft, military and civilian. This 35-second video shows the startup of the XB-70A airplane engines, the beginning of its taxi to the runway, and a turn on the ramp that shows the unique configuration of this aircraft.

  12. Hunting for the $X_b$ via hidden bottomonium decays

    OpenAIRE

    Li, Gang; Zhou, Zhu

    2015-01-01

    In this work, we study the isospin conserved hidden bottomonium decay of $X_b\\to \\Upsilon(1S)\\omega$, where $X_b$ is taken to be the counterpart of the famous $X(3872)$ in the bottomonium sector as a candidate for the meson-meson molecule. Since it is likely that the $X_b$ is below the $B\\bar B^*$ threshold and the mass difference between the neutral and charged bottom meson is small compared to the binding energy of the $X_b$, the isospin violating decay mode $X_b\\to \\Upsilon (nS)\\pi^+\\pi^-$...

  13. Hunting for the X_b via Radiative Decays

    OpenAIRE

    Li, Gang; Wang, Wei

    2014-01-01

    In this paper, we study radiative decays of X_b, the counterpart of the famous X(3872) in the bottomonium-sector as a candidate for meson-meson molecule, into the \\gamma \\Upsilon(nS) (n=1, 2, 3). Since it is likely that the X_b is below the B\\bar B^* threshold and the mass difference between the neutral and charged bottom meson is small compared to the binding energy of the X_b, the isospin violating decay mode X_b\\to \\Upsilon (nS)\\pi^+\\pi^- would be greatly suppressed. This will promote the ...

  14. Accuros XB or AAA? Dosimetry study on a heterogeneous medium

    International Nuclear Information System (INIS)

    Accuros XB 1 is a new algorithm introduced by Varian Medical Systems in your Eclipse Planner for external radiotherapy. It is based on the solution of the linear Boltzmann transport equation2. It is necessary to carry out different tests in order to determine its accuracy. This paper examines the variation in absolute doses in presence of inhomogeneities and the results are compared with the results obtained for the Accuros XB and AAA algorithms. (Author)

  15. Hunting for the Xb via hidden bottomonium decays

    Science.gov (United States)

    Li, Gang; Zhou, Zhu

    2015-02-01

    In this work, we study the isospin conserved hidden bottomonium decay of Xb→ϒ (1 S )ω , where Xb is taken to be the counterpart of the famous X (3872 ) in the bottomonium sector as a candidate for the meson-meson molecule. Since it is likely that the Xb is below the B B¯* threshold and the mass difference between the neutral and charged bottom meson is small compared to the binding energy of the Xb, the isospin violating decay mode Xb→ϒ (n S )π+π- would be greatly suppressed. We use the effective Lagrangian based on the heavy quark symmetry to explore the rescattering mechanism of Xb→ϒ (1 S )ω and calculate the partial widths. Our results show that the partial width for the Xb→ϒ (1 S )ω is about tens of keVs. Taking into account the fact that the total width of Xb may be smaller than a few MeV like X (3872 ), the calculated branching ratios may reach to orders of 10-2. These hidden bottomonium decay modes are of great importance in the experimental search for the Xb particularly at the hadron collider. Also, the associated studies of hidden bottomonium decays Xb→ϒ (n S )γ , ϒ (n S )ω , and B B ¯γ may help us investigate the structure of Xb deeply. The experimental observation of Xb will provide us with further insight into the spectroscopy of exotic states and is helpful to probe the structure of the states connected by the heavy quark symmetry.

  16. Possible Analogues of Cognitive Processes in the Patterns of X-ray Variability of the Rapid Burster

    CERN Document Server

    Lefebvre, V A; Lefebvre, Vladimir A.; Efremov, Yuri N.

    1999-01-01

    The bizarre patterns of rapid flashes and bursts in the X-ray source MXB 1730-335 (Rapid Burster) have been puzzling researchers for two decades; especially intriguing are its peculiarities in the time-invariant decay profiles of many type II bursts of the Rapid Burster. We have discovered that they are similar to certain regularities found in cognitive psychology, suggesting an analogy between the activity of the Rapid Burster and the cognitive activity of the human mind.

  17. Hunting for the X_b via Radiative Decays

    CERN Document Server

    Li, Gang

    2014-01-01

    In this paper, we study radiative decays of X_b, the counterpart of the famous X(3872) in the bottomonium-sector as a candidate for meson-meson molecule, into the \\gamma \\Upsilon(nS) (n=1, 2, 3). Since it is likely that the X_b is below the B\\bar B^* threshold and the mass difference between the neutral and charged bottom meson is small compared to the binding energy of the X_b, the isospin violating decay mode X_b\\to \\Upsilon (nS)\\pi^+\\pi^- would be greatly suppressed. This will promote the importance of the radiative decays. We use the effective Lagrangian based on the heavy quark symmetry to explore the rescattering mechanism and calculate the partial widths. Our results show that the partial widths into \\gamma \\Upsilon(nS) are about 1 keV, and thus the branching fractions may be sizeable, considering the fact the total width may also be smaller than a few MeV like the X(3872). These radiative decay modes are of great importance in the experimental search for the X_b particularly at hadron collider. An obs...

  18. Hunting for the $X_b$ via hidden bottomonium decays

    CERN Document Server

    Li, Gang

    2015-01-01

    In this work, we study the isospin conserved hidden bottomonium decay of $X_b\\to \\Upsilon(1S)\\omega$, where $X_b$ is taken to be the counterpart of the famous $X(3872)$ in the bottomonium sector as a candidate for the meson-meson molecule. Since it is likely that the $X_b$ is below the $B\\bar B^*$ threshold and the mass difference between the neutral and charged bottom meson is small compared to the binding energy of the $X_b$, the isospin violating decay mode $X_b\\to \\Upsilon (nS)\\pi^+\\pi^-$ would be greatly suppressed. We use the effective Lagrangian based on the heavy quark symmetry to explore the rescattering mechanism of $X_b\\to \\Upsilon(1S)\\omega$ and calculate the partial widths. Our results show that the partial width for the $X_b\\to \\Upsilon(1S)\\omega$ is about tens of keVs. Taking into account the fact that the total width of $X_b$ may be smaller than a few MeV like $X(3872)$, the calculated branching ratios may reach to orders of $10^{-2}$. These hidden bottomonium decay modes are of great importan...

  19. Percolative superconductivity in Mg1-xB2

    International Nuclear Information System (INIS)

    Our results from various transport experiments on Mg1-xB2 indicate a surprising effect associated with the presence of a Mg deficiency in MgB2: the phase separation between Mg-vacancy rich and Mg-vacancy poor phases. The Mg-vacancy poor phase is superconducting, but the insulating nature of the Mg-vacancy rich phase probably originates from the Anderson (disorder-induced) localization of itinerant carriers. Furthermore, electron diffraction measurements indicate that within vacancy-rich regions these defects tend to order with intriguing patterns. This electronic phase separation in Mg1-xB2 shows similar, but also distinct characteristics compared with that observed in La2CuO4+δ

  20. X-ray timing observations of the brightest neutron star LMXB Sco X-1

    Science.gov (United States)

    Yu, W.

    The observations of the brightest neutron star LMXB Sco X-1 with the Rossi X-ray timing explorer RXTE show that the components of its variability in the frequency range between 0 01 Hz to 1000 Hz are related This is unique and has been benefited from the high X-ray count rate which would only be obtained for other neutron star LMXBs with a ten times RXTE In previous studies we have found that 1 the upper kHz QPO frequency varies more than 22 Hz within the 6 Hz normal branch oscillation NBO cycle 2 the 45 Hz HBO amplitude is correlated with the phase of the 6 Hz NBO We will summarize our results obtained from further studies of Sco X-1 and other sources in these directions and discuss the underlying physics

  1. Propeller driven spectral state transition in LMXB 4U 1608-52

    CERN Document Server

    Chen, X; Ding, G Q; Chen, Xie; Zhang, Shuang Nan; Ding, Guo Qiang

    2006-01-01

    Spectral state transitions in neutron star LMXB systems have been widely observed yet not well understood. Here we report an abrupt spectral change in 4U 1608-52, a typical atoll source, during its decay phase of the 2004 outburst. The source is found to undergo sudden changes in its spectral hardness and other properties. The transition occurred when its luminosity is between (3.3-5.3) E36 ergs/s, assuming a distance of 3.6 kpc. Interpreting this event in terms of the propeller effect, we infer the neutron star surface magnetic field as (1.4-1.8) E8 Gauss. We also briefly discuss similarities and differences between the spectral states of neutron star and black hole binary systems.

  2. How to get the reduced B fields of millisecond pulsars: Flux expulsion by spindown before the LMXB phase

    Science.gov (United States)

    Alpar, Mehmet Ali; Gügercinoǧlu, Erbil

    2016-07-01

    The physical interaction between quantized flux lines of the Type II proton superconductor and the quantized vortex lines of the neutron superfluid is re-visited. Srinivasan et al. (1990) had proposed that this interaction led to reduction of the magnetic field to the B ˜10^9 G range as the flux lines were expelled together with vortex lines during the spindown of the neutron star in an early epoch of binary evolution. The model is discussed with reference to spindown by the wind from the companion prior to the Roche lobe filling LMXB phase. An evolutionary model for the magnetic field and the rotation rate is presented, with application to the 11 Hz accreting pulsar in the LMXB IGR J17480-2446 in Terzan 5 (Patruno et al 2012) as well as 'standard' accreting and radio millisecond pulsar evolution.

  3. Progressive Covering of the ADC during Dipping in the LMXB XBT 0748-676

    CERN Document Server

    Church, M J; Dotani, T; Asai, K

    1998-01-01

    We report results of analysis of the ASCA observation of 1993, May 7th of the dipping LMXB source XBT 0748-676, and propose a new explanation of the spectral evolution in dipping in this source. We show that the non-dip and dip spectra in several intensity bands are well fitted using the same physical model that we have previously shown gives good explanations of several dipping sources, consisting of point source blackbody emission from the neutron star, plus extended Comptonised emission from the accretion disk corona (ADC), with progressive covering of the ADC during dipping. Best fit values of kT_bb = 1.99 +/- 0.16 keV and power law photon index Gamma = 1.70 +/- 0.16 are found. The strong excess below 1 keV was well fitted by a Gaussian line at ~0.65 keV. In dipping, good fits were obtained by allowing it to be covered by the same progressive covering factor as the extended continuum emission, providing strong evidence that the line originates in the ADC. By using our two-component model we show that the ...

  4. Radio imaging observations of PSR J1023+0038 in an LMXB state

    CERN Document Server

    Deller, A T; Miller-Jones, J C A; Patruno, A; Hessels, J W T; Archibald, A M; Paragi, Z; Heald, G; Vilchez, N

    2014-01-01

    The transitional millisecond pulsar binary system PSR J1023+0038 re-entered an accreting state in 2013 June, in which it bears many similarities to low-mass X-ray binaries (LMXBs) in quiescence or near-quiescence. At a distance of just 1.37 kpc, PSR J1023+0038 offers an unsurpassed ability to study low-level accretion onto a highly-magnetized compact object. We have monitored PSR J1023+0038 intensively using radio imaging with the Karl G. Jansky Very Large Array, the European VLBI Network and LOFAR, seeing rapidly variable, flat spectrum emission that persists over a period of 6 months. The flat spectrum and variability is indicative of synchrotron emission originating in an outflow from the system, most likely in the form of a compact, partially self-absorbed jet, as is seen in LMXBs at higher accretion rates. The radio brightness, however, greatly exceeds extrapolations made from observations of more vigorously accreting neutron star LMXB systems. We postulate that PSR J1023+0038 is undergoing radiatively i...

  5. Development of Outboard Nacelle for the XB-36 Airplane

    Science.gov (United States)

    Nuber, Robert J.

    1947-01-01

    An investigation of two 1/14 scale model configurations of an outboard nacelle for the XB-36 airplane was made in the Langley two-dimensional low-turbulence tunnels over a range of airplane lift coefficients (C (sub L) = 0.409 to C(sub L) = 0.943) for three representative flow conditions. The purpose of the investigation was to develop a low-drag wing-nacelle pusher combination which incorporated an internal air-flow system. The present investigation has led to the development of a nacelle which had external drag coefficients of similar order of magnitude to those obtained previously from tests of an inboard nacelle configuration at the corresponding operating lift coefficients and from approximately one-third to one-half of those of conventional tractor designs having the same ratio of wing thickness to nacelle diameter.

  6. Radio Imaging Observations of PSR J1023+0038 in an LMXB State

    Science.gov (United States)

    Deller, A. T.; Moldon, J.; Miller-Jones, J. C. A.; Patruno, A.; Hessels, J. W. T.; Archibald, A. M.; Paragi, Z.; Heald, G.; Vilchez, N.

    2015-08-01

    The transitional millisecond pulsar (MSP) binary system PSR J1023+0038 re-entered an accreting state in 2013 June in which it bears many similarities to low-mass X-ray binaries (LMXBs) in quiescence or near-quiescence. At a distance of just 1.37 kpc, PSR J1023+0038 offers an unsurpassed ability to study low-level accretion onto a highly magnetized compact object. We have monitored PSR J1023+0038 intensively using radio imaging with the Karl G. Jansky Very Large Array, the European VLBI Network and the Low Frequency Array, seeing rapidly variable, flat spectrum emission that persists over a period of six months. The flat spectrum and variability are indicative of synchrotron emission originating in an outflow from the system, most likely in the form of a compact, partially self-absorbed jet, as is seen in LMXBs at higher accretion rates. The radio brightness, however, greatly exceeds extrapolations made from observations of more vigorously accreting neutron star LMXB systems. We postulate that PSR J1023+0038 is undergoing radiatively inefficient “propeller-mode” accretion, with the jet carrying away a dominant fraction of the liberated accretion luminosity. We confirm that the enhanced γ-ray emission seen in PSR J1023+0038 since it re-entered an accreting state has been maintained; the increased γ-ray emission in this state can also potentially be associated with propeller-mode accretion. Similar accretion modes can be invoked to explain the radio and X-ray properties of the other two known transitional MSP systems XSS J12270-4859 and PSR J1824-2452I (M28I), suggesting that radiatively inefficient accretion may be a ubiquitous phenomenon among (at least one class of) neutron star binaries at low accretion rates.

  7. A strong variation of accretion disc corona size with Luminosity in lmxb

    Directory of Open Access Journals (Sweden)

    M. J. Church

    2004-01-01

    Full Text Available Se revisa la controversia que ha existido durante a~nos sobre la naturaleza del continuo de rayos X emitido por la binarias de rayos-X, y que ha estado polarizada entre el modelo oriental con una peque~na regi on afectada por efecto Compton rodeando el objeto compacto y otros modelos alternativos. Presentamos medidas de la extensi on radial de esta regi on ADC en binarias de rayos X de baja masa, las cuales excluyen este modelo oriental y muestran que la regi on ADC es extensa (modelo Birmingham, mostrando los tiempos de ingresos profundos de una manera concluyente que la extensi on radial de la zona ACD var a desde el 7% del radio del disco de acreci on en fuentes d ebiles, hasta el 65% en fuentes brillantes. Hay que se~nalar que el tama~no depende fuertemente de la luminosidad de la fuente, lo cual sugiere que la zona ADC se forma por irradiaci on del disco por la estrella de neutrones y el disco interno caliente. Estos resultados tienen implicaciones fundamentales para la correcta descripci on del proceso de \\Comptonizaci on" en las binarias de rayos X, la cual di ere sustancialmente de la del modelo oriental. Las medidas de las temperaturas electr onicas de la ADC nos proporcionan valores del radio de Compton en buena consonancia con los valores medidos de la extensi on radial de la ADC. Finalmente, mostramos que los resultados son inconsistentes con una emisi on no t ermica producida en un \\jet" y por tanto proporcionan evidencia en contra de la reciente sugerencia de que todos los LMXB tienen \\jets".

  8. On the dosimetric impact of inhomogeneity management in the Acuros XB algorithm for breast treatment

    International Nuclear Information System (INIS)

    A new algorithm for photon dose calculation, Acuros XB, has been recently introduced in the Eclipse, Varian treatment planning system, allowing, similarly to the classic Monte Carlo methods, for accurate modelling of dose deposition in media. Aim of the present study was the assessment of its behaviour in clinical cases. Datasets from ten breast patients scanned under different breathing conditions (free breathing and deep inspiration) were used to calculate dose plans using the simple two tangential field setting, with Acuros XB (in its versions 10 and 11) and the Anisotropic Analytical Algorithm (AAA) for a 6MV beam. Acuros XB calculations were performed as dose-to-medium distributions. This feature was investigated to appraise the capability of the algorithm to distinguish between different elemental compositions in the human body: lobular vs. adipose tissue in the breast, lower (deep inspiration condition) vs. higher (free breathing condition) densities in the lung. The analysis of the two breast structures presenting densities compatible with muscle and with adipose tissue showed an average difference in dose calculation between Acuros XB and AAA of 1.6%, with AAA predicting higher dose than Acuros XB, for the muscle tissue (the lobular breast); while the difference for adipose tissue was negligible. From histograms of the dose difference plans between AAA and Acuros XB (version 10), the dose of the lung portion inside the tangential fields presented an average difference of 0.5% in the free breathing conditions, increasing to 1.5% for the deep inspiration cases, with AAA predicting higher doses than Acuros XB. In lung tissue significant differences are found also between Acuros XB version 10 and 11 for lower density lung. Acuros XB, differently from AAA, is capable to distinguish between the different elemental compositions of the body, and suggests the possibility to further improve the accuracy of the dose plans computed for actual treatment of patients

  9. On the dosimetric impact of inhomogeneity management in the Acuros XB algorithm for breast treatment

    Directory of Open Access Journals (Sweden)

    Vanetti Eugenio

    2011-08-01

    Full Text Available Abstract Background A new algorithm for photon dose calculation, Acuros XB, has been recently introduced in the Eclipse, Varian treatment planning system, allowing, similarly to the classic Monte Carlo methods, for accurate modelling of dose deposition in media. Aim of the present study was the assessment of its behaviour in clinical cases. Methods Datasets from ten breast patients scanned under different breathing conditions (free breathing and deep inspiration were used to calculate dose plans using the simple two tangential field setting, with Acuros XB (in its versions 10 and 11 and the Anisotropic Analytical Algorithm (AAA for a 6MV beam. Acuros XB calculations were performed as dose-to-medium distributions. This feature was investigated to appraise the capability of the algorithm to distinguish between different elemental compositions in the human body: lobular vs. adipose tissue in the breast, lower (deep inspiration condition vs. higher (free breathing condition densities in the lung. Results The analysis of the two breast structures presenting densities compatible with muscle and with adipose tissue showed an average difference in dose calculation between Acuros XB and AAA of 1.6%, with AAA predicting higher dose than Acuros XB, for the muscle tissue (the lobular breast; while the difference for adipose tissue was negligible. From histograms of the dose difference plans between AAA and Acuros XB (version 10, the dose of the lung portion inside the tangential fields presented an average difference of 0.5% in the free breathing conditions, increasing to 1.5% for the deep inspiration cases, with AAA predicting higher doses than Acuros XB. In lung tissue significant differences are found also between Acuros XB version 10 and 11 for lower density lung. Conclusions Acuros XB, differently from AAA, is capable to distinguish between the different elemental compositions of the body, and suggests the possibility to further improve the accuracy of

  10. A group of outbursts with exponential decays in the Rapid Burster

    Czech Academy of Sciences Publication Activity Database

    Šimon, Vojtěch

    2008-01-01

    Roč. 492, č. 1 (2008), s. 135-143. ISSN 0004-6361 R&D Projects: GA ČR GA205/05/2167 Grant ostatní: ESA(XE) ESA PRODEX INTEGRAL 90108; ESA(XE) ESA-PECS project no. 98023 Institutional research plan: CEZ:AV0Z10030501 Keywords : neutron stars * X-rays binaries * Rapid Burster (MXB 1730-335) Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 4.153, year: 2008

  11. LMXB AND IMXB EVOLUTION: I. THE BINARY RADIO PULSAR PSR J1614-2230

    International Nuclear Information System (INIS)

    We have computed an extensive grid of binary evolution tracks to represent low- and intermediate-mass X-ray binaries (LMXBs and IMXBs). The grid includes 42,000 models which cover 60 initial donor masses over the range of 1-4 Msun and, for each of these, 700 initial orbital periods over the range of 10-250 hr. These results can be applied to understanding LMXBs and IMXBs: those that evolve analogously to cataclysmic variables, that form ultracompact binaries with Porb in the range of 6-50 minutes, and that lead to wide orbits with giant donors. We also investigate the relic binary recycled radio pulsars into which these systems evolve. To evolve the donor stars in this study, we utilized a newly developed stellar evolution code called 'MESA' that was designed, among other things, to be able to handle very low mass and degenerate donors. This first application of the results is aimed at an understanding of the newly discovered pulsar PSR J1614-2230 which has a 1.97 Msun neutron star, Porb = 8.7 days, and a companion star of 0.5 Msun. We show that (1) this system is a cousin to the LMXB Cyg X-2; (2) for neutron stars of canonical birth mass 1.4 Msun, the initial donor stars which produce the closest relatives to PSR J1614-2230 have a mass between 3.4 and 3.8 Msun; (3) neutron stars as massive as 1.97 Msun are not easy to produce in spite of the initially high mass of the donor star, unless they were already born as relatively massive neutron stars; (4) to successfully produce a system like PSR J1614-2230 requires a minimum initial neutron-star mass of at least 1.6 ± 0.1 Msun, as well as initial donor masses and Porb of ∼4.25 ± 0.10 Msun and ∼49 ± 2 hr, respectively; and (5) the current companion star is largely composed of CO, but should have a surface H abundance of ∼10%-15%.

  12. Kinetic simulations of X-B and O-X-B mode conversion

    Energy Technology Data Exchange (ETDEWEB)

    Arefiev, A. V., E-mail: alexey@austin.utexas.edu [Institute for Fusion Studies, The University of Texas, Austin, Texas 78712 (United States); Du Toit, E. J.; Vann, R. G. L. [York Plasma Institute, Department of Physics, University of York, York (United Kingdom); Köhn, A. [IGVP, University of Stuttgart, Stuttgart (Germany); Max Planck Institute for Plasma Physics, Garching (Germany); Holzhauer, E. [IGVP, University of Stuttgart, Stuttgart (Germany); Shevchenko, V. F. [EURATOM/CCFE Fusion Association, Culham Science Centre, Abingdon (United Kingdom)

    2015-12-10

    We have performed fully-kinetic simulations of X-B and O-X-B mode conversion in one and two dimensional setups using the PIC code EPOCH. We have recovered the linear dispersion relation for electron Bernstein waves by employing relatively low amplitude incoming waves. The setups presented here can be used to study non-linear regimes of X-B and O-X-B mode conversion.

  13. Dosimetric validation of the Acuros XB Advanced Dose Calculation algorithm: fundamental characterization in water

    Science.gov (United States)

    Fogliata, Antonella; Nicolini, Giorgia; Clivio, Alessandro; Vanetti, Eugenio; Mancosu, Pietro; Cozzi, Luca

    2011-03-01

    A new algorithm, Acuros® XB Advanced Dose Calculation, has been introduced by Varian Medical Systems in the Eclipse planning system for photon dose calculation in external radiotherapy. Acuros XB is based on the solution of the linear Boltzmann transport equation (LBTE). The LBTE describes the macroscopic behaviour of radiation particles as they travel through and interact with matter. The implementation of Acuros XB in Eclipse has not been assessed; therefore, it is necessary to perform these pre-clinical validation tests to determine its accuracy. This paper summarizes the results of comparisons of Acuros XB calculations against measurements and calculations performed with a previously validated dose calculation algorithm, the Anisotropic Analytical Algorithm (AAA). The tasks addressed in this paper are limited to the fundamental characterization of Acuros XB in water for simple geometries. Validation was carried out for four different beams: 6 and 15 MV beams from a Varian Clinac 2100 iX, and 6 and 10 MV 'flattening filter free' (FFF) beams from a TrueBeam linear accelerator. The TrueBeam FFF are new beams recently introduced in clinical practice on general purpose linear accelerators and have not been previously reported on. Results indicate that Acuros XB accurately reproduces measured and calculated (with AAA) data and only small deviations were observed for all the investigated quantities. In general, the overall degree of accuracy for Acuros XB in simple geometries can be stated to be within 1% for open beams and within 2% for mechanical wedges. The basic validation of the Acuros XB algorithm was therefore considered satisfactory for both conventional photon beams as well as for FFF beams of new generation linacs such as the Varian TrueBeam.

  14. Hard X-ray Tail Discovered in the Clocked Burster GS 1826-238

    CERN Document Server

    Rodi, James; Roques, Jean-Pierre

    2015-01-01

    The LMXB NS GS 1826-238 was discovered by Ginga in 1988 September. Due to the presence of quasi-periodicity in the type I X-ray burst rate, the source has been a frequent target of X-ray observations for almost 30 years. Though the bursts were too soft to be detected by INTEGRAL/SPI, the persistent emission from GS 1826-238 was detected over 150 keV during the ~10 years of observations. Spectral analysis found a significant high-energy excess above a Comptonization model that is well fit by a power law, indicating an additional spectral component. Most previously reported spectra with hard tails in LMXB NS have had an electron temperature of a few keV and a hard tail dominating above ~50 keV with an index of \\Gamma ~ 2-3. GS 1826-238 was found to have a markedly different spectrum with $ kT_e \\sim 20 $ keV and a hard tail dominating above ~150 keV with an index of \\Gamma ~ 1.8, more similar to BHXRB. We report on our search for long-term spectral variability over the 25-370 keV energy range and on a compariso...

  15. Further analysis of SAS 3 observations of the rapid burster /MXB 1730-335/

    Science.gov (United States)

    Marshall, H. L.; Hoffman, J. A.; Doty, J.; Lewin, W. H. G.; Ulmer, M. P.

    1979-01-01

    SAS 3 observations of the rapid burster MXB 1730-335 are analyzed with specific reference to the rapidly repetitive type II bursts and also the type I bursts. It is found that: (1) there are two stable patterns in the recurrence of the rapidly repetitive type II bursts, designated modes I and II; (2) the range of type II burst energies is a factor of about 100 for mode I and a factor of about 10 for mode II; (3) type II burst spectra are best fitted by a blackbody of constant temperature (of the order of 18 million K), constant column density, and decreasing intensity; and (4) type I bursts are best fitted by a blackbody spectrum with decreasing temperature (approximately 24 million K during the first few seconds and 16 million K about 10 sec later). The spectral fits for both types of burst are shown to yield sizes for the emission region comparable to the radius of a neutron star. A model for the rapid burster is suggested.

  16. Development of Inboard Nacelle for the XB-36 Airplane

    Science.gov (United States)

    Nuber, Robert J.

    1947-01-01

    A series of investigations of several 1/14-scale models of an inboard nacelle for the XB-36 airplane was made in the Langley two-dimensional low-turbulence tunnels. The purpose of these investigations was to develop a low-drag wing-nacelle pusher combination which incorporated an internal air-flow system. As a result of these investigations, a nacelle was developed which had external drag coefficients considerably lower than the original basic form with the external nacelle drag approximately one-half to two-thirds of those of conventional tractor designs. The largest reductions in drag resulted from sealing the gaps between the wing flaps and nacelle, reducing the thickness of the nacelle training-edge lip, and bringing the under-wing air inlet to the wing leading edge. It was found that without the engine cooling fan adequate cooling air would be available for all conditions of flight except for cruise and climb at 40,000 feet. Sufficient oil cooling at an altitude of 40,000 feet may be obtained by the use of flap-type exit doors.

  17. Contributions of gamma ray bursters and supernovae to the terrestrial background radiation field

    International Nuclear Information System (INIS)

    Supernovae and gamma ray bursters are the most energetic events known in the universe. For over three decades researchers have speculated that these events may periodically increase the terrestrial radiation field to lethal levels, perhaps periodically sterilizing the surface of every planet in the Galaxy. Indeed, calculations show that a gamma ray burster located anywhere in the Milky Way Galaxy would produce a gamma ray dose of about 200 Gy to the top of the Earth's atmosphere. However, due to attenuation by the atmosphere, dose at the surface would be considerably lower and dose at a meter underwater would be lower still. In fact, the gamma ray dose from a gamma ray burst with a gamma energy of 1053 ergs at a distance of 100 parsecs from Earth will yield a direct gamma radiation dose of about 107 Gy at the top of the earth's atmosphere, about 1 Gy at sea level, and 160 mGy at a water depth of one meter. Similar calculations have been performed for supernovae, which are two orders of magnitude less energetic. Of crucial importance in determining the radiation exposure from these events is the gamma ray spectrum because gamma ray energy determines the degree of shielding provided by the atmosphere, buildup within the atmosphere, and water as well as contributions to other interactions such as pair production and photo-neutron interactions. In addition, other supernova and gamma ray burster debris such as charged and uncharged particles that may contribute in as-yet-unknown ways to overall radiation dose from these events. Gamma ray bursts are thought to occur about once every million years in the Milky Way Galaxy and supernovae occur a few times per century. With this periodicity, we would expect about one gamma ray burst every 10-20 million years that would raise sea-level gamma radiation dose to about 10 mGy and supernovae with similar effects should occur every 20-30 million years. This suggests that, while these events may not be important from the standpoint

  18. The x-ray activity of the rapid burster in 1983

    International Nuclear Information System (INIS)

    The rapid burster became active on August 5, 1983 after a long quiescence of four years. In this active period, the source exhibited several new features. It started to emit to train of bursts which apparently resemble to type I bursts, with quasi-periodic occurrence (74-90 min) superposed on a strong persistent component of approximately 50 mCrab. From August 17 to 19 there appeared eight long bursts of trapezoidal profiles similar to those observed in August 1979, and seven exotic long bursts, each being preceded by a gradual intensity increase in a few minutes. From August 20 to the termination of the activity on August 31 were observed about 3000 rapidly repetitive short bursts characteristic to this source in its discovery in 1976. The burst interval changed day to day from 15 to 150 s. Bursts with short interval exhibited almost periodic features of 16 s, suggesting a coherent nature of the burst train. (author)

  19. VizieR Online Data Catalog: Models of thermonuclear X-ray bursters (Lampe+, 2016)

    Science.gov (United States)

    Lampe, N.; Heger, A.; Galloway, D. K.

    2016-05-01

    Using the KEPLER 1D hydrodynamics code (Woosley et al. 2004ApJS..151...75W), 464 models of thermonuclear X-ray bursters were performed across a range of accretion rates and compositions. We present the library of simulated burst profiles from this sample, and examine variations in the simulated light curve for different model conditions. We find that the recurrence time varies as a power law against accretion rate, and measure its slope while mixed H/He burning is occurring for a range of metallicities, finding the power law gradient to vary from {eta}=1.1 to 1.24. We identify the accretion rates at which mixed H/He burning stops and a transition occurs to different burning regimes. We explore how varying the accretion rate and metallicity affects burst morphology in both the rise and tail. (1 data file).

  20. Spike-adding in parabolic bursters: The role of folded-saddle canards

    Science.gov (United States)

    Desroches, Mathieu; Krupa, Martin; Rodrigues, Serafim

    2016-09-01

    The present work develops a new approach to studying parabolic bursting, and also proposes a novel four-dimensional canonical and polynomial-based parabolic burster. In addition to this new polynomial system, we also consider the conductance-based model of the Aplysia R15 neuron known as the Plant model, and a reduction of this prototypical biophysical parabolic burster to three variables, including one phase variable, namely the Baer-Rinzel-Carillo (BRC) phase model. Revisiting these models from the perspective of slow-fast dynamics reveals that the number of spikes per burst may vary upon parameter changes, however the spike-adding process occurs in an explosive fashion that involves special solutions called canards. This spike-adding canard explosion phenomenon is analysed by using tools from geometric singular perturbation theory in tandem with numerical bifurcation techniques. We find that the bifurcation structure persists across all considered systems, that is, spikes within the burst are incremented via the crossing of an excitability threshold given by a particular type of canard orbit, namely the true canard of a folded-saddle singularity. However there can be a difference in the spike-adding transitions in parameter space from one case to another, according to whether the process is continuous or discontinuous, which depends upon the geometry of the folded-saddle canard. Using these findings, we construct a new polynomial approximation of the Plant model, which retains all the key elements for parabolic bursting, including the spike-adding transitions mediated by folded-saddle canards. Finally, we briefly investigate the presence of spike-adding via canards in planar phase models of parabolic bursting, namely the theta model by Ermentrout and Kopell.

  1. Dosimetric validation of Acuros XB with Monte Carlo methods for photon dose calculations

    International Nuclear Information System (INIS)

    Purpose: The dosimetric accuracy of the recently released Acuros XB advanced dose calculation algorithm (Varian Medical Systems, Palo Alto, CA) is investigated for single radiation fields incident on homogeneous and heterogeneous geometries, and a comparison is made to the analytical anisotropic algorithm (AAA). Methods: Ion chamber measurements for the 6 and 18 MV beams within a range of field sizes (from 4.0x4.0 to 30.0x30.0 cm2) are used to validate Acuros XB dose calculations within a unit density phantom. The dosimetric accuracy of Acuros XB in the presence of lung, low-density lung, air, and bone is determined using BEAMnrc/DOSXYZnrc calculations as a benchmark. Calculations using the AAA are included for reference to a current superposition/convolution standard. Results: Basic open field tests in a homogeneous phantom reveal an Acuros XB agreement with measurement to within ±1.9% in the inner field region for all field sizes and energies. Calculations on a heterogeneous interface phantom were found to agree with Monte Carlo calculations to within ±2.0%(σMC=0.8%) in lung (ρ=0.24 g cm-3) and within ±2.9%(σMC=0.8%) in low-density lung (ρ=0.1 g cm-3). In comparison, differences of up to 10.2% and 17.5% in lung and low-density lung were observed in the equivalent AAA calculations. Acuros XB dose calculations performed on a phantom containing an air cavity (ρ=0.001 g cm-3) were found to be within the range of ±1.5% to ±4.5% of the BEAMnrc/DOSXYZnrc calculated benchmark (σMC=0.8%) in the tissue above and below the air cavity. A comparison of Acuros XB dose calculations performed on a lung CT dataset with a BEAMnrc/DOSXYZnrc benchmark shows agreement within ±2%/2mm and indicates that the remaining differences are primarily a result of differences in physical material assignments within a CT dataset. Conclusions: By considering the fundamental particle interactions in matter based on theoretical interaction cross sections, the Acuros XB algorithm is

  2. Chandra and RXTE Spectra of the Burster GS 1826-238

    CERN Document Server

    Thompson, T W J; Tomsick, J A; Marshall, H L

    2005-01-01

    Using simultaneous observations from Chandra and RXTE, we investigated the LMXB GS 1826-238 with the goal of studying its spectral and timing properties. The uninterrupted Chandra observation captured 6 bursts (RXTE saw 3 of the 6), yielding a recurrence time of 3.54 +/- 0.03 hr. Using the proportional counter array on board RXTE, we made a probable detection of 611 Hz burst oscillations in the decaying phases of the bursts with an average rms signal amplitude of 4.8%. The integrated persistent emission spectrum can be described as the dual Comptonization of ~ 0.3 keV soft photons by a plasma with kT_e ~ 20 keV and an optical depth of about 2.6 (interpreted as emission from the accretion disk corona), plus the Comptonization of hotter ~ 0.8 keV seed photons by a ~ 6.8 keV plasma (interpreted as emission from or near the boundary layer). We discovered evidence for a neutral Fe K\\alpha emission line, and we found interstellar Fe L_II and Fe L_III absorption features. The burst spectrum can be fit by fixing the ...

  3. A population study of type II bursts in the Rapid Burster

    CERN Document Server

    Bagnoli, T; D'Angelo, C R; Galloway, D K

    2015-01-01

    Type II bursts are thought to arise from instabilities in the accretion flow onto a neutron star in an X-ray binary. Despite having been known for almost 40 years, no model can yet satisfactorily account for all their properties. To shed light on the nature of this phenomenon and provide a reference for future theoretical work, we study the entire sample of Rossi X-ray Timing Explorer data of type II bursts from the Rapid Burster (MXB 1730-335). We find that type II bursts are Eddington-limited in flux, that a larger amount of energy goes in the bursts than in the persistent emission, that type II bursts can be as short as 0.130 s, and that the distribution of recurrence times drops abruptly below 15-18 s. We highlight the complicated feedback between type II bursts and the NS surface thermonuclear explosions known as type I bursts, and between type II bursts and the persistent emission. We review a number of models for type II bursts. While no model can reproduce all the observed burst properties and explain...

  4. Discovery of GRS 1915+105 variability patterns in the Rapid Burster

    CERN Document Server

    Bagnoli, T

    2015-01-01

    We report the discovery of two new types of variability in the neutron star low-mass X-ray binary MXB 1730-335 (the 'Rapid Burster'). In one observation in 1999, it exhibits a large-amplitude quasi-periodic oscillation with a period of about 7 min. In another observation in 2008, it exhibits two 4-min long 75 per cent deep dips 44 min apart. These two kinds of variability are very similar to the so-called $\\rho$ or 'heartbeat' variability and the $\\theta$ variability, respectively, seen in the black hole low-mass X-ray binaries GRS 1915+105 and IGR J17091-3624. This shows that these types of behavior are unrelated to a black hole nature of the accretor. Our findings also show that these kinds of behaviour need not take place at near-Eddington accretion rates. We speculate that they may rather be related to the presence of a relatively wide orbit with an orbital period in excess of a few days and about the relation between these instabilities and the type II bursts.

  5. The INTEGRAL long monitoring of persistent Ultra Compact X-ray Bursters

    CERN Document Server

    Fiocchi, M; Ubertini, P; Bird, A J; Natalucci, L; Sguera, V

    2008-01-01

    The combination of compact objects, short period variability and peculiar chemical composition of the Ultra Compact X-ray Binaries make up a very interesting laboratory to study accretion processes and thermonuclear burning on the neutron star surface. The improved large optical telescopes and more sensitive X-ray satellites have increased the number of known Ultra Compact X-ray Binaries allowing their study with unprecedented detail. We analyze the average properties common to all ultra compact Bursters observed by INTEGRAL from ~0.2keV to ~150keV. We have performed a systematic analysis of the INTEGRAL public data and Key-Program proprietary observations of a sample of the Ultra Compact X-ray Binaries. In order to study their average properties in a very broad energy band, we combined INTEGRAL with BeppoSAX and SWIFT data whenever possible. For sources not showing any significant flux variations along the INTEGRAL monitoring, we build the average spectrum by combining all available data; in the case of vari...

  6. One-dimensional full wave simulation on XB mode conversion in electron cyclotron heating

    International Nuclear Information System (INIS)

    The XB mode conversion in electron cyclotron resonance frequency heating has been studied in detail through 1D full wave simulation. The field pattern depends on the density scale length, and the wave absorption near upper hybrid resonance is maximized beyond the R(X) mode cutoff density for optimized density scale length. The simulated mode conversion efficiency has been compared with that of an analytic formula, showing good agreements except for the phase dependent term of the X wave. The mode conversion efficiency is calculated for oblique injections as well, and it is found that the efficiency decreases as the injection angles increases. Short magnetic field scale length is confirmed to relax the short density scale length condition maximizing the XB mode conversion efficiency. Finally, the simulation code is used to analyze the mode conversion and power absorption of a pre-ionization plasma in versatile experiment spherical torus

  7. NuSTAR and XMM-Newton Observations of 1E1743.1-2843: Indications of a Neutron Star LMXB Nature of the Compact Object

    Science.gov (United States)

    Lotti, Simone; Natalucci, Lorenzo; Mori, Kaya; Baganoff, Frederick K.; Boggs, Steven E.; Christensen, Finn E.; Craig, William W.; Hailey, Charles J.; Harrison, Fiona A.; Hong, Jaesub; Krivonos, Roman A.; Rahoui, Farid; Stern, Daniel; Tomsick, John A.; Zhang, Shuo; Zhang, William W.

    2016-05-01

    We report on the results of NuSTAR and XMM-Newton observations of the persistent X-ray source 1E1743.1-2843, located in the Galactic Center region. The source was observed between 2012 September and October by NuSTAR and XMM-Newton, providing almost simultaneous observations in the hard and soft X-ray bands. The high X-ray luminosity points to the presence of an accreting compact object. We analyze the possibilities of this accreting compact object being either a neutron star (NS) or a black hole, and conclude that the joint XMM-Newton and NuSTAR spectrum from 0.3 to 40 keV fits a blackbody spectrum with {kT}˜ 1.8 {keV} emitted from a hot spot or an equatorial strip on an NS surface. This spectrum is thermally Comptonized by electrons with {{kT}}e˜ 4.6 {keV}. Accepting this NS hypothesis, we probe the low-mass X-ray binary (LMXB) or high-mass X-ray binary (HMXB) nature of the source. While the lack of Type-I bursts can be explained in the LMXB scenario, the absence of pulsations in the 2 mHz-49 Hz frequency range, the lack of eclipses and of an IR companion, and the lack of a {K}α line from neutral or moderately ionized iron strongly disfavor interpreting this source as a HMXB. We therefore conclude that 1E1743.1-2843 is most likely an NS-LMXB located beyond the Galactic Center. There is weak statistical evidence for a soft X-ray excess which may indicate thermal emission from an accretion disk. However, the disk normalization remains unconstrained due to the high hydrogen column density ({N}{{H}}˜ 1.6× {10}23 {{cm}}-2).

  8. Interpretation of the burst spectra from X-ray burster MXB 1728-34 with allowance for Thomson scattering

    International Nuclear Information System (INIS)

    Spectral evolution is investigated and interpretations of the spectra are considered for a burst from the X-ray burster MXB 1728-34 detected by ASTRON. Interpretation of the burst spectra in terms of black.body radiation leads to improbably small neutron star (NS) mass M and radius R as well as distance D to the burster. Interpretation of the spectra around the burst maximum (first ≅4 s) in terms of radiation from an isothermal NS photosphere with dominating role of the Thomson scattering allows one to obtain reasonable constraints on M, R, and D (in particular, M=(1.4-2) M Sun, R=(6.5-12) km for D=6 kpk and helium photosphere). This interpretation leads to a conclusion that the photosphere expands up to several tens of kilometers in the burst maximum. The luminosity remains close to the Eddington limit during expansion and contraction; maxima of the observed flux corresponding to minima of the luminosity due to general relativity effects. The burst tail spectra are close to those of thermal bremstrahlung. Such spectra might originate in a corona around NS with mass ∼ 10 -16 MSun, radius ∼ 100 km and electron density ∼ 1019 cm-3, or in a hot layer with thickness ∼ 1-10 gxcm-2 on the photosphere

  9. NuSTAR and XMM-Newton observations of 1E1743.1-2843: indications of a neutron star LMXB nature of the compact object

    CERN Document Server

    Lotti, Simone; Mori, Kaya; Baganoff, Frederick K; Boggs, Steven E; Christensen, Finn E; Craig, William W; Hailey, Charles J; Harrison, Fiona A; Hong, Jaesub; Krivonos, Roman A; Rahoui, Farid; Stern, Daniel; Tomsick, John A; Zhang, Shuo; Zhang, William W

    2016-01-01

    We report on the results of NuSTAR and XMM-Newton observations of the persistent X-ray source \\object{1E1743.1-2843}, located in the Galactic Center region. The source was observed between September and October 2012 by NuSTAR and XMM-Newton, providing almost simultaneous observations in the hard and soft X-ray bands. The high X-ray luminosity points to the presence of an accreting compact object. We analyze the possibilities of this accreting compact object being either a neutron star (NS) or a black hole, and conclude that the joint XMM-Newton and NuSTAR spectrum from 0.3 to 40 $\\mathrm{keV}$ fits to a black body spectrum with $kT\\sim1.8~\\mathrm{keV}$ emitted from a hot spot or an equatorial strip on a neutron star surface. This spectrum is thermally Comptonized by electrons with $kT_{e}\\sim4.6~\\mathrm{keV}$. Accepting this neutron star hypothesis, we probe the Low Mass (LMXB) or High Mass (HMXB) X-ray Binary nature of the source. While the lack of Type-I bursts can be explained in the LMXB scenario, the abs...

  10. Dosimetric evaluation of Acuros XB Advanced Dose Calculation algorithm in heterogeneous media

    International Nuclear Information System (INIS)

    A study was realised to evaluate and determine relative figures of merit of a new algorithm for photon dose calculation when applied to inhomogeneous media. The new Acuros XB algorithm implemented in the Varian Eclipse treatment planning system was compared against a Monte Carlo method (VMC++), and the Analytical Anisotropic Algorithm (AAA). The study was carried out in virtual phantoms characterized by simple geometrical structures. An insert of different material and density was included in a phantom built of skeletal-muscle and HU = 0 (setting 'A'): Normal Lung (lung, 0.198 g/cm3); Light Lung (lung, 0.035 g/cm3); Bone (bone, 1.798 g/cm3); another phantom (setting 'B') was built of adipose material and including thin layers of bone (1.85 g/cm3), adipose (0.92 g/cm3), cartilage (1.4745 g/cm3), air (0.0012 g/cm3). Investigations were performed for 6 and 15 MV photon beams, and for a large (13 × 13 cm2) and a small (2.8 × 13 cm2) field. Results are provided in terms of depth dose curves, transverse profiles and Gamma analysis (3 mm/3% and 2 mm/2% distance to agreement/dose difference criteria) in planes parallel to the beam central axis; Monte Carlo simulations were assumed as reference. Acuros XB gave an average gamma agreement, with a 3 mm/3% criteria, of 100%, 86% and 100% for Normal Lung, Light Lung and Bone settings, respectively, and dose to medium calculations. The same figures were 86%, 11% and 100% for AAA, where only dose rescaled to water calculations are possible. In conclusion, Acuros XB algorithm provides a valid and accurate alternative to Monte Carlo calculations for heterogeneity management

  11. Kinematical Studies of the Low Mass X-Ray Binary GR Mus (XB1254-690)

    OpenAIRE

    Barnes, A D; Casares, J.; Cornelisse, R.; Charles, P. A.; Steeghs, D; Hynes, R.I.; O'Brien, K.

    2007-01-01

    We present simultaneous high-resolution optical spectroscopy and X-ray data of the X-ray binary system GR Mus (XB1254-690), obtained over a full range of orbital phases. The X-ray observations are used to re-establish the orbital ephemeris for this source. The optical data includes the first spectroscopic detection of the donor star in this system, through the use of the Doppler Tomography technique on the Bowen fluorescence blend (~4630-4650 A). In combination with an estimate for the orbita...

  12. Magnetic exchange coupling in amorphous Fe80-xDy xB20 alloys

    International Nuclear Information System (INIS)

    Amorphous Fe80-xDy xB20 alloys have been prepared by melt spinning and their magnetic properties have been studied. The mean field theory has been used to explain the temperature dependence of the magnetization. The exchange interactions between Co-Co and Dy-Co atom pairs have been evaluated. High-field magnetization studies on samples with stoichiometry close to that of a compensated ferrimagnet show a magnetic behavior that is characteristic of a non-collinear magnetic structure of the Dy and Fe sublattices. The region of the canted moments can be described by a phase diagram in the H-T plane

  13. NuSTAR and XMM-Newton observations of 1e1743.1-2843: indications of a neutron star LMXB nature of the compact object

    DEFF Research Database (Denmark)

    Lotti, Simone; Natalucci, Lorenzo; Mori, Kaya;

    2016-01-01

    -I bursts can be explained in the LMXB scenario, the absence of pulsations in the 2 mHz-49 Hz frequency range, the lack of eclipses and of an IR companion, and the lack of a Ka line from neutral or moderately ionized iron strongly disfavor interpreting this source as a HMXB. We therefore conclude that 1E...

  14. Plasma heating due to X-B mode conversion in a cylindrical ECR plasma system

    CERN Document Server

    Yadav, V K; Yadav, Vipin K.

    2004-01-01

    Extra Ordinary (X) mode conversion to Bernstein wave near Upper Hybrid Resonance (UHR) layer plays an important role in plasma heating through cyclotron resonance. Wave generation at UHR and parametric decay at high power has been observed during Electron Cyclotron Resonance (ECR) heating experiments in toroidal magnetic fusion devices. A small linear system with ECR and UHR layer within the system has been used to conduct experiments on X-B conversion and parametric decay process as a function of system parameters. Direct probing {\\em in situ} is conducted and plasma heating is evidenced by soft x-ray emission measurement. Experiments are performed with hydrogen plasma produced with 160-800 W microwave power at 2.45 GHz of operating frequency at $10^{-3}$ mbar pressure. The axial magnetic field required for ECR is such that the resonant surface (B = 875 G) is situated at the geometrical axis of the plasma system. Experimental results will be presented in the paper.

  15. Plasma heating due to X-B mode conversion in a cylindrical ECR plasma system

    International Nuclear Information System (INIS)

    Extra Ordinary (X) mode conversion to Bernstein wave near Upper Hybrid Resonance (UHR) layer plays an important role in plasma heating through cyclotron resonance. Wave generation at UHR and parametric decay at high power has been observed during Electron Cyclotron Resonance (ECR) heating experiments in toroidal magnetic fusion devices. A small linear system with ECR and UHR layer within the system has been used to conduct experiments on X-B conversion and parametric decay process as a function of system parameters. Direct probing in situ is conducted and plasma heating is evidenced by soft x-ray emission measurement. Experiments are performed with hydrogen plasma produced with 160-800 W microwave power at 2.45 GHz of operating frequency at 10-3 mbar pressure. The axial magnetic field required for ECR is such that the resonant surface (B = 875 G) is situated at the geometrical axis of the plasma system. Experimental results will be presented in the paper. (authors)

  16. Kinematical Studies of the Low Mass X-Ray Binary GR Mus (XB1254-690)

    CERN Document Server

    Barnes, A D; Cornelisse, R; Charles, P A; Steeghs, D; Hynes, R I; O'Brien, K

    2007-01-01

    We present simultaneous high-resolution optical spectroscopy and X-ray data of the X-ray binary system GR Mus (XB1254-690), obtained over a full range of orbital phases. The X-ray observations are used to re-establish the orbital ephemeris for this source. The optical data includes the first spectroscopic detection of the donor star in this system, through the use of the Doppler Tomography technique on the Bowen fluorescence blend (~4630-4650 A). In combination with an estimate for the orbital parameters of the compact object using the wings of the He II 4686 emission line, dynamical mass constraints of 1.20 < M_X/M_{sun} < 2.64 for the neutron star and 0.45 < M_2/M_{sun} < 0.85 for the companion are derived.

  17. Measured Sonic Boom Signatures Above and Below the XB-70 Airplane Flying at Mach 1.5 and 37,000 Feet

    Science.gov (United States)

    Maglieri, Domenic J.; Henderson, Herbert R.; Tinetti, Ana F.

    2011-01-01

    During the 1966-67 Edwards Air Force Base (EAFB) National Sonic Boom Evaluation Program, a series of in-flight flow-field measurements were made above and below the USAF XB-70 using an instrumented NASA F-104 aircraft with a specially designed nose probe. These were accomplished in the three XB-70 flights at about Mach 1.5 at about 37,000 ft. and gross weights of about 350,000 lbs. Six supersonic passes with the F-104 probe aircraft were made through the XB-70 shock flow-field; one above and five below the XB-70. Separation distances ranged from about 3000 ft. above and 7000 ft. to the side of the XB-70 and about 2000 ft. and 5000 ft. below the XB-70. Complex near-field "sawtooth-type" signatures were observed in all cases. At ground level, the XB-70 shock waves had not coalesced into the two-shock classical sonic boom N-wave signature, but contained three shocks. Included in this report is a description of the generating and probe airplanes, the in-flight and ground pressure measuring instrumentation, the flight test procedure and aircraft positioning, surface and upper air weather observations, and the six in-flight pressure signatures from the three flights.

  18. Critical Appraisal of Acuros XB and Anisotropic Analytic Algorithm Dose Calculation in Advanced Non-Small-Cell Lung Cancer Treatments

    Energy Technology Data Exchange (ETDEWEB)

    Fogliata, Antonella, E-mail: afc@iosi.ch [Medical Physics Unit, Oncology Institute of Southern Switzerland, Bellinzona (Switzerland); Nicolini, Giorgia; Clivio, Alessandro; Vanetti, Eugenio; Cozzi, Luca [Medical Physics Unit, Oncology Institute of Southern Switzerland, Bellinzona (Switzerland)

    2012-08-01

    Purpose: To assess the clinical impact of the Acuros XB algorithm (implemented in the Varian Eclipse treatment-planning system) in non-small-cell lung cancer (NSCLC) cases. Methods and Materials: A CT dataset of 10 patients presenting with advanced NSCLC was selected and contoured for planning target volume, lungs, heart, and spinal cord. Plans were created for 6-MV and 15-MV beams using three-dimensional conformal therapy, intensity-modulated therapy, and volumetric modulated arc therapy with RapidArc. Calculations were performed with Acuros XB and the Anisotropic Analytical Algorithm. To distinguish between differences coming from the different heterogeneity management and those coming from the algorithm and its implementation, all the plans were recalculated assigning Hounsfield Unit (HU) = 0 (Water) to the CT dataset. Results: Differences in dose distributions between the two algorithms calculated in Water were <0.5%. This suggests that the differences in the real CT dataset can be ascribed mainly to the different heterogeneity management, which is proven to be more accurate in the Acuros XB calculations. The planning target dose difference was stratified between the target in soft tissue, where the mean dose was found to be lower for Acuros XB, with a range of 0.4% {+-} 0.6% (intensity-modulated therapy, 6 MV) to 1.7% {+-} 0.2% (three-dimensional conformal therapy, 6 MV), and the target in lung tissue, where the mean dose was higher for 6 MV (from 0.2% {+-} 0.2% to 1.2% {+-} 0.5%) and lower for 15 MV (from 0.5% {+-} 0.5% to 2.0% {+-} 0.9%). Mean doses to organs at risk presented differences up to 3% of the mean structure dose in the worst case. No particular or systematic differences were found related to the various modalities. Calculation time ratios between calculation time for Acuros XB and the Anisotropic Analytical Algorithm were 7 for three-dimensional conformal therapy, 5 for intensity-modulated therapy, and 0.2 for volumetric modulated arc therapy

  19. Broadband observations of the X-ray burster 4U 1705-44 with BeppoSAX

    CERN Document Server

    Piraino, S; Mueck, B; Kaaret, P; Di Salvo, T; D'Ai, A; Iaria, R; Egron, E

    2016-01-01

    4U 1705-44 is one of the most-studied type I X-ray burster and Atoll sources. This source represents a perfect candidate to test different models proposed to self-consistently track the physical changes occurring between different spectral states because it shows clear spectral state transitions. The broadband coverage, the sensitivity and energy resolution of the BeppoSAX satellite offers the opportunity to disentangle the components that form the total X-ray spectrum and to study their changes according to the spectral state. Using two BeppoSAX observations carried out in August and October 2000, respectively, for a total effective exposure time of about 100 ks, we study the spectral evolution of the source from a soft to hard state. Energy spectra are selected according to the source position in the color-color diagram (CCD) Results. We succeeded in modeling the spectra of the source using a physical self-consistent scenario for both the island and banana branches (the double Comptonization scenario). The ...

  20. X-ray follow-ups of the mysterious source XSSJ12270-4859: a LMXB with high energy Gamma ray FERMI/LAT association

    CERN Document Server

    de Martino, D; Falanga, M; Papitto, A; Motta, S; Pellizzoni, A; Evangelista, Y; Piano, G; Masetti, N; Bonnet-Bidaud, J -M; Mouchet, M; Mukai, K; Possenti, A

    2012-01-01

    XSSJ1227.0-4859 is a peculiar hard X-ray source recently positionally associated to the Fermi/LAT source 1FGLJ1227.9-4852/2FGLJ1227.7-4853. Multi-wavelength observations have added information on this source indicating a low-luminosity low mass X-ray binary (LMXB) but its nature is still unclear. To progress in our understanding, we present new X-ray data from a monitoring campaign performed in 2011 with the XMM-Newton, RXTE and Swift satellites and combine them with new Gamma-ray data from the Fermi and AGILE satellites. We complement the study with simultaneous near-UV photometry from XMM-Newton and with previous UV/optical and near-IR data. The X-ray history of XSSJ1227.0-4859 over 7yr shows a persistent and rather stable low luminosity (~6x10^33 d_{1\\,kpc}^2 erg/s) source, with flares and dips being a peculiar and permanent characteristics. The associated Fermi/LAT source 2FGLJ1227.7-4853 is also stable over an overlapping period of 4.7\\,yr. Searches for fast pulsations down to msec give upper limits to p...

  1. On the multi-periodicities in the X-ray dipper XB 1916-053

    CERN Document Server

    Homer, L; Hakala, P; Muhli, P; Shih, I C; Smale, A P; Ramsay, G

    2000-01-01

    Using the Rossi X-ray Timing Explorer and the Nordic Optical Telescope we have obtained the highest ever quality X-ray/white-light high-speed photometry of XB 1916-053. We refine the X-ray period (P_X) to 3000.6+/-0.2s via a restricted cycle counting approach. Using our complete optical lightcurve, we have extended the optical period (P_opt) ephemeris by another 4 years, providing further evidence for its stability, although a slightly longer period of 3027.555+/-0.002s now provides a marginally better fit. Moreover, modulations at both P_X and P_opt are present in the optical data, with the former dominating the nightly lightcurves (i.e. a few cycles of data). We have also attempted to determine the ``beat'' period, as seen in the repeating evolution of the X-ray dip structure, and the variation in primary dip phase. We find that a quasi-period of 4.74+/-0.05d provides the best fit to the data, even then requiring phase shifts between cycles, with the expected 3.90d ``beat'' of P_X and P_opt appearing to be ...

  2. Four-quark structure of Zc(3900), Z(4430) and Xb(5568) states

    CERN Document Server

    Goerke, Fabian; Ivanov, Mikhail A; Korner, Jurgen G; Lyubovitskij, Valery E; Santorelli, Pietro

    2016-01-01

    We examine the four-quark structure of the recently discovered charged $Z_c(3900)$, $Z(4430)$ and $X_b(5568)$ states. We calculate the widths of the strong decays $Z_c^+ \\to J/\\psi \\pi^+$ ($\\eta_c\\rho^+$, $\\bar D^0D^{\\ast\\,+}$, $\\bar D^{\\ast\\,0}D^+$), $Z(4430)^+ \\to J/\\psi \\pi^+$ ($\\psi(2s) \\pi^+$), and $X^+_b\\to B_s\\pi^+$ within a covariant quark model previously developed by us. We find that the tetraquark-type current widely used in the literature for the $Z_c(3900)$ leads to a significant suppression of the $\\bar D D^\\ast$ and $\\bar D^\\ast D$ modes. Contrary to this a molecular-type current provides an enhancement by a factor of 6-7 for the $\\bar D D^\\ast$ modes compared with the $Z_c^+\\to J/\\psi\\pi^+$, $\\eta_c\\rho^+$ modes in agreement with recent experimental data from the BESIII Collaboration. In case of $Z(4430)$ state we test a sensitivity of the ratio $R_Z$ of the $Z(4430)^+ \\to \\psi(2s) \\pi^+$ and $Z(4430)^+ \\to J/\\psi \\pi^+$ decay rates to a choice of the size parameter $\\Lambda_{Z(4430)}$ of the ...

  3. Broadband observations of the X-ray burster 4U1705-44 with BeppoSAX

    Science.gov (United States)

    Piraino, S.; Santangelo, A.; Mück, B.; Kaaret, P.; Di Salvo, T.; D'Aì, A.; Iaria, R.; Egron, E.

    2016-06-01

    Context. 4U1705-44 is one of the most-studied type I X-ray burster and Atoll sources. This source represents a perfect candidate to test different models proposed to self-consistently track the physical changes occurring between different spectral states because it shows clear spectral state transitions. Aims: The broadband coverage, the sensitivity and energy resolution of the BeppoSAX satellite offers the opportunity to disentangle the components that form the total X-ray spectrum and to study their changes according to the spectral state. Methods: Using two BeppoSAX observations carried out in August and October 2000, respectively, for a total effective exposure time of ~100 ks, we study the spectral evolution of the source from a soft to hard state. Energy spectra are selected according to the source position in the color-color diagram (CCD). Results: We succeeded in modeling the spectra of the source using a physical self-consistent scenario for both the island and banana branches (the double Comptonization scenario). The components observed are the soft Comptonization and hard Comptonization, the blackbody, and a reflection component with a broad iron line. When the source moves from the banana state to the island state, the parameters of the two Comptonization components change significantly and the blackbody component becomes too weak to be detected. Conclusions: We interpret the soft Comptonization component as emission from the hot plasma surrounding the neutron star, hard Comptonization as emission from the disk region, and the blackbody component as emission from the inner accretion disk. The broad feature in the iron line region is compatible with reflection from the inner accretion disk.

  4. Comparison between Acuros XB and Brainlab Monte Carlo algorithms for photon dose calculation

    Energy Technology Data Exchange (ETDEWEB)

    Misslbeck, M.; Kneschaurek, P. [Klinikum rechts der Isar der Technischen Univ. Muenchen (Germany). Klinik und Poliklinik fuer Strahlentherapie und Radiologische Onkologie

    2012-07-15

    Purpose: The Acuros {sup registered} XB dose calculation algorithm by Varian and the Monte Carlo algorithm XVMC by Brainlab were compared with each other and with the well-established AAA algorithm, which is also from Varian. Methods: First, square fields to two different artificial phantoms were applied: (1) a 'slab phantom' with a 3 cm water layer, followed by a 2 cm bone layer, a 7 cm lung layer, and another 18 cm water layer and (2) a 'lung phantom' with water surrounding an eccentric lung block. For the slab phantom, depth-dose curves along central beam axis were compared. The lung phantom was used to compare profiles at depths of 6 and 14 cm. As clinical cases, the CTs of three different patients were used. The original AAA plans with all three algorithms using open fields were recalculated. Results: There were only minor differences between Acuros and XVMC in all artificial phantom depth doses and profiles; however, this was different for AAA, which had deviations of up to 13% in depth dose and a few percent for profiles in the lung phantom. These deviations did not translate into the clinical cases, where the dose-volume histograms of all algorithms were close to each other for open fields. Conclusion: Only within artificial phantoms with clearly separated layers of simulated tissue does AAA show differences at layer boundaries compared to XVMC or Acuros. In real patient CTs, these differences in the dose-volume histogram of the planning target volume were not observed. (orig.)

  5. Clinical dosimetric impact of Acuros XB and analytical anisotropic algorithm (AAA on real lung cancer treatment plans : review

    Directory of Open Access Journals (Sweden)

    Suresh Rana

    2014-02-01

    Full Text Available Photon dose calculation algorithms in treatment planning system could affect the accuracy of dose delivery when tissue heterogeneity is involved along the beam path. Treatment planning for lung cancer is challenging, especially in the case of treatment plan involving small fields. The combination of low-density (air medium and small fields cause charge particle disequilibrium nears the air/tissue interface. Beam modeling within the dose calculation algorithms must also employ an accurate method of accounting tissue heterogeneity corrections in order to avoid dose overestimation or underestimation. Analytical anisotropic algorithm (AAA is one of the widely tested and validated dose calculation algorithms in external beam photon radiation therapy. Recently, Acuros XB (AXB was made available for photon dose calculations, and several studies have demonstrated better dose prediction accuracy of the AXB over AAA. This article reviews the results from the treatment planning studies, which have investigated the clinical dosimetric impact of the AXB and AAA on real lung cancer treatment plans.--------------------------------------Cite this article as: Rana S. Clinical dosimetric impact of Acuros XB and analytical anisotropic algorithm (AAA on real lung cancer treatment plans: review. Int J Cancer Ther Oncol 2014; 2(1:02019.DOI: http://dx.doi.org/10.14319/ijcto.0201.9

  6. Direct X-B mode conversion for high-β national spherical torus experiment in nonlinear regime

    International Nuclear Information System (INIS)

    Electron Bernstein wave (EBW) can be effective for heating and driving currents in spherical tokamak plasmas. Power can be coupled to EBW via mode conversion of the extraordinary (X) mode wave. The most common and successful approach to study the conditions for optimized mode conversion to EBW was evaluated analytically and numerically using a cold plasma model and an approximate kinetic model. The major drawback in using radio frequency waves was the lack of continuous wave sources at very high frequencies (above the electron plasma frequency), which has been addressed. A future milestone is to approach high power regime, where the nonlinear effects become significant, exceeding the limits of validity for present linear theory. Therefore, one appropriate tool would be particle in cell (PIC) simulation. The PIC method retains most of the nonlinear physics without approximations. In this work, we study the direct X-B mode conversion process stages using PIC method for incident wave frequency f0 = 15 GHz, and maximum amplitude E0 = 105 V/m in the national spherical torus experiment (NSTX). The modelling shows a considerable reduction in X-B mode conversion efficiency, Cmodelling = 0.43, due to the presence of nonlinearities. Comparison of system properties to the linear state reveals predominant nonlinear effects; EBW wavelength and group velocity in comparison with linear regime exhibit an increment around 36% and 17%, respectively

  7. Direct X-B mode conversion for high-β national spherical torus experiment in nonlinear regime

    Energy Technology Data Exchange (ETDEWEB)

    Ali Asgarian, M., E-mail: maliasgarian@ph.iut.ac.ir, E-mail: maa@msu.edu [Physics Department, Isfahan University of Technology, Isfahan 84156 (Iran, Islamic Republic of); Department of Electrical and Computer Engineering, Michigan State University, Michigan 48824-1226 (United States); Parvazian, A.; Abbasi, M. [Physics Department, Isfahan University of Technology, Isfahan 84156 (Iran, Islamic Republic of); Verboncoeur, J. P. [Department of Electrical and Computer Engineering, Michigan State University, Michigan 48824-1226 (United States)

    2014-09-15

    Electron Bernstein wave (EBW) can be effective for heating and driving currents in spherical tokamak plasmas. Power can be coupled to EBW via mode conversion of the extraordinary (X) mode wave. The most common and successful approach to study the conditions for optimized mode conversion to EBW was evaluated analytically and numerically using a cold plasma model and an approximate kinetic model. The major drawback in using radio frequency waves was the lack of continuous wave sources at very high frequencies (above the electron plasma frequency), which has been addressed. A future milestone is to approach high power regime, where the nonlinear effects become significant, exceeding the limits of validity for present linear theory. Therefore, one appropriate tool would be particle in cell (PIC) simulation. The PIC method retains most of the nonlinear physics without approximations. In this work, we study the direct X-B mode conversion process stages using PIC method for incident wave frequency f{sub 0} = 15 GHz, and maximum amplitude E{sub 0} = 10{sup 5 }V/m in the national spherical torus experiment (NSTX). The modelling shows a considerable reduction in X-B mode conversion efficiency, C{sub modelling} = 0.43, due to the presence of nonlinearities. Comparison of system properties to the linear state reveals predominant nonlinear effects; EBW wavelength and group velocity in comparison with linear regime exhibit an increment around ∼36% and 17%, respectively.

  8. Probing the MSP prenatal stage: the optical identification of the X-ray burster EXO 1745-248 in Terzan 5

    CERN Document Server

    Ferraro, F R; Lanzoni, B; Cadelano, M; Massari, D; Dalessandro, E; Mucciarelli, A; -,

    2015-01-01

    We report on the optical identification of the neutron star burster EXO 1745-248 in Terzan 5. The identification was performed by exploiting HST/ACS images acquired in Director's Discretionary Time shortly after (approximately 1 month) the Swift detection of the X-ray burst. The comparison between these images and previous archival data revealed the presence of a star that currently brightened by ~3 magnitudes, consistent with expectations during an X-ray outburst. The centroid of this object well agrees with the position, in the archival images, of a star located in the Turn-Off/Sub Giant Branch region of Terzan 5. This supports the scenario that the companion should has recently filled its Roche Lobe. Such a system represents the pre-natal stage of a millisecond pulsar, an evolutionary phase during which heavy mass accretion on the compact object occurs, thus producing X-ray outbursts and re-accelerating the neutron star.

  9. Dosimetric comparison of Acuros XB, AAA, and XVMC in stereotactic body radiotherapy for lung cancer

    International Nuclear Information System (INIS)

    Purpose: To compare the dosimetric performance of Acuros XB (AXB), anisotropic analytical algorithm (AAA), and x-ray voxel Monte Carlo (XVMC) in heterogeneous phantoms and lung stereotactic body radiotherapy (SBRT) plans. Methods: Water- and lung-equivalent phantoms were combined to evaluate the percentage depth dose and dose profile. The radiation treatment machine Novalis (BrainLab AG, Feldkirchen, Germany) with an x-ray beam energy of 6 MV was used to calculate the doses in the composite phantom at a source-to-surface distance of 100 cm with a gantry angle of 0°. Subsequently, the clinical lung SBRT plans for the 26 consecutive patients were transferred from the iPlan (ver. 4.1; BrainLab AG) to the Eclipse treatment planning systems (ver. 11.0.3; Varian Medical Systems, Palo Alto, CA). The doses were then recalculated with AXB and AAA while maintaining the XVMC-calculated monitor units and beam arrangement. Then the dose-volumetric data obtained using the three different radiation dose calculation algorithms were compared. Results: The results from AXB and XVMC agreed with measurements within ±3.0% for the lung-equivalent phantom with a 6 × 6 cm2 field size, whereas AAA values were higher than measurements in the heterogeneous zone and near the boundary, with the greatest difference being 4.1%. AXB and XVMC agreed well with measurements in terms of the profile shape at the boundary of the heterogeneous zone. For the lung SBRT plans, AXB yielded lower values than XVMC in terms of the maximum doses of ITV and PTV; however, the differences were within ±3.0%. In addition to the dose-volumetric data, the dose distribution analysis showed that AXB yielded dose distribution calculations that were closer to those with XVMC than did AAA. Means ± standard deviation of the computation time was 221.6 ± 53.1 s (range, 124–358 s), 66.1 ± 16.0 s (range, 42–94 s), and 6.7 ± 1.1 s (range, 5–9 s) for XVMC, AXB, and AAA, respectively. Conclusions: In the phantom

  10. Dosimetric impact of Acuros XB deterministic radiation transport algorithm for heterogeneous dose calculation in lung cancer

    Energy Technology Data Exchange (ETDEWEB)

    Han Tao; Followill, David; Repchak, Roman; Molineu, Andrea; Howell, Rebecca; Salehpour, Mohammad [Department of Radiation Physics, University of Texas MD Anderson Cancer Center, Houston, Texas 77030 (United States); Mikell, Justin [Department of Radiation Physics, the University of Texas MD Anderson Cancer Center, Houston, Texas 77030 (United States); University of Texas Graduate School of Biomedical Sciences at Houston, Houston, Texas 77030 (United States); Mourtada, Firas [Department of Radiation Physics, the University of Texas MD Anderson Cancer Center, Houston, Texas 77030 (United States); Department of Radiation Oncology, Christiana Care Health System, Newark, Delaware 19713 (United States)

    2013-05-15

    Purpose: The novel deterministic radiation transport algorithm, Acuros XB (AXB), has shown great potential for accurate heterogeneous dose calculation. However, the clinical impact between AXB and other currently used algorithms still needs to be elucidated for translation between these algorithms. The purpose of this study was to investigate the impact of AXB for heterogeneous dose calculation in lung cancer for intensity-modulated radiation therapy (IMRT) and volumetric-modulated arc therapy (VMAT). Methods: The thorax phantom from the Radiological Physics Center (RPC) was used for this study. IMRT and VMAT plans were created for the phantom in the Eclipse 11.0 treatment planning system. Each plan was delivered to the phantom three times using a Varian Clinac iX linear accelerator to ensure reproducibility. Thermoluminescent dosimeters (TLDs) and Gafchromic EBT2 film were placed inside the phantom to measure delivered doses. The measurements were compared with dose calculations from AXB 11.0.21 and the anisotropic analytical algorithm (AAA) 11.0.21. Two dose reporting modes of AXB, dose-to-medium in medium (D{sub m,m}) and dose-to-water in medium (D{sub w,m}), were studied. Point doses, dose profiles, and gamma analysis were used to quantify the agreement between measurements and calculations from both AXB and AAA. The computation times for AAA and AXB were also evaluated. Results: For the RPC lung phantom, AAA and AXB dose predictions were found in good agreement to TLD and film measurements for both IMRT and VMAT plans. TLD dose predictions were within 0.4%-4.4% to AXB doses (both D{sub m,m} and D{sub w,m}); and within 2.5%-6.4% to AAA doses, respectively. For the film comparisons, the gamma indexes ({+-}3%/3 mm criteria) were 94%, 97%, and 98% for AAA, AXB{sub Dm,m}, and AXB{sub Dw,m}, respectively. The differences between AXB and AAA in dose-volume histogram mean doses were within 2% in the planning target volume, lung, heart, and within 5% in the spinal cord

  11. Designing for 'meaningful' patient experience using Xperience-based designing (XbD): A new twist on a familiar approach

    DEFF Research Database (Denmark)

    Coxon, Ian Robert

    2013-01-01

    the larger Danish the Patient@Home research and development project. We base our design perspective on deep phenomenal understanding of patient experience beyond what is said and immediately observed, working only with the meaning level in data. We utilise immersive embodiments (always with an edge......); standard observational/conversational techniques (with a technological twist) and hermeneutic meaning analysis methods (The SEEing process - Coxon, 2008) that elevate the deep meaning structures within field data. Based on the understandings so produced, we ‘design’ a process for sharing insights....... In this paper we present ways to address this gap with a number of new twists on established Experience based Design practices (EbD) that have gained popularity in the UK and other parts of the world (NHS, 2013; Cain, 1998). At the Experience-based Designing Centre (XbDC) we are currently working within...

  12. Optimization of permanent magnetic properties in melt spun Co82-xHf12+xB6 (x = 0-4) nanocomposites

    Science.gov (United States)

    Chang, H. W.; Liao, M. C.; Shih, C. W.; Chang, W. C.; Shaw, C. C.

    2015-05-01

    Magnetic properties of melt spun Co82-xHf12+xB6 ribbons made with various wheel speeds have been studied. The ribbons with x = 0-1 are not easy to crystallize and thus display soft magnetic behavior even at wheel speed of 10 m/s. In contrast, the ribbons with x = 1.5-4 at optimized wheel speed exhibit good permanent magnetic properties of Br = 0.41-0.59 T, iHc = 120-400 kA/m, and (BH)max = 10.6-48.1 kJ/m3. The optimal magnetic properties of Br = 0.59 T, iHc = 384 kA/m, and (BH)max = 48.1 kJ/m3 are achieved for Co80Hf14B6 ribbons at wheel speed of 30 m/s. X-ray diffraction, thermo-magnetic analysis, and transmission electron microscopy results show that good hard magnetic properties of Co82-xHf12+xB6 ribbons (x = 2-4) are originated from the Co11Hf2 phase well coupled with the Co phase. The change of magnetic properties for Co82-xHf12+xB6 ribbons spun at various wheel speeds is correlated to microstructure and phase constitution. The strong exchange-coupling effect between magnetic grains for the ribbons with x = 2-3 at wheel speed = 30 m/s leads to remarkable permanent magnetic properties. The presented results suggest that the optimized Co82-xHf12+xB6 (x = 2-3) ribbons are much suitable than others (x = 0-1.5 and 4) for making rare earth and Pt-free magnets.

  13. A Soft X-Ray Spectral Episode for the Clocked Burster, GS 1826-24 as Measured by Swift and NuSTAR

    CERN Document Server

    Chenevez, J; Zand, J J M in 't; Tomsick, J A; Barret, D; Chakrabarty, D; Fürst, F; Boggs, S E; Christensen, F E; Craig, W W; Hailey, C J; Harrison, F A; Romano, P; Stern, D; Zhang, W W

    2015-01-01

    We report on NuSTAR and Swift observations of a soft state of the neutron star low-mass X-ray binary GS 1826-24, commonly known as the "clocked" burster. The transition to the soft state was recorded in 2014 June through an increase of the 2-20 keV source intensity measured by MAXI, simultaneous with a decrease of the 15-50 keV intensity measured by Swift/BAT. The episode lasted approximately two months, after which the source returned to its usual hard state. We analyze the broad-band spectrum measured by Swift/XRT and NuSTAR, and estimate the accretion rate during the soft episode to be about 13% of Eddington, within the range of previous observations. However, the best fit spectral model, adopting the double Comptonization used previously, exhibits significantly softer components. We detect seven type-I X-ray bursts, all significantly weaker (and with shorter rise and decay times) than observed previously. The burst profiles and recurrence times vary significantly, ruling out the regular bursts that are ty...

  14. A Soft X-Ray Spectral Episode for the Clocked Burster, GS 1826-24 as Measured by Swift and NuStar

    Science.gov (United States)

    Chenevez, J.; Galloway, D. K.; in 't Zand, J. J. M.; Tomsick, J. A.; Barret, D.; Chakrabarty, D.; Fürst, F.; Boggs, S. E.; Christensen, F. E.; Craig, W. W.; Hailey, C. J.; Harrison, F. A.; Romano, P.; Stern, D.; Zhang, W. W.

    2016-02-01

    We report on NuSTAR and Swift observations of a soft state of the neutron star low-mass X-ray binary GS 1826-24, commonly known as the “clocked” burster. The transition to the soft state was recorded in 2014 June through an increase of the 2-20 keV source intensity measured by MAXI, simultaneous with a decrease of the 15-50 keV intensity measured by Swift/BAT. The episode lasted approximately two months, after which the source returned to its usual hard state. We analyze the broadband spectrum measured by Swift/XRT and NuSTAR and estimate the accretion rate during the soft episode to be ≈ 13% {\\dot{m}}{{Edd}}, within the range of previous observations. However, the best-fit spectral model, adopting the double Comptonization used previously, exhibits significantly softer components. We detect seven type-I X-ray bursts, all significantly weaker (and with shorter rise and decay times) than observed previously. The burst profiles and recurrence times vary significantly, ruling out the regular bursts that are typical for this source. One burst exhibited photospheric radius expansion and we estimate the source distance as (5.7+/- 0.2) {ξ }b-1/2 kpc, where ξb parameterizes the possible anisotropy of the burst emission. The observed soft state may most likely be interpreted as a change in accretion geometry at about similar bolometric luminosity as in the hard state. The different burst behavior can therefore be attributed to this change in accretion flow geometry, but the fundamental cause and process for this effect remain unclear.

  15. The electronic structure, mechanical and thermodynamic properties of Mo2XB2 and MoX2B4 (X = Fe, Co, Ni) ternary borides

    International Nuclear Information System (INIS)

    The mechanical properties, electronic structure and thermodynamic properties of the Mo2XB2 and MoX2B4 (X = Fe, Co, Ni) ternary borides were calculated by first-principles methods. The elastic constants show that these ternary borides are mechanically stable. Formation enthalpy of Mo2XB2 and MoX2B4 (X = Fe, Co, Ni) ternary borides are at the range of −118.09 kJ/mol to −40.14 kJ/mol. The electronic structures and chemical bonding characteristics are analyzed by the density of states. Mo2FeB2 has the largest shear and Young's modulus because of its strong chemical bonding, and the values are 204.3 GPa and 500.3 GPa, respectively. MoCo2B4 shows the lowest degree of anisotropy due to the lack of strong direction in the bonding. The Debye temperature of MoFe2B4 is the largest among the six phases, which means that MoFe2B4 possesses the best thermal conductivity. Enthalpy shows an approximately linear function of the temperature above 300 K. The entropy of these compounds increase rapidly when the temperature is below 450 K. The Gibbs free energy decreases with the increase in temperature. MoCo2B4 has the lowest Gibbs free energy, which indicates the strongest formation ability in Mo2XB2 and MoX2B4 (X = Fe, Co, Ni) ternary borides

  16. Lattice distortion and spontaneous Γ5g ferro-quadrupole moment in phase IV of CexLa1-xB6

    International Nuclear Information System (INIS)

    We have performed low-temperature thermal expansion measurements to investigate lattice effect of the phase IV in CexLa1-xB6, for x=0.75 and 0.70. In phase IV of both compounds, lattice length along the [111] direction shrinks notably, on the other hand length along the [001] direction expands. These results provide evidence that the spontaneous Γ5g ferro-quadrupole moment yz>=zx>=xy>0 is relevant in phase IV because the trigonal lattice distortion is described by the symmetry strain yz>=zx>=xy>0 simultaneously

  17. Optimization of permanent magnetic properties in melt spun Co82−xHf12+xB6 (x = 0–4) nanocomposites

    International Nuclear Information System (INIS)

    Magnetic properties of melt spun Co82−xHf12+xB6 ribbons made with various wheel speeds have been studied. The ribbons with x = 0–1 are not easy to crystallize and thus display soft magnetic behavior even at wheel speed of 10 m/s. In contrast, the ribbons with x = 1.5–4 at optimized wheel speed exhibit good permanent magnetic properties of Br = 0.41–0.59 T, iHc = 120–400 kA/m, and (BH)max = 10.6–48.1 kJ/m3. The optimal magnetic properties of Br = 0.59 T, iHc = 384 kA/m, and (BH)max = 48.1 kJ/m3 are achieved for Co80Hf14B6 ribbons at wheel speed of 30 m/s. X-ray diffraction, thermo-magnetic analysis, and transmission electron microscopy results show that good hard magnetic properties of Co82−xHf12+xB6 ribbons (x = 2–4) are originated from the Co11Hf2 phase well coupled with the Co phase. The change of magnetic properties for Co82−xHf12+xB6 ribbons spun at various wheel speeds is correlated to microstructure and phase constitution. The strong exchange-coupling effect between magnetic grains for the ribbons with x = 2–3 at wheel speed = 30 m/s leads to remarkable permanent magnetic properties. The presented results suggest that the optimized Co82−xHf12+xB6 (x = 2–3) ribbons are much suitable than others (x = 0–1.5 and 4) for making rare earth and Pt-free magnets

  18. Effect of Tm substitution on the magnetic properties and local magnetic anisotropy of amorphous Fe80-xTm xB20 ribbons

    International Nuclear Information System (INIS)

    We have carried out magnetic and Moessbauer studies of amorphous Fe80-xTm xB20 alloys (0 ≤ x ≤ 16). With an increasing Tm content, both the Curie temperature T C and the magnetic moment of Fe atom μ Fe decrease. We have extracted the value of exchange constant A from T C and that of the local magnetic anisotropy constant K L from the coercivity. Moessbauer studies were performed in a transmission geometry and also using the conversion electron spectroscopy. Both Moessbauer spectrometry techniques show that the average hyperfine field decreases linearly with the addition of rare-earth

  19. Search for the $X_b$ and other hidden-beauty states in the $\\pi^+ \\pi^- \\Upsilon(1 \\rm S)$ channel at ATLAS

    CERN Document Server

    Aad, Georges; Abdallah, Jalal; Abdel Khalek, Samah; Abdinov, Ovsat; Aben, Rosemarie; Abi, Babak; Abolins, Maris; AbouZeid, Ossama; Abramowicz, Halina; Abreu, Henso; Abreu, Ricardo; Abulaiti, Yiming; Acharya, Bobby Samir; Adamczyk, Leszek; Adams, David; Adelman, Jahred; Adomeit, Stefanie; Adye, Tim; Agatonovic-Jovin, Tatjana; Aguilar-Saavedra, Juan Antonio; Agustoni, Marco; Ahlen, Steven; Ahmadov, Faig; Aielli, Giulio; Akerstedt, Henrik; Åkesson, Torsten Paul Ake; Akimoto, Ginga; Akimov, Andrei; Alberghi, Gian Luigi; Albert, Justin; Albrand, Solveig; Alconada Verzini, Maria Josefina; Aleksa, Martin; Aleksandrov, Igor; Alexa, Calin; Alexander, Gideon; Alexandre, Gauthier; Alexopoulos, Theodoros; Alhroob, Muhammad; Alimonti, Gianluca; Alio, Lion; Alison, John; Allbrooke, Benedict; Allison, Lee John; Allport, Phillip; Almond, John; Aloisio, Alberto; Alonso, Alejandro; Alonso, Francisco; Alpigiani, Cristiano; Altheimer, Andrew David; Alvarez Gonzalez, Barbara; Alviggi, Mariagrazia; Amako, Katsuya; Amaral Coutinho, Yara; Amelung, Christoph; Amidei, Dante; Amor Dos Santos, Susana Patricia; Amorim, Antonio; Amoroso, Simone; Amram, Nir; Amundsen, Glenn; Anastopoulos, Christos; Ancu, Lucian Stefan; Andari, Nansi; Andeen, Timothy; Anders, Christoph Falk; Anders, Gabriel; Anderson, Kelby; Andreazza, Attilio; Andrei, George Victor; Anduaga, Xabier; Angelidakis, Stylianos; Angelozzi, Ivan; Anger, Philipp; Angerami, Aaron; Anghinolfi, Francis; Anisenkov, Alexey; Anjos, Nuno; Annovi, Alberto; Antonaki, Ariadni; Antonelli, Mario; Antonov, Alexey; Antos, Jaroslav; Anulli, Fabio; Aoki, Masato; Aperio Bella, Ludovica; Apolle, Rudi; Arabidze, Giorgi; Aracena, Ignacio; Arai, Yasuo; Araque, Juan Pedro; Arce, Ayana; Arguin, Jean-Francois; Argyropoulos, Spyridon; Arik, Metin; Armbruster, Aaron James; Arnaez, Olivier; Arnal, Vanessa; Arnold, Hannah; Arratia, Miguel; Arslan, Ozan; Artamonov, Andrei; Artoni, Giacomo; Asai, Shoji; Asbah, Nedaa; Ashkenazi, Adi; Åsman, Barbro; Asquith, Lily; Assamagan, Ketevi; Astalos, Robert; Atkinson, Markus; Atlay, Naim Bora; Auerbach, Benjamin; Augsten, Kamil; Aurousseau, Mathieu; Avolio, Giuseppe; Azuelos, Georges; Azuma, Yuya; Baak, Max; Baas, Alessandra; Bacci, Cesare; Bachacou, Henri; Bachas, Konstantinos; Backes, Moritz; Backhaus, Malte; Backus Mayes, John; Badescu, Elisabeta; Bagiacchi, Paolo; Bagnaia, Paolo; Bai, Yu; Bain, Travis; Baines, John; Baker, Oliver Keith; Balek, Petr; Balli, Fabrice; Banas, Elzbieta; Banerjee, Swagato; Bannoura, Arwa A E; Bansal, Vikas; Bansil, Hardeep Singh; Barak, Liron; Baranov, Sergei; Barberio, Elisabetta Luigia; Barberis, Dario; Barbero, Marlon; Barillari, Teresa; Barisonzi, Marcello; Barklow, Timothy; Barlow, Nick; Barnett, Bruce; Barnett, Michael; Barnovska, Zuzana; Baroncelli, Antonio; Barone, Gaetano; Barr, Alan; Barreiro, Fernando; Barreiro Guimarães da Costa, João; Bartoldus, Rainer; Barton, Adam Edward; Bartos, Pavol; Bartsch, Valeria; Bassalat, Ahmed; Basye, Austin; Bates, Richard; Batley, Richard; Battaglia, Marco; Battistin, Michele; Bauer, Florian; Bawa, Harinder Singh; Beattie, Michael David; Beau, Tristan; Beauchemin, Pierre-Hugues; Beccherle, Roberto; Bechtle, Philip; Beck, Hans Peter; Becker, Anne Kathrin; Becker, Sebastian; Beckingham, Matthew; Becot, Cyril; Beddall, Andrew; Beddall, Ayda; Bedikian, Sourpouhi; Bednyakov, Vadim; Bee, Christopher; Beemster, Lars; Beermann, Thomas; Begel, Michael; Behr, Katharina; Belanger-Champagne, Camille; Bell, Paul; Bell, William; Bella, Gideon; Bellagamba, Lorenzo; Bellerive, Alain; Bellomo, Massimiliano; Belotskiy, Konstantin; Beltramello, Olga; Benary, Odette; Benchekroun, Driss; Bendtz, Katarina; Benekos, Nektarios; Benhammou, Yan; Benhar Noccioli, Eleonora; Benitez Garcia, Jorge-Armando; Benjamin, Douglas; Bensinger, James; Benslama, Kamal; Bentvelsen, Stan; Berge, David; Bergeaas Kuutmann, Elin; Berger, Nicolas; Berghaus, Frank; Beringer, Jürg; Bernard, Clare; Bernat, Pauline; Bernius, Catrin; Bernlochner, Florian Urs; Berry, Tracey; Berta, Peter; Bertella, Claudia; Bertoli, Gabriele; Bertolucci, Federico; Bertsche, Carolyn; Bertsche, David; Besana, Maria Ilaria; Besjes, Geert-Jan; Bessidskaia, Olga; Bessner, Martin Florian; Besson, Nathalie; Betancourt, Christopher; Bethke, Siegfried; Bhimji, Wahid; Bianchi, Riccardo-Maria; Bianchini, Louis; Bianco, Michele; Biebel, Otmar; Bieniek, Stephen Paul; Bierwagen, Katharina; Biesiada, Jed; Biglietti, Michela; Bilbao De Mendizabal, Javier; Bilokon, Halina; Bindi, Marcello; Binet, Sebastien; Bingul, Ahmet; Bini, Cesare; Black, Curtis; Black, James; Black, Kevin; Blackburn, Daniel; Blair, Robert; Blanchard, Jean-Baptiste; Blazek, Tomas; Bloch, Ingo; Blocker, Craig; Blum, Walter; Blumenschein, Ulrike; Bobbink, Gerjan; Bobrovnikov, Victor; Bocchetta, Simona Serena; Bocci, Andrea; Bock, Christopher; Boddy, Christopher Richard; Boehler, Michael; Boek, Thorsten Tobias; Bogaerts, Joannes Andreas; Bogdanchikov, Alexander; Bogouch, Andrei; Bohm, Christian; Bohm, Jan; Boisvert, Veronique; Bold, Tomasz; Boldea, Venera; Boldyrev, Alexey; Bomben, Marco; Bona, Marcella; Boonekamp, Maarten; Borisov, Anatoly; Borissov, Guennadi; Borri, Marcello; Borroni, Sara; Bortfeldt, Jonathan; Bortolotto, Valerio; Bos, Kors; Boscherini, Davide; Bosman, Martine; Boterenbrood, Hendrik; Boudreau, Joseph; Bouffard, Julian; Bouhova-Thacker, Evelina Vassileva; Boumediene, Djamel Eddine; Bourdarios, Claire; Bousson, Nicolas; Boutouil, Sara; Boveia, Antonio; Boyd, James; Boyko, Igor; Bozic, Ivan; Bracinik, Juraj; Brandt, Andrew; Brandt, Gerhard; Brandt, Oleg; Bratzler, Uwe; Brau, Benjamin; Brau, James; Braun, Helmut; Brazzale, Simone Federico; Brelier, Bertrand; Brendlinger, Kurt; Brennan, Amelia Jean; Brenner, Richard; Bressler, Shikma; Bristow, Kieran; Bristow, Timothy Michael; Britton, Dave; Brochu, Frederic; Brock, Ian; Brock, Raymond; Bromberg, Carl; Bronner, Johanna; Brooijmans, Gustaaf; Brooks, Timothy; Brooks, William; Brosamer, Jacquelyn; Brost, Elizabeth; Brown, Jonathan; Bruckman de Renstrom, Pawel; Bruncko, Dusan; Bruneliere, Renaud; Brunet, Sylvie; Bruni, Alessia; Bruni, Graziano; Bruschi, Marco; Bryngemark, Lene; Buanes, Trygve; Buat, Quentin; Bucci, Francesca; Buchholz, Peter; Buckingham, Ryan; Buckley, Andrew; Buda, Stelian Ioan; Budagov, Ioulian; Buehrer, Felix; Bugge, Lars; Bugge, Magnar Kopangen; Bulekov, Oleg; Bundock, Aaron Colin; Burckhart, Helfried; Burdin, Sergey; Burghgrave, Blake; Burke, Stephen; Burmeister, Ingo; Busato, Emmanuel; Büscher, Daniel; Büscher, Volker; Bussey, Peter; Buszello, Claus-Peter; Butler, Bart; Butler, John; Butt, Aatif Imtiaz; Buttar, Craig; Butterworth, Jonathan; Butti, Pierfrancesco; Buttinger, William; Buzatu, Adrian; Byszewski, Marcin; Cabrera Urbán, Susana; Caforio, Davide; Cakir, Orhan; Calafiura, Paolo; Calandri, Alessandro; Calderini, Giovanni; Calfayan, Philippe; Calkins, Robert; Caloba, Luiz; Calvet, David; Calvet, Samuel; Camacho Toro, Reina; Camarda, Stefano; Cameron, David; Caminada, Lea Michaela; Caminal Armadans, Roger; Campana, Simone; Campanelli, Mario; Campoverde, Angel; Canale, Vincenzo; Canepa, Anadi; Cano Bret, Marc; Cantero, Josu; Cantrill, Robert; Cao, Tingting; Capeans Garrido, Maria Del Mar; Caprini, Irinel; Caprini, Mihai; Capua, Marcella; Caputo, Regina; Cardarelli, Roberto; Carli, Tancredi; Carlino, Gianpaolo; Carminati, Leonardo; Caron, Sascha; Carquin, Edson; Carrillo-Montoya, German D; Carter, Janet; Carvalho, João; Casadei, Diego; Casado, Maria Pilar; Casolino, Mirkoantonio; Castaneda-Miranda, Elizabeth; Castelli, Angelantonio; Castillo Gimenez, Victoria; Castro, Nuno Filipe; Catastini, Pierluigi; Catinaccio, Andrea; Catmore, James; Cattai, Ariella; Cattani, Giordano; Caudron, Julien; Cavaliere, Viviana; Cavalli, Donatella; Cavalli-Sforza, Matteo; Cavasinni, Vincenzo; Ceradini, Filippo; Cerio, Benjamin; Cerny, Karel; Cerqueira, Augusto Santiago; Cerri, Alessandro; Cerrito, Lucio; Cerutti, Fabio; Cerv, Matevz; Cervelli, Alberto; Cetin, Serkant Ali; Chafaq, Aziz; Chakraborty, Dhiman; Chalupkova, Ina; Chang, Philip; Chapleau, Bertrand; Chapman, John Derek; Charfeddine, Driss; Charlton, Dave; Chau, Chav Chhiv; Chavez Barajas, Carlos Alberto; Cheatham, Susan; Chegwidden, Andrew; Chekanov, Sergei; Chekulaev, Sergey; Chelkov, Gueorgui; Chelstowska, Magda Anna; Chen, Chunhui; Chen, Hucheng; Chen, Karen; Chen, Liming; Chen, Shenjian; Chen, Xin; Chen, Ye; Chen, Yujiao; Cheng, Hok Chuen; Cheng, Yangyang; Cheplakov, Alexander; Cherkaoui El Moursli, Rajaa; Chernyatin, Valeriy; Cheu, Elliott; Chevalier, Laurent; Chiarella, Vitaliano; Chiefari, Giovanni; Childers, John Taylor; Chilingarov, Alexandre; Chiodini, Gabriele; Chisholm, Andrew; Chislett, Rebecca Thalatta; Chitan, Adrian; Chizhov, Mihail; Chouridou, Sofia; Chow, Bonnie Kar Bo; Chromek-Burckhart, Doris; Chu, Ming-Lee; Chudoba, Jiri; Chwastowski, Janusz; Chytka, Ladislav; Ciapetti, Guido; Ciftci, Abbas Kenan; Ciftci, Rena; Cinca, Diane; Cindro, Vladimir; Ciocio, Alessandra; Cirkovic, Predrag; Citron, Zvi Hirsh; Citterio, Mauro; Ciubancan, Mihai; Clark, Allan G; Clark, Philip James; Clarke, Robert; Cleland, Bill; Clemens, Jean-Claude; Clement, Christophe; Coadou, Yann; Cobal, Marina; Coccaro, Andrea; Cochran, James H; Coffey, Laurel; Cogan, Joshua Godfrey; Coggeshall, James; Cole, Brian; Cole, Stephen; Colijn, Auke-Pieter; Collot, Johann; Colombo, Tommaso; Colon, German; Compostella, Gabriele; Conde Muiño, Patricia; Coniavitis, Elias; Conidi, Maria Chiara; Connell, Simon Henry; Connelly, Ian; Consonni, Sofia Maria; Consorti, Valerio; Constantinescu, Serban; Conta, Claudio; Conti, Geraldine; Conventi, Francesco; Cooke, Mark; Cooper, Ben; Cooper-Sarkar, Amanda; Cooper-Smith, Neil; Copic, Katherine; Cornelissen, Thijs; Corradi, Massimo; Corriveau, Francois; Corso-Radu, Alina; Cortes-Gonzalez, Arely; Cortiana, Giorgio; Costa, Giuseppe; Costa, María José; Costanzo, Davide; Côté, David; Cottin, Giovanna; Cowan, Glen; Cox, Brian; Cranmer, Kyle; Cree, Graham; Crépé-Renaudin, Sabine; Crescioli, Francesco; Cribbs, Wayne Allen; Crispin Ortuzar, Mireia; Cristinziani, Markus; Croft, Vince; Crosetti, Giovanni; Cuciuc, Constantin-Mihai; Cuhadar Donszelmann, Tulay; Cummings, Jane; Curatolo, Maria; Cuthbert, Cameron; Czirr, Hendrik; Czodrowski, Patrick; Czyczula, Zofia; D'Auria, Saverio; D'Onofrio, Monica; Da Cunha Sargedas De Sousa, Mario Jose; Da Via, Cinzia; Dabrowski, Wladyslaw; Dafinca, Alexandru; Dai, Tiesheng; Dale, Orjan; Dallaire, Frederick; Dallapiccola, Carlo; Dam, Mogens; Daniells, Andrew Christopher; Dano Hoffmann, Maria; Dao, Valerio; Darbo, Giovanni; Darmora, Smita; Dassoulas, James; Dattagupta, Aparajita; Davey, Will; David, Claire; Davidek, Tomas; Davies, Eleanor; Davies, Merlin; Davignon, Olivier; Davison, Adam; Davison, Peter; Davygora, Yuriy; Dawe, Edmund; Dawson, Ian; Daya-Ishmukhametova, Rozmin; De, Kaushik; de Asmundis, Riccardo; De Castro, Stefano; De Cecco, Sandro; De Groot, Nicolo; de Jong, Paul; De la Torre, Hector; De Lorenzi, Francesco; De Nooij, Lucie; De Pedis, Daniele; De Salvo, Alessandro; De Sanctis, Umberto; De Santo, Antonella; De Vivie De Regie, Jean-Baptiste; Dearnaley, William James; Debbe, Ramiro; Debenedetti, Chiara; Dechenaux, Benjamin; Dedovich, Dmitri; Deigaard, Ingrid; Del Peso, Jose; Del Prete, Tarcisio; Deliot, Frederic; Delitzsch, Chris Malena; Deliyergiyev, Maksym; Dell'Acqua, Andrea; Dell'Asta, Lidia; Dell'Orso, Mauro; Della Pietra, Massimo; della Volpe, Domenico; Delmastro, Marco; Delsart, Pierre-Antoine; Deluca, Carolina; Demers, Sarah; Demichev, Mikhail; Demilly, Aurelien; Denisov, Sergey; Derendarz, Dominik; Derkaoui, Jamal Eddine; Derue, Frederic; Dervan, Paul; Desch, Klaus Kurt; Deterre, Cecile; Deviveiros, Pier-Olivier; Dewhurst, Alastair; Dhaliwal, Saminder; Di Ciaccio, Anna; Di Ciaccio, Lucia; Di Domenico, Antonio; Di Donato, Camilla; Di Girolamo, Alessandro; Di Girolamo, Beniamino; Di Mattia, Alessandro; Di Micco, Biagio; Di Nardo, Roberto; Di Simone, Andrea; Di Sipio, Riccardo; Di Valentino, David; Dias, Flavia; Diaz, Marco Aurelio; Diehl, Edward; Dietrich, Janet; Dietzsch, Thorsten; Diglio, Sara; Dimitrievska, Aleksandra; Dingfelder, Jochen; Dionisi, Carlo; Dita, Petre; Dita, Sanda; Dittus, Fridolin; Djama, Fares; Djobava, Tamar; Djuvsland, Julia Isabell; do Vale, Maria Aline Barros; Do Valle Wemans, André; Dobos, Daniel; Doglioni, Caterina; Doherty, Tom; Dohmae, Takeshi; Dolejsi, Jiri; Dolezal, Zdenek; Dolgoshein, Boris; Donadelli, Marisilvia; Donati, Simone; Dondero, Paolo; Donini, Julien; Dopke, Jens; Doria, Alessandra; Dova, Maria-Teresa; Doyle, Tony; Dris, Manolis; Dubbert, Jörg; Dube, Sourabh; Dubreuil, Emmanuelle; Duchovni, Ehud; Duckeck, Guenter; Ducu, Otilia Anamaria; Duda, Dominik; Dudarev, Alexey; Dudziak, Fanny; Duflot, Laurent; Duguid, Liam; Dührssen, Michael; Dunford, Monica; Duran Yildiz, Hatice; Düren, Michael; Durglishvili, Archil; Dwuznik, Michal; Dyndal, Mateusz; Ebke, Johannes; Edson, William; Edwards, Nicholas Charles; Ehrenfeld, Wolfgang; Eifert, Till; Eigen, Gerald; Einsweiler, Kevin; Ekelof, Tord; El Kacimi, Mohamed; Ellert, Mattias; Elles, Sabine; Ellinghaus, Frank; Ellis, Nicolas; Elmsheuser, Johannes; Elsing, Markus; Emeliyanov, Dmitry; Enari, Yuji; Endner, Oliver Chris; Endo, Masaki; Engelmann, Roderich; Erdmann, Johannes; Ereditato, Antonio; Eriksson, Daniel; Ernis, Gunar; Ernst, Jesse; Ernst, Michael; Ernwein, Jean; Errede, Deborah; Errede, Steven; Ertel, Eugen; Escalier, Marc; Esch, Hendrik; Escobar, Carlos; Esposito, Bellisario; Etienvre, Anne-Isabelle; Etzion, Erez; Evans, Hal; Ezhilov, Alexey; Fabbri, Laura; Facini, Gabriel; Fakhrutdinov, Rinat; Falciano, Speranza; Falla, Rebecca Jane; Faltova, Jana; Fang, Yaquan; Fanti, Marcello; Farbin, Amir; Farilla, Addolorata; Farooque, Trisha; Farrell, Steven; Farrington, Sinead; Farthouat, Philippe; Fassi, Farida; Fassnacht, Patrick; Fassouliotis, Dimitrios; Favareto, Andrea; Fayard, Louis; Federic, Pavol; Fedin, Oleg; Fedorko, Wojciech; Fehling-Kaschek, Mirjam; Feigl, Simon; Feligioni, Lorenzo; Feng, Cunfeng; Feng, Eric; Feng, Haolu; Fenyuk, Alexander; Fernandez Perez, Sonia; Ferrag, Samir; Ferrando, James; Ferrari, Arnaud; Ferrari, Pamela; Ferrari, Roberto; Ferreira de Lima, Danilo Enoque; Ferrer, Antonio; Ferrere, Didier; Ferretti, Claudio; Ferretto Parodi, Andrea; Fiascaris, Maria; Fiedler, Frank; Filipčič, Andrej; Filipuzzi, Marco; Filthaut, Frank; Fincke-Keeler, Margret; Finelli, Kevin Daniel; Fiolhais, Miguel; Fiorini, Luca; Firan, Ana; Fischer, Adam; Fischer, Julia; Fisher, Wade Cameron; Fitzgerald, Eric Andrew; Flechl, Martin; Fleck, Ivor; Fleischmann, Philipp; Fleischmann, Sebastian; Fletcher, Gareth Thomas; Fletcher, Gregory; Flick, Tobias; Floderus, Anders; Flores Castillo, Luis; Florez Bustos, Andres Carlos; Flowerdew, Michael; Formica, Andrea; Forti, Alessandra; Fortin, Dominique; Fournier, Daniel; Fox, Harald; Fracchia, Silvia; Francavilla, Paolo; Franchini, Matteo; Franchino, Silvia; Francis, David; Franconi, Laura; Franklin, Melissa; Franz, Sebastien; Fraternali, Marco; French, Sky; Friedrich, Conrad; Friedrich, Felix; Froidevaux, Daniel; Frost, James; Fukunaga, Chikara; Fullana Torregrosa, Esteban; Fulsom, Bryan Gregory; Fuster, Juan; Gabaldon, Carolina; Gabizon, Ofir; Gabrielli, Alessandro; Gabrielli, Andrea; Gadatsch, Stefan; Gadomski, Szymon; Gagliardi, Guido; Gagnon, Pauline; Galea, Cristina; Galhardo, Bruno; Gallas, Elizabeth; Gallo, Valentina Santina; Gallop, Bruce; Gallus, Petr; Galster, Gorm Aske Gram Krohn; Gan, KK; Gao, Jun; Gao, Yongsheng; Garay Walls, Francisca; Garberson, Ford; García, Carmen; García Navarro, José Enrique; Garcia-Sciveres, Maurice; Gardner, Robert; Garelli, Nicoletta; Garonne, Vincent; Gatti, Claudio; Gaudio, Gabriella; Gaur, Bakul; Gauthier, Lea; Gauzzi, Paolo; Gavrilenko, Igor; Gay, Colin; Gaycken, Goetz; Gazis, Evangelos; Ge, Peng; Gecse, Zoltan; Gee, Norman; Geerts, Daniël Alphonsus Adrianus; Geich-Gimbel, Christoph; Gellerstedt, Karl; Gemme, Claudia; Gemmell, Alistair; Genest, Marie-Hélène; Gentile, Simonetta; George, Matthias; George, Simon; Gerbaudo, Davide; Gershon, Avi; Ghazlane, Hamid; Ghodbane, Nabil; Giacobbe, Benedetto; Giagu, Stefano; Giangiobbe, Vincent; Giannetti, Paola; Gianotti, Fabiola; Gibbard, Bruce; Gibson, Stephen; Gilchriese, Murdock; Gillam, Thomas; Gillberg, Dag; Gilles, Geoffrey; Gingrich, Douglas; Giokaris, Nikos; Giordani, MarioPaolo; Giordano, Raffaele; Giorgi, Filippo Maria; Giorgi, Francesco Michelangelo; Giraud, Pierre-Francois; Giugni, Danilo; Giuliani, Claudia; Giulini, Maddalena; Gjelsten, Børge Kile; Gkaitatzis, Stamatios; Gkialas, Ioannis; Gladilin, Leonid; Glasman, Claudia; Glatzer, Julian; Glaysher, Paul; Glazov, Alexandre; Glonti, George; Goblirsch-Kolb, Maximilian; Goddard, Jack Robert; Godlewski, Jan; Goeringer, Christian; Goldfarb, Steven; Golling, Tobias; Golubkov, Dmitry; Gomes, Agostinho; Gomez Fajardo, Luz Stella; Gonçalo, Ricardo; Goncalves Pinto Firmino Da Costa, Joao; Gonella, Laura; González de la Hoz, Santiago; Gonzalez Parra, Garoe; Gonzalez-Sevilla, Sergio; Goossens, Luc; Gorbounov, Petr Andreevich; Gordon, Howard; Gorelov, Igor; Gorini, Benedetto; Gorini, Edoardo; Gorišek, Andrej; Gornicki, Edward; Goshaw, Alfred; Gössling, Claus; Gostkin, Mikhail Ivanovitch; Gouighri, Mohamed; Goujdami, Driss; Goulette, Marc Phillippe; Goussiou, Anna; Goy, Corinne; Gozpinar, Serdar; Grabas, Herve Marie Xavier; Graber, Lars; Grabowska-Bold, Iwona; Grafström, Per; Grahn, Karl-Johan; Gramling, Johanna; Gramstad, Eirik; Grancagnolo, Sergio; Grassi, Valerio; Gratchev, Vadim; Gray, Heather; Graziani, Enrico; Grebenyuk, Oleg; Greenwood, Zeno Dixon; Gregersen, Kristian; Gregor, Ingrid-Maria; Grenier, Philippe; Griffiths, Justin; Grillo, Alexander; Grimm, Kathryn; Grinstein, Sebastian; Gris, Philippe Luc Yves; Grishkevich, Yaroslav; Grivaz, Jean-Francois; Grohs, Johannes Philipp; Grohsjean, Alexander; Gross, Eilam; Grosse-Knetter, Joern; Grossi, Giulio Cornelio; Groth-Jensen, Jacob; Grout, Zara Jane; Guan, Liang; Guenther, Jaroslav; Guescini, Francesco; Guest, Daniel; Gueta, Orel; Guicheney, Christophe; Guido, Elisa; Guillemin, Thibault; Guindon, Stefan; Gul, Umar; Gumpert, Christian; Guo, Jun; Gupta, Shaun; Gutierrez, Phillip; Gutierrez Ortiz, Nicolas Gilberto; Gutschow, Christian; Guttman, Nir; Guyot, Claude; Gwenlan, Claire; Gwilliam, Carl; Haas, Andy; Haber, Carl; Hadavand, Haleh Khani; Haddad, Nacim; Haefner, Petra; Hageböck, Stephan; Hajduk, Zbigniew; Hakobyan, Hrachya; Haleem, Mahsana; Hall, David; Halladjian, Garabed; Hamacher, Klaus; Hamal, Petr; Hamano, Kenji; Hamer, Matthias; Hamilton, Andrew; Hamilton, Samuel; Hamity, Guillermo Nicolas; Hamnett, Phillip George; Han, Liang; Hanagaki, Kazunori; Hanawa, Keita; Hance, Michael; Hanke, Paul; Hanna, Remie; Hansen, Jørgen Beck; Hansen, Jorn Dines; Hansen, Peter Henrik; Hara, Kazuhiko; Hard, Andrew; Harenberg, Torsten; Hariri, Faten; Harkusha, Siarhei; Harper, Devin; Harrington, Robert; Harris, Orin; Harrison, Paul Fraser; Hartjes, Fred; Hasegawa, Makoto; Hasegawa, Satoshi; Hasegawa, Yoji; Hasib, A; Hassani, Samira; Haug, Sigve; Hauschild, Michael; Hauser, Reiner; Havranek, Miroslav; Hawkes, Christopher; Hawkings, Richard John; Hawkins, Anthony David; Hayashi, Takayasu; Hayden, Daniel; Hays, Chris; Hayward, Helen; Haywood, Stephen; Head, Simon; Heck, Tobias; Hedberg, Vincent; Heelan, Louise; Heim, Sarah; Heim, Timon; Heinemann, Beate; Heinrich, Lukas; Hejbal, Jiri; Helary, Louis; Heller, Claudio; Heller, Matthieu; Hellman, Sten; Hellmich, Dennis; Helsens, Clement; Henderson, James; Henderson, Robert; Heng, Yang; Hengler, Christopher; Henrichs, Anna; Henriques Correia, Ana Maria; Henrot-Versille, Sophie; Herbert, Geoffrey Henry; Hernández Jiménez, Yesenia; Herrberg-Schubert, Ruth; Herten, Gregor; Hertenberger, Ralf; Hervas, Luis; Hesketh, Gavin Grant; Hessey, Nigel; Hickling, Robert; Higón-Rodriguez, Emilio; Hill, Ewan; Hill, John; Hiller, Karl Heinz; Hillert, Sonja; Hillier, Stephen; Hinchliffe, Ian; Hines, Elizabeth; Hirose, Minoru; Hirschbuehl, Dominic; Hobbs, John; Hod, Noam; Hodgkinson, Mark; Hodgson, Paul; Hoecker, Andreas; Hoeferkamp, Martin; Hoenig, Friedrich; Hoffman, Julia; Hoffmann, Dirk; Hohlfeld, Marc; Holmes, Tova Ray; Hong, Tae Min; Hooft van Huysduynen, Loek; Hopkins, Walter; Horii, Yasuyuki; Hostachy, Jean-Yves; Hou, Suen; Hoummada, Abdeslam; Howard, Jacob; Howarth, James; Hrabovsky, Miroslav; Hristova, Ivana; Hrivnac, Julius; Hryn'ova, Tetiana; Hsu, Catherine; Hsu, Pai-hsien Jennifer; Hsu, Shih-Chieh; Hu, Diedi; Hu, Xueye; Huang, Yanping; Hubacek, Zdenek; Hubaut, Fabrice; Huegging, Fabian; Huffman, Todd Brian; Hughes, Emlyn; Hughes, Gareth; Huhtinen, Mika; Hülsing, Tobias Alexander; Hurwitz, Martina; Huseynov, Nazim; Huston, Joey; Huth, John; Iacobucci, Giuseppe; Iakovidis, Georgios; Ibragimov, Iskander; Iconomidou-Fayard, Lydia; Ideal, Emma; Idrissi, Zineb; Iengo, Paolo; Igonkina, Olga; Iizawa, Tomoya; Ikegami, Yoichi; Ikematsu, Katsumasa; Ikeno, Masahiro; Ilchenko, Iurii; Iliadis, Dimitrios; Ilic, Nikolina; Inamaru, Yuki; Ince, Tayfun; Ioannou, Pavlos; Iodice, Mauro; Iordanidou, Kalliopi; Ippolito, Valerio; Irles Quiles, Adrian; Isaksson, Charlie; Ishino, Masaya; Ishitsuka, Masaki; Ishmukhametov, Renat; Issever, Cigdem; Istin, Serhat; Iturbe Ponce, Julia Mariana; Iuppa, Roberto; Ivarsson, Jenny; Iwanski, Wieslaw; Iwasaki, Hiroyuki; Izen, Joseph; Izzo, Vincenzo; Jackson, Brett; Jackson, Matthew; Jackson, Paul; Jaekel, Martin; Jain, Vivek; Jakobs, Karl; Jakobsen, Sune; Jakoubek, Tomas; Jakubek, Jan; Jamin, David Olivier; Jana, Dilip; Jansen, Eric; Jansen, Hendrik; Janssen, Jens; Janus, Michel; Jarlskog, Göran; Javadov, Namig; Javůrek, Tomáš; Jeanty, Laura; Jejelava, Juansher; Jeng, Geng-yuan; Jennens, David; Jenni, Peter; Jentzsch, Jennifer; Jeske, Carl; Jézéquel, Stéphane; Ji, Haoshuang; Jia, Jiangyong; Jiang, Yi; Jimenez Belenguer, Marcos; Jin, Shan; Jinaru, Adam; Jinnouchi, Osamu; Joergensen, Morten Dam; Johansson, Erik; Johansson, Per; Johns, Kenneth; Jon-And, Kerstin; Jones, Graham; Jones, Roger; Jones, Tim; Jongmanns, Jan; Jorge, Pedro; Joshi, Kiran Daniel; Jovicevic, Jelena; Ju, Xiangyang; Jung, Christian; Jungst, Ralph Markus; Jussel, Patrick; Juste Rozas, Aurelio; Kaci, Mohammed; Kaczmarska, Anna; Kado, Marumi; Kagan, Harris; Kagan, Michael; Kajomovitz, Enrique; Kalderon, Charles William; Kama, Sami; Kamenshchikov, Andrey; Kanaya, Naoko; Kaneda, Michiru; Kaneti, Steven; Kantserov, Vadim; Kanzaki, Junichi; Kaplan, Benjamin; Kapliy, Anton; Kar, Deepak; Karakostas, Konstantinos; Karastathis, Nikolaos; Kareem, Mohammad Jawad; Karnevskiy, Mikhail; Karpov, Sergey; Karpova, Zoya; Karthik, Krishnaiyengar; Kartvelishvili, Vakhtang; Karyukhin, Andrey; Kashif, Lashkar; Kasieczka, Gregor; Kass, Richard; Kastanas, Alex; Kataoka, Yousuke; Katre, Akshay; Katzy, Judith; Kaushik, Venkatesh; Kawagoe, Kiyotomo; Kawamoto, Tatsuo; Kawamura, Gen; Kazama, Shingo; Kazanin, Vassili; Kazarinov, Makhail; Keeler, Richard; Kehoe, Robert; Keil, Markus; Keller, John; Kempster, Jacob Julian; Keoshkerian, Houry; Kepka, Oldrich; Kerševan, Borut Paul; Kersten, Susanne; Kessoku, Kohei; Keung, Justin; Khalil-zada, Farkhad; Khandanyan, Hovhannes; Khanov, Alexander; Khodinov, Alexander; Khomich, Andrei; Khoo, Teng Jian; Khoriauli, Gia; Khoroshilov, Andrey; Khovanskiy, Valery; Khramov, Evgeniy; Khubua, Jemal; Kim, Hee Yeun; Kim, Hyeon Jin; Kim, Shinhong; Kimura, Naoki; Kind, Oliver; King, Barry; King, Matthew; King, Robert Steven Beaufoy; King, Samuel Burton; Kirk, Julie; Kiryunin, Andrey; Kishimoto, Tomoe; Kisielewska, Danuta; Kiss, Florian; Kittelmann, Thomas; Kiuchi, Kenji; Kladiva, Eduard; Klein, Max; Klein, Uta; Kleinknecht, Konrad; Klimek, Pawel; Klimentov, Alexei; Klingenberg, Reiner; Klinger, Joel Alexander; Klioutchnikova, Tatiana; Klok, Peter; Kluge, Eike-Erik; Kluit, Peter; Kluth, Stefan; Kneringer, Emmerich; Knoops, Edith; Knue, Andrea; Kobayashi, Dai; Kobayashi, Tomio; Kobel, Michael; Kocian, Martin; Kodys, Peter; Koevesarki, Peter; Koffas, Thomas; Koffeman, Els; Kogan, Lucy Anne; Kohlmann, Simon; Kohout, Zdenek; Kohriki, Takashi; Koi, Tatsumi; Kolanoski, Hermann; Koletsou, Iro; Koll, James; Komar, Aston; Komori, Yuto; Kondo, Takahiko; Kondrashova, Nataliia; Köneke, Karsten; König, Adriaan; König, Sebastian; Kono, Takanori; Konoplich, Rostislav; Konstantinidis, Nikolaos; Kopeliansky, Revital; Koperny, Stefan; Köpke, Lutz; Kopp, Anna Katharina; Korcyl, Krzysztof; Kordas, Kostantinos; Korn, Andreas; Korol, Aleksandr; Korolkov, Ilya; Korolkova, Elena; Korotkov, Vladislav; Kortner, Oliver; Kortner, Sandra; Kostyukhin, Vadim; Kotov, Vladislav; Kotwal, Ashutosh; Kourkoumelis, Christine; Kouskoura, Vasiliki; Koutsman, Alex; Kowalewski, Robert Victor; Kowalski, Tadeusz; Kozanecki, Witold; Kozhin, Anatoly; Kral, Vlastimil; Kramarenko, Viktor; Kramberger, Gregor; Krasnopevtsev, Dimitriy; Krasny, Mieczyslaw Witold; Krasznahorkay, Attila; Kraus, Jana; Kravchenko, Anton; Kreiss, Sven; Kretz, Moritz; Kretzschmar, Jan; Kreutzfeldt, Kristof; Krieger, Peter; Kroeninger, Kevin; Kroha, Hubert; Kroll, Joe; Kroseberg, Juergen; Krstic, Jelena; Kruchonak, Uladzimir; Krüger, Hans; Kruker, Tobias; Krumnack, Nils; Krumshteyn, Zinovii; Kruse, Amanda; Kruse, Mark; Kruskal, Michael; Kubota, Takashi; Kucuk, Hilal; Kuday, Sinan; Kuehn, Susanne; Kugel, Andreas; Kuhl, Andrew; Kuhl, Thorsten; Kukhtin, Victor; Kulchitsky, Yuri; Kuleshov, Sergey; Kuna, Marine; Kunkle, Joshua; Kupco, Alexander; Kurashige, Hisaya; Kurochkin, Yurii; Kurumida, Rie; Kus, Vlastimil; Kuwertz, Emma Sian; Kuze, Masahiro; Kvita, Jiri; La Rosa, Alessandro; La Rotonda, Laura; Lacasta, Carlos; Lacava, Francesco; Lacey, James; Lacker, Heiko; Lacour, Didier; Lacuesta, Vicente Ramón; Ladygin, Evgueni; Lafaye, Remi; Laforge, Bertrand; Lagouri, Theodota; Lai, Stanley; Laier, Heiko; Lambourne, Luke; Lammers, Sabine; Lampen, Caleb; Lampl, Walter; Lançon, Eric; Landgraf, Ulrich; Landon, Murrough; Lang, Valerie Susanne; Lankford, Andrew; Lanni, Francesco; Lantzsch, Kerstin; Laplace, Sandrine; Lapoire, Cecile; Laporte, Jean-Francois; Lari, Tommaso; Lasagni Manghi, Federico; Lassnig, Mario; Laurelli, Paolo; Lavrijsen, Wim; Law, Alexander; Laycock, Paul; Le Dortz, Olivier; Le Guirriec, Emmanuel; Le Menedeu, Eve; LeCompte, Thomas; Ledroit-Guillon, Fabienne Agnes Marie; Lee, Claire, Alexandra; Lee, Hurng-Chun; Lee, Jason; Lee, Shih-Chang; Lee, Lawrence; Lefebvre, Guillaume; Lefebvre, Michel; Legger, Federica; Leggett, Charles; Lehan, Allan; Lehmacher, Marc; Lehmann Miotto, Giovanna; Lei, Xiaowen; Leight, William Axel; Leisos, Antonios; Leister, Andrew Gerard; Leite, Marco Aurelio Lisboa; Leitner, Rupert; Lellouch, Daniel; Lemmer, Boris; Leney, Katharine; Lenz, Tatjana; Lenzen, Georg; Lenzi, Bruno; Leone, Robert; Leone, Sandra; Leonidopoulos, Christos; Leontsinis, Stefanos; Leroy, Claude; Lester, Christopher; Lester, Christopher Michael; Levchenko, Mikhail; Levêque, Jessica; Levin, Daniel; Levinson, Lorne; Levy, Mark; Lewis, Adrian; Lewis, George; Leyko, Agnieszka; Leyton, Michael; Li, Bing; Li, Bo; Li, Haifeng; Li, Ho Ling; Li, Lei; Li, Liang; Li, Shu; Li, Yichen; Liang, Zhijun; Liao, Hongbo; Liberti, Barbara; Lichard, Peter; Lie, Ki; Liebal, Jessica; Liebig, Wolfgang; Limbach, Christian; Limosani, Antonio; Lin, Simon; Lin, Tai-Hua; Linde, Frank; Lindquist, Brian Edward; Linnemann, James; Lipeles, Elliot; Lipniacka, Anna; Lisovyi, Mykhailo; Liss, Tony; Lissauer, David; Lister, Alison; Litke, Alan; Liu, Bo; Liu, Dong; Liu, Jianbei; Liu, Kun; Liu, Lulu; Liu, Miaoyuan; Liu, Minghui; Liu, Yanwen; Livan, Michele; Livermore, Sarah; Lleres, Annick; Llorente Merino, Javier; Lloyd, Stephen; Lo Sterzo, Francesco; Lobodzinska, Ewelina; Loch, Peter; Lockman, William; Loebinger, Fred; Loevschall-Jensen, Ask Emil; Loginov, Andrey; Lohse, Thomas; Lohwasser, Kristin; Lokajicek, Milos; Lombardo, Vincenzo Paolo; Long, Brian Alexander; Long, Jonathan; Long, Robin Eamonn; Lopes, Lourenco; Lopez Mateos, David; Lopez Paredes, Brais; Lopez Paz, Ivan; Lorenz, Jeanette; Lorenzo Martinez, Narei; Losada, Marta; Loscutoff, Peter; Lou, XinChou; Lounis, Abdenour; Love, Jeremy; Love, Peter; Lowe, Andrew; Lu, Feng; Lu, Nan; Lubatti, Henry; Luci, Claudio; Lucotte, Arnaud; Luehring, Frederick; Lukas, Wolfgang; Luminari, Lamberto; Lundberg, Olof; Lund-Jensen, Bengt; Lungwitz, Matthias; Lynn, David; Lysak, Roman; Lytken, Else; Ma, Hong; Ma, Lian Liang; Maccarrone, Giovanni; Macchiolo, Anna; Machado Miguens, Joana; Macina, Daniela; Madaffari, Daniele; Madar, Romain; Maddocks, Harvey Jonathan; Mader, Wolfgang; Madsen, Alexander; Maeno, Mayuko; Maeno, Tadashi; Maevskiy, Artem; Magradze, Erekle; Mahboubi, Kambiz; Mahlstedt, Joern; Mahmoud, Sara; Maiani, Camilla; Maidantchik, Carmen; Maier, Andreas Alexander; Maio, Amélia; Majewski, Stephanie; Makida, Yasuhiro; Makovec, Nikola; Mal, Prolay; Malaescu, Bogdan; Malecki, Pawel; Maleev, Victor; Malek, Fairouz; Mallik, Usha; Malon, David; Malone, Caitlin; Maltezos, Stavros; Malyshev, Vladimir; Malyukov, Sergei; Mamuzic, Judita; Mandelli, Beatrice; Mandelli, Luciano; Mandić, Igor; Mandrysch, Rocco; Maneira, José; Manfredini, Alessandro; Manhaes de Andrade Filho, Luciano; Manjarres Ramos, Joany Andreina; Mann, Alexander; Manning, Peter; Manousakis-Katsikakis, Arkadios; Mansoulie, Bruno; Mantifel, Rodger; Mapelli, Livio; March, Luis; Marchand, Jean-Francois; Marchiori, Giovanni; Marcisovsky, Michal; Marino, Christopher; Marjanovic, Marija; Marques, Carlos; Marroquim, Fernando; Marsden, Stephen Philip; Marshall, Zach; Marti, Lukas Fritz; Marti-Garcia, Salvador; Martin, Brian; Martin, Brian; Martin, Tim; Martin, Victoria Jane; Martin dit Latour, Bertrand; Martinez, Homero; Martinez, Mario; Martin-Haugh, Stewart; Martyniuk, Alex; Marx, Marilyn; Marzano, Francesco; Marzin, Antoine; Masetti, Lucia; Mashimo, Tetsuro; Mashinistov, Ruslan; Masik, Jiri; Maslennikov, Alexey; Massa, Ignazio; Massa, Lorenzo; Massol, Nicolas; Mastrandrea, Paolo; Mastroberardino, Anna; Masubuchi, Tatsuya; Mättig, Peter; Mattmann, Johannes; Maurer, Julien; Maxfield, Stephen; Maximov, Dmitriy; Mazini, Rachid; Mazzaferro, Luca; Mc Goldrick, Garrin; Mc Kee, Shawn Patrick; McCarn, Allison; McCarthy, Robert; McCarthy, Tom; McCubbin, Norman; McFarlane, Kenneth; Mcfayden, Josh; Mchedlidze, Gvantsa; McMahon, Steve; McPherson, Robert; Mechnich, Joerg; Medinnis, Michael; Meehan, Samuel; Mehlhase, Sascha; Mehta, Andrew; Meier, Karlheinz; Meineck, Christian; Meirose, Bernhard; Melachrinos, Constantinos; Mellado Garcia, Bruce Rafael; Meloni, Federico; Mengarelli, Alberto; Menke, Sven; Meoni, Evelin; Mercurio, Kevin Michael; Mergelmeyer, Sebastian; Meric, Nicolas; Mermod, Philippe; Merola, Leonardo; Meroni, Chiara; Merritt, Frank; Merritt, Hayes; Messina, Andrea; Metcalfe, Jessica; Mete, Alaettin Serhan; Meyer, Carsten; Meyer, Christopher; Meyer, Jean-Pierre; Meyer, Jochen; Middleton, Robin; Migas, Sylwia; Mijović, Liza; Mikenberg, Giora; Mikestikova, Marcela; Mikuž, Marko; Milic, Adriana; Miller, David; Mills, Corrinne; Milov, Alexander; Milstead, David; Milstein, Dmitry; Minaenko, Andrey; Minami, Yuto; Minashvili, Irakli; Mincer, Allen; Mindur, Bartosz; Mineev, Mikhail; Ming, Yao; Mir, Lluisa-Maria; Mirabelli, Giovanni; Mitani, Takashi; Mitrevski, Jovan; Mitsou, Vasiliki A; Mitsui, Shingo; Miucci, Antonio; Miyagawa, Paul; Mjörnmark, Jan-Ulf; Moa, Torbjoern; Mochizuki, Kazuya; Mohapatra, Soumya; Mohr, Wolfgang; Molander, Simon; Moles-Valls, Regina; Mönig, Klaus; Monini, Caterina; Monk, James; Monnier, Emmanuel; Montejo Berlingen, Javier; Monticelli, Fernando; Monzani, Simone; Moore, Roger; Morange, Nicolas; Moreno, Deywis; Moreno Llácer, María; Morettini, Paolo; Morgenstern, Marcus; Morii, Masahiro; Moritz, Sebastian; Morley, Anthony Keith; Mornacchi, Giuseppe; Morris, John; Morvaj, Ljiljana; Moser, Hans-Guenther; Mosidze, Maia; Moss, Josh; Motohashi, Kazuki; Mount, Richard; Mountricha, Eleni; Mouraviev, Sergei; Moyse, Edward; Muanza, Steve; Mudd, Richard; Mueller, Felix; Mueller, James; Mueller, Klemens; Mueller, Thibaut; Mueller, Timo; Muenstermann, Daniel; Munwes, Yonathan; Murillo Quijada, Javier Alberto; Murray, Bill; Musheghyan, Haykuhi; Musto, Elisa; Myagkov, Alexey; Myska, Miroslav; Nackenhorst, Olaf; Nadal, Jordi; Nagai, Koichi; Nagai, Ryo; Nagai, Yoshikazu; Nagano, Kunihiro; Nagarkar, Advait; Nagasaka, Yasushi; Nagel, Martin; Nairz, Armin Michael; Nakahama, Yu; Nakamura, Koji; Nakamura, Tomoaki; Nakano, Itsuo; Namasivayam, Harisankar; Nanava, Gizo; Narayan, Rohin; Nattermann, Till; Naumann, Thomas; Navarro, Gabriela; Nayyar, Ruchika; Neal, Homer; Nechaeva, Polina; Neep, Thomas James; Nef, Pascal Daniel; Negri, Andrea; Negri, Guido; Negrini, Matteo; Nektarijevic, Snezana; Nellist, Clara; Nelson, Andrew; Nelson, Timothy Knight; Nemecek, Stanislav; Nemethy, Peter; Nepomuceno, Andre Asevedo; Nessi, Marzio; Neubauer, Mark; Neumann, Manuel; Neves, Ricardo; Nevski, Pavel; Newman, Paul; Nguyen, Duong Hai; Nickerson, Richard; Nicolaidou, Rosy; Nicquevert, Bertrand; Nielsen, Jason; Nikiforou, Nikiforos; Nikiforov, Andriy; Nikolaenko, Vladimir; Nikolic-Audit, Irena; Nikolics, Katalin; Nikolopoulos, Konstantinos; Nilsson, Paul; Ninomiya, Yoichi; Nisati, Aleandro; Nisius, Richard; Nobe, Takuya; Nodulman, Lawrence; Nomachi, Masaharu; Nomidis, Ioannis; Norberg, Scarlet; Nordberg, Markus; Novgorodova, Olga; Nowak, Sebastian; Nozaki, Mitsuaki; Nozka, Libor; Ntekas, Konstantinos; Nunes Hanninger, Guilherme; Nunnemann, Thomas; Nurse, Emily; Nuti, Francesco; O'Brien, Brendan Joseph; O'grady, Fionnbarr; O'Neil, Dugan; O'Shea, Val; Oakham, Gerald; Oberlack, Horst; Obermann, Theresa; Ocariz, Jose; Ochi, Atsuhiko; Ochoa, Ines; Oda, Susumu; Odaka, Shigeru; Ogren, Harold; Oh, Alexander; Oh, Seog; Ohm, Christian; Ohman, Henrik; Okamura, Wataru; Okawa, Hideki; Okumura, Yasuyuki; Okuyama, Toyonobu; Olariu, Albert; Olchevski, Alexander; Olivares Pino, Sebastian Andres; Oliveira Damazio, Denis; Oliver Garcia, Elena; Olszewski, Andrzej; Olszowska, Jolanta; Onofre, António; Onyisi, Peter; Oram, Christopher; Oreglia, Mark; Oren, Yona; Orestano, Domizia; Orlando, Nicola; Oropeza Barrera, Cristina; Orr, Robert; Osculati, Bianca; Ospanov, Rustem; Otero y Garzon, Gustavo; Otono, Hidetoshi; Ouchrif, Mohamed; Ouellette, Eric; Ould-Saada, Farid; Ouraou, Ahmimed; Oussoren, Koen Pieter; Ouyang, Qun; Ovcharova, Ana; Owen, Mark; Ozcan, Veysi Erkcan; Ozturk, Nurcan; Pachal, Katherine; Pacheco Pages, Andres; Padilla Aranda, Cristobal; Pagáčová, Martina; Pagan Griso, Simone; Paganis, Efstathios; Pahl, Christoph; Paige, Frank; Pais, Preema; Pajchel, Katarina; Palacino, Gabriel; Palestini, Sandro; Palka, Marek; Pallin, Dominique; Palma, Alberto; Palmer, Jody; Pan, Yibin; Panagiotopoulou, Evgenia; Panduro Vazquez, William; Pani, Priscilla; Panikashvili, Natalia; Panitkin, Sergey; Pantea, Dan; Paolozzi, Lorenzo; Papadopoulou, Theodora; Papageorgiou, Konstantinos; Paramonov, Alexander; Paredes Hernandez, Daniela; Parker, Michael Andrew; Parodi, Fabrizio; Parsons, John; Parzefall, Ulrich; Pasqualucci, Enrico; Passaggio, Stefano; Passeri, Antonio; Pastore, Fernanda; Pastore, Francesca; Pásztor, Gabriella; Pataraia, Sophio; Patel, Nikhul; Pater, Joleen; Patricelli, Sergio; Pauly, Thilo; Pearce, James; Pedersen, Lars Egholm; Pedersen, Maiken; Pedraza Lopez, Sebastian; Pedro, Rute; Peleganchuk, Sergey; Pelikan, Daniel; Peng, Haiping; Penning, Bjoern; Penwell, John; Perepelitsa, Dennis; Perez Codina, Estel; Pérez García-Estañ, María Teresa; Perez Reale, Valeria; Perini, Laura; Pernegger, Heinz; Perrella, Sabrina; Perrino, Roberto; Peschke, Richard; Peshekhonov, Vladimir; Peters, Krisztian; Peters, Yvonne; Petersen, Brian; Petersen, Troels; Petit, Elisabeth; Petridis, Andreas; Petridou, Chariclia; Petrolo, Emilio; Petrucci, Fabrizio; Pettersson, Nora Emilia; Pezoa, Raquel; Phillips, Peter William; Piacquadio, Giacinto; Pianori, Elisabetta; Picazio, Attilio; Piccaro, Elisa; Piccinini, Maurizio; Piegaia, Ricardo; Pignotti, David; Pilcher, James; Pilkington, Andrew; Pina, João Antonio; Pinamonti, Michele; Pinder, Alex; Pinfold, James; Pingel, Almut; Pinto, Belmiro; Pires, Sylvestre; Pitt, Michael; Pizio, Caterina; Plazak, Lukas; Pleier, Marc-Andre; Pleskot, Vojtech; Plotnikova, Elena; Plucinski, Pawel; Poddar, Sahill; Podlyski, Fabrice; Poettgen, Ruth; Poggioli, Luc; Pohl, David-leon; Pohl, Martin; Polesello, Giacomo; Policicchio, Antonio; Polifka, Richard; Polini, Alessandro; Pollard, Christopher Samuel; Polychronakos, Venetios; Pommès, Kathy; Pontecorvo, Ludovico; Pope, Bernard; Popeneciu, Gabriel Alexandru; Popovic, Dragan; Poppleton, Alan; Portell Bueso, Xavier; Pospisil, Stanislav; Potamianos, Karolos; Potrap, Igor; Potter, Christina; Potter, Christopher; Poulard, Gilbert; Poveda, Joaquin; Pozdnyakov, Valery; Pralavorio, Pascal; Pranko, Aliaksandr; Prasad, Srivas; Pravahan, Rishiraj; Prell, Soeren; Price, Darren; Price, Joe; Price, Lawrence; Prieur, Damien; Primavera, Margherita; Proissl, Manuel; Prokofiev, Kirill; Prokoshin, Fedor; Protopapadaki, Eftychia-sofia; Protopopescu, Serban; Proudfoot, James; Przybycien, Mariusz; Przysiezniak, Helenka; Ptacek, Elizabeth; Puddu, Daniele; Pueschel, Elisa; Puldon, David; Purohit, Milind; Puzo, Patrick; Qian, Jianming; Qin, Gang; Qin, Yang; Quadt, Arnulf; Quarrie, David; Quayle, William; Queitsch-Maitland, Michaela; Quilty, Donnchadha; Qureshi, Anum; Radeka, Veljko; Radescu, Voica; Radhakrishnan, Sooraj Krishnan; Radloff, Peter; Rados, Pere; Ragusa, Francesco; Rahal, Ghita; Rajagopalan, Srinivasan; Rammensee, Michael; Randle-Conde, Aidan Sean; Rangel-Smith, Camila; Rao, Kanury; Rauscher, Felix; Rave, Tobias Christian; Ravenscroft, Thomas; Raymond, Michel; Read, Alexander Lincoln; Readioff, Nathan Peter; Rebuzzi, Daniela; Redelbach, Andreas; Redlinger, George; Reece, Ryan; Reeves, Kendall; Rehnisch, Laura; Reisin, Hernan; Relich, Matthew; Rembser, Christoph; Ren, Huan; Ren, Zhongliang; Renaud, Adrien; Rescigno, Marco; Resconi, Silvia; Rezanova, Olga; Reznicek, Pavel; Rezvani, Reyhaneh; Richter, Robert; Ridel, Melissa; Rieck, Patrick; Rieger, Julia; Rijssenbeek, Michael; Rimoldi, Adele; Rinaldi, Lorenzo; Ritsch, Elmar; Riu, Imma; Rizatdinova, Flera; Rizvi, Eram; Robertson, Steven; Robichaud-Veronneau, Andree; Robinson, Dave; Robinson, James; Robson, Aidan; Roda, Chiara; Rodrigues, Luis; Roe, Shaun; Røhne, Ole; Rolli, Simona; Romaniouk, Anatoli; Romano, Marino; Romero Adam, Elena; Rompotis, Nikolaos; Ronzani, Manfredi; Roos, Lydia; Ros, Eduardo; Rosati, Stefano; Rosbach, Kilian; Rose, Matthew; Rose, Peyton; Rosendahl, Peter Lundgaard; Rosenthal, Oliver; Rossetti, Valerio; Rossi, Elvira; Rossi, Leonardo Paolo; Rosten, Rachel; Rotaru, Marina; Roth, Itamar; Rothberg, Joseph; Rousseau, David; Royon, Christophe; Rozanov, Alexandre; Rozen, Yoram; Ruan, Xifeng; Rubbo, Francesco; Rubinskiy, Igor; Rud, Viacheslav; Rudolph, Christian; Rudolph, Matthew Scott; Rühr, Frederik; Ruiz-Martinez, Aranzazu; Rurikova, Zuzana; Rusakovich, Nikolai; Ruschke, Alexander; Rutherfoord, John; Ruthmann, Nils; Ryabov, Yury; Rybar, Martin; Rybkin, Grigori; Ryder, Nick; Saavedra, Aldo; Sacerdoti, Sabrina; Saddique, Asif; Sadeh, Iftach; Sadrozinski, Hartmut; Sadykov, Renat; Safai Tehrani, Francesco; Sakamoto, Hiroshi; Sakurai, Yuki; Salamanna, Giuseppe; Salamon, Andrea; Saleem, Muhammad; Salek, David; Sales De Bruin, Pedro Henrique; Salihagic, Denis; Salnikov, Andrei; Salt, José; Salvatore, Daniela; Salvatore, Pasquale Fabrizio; Salvucci, Antonio; Salzburger, Andreas; Sampsonidis, Dimitrios; Sanchez, Arturo; Sánchez, Javier; Sanchez Martinez, Victoria; Sandaker, Heidi; Sandbach, Ruth Laura; Sander, Heinz Georg; Sanders, Michiel; Sandhoff, Marisa; Sandoval, Tanya; Sandoval, Carlos; Sandstroem, Rikard; Sankey, Dave; Sansoni, Andrea; Santoni, Claudio; Santonico, Rinaldo; Santos, Helena; Santoyo Castillo, Itzebelt; Sapp, Kevin; Sapronov, Andrey; Saraiva, João; Sarrazin, Bjorn; Sartisohn, Georg; Sasaki, Osamu; Sasaki, Yuichi; Sauvage, Gilles; Sauvan, Emmanuel; Savard, Pierre; Savu, Dan Octavian; Sawyer, Craig; Sawyer, Lee; Saxon, David; Saxon, James; Sbarra, Carla; Sbrizzi, Antonio; Scanlon, Tim; Scannicchio, Diana; Scarcella, Mark; Scarfone, Valerio; Schaarschmidt, Jana; Schacht, Peter; Schaefer, Douglas; Schaefer, Ralph; Schaepe, Steffen; Schaetzel, Sebastian; Schäfer, Uli; Schaffer, Arthur; Schaile, Dorothee; Schamberger, R~Dean; Scharf, Veit; Schegelsky, Valery; Scheirich, Daniel; Schernau, Michael; Scherzer, Max; Schiavi, Carlo; Schieck, Jochen; Schillo, Christian; Schioppa, Marco; Schlenker, Stefan; Schmidt, Evelyn; Schmieden, Kristof; Schmitt, Christian; Schmitt, Sebastian; Schneider, Basil; Schnellbach, Yan Jie; Schnoor, Ulrike; Schoeffel, Laurent; Schoening, Andre; Schoenrock, Bradley Daniel; Schorlemmer, Andre Lukas; Schott, Matthias; Schouten, Doug; Schovancova, Jaroslava; Schramm, Steven; Schreyer, Manuel; Schroeder, Christian; Schuh, Natascha; Schultens, Martin Johannes; Schultz-Coulon, Hans-Christian; Schulz, Holger; Schumacher, Markus; Schumm, Bruce; Schune, Philippe; Schwanenberger, Christian; Schwartzman, Ariel; Schwarz, Thomas Andrew; Schwegler, Philipp; Schwemling, Philippe; Schwienhorst, Reinhard; Schwindling, Jerome; Schwindt, Thomas; Schwoerer, Maud; Sciacca, Gianfranco; Scifo, Estelle; Sciolla, Gabriella; Scott, Bill; Scuri, Fabrizio; Scutti, Federico; Searcy, Jacob; Sedov, George; Sedykh, Evgeny; Seidel, Sally; Seiden, Abraham; Seifert, Frank; Seixas, José; Sekhniaidze, Givi; Sekula, Stephen; Selbach, Karoline Elfriede; Seliverstov, Dmitry; Sellers, Graham; Semprini-Cesari, Nicola; Serfon, Cedric; Serin, Laurent; Serkin, Leonid; Serre, Thomas; Seuster, Rolf; Severini, Horst; Sfiligoj, Tina; Sforza, Federico; Sfyrla, Anna; Shabalina, Elizaveta; Shamim, Mansoora; Shan, Lianyou; Shang, Ruo-yu; Shank, James; Shapiro, Marjorie; Shatalov, Pavel; Shaw, Kate; Shehu, Ciwake Yusufu; Sherwood, Peter; Shi, Liaoshan; Shimizu, Shima; Shimmin, Chase Owen; Shimojima, Makoto; Shiyakova, Mariya; Shmeleva, Alevtina; Shochet, Mel; Short, Daniel; Shrestha, Suyog; Shulga, Evgeny; Shupe, Michael; Shushkevich, Stanislav; Sicho, Petr; Sidiropoulou, Ourania; Sidorov, Dmitri; Sidoti, Antonio; Siegert, Frank; Sijacki, Djordje; Silva, José; Silver, Yiftah; Silverstein, Daniel; Silverstein, Samuel; Simak, Vladislav; Simard, Olivier; Simic, Ljiljana; Simion, Stefan; Simioni, Eduard; Simmons, Brinick; Simoniello, Rosa; Simonyan, Margar; Sinervo, Pekka; Sinev, Nikolai; Sipica, Valentin; Siragusa, Giovanni; Sircar, Anirvan; Sisakyan, Alexei; Sivoklokov, Serguei; Sjölin, Jörgen; Sjursen, Therese; Skottowe, Hugh Philip; Skovpen, Kirill; Skubic, Patrick; Slater, Mark; Slavicek, Tomas; Sliwa, Krzysztof; Smakhtin, Vladimir; Smart, Ben; Smestad, Lillian; Smirnov, Sergei; Smirnov, Yury; Smirnova, Lidia; Smirnova, Oxana; Smith, Kenway; Smizanska, Maria; Smolek, Karel; Snesarev, Andrei; Snidero, Giacomo; Snyder, Scott; Sobie, Randall; Socher, Felix; Soffer, Abner; Soh, Dart-yin; Solans, Carlos; Solar, Michael; Solc, Jaroslav; Soldatov, Evgeny; Soldevila, Urmila; Solodkov, Alexander; Soloshenko, Alexei; Solovyanov, Oleg; Solovyev, Victor; Sommer, Philip; Song, Hong Ye; Soni, Nitesh; Sood, Alexander; Sopczak, Andre; Sopko, Bruno; Sopko, Vit; Sorin, Veronica; Sosebee, Mark; Soualah, Rachik; Soueid, Paul; Soukharev, Andrey; South, David; Spagnolo, Stefania; Spanò, Francesco; Spearman, William Robert; Spettel, Fabian; Spighi, Roberto; Spigo, Giancarlo; Spiller, Laurence Anthony; Spousta, Martin; Spreitzer, Teresa; Spurlock, Barry; St Denis, Richard Dante; Staerz, Steffen; Stahlman, Jonathan; Stamen, Rainer; Stamm, Soren; Stanecka, Ewa; Stanek, Robert; Stanescu, Cristian; Stanescu-Bellu, Madalina; Stanitzki, Marcel Michael; Stapnes, Steinar; Starchenko, Evgeny; Stark, Jan; Staroba, Pavel; Starovoitov, Pavel; Staszewski, Rafal; Stavina, Pavel; Steinberg, Peter; Stelzer, Bernd; Stelzer, Harald Joerg; Stelzer-Chilton, Oliver; Stenzel, Hasko; Stern, Sebastian; Stewart, Graeme; Stillings, Jan Andre; Stockton, Mark; Stoebe, Michael; Stoicea, Gabriel; Stolte, Philipp; Stonjek, Stefan; Stradling, Alden; Straessner, Arno; Stramaglia, Maria Elena; Strandberg, Jonas; Strandberg, Sara; Strandlie, Are; Strauss, Emanuel; Strauss, Michael; Strizenec, Pavol; Ströhmer, Raimund; Strom, David; Stroynowski, Ryszard; Strubig, Antonia; Stucci, Stefania Antonia; Stugu, Bjarne; Styles, Nicholas Adam; Su, Dong; Su, Jun; Subramaniam, Rajivalochan; Succurro, Antonella; Sugaya, Yorihito; Suhr, Chad; Suk, Michal; Sulin, Vladimir; Sultansoy, Saleh; Sumida, Toshi; Sun, Siyuan; Sun, Xiaohu; Sundermann, Jan Erik; Suruliz, Kerim; Susinno, Giancarlo; Sutton, Mark; Suzuki, Yu; Svatos, Michal; Swedish, Stephen; Swiatlowski, Maximilian; Sykora, Ivan; Sykora, Tomas; Ta, Duc; Taccini, Cecilia; Tackmann, Kerstin; Taenzer, Joe; Taffard, Anyes; Tafirout, Reda; Taiblum, Nimrod; Takai, Helio; Takashima, Ryuichi; Takeda, Hiroshi; Takeshita, Tohru; Takubo, Yosuke; Talby, Mossadek; Talyshev, Alexey; Tam, Jason; Tan, Kong Guan; Tanaka, Junichi; Tanaka, Reisaburo; Tanaka, Satoshi; Tanaka, Shuji; Tanasijczuk, Andres Jorge; Tannenwald, Benjamin Bordy; Tannoury, Nancy; Tapprogge, Stefan; Tarem, Shlomit; Tarrade, Fabien; Tartarelli, Giuseppe Francesco; Tas, Petr; Tasevsky, Marek; Tashiro, Takuya; Tassi, Enrico; Tavares Delgado, Ademar; Tayalati, Yahya; Taylor, Frank; Taylor, Geoffrey; Taylor, Wendy; Teischinger, Florian Alfred; Teixeira Dias Castanheira, Matilde; Teixeira-Dias, Pedro; Temming, Kim Katrin; Ten Kate, Herman; Teng, Ping-Kun; Teoh, Jia Jian; Terada, Susumu; Terashi, Koji; Terron, Juan; Terzo, Stefano; Testa, Marianna; Teuscher, Richard; Therhaag, Jan; Theveneaux-Pelzer, Timothée; Thomas, Juergen; Thomas-Wilsker, Joshuha; Thompson, Emily; Thompson, Paul; Thompson, Peter; Thompson, Ray; Thompson, Stan; Thomsen, Lotte Ansgaard; Thomson, Evelyn; Thomson, Mark; Thong, Wai Meng; Thun, Rudolf; Tian, Feng; Tibbetts, Mark James; Tikhomirov, Vladimir; Tikhonov, Yury; Timoshenko, Sergey; Tiouchichine, Elodie; Tipton, Paul; Tisserant, Sylvain; Todorov, Theodore; Todorova-Nova, Sharka; Toggerson, Brokk; Tojo, Junji; Tokár, Stanislav; Tokushuku, Katsuo; Tollefson, Kirsten; Tolley, Emma; Tomlinson, Lee; Tomoto, Makoto; Tompkins, Lauren; Toms, Konstantin; Topilin, Nikolai; Torrence, Eric; Torres, Heberth; Torró Pastor, Emma; Toth, Jozsef; Touchard, Francois; Tovey, Daniel; Tran, Huong Lan; Trefzger, Thomas; Tremblet, Louis; Tricoli, Alessandro; Trigger, Isabel Marian; Trincaz-Duvoid, Sophie; Tripiana, Martin; Trischuk, William; Trocmé, Benjamin; Troncon, Clara; Trottier-McDonald, Michel; Trovatelli, Monica; True, Patrick; Trzebinski, Maciej; Trzupek, Adam; Tsarouchas, Charilaos; Tseng, Jeffrey; Tsiareshka, Pavel; Tsionou, Dimitra; Tsipolitis, Georgios; Tsirintanis, Nikolaos; Tsiskaridze, Shota; Tsiskaridze, Vakhtang; Tskhadadze, Edisher; Tsukerman, Ilya; Tsulaia, Vakhtang; Tsuno, Soshi; Tsybychev, Dmitri; Tudorache, Alexandra; Tudorache, Valentina; Tuna, Alexander Naip; Tupputi, Salvatore; Turchikhin, Semen; Turecek, Daniel; Turk Cakir, Ilkay; Turra, Ruggero; Tuts, Michael; Tykhonov, Andrii; Tylmad, Maja; Tyndel, Mike; Uchida, Kirika; Ueda, Ikuo; Ueno, Ryuichi; Ughetto, Michael; Ugland, Maren; Uhlenbrock, Mathias; Ukegawa, Fumihiko; Unal, Guillaume; Undrus, Alexander; Unel, Gokhan; Ungaro, Francesca; Unno, Yoshinobu; Unverdorben, Christopher; Urbaniec, Dustin; Urquijo, Phillip; Usai, Giulio; Usanova, Anna; Vacavant, Laurent; Vacek, Vaclav; Vachon, Brigitte; Valencic, Nika; Valentinetti, Sara; Valero, Alberto; Valery, Loic; Valkar, Stefan; Valladolid Gallego, Eva; Vallecorsa, Sofia; Valls Ferrer, Juan Antonio; Van Den Wollenberg, Wouter; Van Der Deijl, Pieter; van der Geer, Rogier; van der Graaf, Harry; Van Der Leeuw, Robin; van der Ster, Daniel; van Eldik, Niels; van Gemmeren, Peter; Van Nieuwkoop, Jacobus; van Vulpen, Ivo; van Woerden, Marius Cornelis; Vanadia, Marco; Vandelli, Wainer; Vanguri, Rami; Vaniachine, Alexandre; Vankov, Peter; Vannucci, Francois; Vardanyan, Gagik; Vari, Riccardo; Varnes, Erich; Varol, Tulin; Varouchas, Dimitris; Vartapetian, Armen; Varvell, Kevin; Vazeille, Francois; Vazquez Schroeder, Tamara; Veatch, Jason; Veloso, Filipe; Velz, Thomas; Veneziano, Stefano; Ventura, Andrea; Ventura, Daniel; Venturi, Manuela; Venturi, Nicola; Venturini, Alessio; Vercesi, Valerio; Verducci, Monica; Verkerke, Wouter; Vermeulen, Jos; Vest, Anja; Vetterli, Michel; Viazlo, Oleksandr; Vichou, Irene; Vickey, Trevor; Vickey Boeriu, Oana Elena; Viehhauser, Georg; Viel, Simon; Vigne, Ralph; Villa, Mauro; Villaplana Perez, Miguel; Vilucchi, Elisabetta; Vincter, Manuella; Vinogradov, Vladimir; Virzi, Joseph; Vivarelli, Iacopo; Vives Vaque, Francesc; Vlachos, Sotirios; Vladoiu, Dan; Vlasak, Michal; Vogel, Adrian; Vogel, Marcelo; Vokac, Petr; Volpi, Guido; Volpi, Matteo; von der Schmitt, Hans; von Radziewski, Holger; von Toerne, Eckhard; Vorobel, Vit; Vorobev, Konstantin; Vos, Marcel; Voss, Rudiger; Vossebeld, Joost; Vranjes, Nenad; Vranjes Milosavljevic, Marija; Vrba, Vaclav; Vreeswijk, Marcel; Vu Anh, Tuan; Vuillermet, Raphael; Vukotic, Ilija; Vykydal, Zdenek; Wagner, Peter; Wagner, Wolfgang; Wahlberg, Hernan; Wahrmund, Sebastian; Wakabayashi, Jun; Walder, James; Walker, Rodney; Walkowiak, Wolfgang; Wall, Richard; Waller, Peter; Walsh, Brian; Wang, Chao; Wang, Chiho; Wang, Fuquan; Wang, Haichen; Wang, Hulin; Wang, Jike; Wang, Jin; Wang, Kuhan; Wang, Rui; Wang, Song-Ming; Wang, Tan; Wang, Xiaoxiao; Wanotayaroj, Chaowaroj; Warburton, Andreas; Ward, Patricia; Wardrope, David Robert; Warsinsky, Markus; Washbrook, Andrew; Wasicki, Christoph; Watkins, Peter; Watson, Alan; Watson, Ian; Watson, Miriam; Watts, Gordon; Watts, Stephen; Waugh, Ben; Webb, Samuel; Weber, Michele; Weber, Stefan Wolf; Webster, Jordan S; Weidberg, Anthony; Weigell, Philipp; Weinert, Benjamin; Weingarten, Jens; Weiser, Christian; Weits, Hartger; Wells, Phillippa; Wenaus, Torre; Wendland, Dennis; Weng, Zhili; Wengler, Thorsten; Wenig, Siegfried; Wermes, Norbert; Werner, Matthias; Werner, Per; Wessels, Martin; Wetter, Jeffrey; Whalen, Kathleen; White, Andrew; White, Martin; White, Ryan; White, Sebastian; Whiteson, Daniel; Wicke, Daniel; Wickens, Fred; Wiedenmann, Werner; Wielers, Monika; Wienemann, Peter; Wiglesworth, Craig; Wiik-Fuchs, Liv Antje Mari; Wijeratne, Peter Alexander; Wildauer, Andreas; Wildt, Martin Andre; Wilkens, Henric George; Will, Jonas Zacharias; Williams, Hugh; Williams, Sarah; Willis, Christopher; Willocq, Stephane; Wilson, Alan; Wilson, John; Wingerter-Seez, Isabelle; Winklmeier, Frank; Winter, Benedict Tobias; Wittgen, Matthias; Wittig, Tobias; Wittkowski, Josephine; Wollstadt, Simon Jakob; Wolter, Marcin Wladyslaw; Wolters, Helmut; Wosiek, Barbara; Wotschack, Jorg; Woudstra, Martin; Wozniak, Krzysztof; Wright, Michael; Wu, Mengqing; Wu, Sau Lan; Wu, Xin; Wu, Yusheng; Wulf, Evan; Wyatt, Terry Richard; Wynne, Benjamin; Xella, Stefania; Xiao, Meng; Xu, Da; Xu, Lailin; Yabsley, Bruce; Yacoob, Sahal; Yakabe, Ryota; Yamada, Miho; Yamaguchi, Hiroshi; Yamaguchi, Yohei; Yamamoto, Akira; Yamamoto, Kyoko; Yamamoto, Shimpei; Yamamura, Taiki; Yamanaka, Takashi; Yamauchi, Katsuya; Yamazaki, Yuji; Yan, Zhen; Yang, Haijun; Yang, Hongtao; Yang, Un-Ki; Yang, Yi; Yanush, Serguei; Yao, Liwen; Yao, Weiming; Yasu, Yoshiji; Yatsenko, Elena; Yau Wong, Kaven Henry; Ye, Jingbo; Ye, Shuwei; Yeletskikh, Ivan; Yen, Andy L; Yildirim, Eda; Yilmaz, Metin; Yoosoofmiya, Reza; Yorita, Kohei; Yoshida, Rikutaro; Yoshihara, Keisuke; Young, Charles; Young, Christopher John; Youssef, Saul; Yu, David Ren-Hwa; Yu, Jaehoon; Yu, Jiaming; Yu, Jie; Yuan, Li; Yurkewicz, Adam; Yusuff, Imran; Zabinski, Bartlomiej; Zaidan, Remi; Zaitsev, Alexander; Zaman, Aungshuman; Zambito, Stefano; Zanello, Lucia; Zanzi, Daniele; Zeitnitz, Christian; Zeman, Martin; Zemla, Andrzej; Zengel, Keith; Zenin, Oleg; Ženiš, Tibor; Zerwas, Dirk; Zevi della Porta, Giovanni; Zhang, Dongliang; Zhang, Fangzhou; Zhang, Huaqiao; Zhang, Jinlong; Zhang, Lei; Zhang, Xueyao; Zhang, Zhiqing; Zhao, Zhengguo; Zhemchugov, Alexey; Zhong, Jiahang; Zhou, Bing; Zhou, Lei; Zhou, Ning; Zhu, Cheng Guang; Zhu, Hongbo; Zhu, Junjie; Zhu, Yingchun; Zhuang, Xuai; Zhukov, Konstantin; Zibell, Andre; Zieminska, Daria; Zimine, Nikolai; Zimmermann, Christoph; Zimmermann, Robert; Zimmermann, Simone; Zimmermann, Stephanie; Zinonos, Zinonas; Ziolkowski, Michael; Zobernig, Georg; Zoccoli, Antonio; zur Nedden, Martin; Zurzolo, Giovanni; Zutshi, Vishnu; Zwalinski, Lukasz

    2015-01-01

    This Letter presents a search for a hidden-beauty counterpart of the $X(3872)$ in the mass ranges 10.05--10.31 GeV and 10.40--11.00 GeV, in the channel $X_b \\to \\pi^{+} \\pi^{-} \\Upsilon(1 \\rm S)(\\rightarrow\\mu^+\\mu^-)$, using 16.2 fb$^{-1}$ of $\\sqrt{s}=8$ TeV $pp$ collision data collected by the ATLAS detector at the LHC. No evidence for new narrow states is found, and upper limits are set on the product of the $X_b$ cross section and branching fraction, relative to those of the $\\Upsilon(2 \\rm S)$, at the 95% confidence level using the CL$_S$ approach. These limits range from 0.8% to 4.0%, depending on mass. For masses above 10.1 GeV, the expected upper limits from this analysis are the most restrictive to date. Searches for production of the $\\Upsilon(1^3 \\rm{D}$$_J)$, $\\Upsilon(10860)$, and $\\Upsilon(11020)$ states also reveal no significant signals.

  20. Trigonal lattice distortion and ferro-quadrupole ordering in phase IV of CexLa1-xB6 (x=0.75 and 0.70)

    International Nuclear Information System (INIS)

    The low-temperature lattice effects of the Kondo compounds CexLa1-xB6 (x=0.75 and 0.70) with a Γ8 ground state have been investigated by dilatometric measurements. In an ordered phase IV below TC=1.6 K (1.4 K) for x=0.75 (0.70), the lattice length along the [001] direction reveals an increase, while the length along the [111] direction shows an appreciable decrease. This lattice distortion is described in terms of the trigonal strain yz>=zx>=xy>≠0 with Γ5 symmetry in addition to a volume expansion εB=εxx + εyy + εzz with full symmetry Γ1. The trigonal strain in phase IV indicates a ferro-quadrupole ordering of yx>=zx>=xy>≠0. (author)

  1. Structure, elastic stiffness, and hardness of Os 1- xRu xB 2 solid solution transition-metal diborides

    KAUST Repository

    Kanoun, Mohammed

    2012-05-31

    On the basis of recent experiments, the solid solution transition-metal diborides were proposed to be new ultra-incompressible hard materials. We investigate using density functional theory based methods the structural and mechanical properties, electronic structure, and hardness of Os 1-xRu xB 2 solid solutions. A difference in chemical bonding occurs between OsB 2 and RuB 2 diborides, leading to significantly different elastic properties: a large bulk, shear moduli, and hardness for Os-rich diborides and relatively small bulk, shear moduli, and hardness for Ru-rich diborides. The electronic structure and bonding characterization are also analyzed as a function of Ru-dopant concentration in the OsB 2 lattice. © 2012 American Chemical Society.

  2. Pyroelectric properties of BST/PLT composite thick films with addition of xPbO-(1 - x)B2O3 glass

    International Nuclear Information System (INIS)

    The Ba xSr1-xTiO3 (BST)/Pb1-xLa xTiO3 (PLT) composite thick films (∼20 μm) with 12 mol% amount of xPbO-(1 - x)B2O3 glass additives (x = 0.2, 0.35, 0.5, 0.65 and 0.8) have been prepared by screen-printing the paste onto the alumina substrates with silver bottom electrode. X-ray diffraction (XRD), scanning electron microscope (SEM) and an impedance analyzer and an electrometer were used to analyze the phase structures, morphologies and dielectric and pyroelectric properties of the composite thick films, respectively. The wetting and infiltration of the liquid phase on the particles results in the densification of the composite thick films sintered at 750 deg. C. Nice porous structure formed in the composite thick films with xPbO-(1 - x)B2O3 glass as the PbO content (x) is 0.5 ≥ x ≥ 0.35, while dense structure formed in these thick films as the PbO content (x) is 0.8 ≥ x ≥ 0.65. The volatilization of the PbO in PLT and the interdiffusion between the PLT and the glass lead to the reduction of the c-axis of the PLT phase. The operating temperature range of our composite thick films is 0-200 deg. C. At room temperature (20 deg. C), the BST/PLT composite thick films with 0.35PbO-0.65B2O3 glass additives provided low heat capacity and good pyroelectric figure-of-merit because of their porous structure. The pyroelectric coefficient and figure-of-merit F D are 364 μC/(m2 K) and 14.3 μPa-1/2, respectively. These good pyroelectric properties as well as being able to produce low-cost devices make this kind of thick films a promising candidate for high-performance pyroelectric applications

  3. Competing anisotropies on 3d sub-lattice of YNi{sub 4–x}Co{sub x}B compounds

    Energy Technology Data Exchange (ETDEWEB)

    Caraballo Vivas, R. J.; Rocco, D. L.; Reis, M. S. [Instituto de Física, Universidade Federal Fluminense, Av. Gal. Milton Tavares de Souza s/n, 24210-346 Niterói, RJ (Brazil); Costa Soares, T. [Instituto de Física, Universidade Federal Fluminense, Av. Gal. Milton Tavares de Souza s/n, 24210-346 Niterói, RJ (Brazil); IF Sudeste MG Campus de Juiz de Fora-Núcleo de Física, 36080-001 Juiz de Fora, MG (Brazil); Caldeira, L. [IF Sudeste MG Campus de Juiz de Fora-Núcleo de Física, 36080-001 Juiz de Fora, MG (Brazil); Coelho, A. A. [Instituto de Física Gleb Wataghin, Universidade Estadual de Campinas-Unicamp, Caixa postal 6165, 13083-859 Campinas, SP (Brazil)

    2014-08-14

    The magnetic anisotropy of 3d sub-lattices has an important rule on the overall magnetic properties of hard magnets. Intermetallics alloys with boron (R-Co/Ni-B, for instance) belong to those hard magnets family and are useful objects to help to understand the magnetic behavior of 3d sub-lattice, specially when the rare earth ions R do not have magnetic nature, like YCo{sub 4}B ferromagnetic material. Interestingly, YNi{sub 4}B is a paramagnetic material and Ni ions do not contribute to the magnetic anisotropy. We focused therefore our attention to YNi{sub 4–x}Co{sub x}B series, with x = 0, 1, 2, 3, and 4. The magnetic anisotropy of these compounds is deeper described using statistical and preferential models of Co occupation among the possible Wyckoff positions into the CeCo{sub 4}B type hexagonal structure. We found that the preferential model is the most suitable to explain the magnetization experimental data.

  4. Search for the Xb and other hidden-beauty states in the π+π−ϒ(1S) channel at ATLAS

    International Nuclear Information System (INIS)

    This Letter presents a search for a hidden-beauty counterpart of the X(3872) in the mass ranges of 10.05–10.31 GeV and 10.40–11.00 GeV, in the channel Xb→π+π−ϒ(1S)(→μ+μ−), using 16.2 fb−1 of √(s)=8 TeV pp collision data collected by the ATLAS detector at the LHC. No evidence for new narrow states is found, and upper limits are set on the product of the Xb cross section and branching fraction, relative to those of the ϒ(2S), at the 95% confidence level using the CLS approach. These limits range from 0.8% to 4.0%, depending on mass. For masses above 10.1 GeV, the expected upper limits from this analysis are the most restrictive to date. Searches for production of the ϒ(13DJ), ϒ(10860), and ϒ(11020) states also reveal no significant signals

  5. Quantum mechanically guided design of Co43Fe20Ta5.5X31.5 (X=B, Si, P, S) metallic glasses

    International Nuclear Information System (INIS)

    A systematic ab initio molecular dynamics study was carried out to identify valence electron concentration and size induced changes on structure, elastic and magnetic properties for Co43Fe20Ta5.5X31.5 (X=B, Si, P, S). Short range order, charge transfer and the bonding nature are analyzed by means of density of states, Bader decomposition and pair distribution function analysis. A clear trend of a decrease in density and bulk modulus as well as a weaker cohesion was observed as the valence electron concentration is increased by replacing B with Si and further with P and S. These changes may be understood based on increased interatomic distances, variations in coordination numbers and the electronic structure changes; as the valence electron concentration of X is increased the X bonding becomes more ionic, which disrupts the overall metallic interactions, leading to lower cohesion and stiffness. The highest magnetic moments for the transition metals are identified for X=S, despite the fact that the presence of X generally reduces the magnetic moment of Co. Furthermore, this study reveals an extended diagonal relationship between B and P within these amorphous alloys. Based on quantum mechanical data we identify composition induced changes in short range order, charge transfer and bonding nature and link them to density, elasticity and magnetism. The interplay between transition metal d band filling and s-d hybridization was identified to be a key materials design criterion. (paper)

  6. Search for the Xb and other hidden-beauty states in the π+π−ϒ(1S channel at ATLAS

    Directory of Open Access Journals (Sweden)

    G. Aad

    2015-01-01

    Full Text Available This Letter presents a search for a hidden-beauty counterpart of the X(3872 in the mass ranges of 10.05–10.31 GeV and 10.40–11.00 GeV, in the channel Xb→π+π−ϒ(1S(→μ+μ−, using 16.2 fb−1 of s=8 TeV pp collision data collected by the ATLAS detector at the LHC. No evidence for new narrow states is found, and upper limits are set on the product of the Xb cross section and branching fraction, relative to those of the ϒ(2S, at the 95% confidence level using the CLS approach. These limits range from 0.8% to 4.0%, depending on mass. For masses above 10.1 GeV, the expected upper limits from this analysis are the most restrictive to date. Searches for production of the ϒ(13DJ, ϒ(10860, and ϒ(11020 states also reveal no significant signals.

  7. Equivalent Longitudinal Area Distributions of the B-58 and XB-70-1 Airplanes for Use in Wave Drag and Sonic Boom Calculations

    Science.gov (United States)

    Tinetti, Ana F.; Maglieri, Domenic J.; Driver, Cornelius; Bobbitt, Percy J.

    2011-01-01

    A detailed geometric description, in wave drag format, has been developed for the Convair B-58 and North American XB-70-1 delta wing airplanes. These descriptions have been placed on electronic files, the contents of which are described in this paper They are intended for use in wave drag and sonic boom calculations. Included in the electronic file and in the present paper are photographs and 3-view drawings of the two airplanes, tabulated geometric descriptions of each vehicle and its components, and comparisons of the electronic file outputs with existing data. The comparisons include a pictorial of the two airplanes based on the present geometric descriptions, and cross-sectional area distributions for both the normal Mach cuts and oblique Mach cuts above and below the vehicles. Good correlation exists between the area distributions generated in the late 1950s and 1960s and the present files. The availability of these electronic files facilitates further validation of sonic boom prediction codes through the use of two existing data bases on these airplanes, which were acquired in the 1960s and have not been fully exploited.

  8. Dose calculation of Acuros XB and Anisotropic Analytical Algorithm in lung stereotactic body radiotherapy treatment with flattening filter free beams and the potential role of calculation grid size

    International Nuclear Information System (INIS)

    The study aimed to appraise the dose differences between Acuros XB (AXB) and Anisotropic Analytical Algorithm (AAA) in stereotactic body radiotherapy (SBRT) treatment for lung cancer with flattening filter free (FFF) beams. Additionally, the potential role of the calculation grid size (CGS) on the dose differences between the two algorithms was also investigated. SBRT plans with 6X and 10X FFF beams produced from the CT scan data of 10 patients suffering from stage I lung cancer were enrolled in this study. Clinically acceptable treatment plans with AAA were recalculated using AXB with the same monitor units (MU) and identical multileaf collimator (MLC) settings. Furthermore, different CGS (2.5 mm and 1 mm) in the two algorithms was also employed to investigate their dosimetric impact. Dose to planning target volumes (PTV) and organs at risk (OARs) between the two algorithms were compared. PTV was separated into PTV-soft (density in soft-tissue range) and PTV-lung (density in lung range) for comparison. The dose to PTV-lung predicted by AXB was found to be 1.33 ± 1.12% (6XFFF beam with 2.5 mm CGS), 2.33 ± 1.37% (6XFFF beam with 1 mm CGS), 2.81 ± 2.33% (10XFFF beam with 2.5 mm CGS) and 3.34 ± 1.76% (10XFFF beam with 1 mm CGS) lower compared with that by AAA, respectively. However, the dose directed to PTV-soft was comparable. For OARs, AXB predicted a slightly lower dose to the aorta, chest wall, spinal cord and esophagus, regardless of whether the 6XFFF or 10XFFF beam was utilized. Exceptionally, dose to the ipsilateral lung was significantly higher with AXB. AXB principally predicts lower dose to PTV-lung compared to AAA and the CGS contributes to the relative dose difference between the two algorithms

  9. The electronic structure, mechanical and thermodynamic properties of Mo{sub 2}XB{sub 2} and MoX{sub 2}B{sub 4} (X = Fe, Co, Ni) ternary borides

    Energy Technology Data Exchange (ETDEWEB)

    He, TianWei; Jiang, YeHua, E-mail: jiangyehua@kmust.edu.cn, E-mail: jfeng@seas.harvard.edu; Zhou, Rong [Faculty of Material Science and Engineering, Kunming University of Science and Technology, Kunming 650093 (China); Feng, Jing, E-mail: jiangyehua@kmust.edu.cn, E-mail: jfeng@seas.harvard.edu [Faculty of Material Science and Engineering, Kunming University of Science and Technology, Kunming 650093 (China); School of Engineering and Applied Sciences, Harvard University, Cambridge, Massachusetts 02138 (United States)

    2015-08-21

    The mechanical properties, electronic structure and thermodynamic properties of the Mo{sub 2}XB{sub 2} and MoX{sub 2}B{sub 4} (X = Fe, Co, Ni) ternary borides were calculated by first-principles methods. The elastic constants show that these ternary borides are mechanically stable. Formation enthalpy of Mo{sub 2}XB{sub 2} and MoX{sub 2}B{sub 4} (X = Fe, Co, Ni) ternary borides are at the range of −118.09 kJ/mol to −40.14 kJ/mol. The electronic structures and chemical bonding characteristics are analyzed by the density of states. Mo{sub 2}FeB{sub 2} has the largest shear and Young's modulus because of its strong chemical bonding, and the values are 204.3 GPa and 500.3 GPa, respectively. MoCo{sub 2}B{sub 4} shows the lowest degree of anisotropy due to the lack of strong direction in the bonding. The Debye temperature of MoFe{sub 2}B{sub 4} is the largest among the six phases, which means that MoFe{sub 2}B{sub 4} possesses the best thermal conductivity. Enthalpy shows an approximately linear function of the temperature above 300 K. The entropy of these compounds increase rapidly when the temperature is below 450 K. The Gibbs free energy decreases with the increase in temperature. MoCo{sub 2}B{sub 4} has the lowest Gibbs free energy, which indicates the strongest formation ability in Mo{sub 2}XB{sub 2} and MoX{sub 2}B{sub 4} (X = Fe, Co, Ni) ternary borides.

  10. Critical appraisal of the accuracy of Acuros-XB and Anisotropic Analytical Algorithm compared to measurement and calculations with the compass system in the delivery of RapidArc clinical plans

    International Nuclear Information System (INIS)

    The accuracy of the two dose calculation engines available for RapidArc planning (both released for clinical use) is investigated in comparison to the COMPASS data. Two dose calculation algorithms (Acuros-XB and Anisotropic Analytic Algorithm (AAA)) were used to calculate RA plans and compared to calculations with the Collapsed Cone Convolution algorithm (CC) from the COMPASS system (IBA Dosimetry). CC calculations, performed on patient data, are based on experimental fluence measurements with a 2D array of ion chambers mounted on the linac head. The study was conducted on clinical cases treated with RA. Five cases for each of the following groups were included: Brain, Head and Neck, Thorax, Pelvis and stereotactic body radiation therapy for hypo-fractionated treatments with small fields. COMPASS measurements were performed with the iMatrixx-2D array. RapidArc plans were optimized for delivery using 6MV photons from a Clinac-iX (Varian, Palo Alto, USA). Accuracy of the RA calculation was appraised by means of: 1) comparison of Dose Volume histograms (DVH) metrics; 2) analysis of differential dose distributions and determination of mean dose differences per organ; 3) 3D gamma analysis with distance-to-agreement and dose difference thresholds set to 3%/3 mm or 2%/2 mm for targets, organs at risks and for the volumes encompassed by the 50 and 10% isodoses. For almost all parameters, the better agreement was between Acuros-XB and COMPASS independently from the anatomical site and fractionation. The same result was obtained from the mean dose difference per organ with Acuros-CC average differences below 0.5% while for AAA-CC data, average deviations exceeded 0.5% and in the case of the pelvis 1%. Relevance of observed differences determined with the 3D gamma analysis resulted in a pass rate exceeding 99.5% for Acuros-CC and exceeding 97.5% for AAA-CC. This study demonstrated that i) a good agreement exists between COMPASS-CC calculations based on measured fluences with

  11. Dose-to-medium vs. dose-to-water: Dosimetric evaluation of dose reporting modes in Acuros XB for prostate, lung and breast cancer

    Directory of Open Access Journals (Sweden)

    Suresh Rana

    2014-12-01

    Full Text Available Purpose: Acuros XB (AXB dose calculation algorithm is available for external beam photon dose calculations in Eclipse treatment planning system (TPS. The AXB can report the absorbed dose in two modes: dose-to-water (Dw and dose-to-medium (Dm. The main purpose of this study was to compare the dosimetric results of the AXB_Dm with that of AXB_Dw on real patient treatment plans. Methods: Four groups of patients (prostate cancer, stereotactic body radiation therapy (SBRT lung cancer, left breast cancer, and right breast cancer were selected for this study, and each group consisted of 5 cases. The treatment plans of all cases were generated in the Eclipse TPS. For each case, treatment plans were computed using AXB_Dw and AXB_Dm for identical beam arrangements. Dosimetric evaluation was done by comparing various dosimetric parameters in the AXB_Dw plans with that of AXB_Dm plans for the corresponding patient case. Results: For the prostate cancer, the mean planning target volume (PTV dose in the AXB_Dw plans was higher by up to 1.0%, but the mean PTV dose was within ±0.3% for the SBRT lung cancer. The analysis of organs at risk (OAR results in the prostate cancer showed that AXB_Dw plans consistently produced higher values for the bladder and femoral heads but not for the rectum. In the case of SBRT lung cancer, a clear trend was seen for the heart mean dose and spinal cord maximum dose, with AXB_Dw plans producing higher values than the AXB_Dm plans. However, the difference in the lung doses between the AXB_Dm and AXB_Dw plans did not always produce a clear trend, with difference ranged from -1.4% to 2.9%. For both the left and right breast cancer, the AXB_Dm plans produced higher maximum dose to the PTV for all cases. The evaluation of the maximum dose to the skin showed higher values in the AXB_Dm plans for all 5 left breast cancer cases, whereas only 2 cases had higher maximum dose to the skin in the AXB_Dm plans for the right breast cancer

  12. Dosimetric accuracy and clinical quality of Acuros XB and AAA dose calculation algorithm for stereotactic and conventional lung volumetric modulated arc therapy plans

    International Nuclear Information System (INIS)

    The main aim of the current study was to assess the dosimetric accuracy and clinical quality of volumetric modulated arc therapy (VMAT) plans for stereotactic (stage I) and conventional (stage III) lung cancer treatments planned with Eclipse version 10.0 Anisotropic Analytical Algorithm (AAA) and Acuros XB (AXB) algorithm. The dosimetric impact of using AAA instead of AXB, and grid size 2.5 mm instead of 1.0 mm for VMAT treatment plans was evaluated. The clinical plan quality of AXB VMAT was assessed using 45 stage I and 73 stage III patients, and was compared with published results, planned with VMAT and hybrid-VMAT techniques. The dosimetric impact on near-minimum PTV dose (D98%) using AAA instead of AXB was large (underdose up to 12.3%) for stage I and very small (underdose up to 0.8%) for stage III lung treatments. There were no significant differences for dose volume histogram (DVH) values between grid sizes. The calculation time was significantly higher for AXB grid size 1.0 than 2.5 mm (p < 0.01). The clinical quality of the VMAT plans was at least comparable with clinical qualities given in literature of lung treatment plans with VMAT and hybrid-VMAT techniques. The average mean lung dose (MLD), lung V20Gy and V5Gy in this study were respectively 3.6 Gy, 4.1% and 15.7% for 45 stage I patients and 12.4 Gy, 19.3% and 46.6% for 73 stage III lung patients. The average contra-lateral lung dose V5Gy-cont was 35.6% for stage III patients. For stereotactic and conventional lung treatments, VMAT calculated with AXB grid size 2.5 mm resulted in accurate dose calculations. No hybrid technique was needed to obtain the dose constraints. AXB is recommended instead of AAA for avoiding serious overestimation of the minimum target doses compared to the actual delivered dose

  13. Experimental validation of deterministic Acuros XB algorithm for IMRT and VMAT dose calculations with the Radiological Physics Center's head and neck phantom

    Energy Technology Data Exchange (ETDEWEB)

    Han Tao; Mourtada, Firas; Kisling, Kelly; Mikell, Justin; Followill, David; Howell, Rebecca [Department of Radiation Physics, University of Texas MD Anderson Cancer Center, Houston, Texas 77030 (United States); Department of Radiation Physics, University of Texas MD Anderson Cancer Center, Houston, Texas 77030 (United States) and Department of Radiation Oncology, Christiana Care Health System, Newark, Delaware 19713 (United States); Department of Radiation Physics, University of Texas MD Anderson Cancer Center, Houston, Texas 77030 (United States)

    2012-04-15

    Purpose: The purpose of this study was to verify the dosimetric performance of Acuros XB (AXB), a grid-based Boltzmann solver, in intensity-modulated radiation therapy (IMRT) and volumetric-modulated arc therapy (VMAT). Methods: The Radiological Physics Center (RPC) head and neck (H and N) phantom was used for all calculations and measurements in this study. Clinically equivalent IMRT and VMAT plans were created on the RPC H and N phantom in the Eclipse treatment planning system (version 10.0) by using RPC dose prescription specifications. The dose distributions were calculated with two different algorithms, AXB 11.0.03 and anisotropic analytical algorithm (AAA) 10.0.24. Two dose report modes of AXB were recorded: dose-to-medium in medium (D{sub m,m}) and dose-to-water in medium (D{sub w,m}). Each treatment plan was delivered to the RPC phantom three times for reproducibility by using a Varian Clinac iX linear accelerator. Absolute point dose and planar dose were measured with thermoluminescent dosimeters (TLDs) and GafChromic registered EBT2 film, respectively. Profile comparison and 2D gamma analysis were used to quantify the agreement between the film measurements and the calculated dose distributions from both AXB and AAA. The computation times for AAA and AXB were also evaluated. Results: Good agreement was observed between measured doses and those calculated with AAA or AXB. Both AAA and AXB calculated doses within 5% of TLD measurements in both the IMRT and VMAT plans. Results of AXB{sub Dm,m} (0.1% to 3.6%) were slightly better than AAA (0.2% to 4.6%) or AXB{sub Dw,m} (0.3% to 5.1%). The gamma analysis for both AAA and AXB met the RPC 7%/4 mm criteria (over 90% passed), whereas AXB{sub Dm,m} met 5%/3 mm criteria in most cases. AAA was 2 to 3 times faster than AXB for IMRT, whereas AXB was 4-6 times faster than AAA for VMAT. Conclusions: AXB was found to be satisfactorily accurate when compared to measurements in the RPC H and N phantom. Compared with AAA

  14. Synthesis and characterizations of water-based ferrofluids of substituted ferrites [Fe 1-xB xFe 2O 4, B=Mn, Co ( x=0-1)] for biomedical applications

    Science.gov (United States)

    Giri, Jyotsnendu; Pradhan, Pallab; Somani, Vaibhav; Chelawat, Hitesh; Chhatre, Shreerang; Banerjee, Rinti; Bahadur, Dhirendra

    Nanomagnetic particles have great potential in the biomedical applications like MRI contrast enhancement, magnetic separation, targeting delivery and hyperthermia. In this paper, we have explored the possibility of biomedical applications of [Fe 1-xB xFe 2O 4, B=Mn, Co] ferrite. Superparamagnetic particles of substituted ferrites [Fe 1-xB xFe 2O 4, B=Mn, Co ( x=0-1)] and their fatty acid coated water base ferrofluids have been successfully prepared by co-precipitation technique using NH4OH/TMAH (Tetramethylammonium hydroxide) as base. In vitro cytocompatibility study of different magnetic fluids was done using HeLa (human cervical carcinoma) cell lines. Co 2+-substituted ferrite systems (e.g. CoFe 2O 4) is more toxic than Mn 2+-substituted ferrite systems (e.g. MnFe 2O 4, Fe 0.6Mn 0.4Fe 2O 4). The later is as cytocompatible as Fe 3O 4. Thus, Fe 1-xMn xFe 2O 4 could be useful in biomedical applications like MRI contrast agent and hyperthermia treatment of cancer.

  15. Experimental verification of the Acuros XB and AAA dose calculation adjacent to heterogeneous media for IMRT and RapidArc of nasopharygeal carcinoma

    International Nuclear Information System (INIS)

    Purpose: To compare the doses calculated by the Acuros XB (AXB) algorithm and analytical anisotropic algorithm (AAA) with experimentally measured data adjacent to and within heterogeneous medium using intensity modulated radiation therapy (IMRT) and RapidArc® (RA) volumetric arc therapy plans for nasopharygeal carcinoma (NPC). Methods: Two-dimensional dose distribution immediately adjacent to both air and bone inserts of a rectangular tissue equivalent phantom irradiated using IMRT and RA plans for NPC cases were measured with GafChromic® EBT3 films. Doses near and within the nasopharygeal (NP) region of an anthropomorphic phantom containing heterogeneous medium were also measured with thermoluminescent dosimeters (TLD) and EBT3 films. The measured data were then compared with the data calculated by AAA and AXB. For AXB, dose calculations were performed using both dose-to-medium (AXBDm) and dose-to-water (AXBDw) options. Furthermore, target dose differences between AAA and AXB were analyzed for the corresponding real patients. The comparison of real patient plans was performed by stratifying the targets into components of different densities, including tissue, bone, and air. Results: For the verification of planar dose distribution adjacent to air and bone using the rectangular phantom, the percentages of pixels that passed the gamma analysis with the ± 3%/3mm criteria were 98.7%, 99.5%, and 97.7% on the axial plane for AAA, AXBDm, and AXBDw, respectively, averaged over all IMRT and RA plans, while they were 97.6%, 98.2%, and 97.7%, respectively, on the coronal plane. For the verification of planar dose distribution within the NP region of the anthropomorphic phantom, the percentages of pixels that passed the gamma analysis with the ± 3%/3mm criteria were 95.1%, 91.3%, and 99.0% for AAA, AXBDm, and AXBDw, respectively, averaged over all IMRT and RA plans. Within the NP region where air and bone were present, the film measurements represented the dose close to

  16. Wind-tunnel/flight correlation study of aerodynamic characteristics of a large flexible supersonic cruise airplane (XB-701) 2: Extrapolation of wind-tunnel data to full-scale conditions

    Science.gov (United States)

    Peterson, J. B., Jr.; Mann, M. J.; Sorrells, R. B., III; Sawyer, W. C.; Fuller, D. E.

    1980-01-01

    The results of calculations necessary to extrapolate performance data on an XB-70-1 wind tunnel model to full scale at Mach numbers from 0.76 to 2.53 are presented. The extrapolation was part of a joint program to evaluate performance prediction techniques for large flexible supersonic airplanes similar to a supersonic transport. The extrapolation procedure included: interpolation of the wind tunnel data at the specific conditions of the flight test points; determination of the drag increments to be applied to the wind tunnel data, such as spillage drag, boundary layer trip drag, and skin friction increments; and estimates of the drag items not represented on the wind tunnel model, such as bypass doors, roughness, protuberances, and leakage drag. In addition, estimates of the effects of flexibility of the airplane were determined.

  17. Effect of Small Addition of Cobalt on Magnetic Properties and Internal Stresses Sources in the Form of Free Volumes and Pseudo-Dislocation Dipoles in Fe78CoXSi11-XB11 (x = 0 Or 2 Alloys / Wpływ Nieznacznego Dodatku Kobaltu Na Właściwości Magnetyczne Oraz Źródła Naprężeń Wewnętrznych W Postaci Wolnych Objętości Oraz Pseudodyslokacyjnych Dipoli W Stopach Fe78CoXSi11-XB11 (x = 0 Or 2

    Directory of Open Access Journals (Sweden)

    Szota M.

    2015-12-01

    Full Text Available Amorphous materials in the form of tapes, despite being discovered more than half a century ago, are still the object of interest for materials engineers and electro-technical industry. They possess a great application potential, and are constantly studied for new variations. Due to the different structure from the commonly manufactured textured FeSi sheets, FeCoB based amorphous alloys demonstrate very good, so called soft magnetic properties. This paper presents the results of studying the structure and magnetic properties of tapes of Fe78CoxSi11-xB11 (X = 0 or 2 alloys of amorphous structure. In addition, the effect of Co alloy addition on the type of structural defects in the area of ferromagnetic saturation approach was examined. It was found that a small addition of Co affects the increase of saturation magnetization value, as well as the distribution of magnetization vectors within the stresses sources in form of structure defects.

  18. The central engine of $\\gamma$-ray bursters

    CERN Document Server

    Kluzniak, W

    1998-01-01

    GRBs are thought to arise in relativistic blast-wave shocks at distances of 10 to 1000 AU from the point where the explosive energy is initially released. To account for the observed duration and variability of the gamma-ray emission in most GRBs, a central engine powering the shocks must remain active for several seconds to many minutes but must strongly fluctuate in its output on much shorter timescales. We show how a neutron star differentially rotating at millisecond periods (DROMP) could be such an engine. A magnetized DROMP would repeatedly wind up toroidal magnetic fields to about 10**17 G and only release the corresponding magnetic energy, when each buoyant magnetic field torus floats up to, and breaks through, the stellar surface. The resulting rapid sub-bursts, separated by relatively quiescent phases, repeat until the kinetic energy of differential rotation is exhausted by these events. Calculated values of the energy released and of the various timescales are in agreement with observations of GRBs...

  19. Dynamical constraints on the neutron star mass in EXO 0748-676

    OpenAIRE

    T. Muñoz-Darias(Oxford University, United Kingdom); Casares, J.; O'Brien, K.; Steeghs, D; Martinez-Pais, I. G.; Cornelisse, R.; Charles, P. A.

    2009-01-01

    We present VLT intermediate resolution spectroscopy of UY Vol, the optical counterpart of the LMXB X-ray burster EXO 0748-676. By using Doppler tomography we detect narrow components within the broad He II 4542 A, 4686 A and 5412 A emission lines. The phase, velocity and narrowness of these lines are consistent with their arising from the irradiated hemisphere of the donor star, as has been observed in a number of LMXBs. Under this assumption we provide the first dynamical constraints on the ...

  20. An Improved Study of Electronic Band Structure and Optical Parameters of X-Phosphides (X--B, AL, Ga, In) by Modified Becke-Johnson Potential%An Improved Study of Electronic Band Structure and Optical Parameters of X-Phosphides (X--B, AL, Ga, In) by Modified Becke-Johnson Potential

    Institute of Scientific and Technical Information of China (English)

    Masood Yousaf; M.A. Saeed; R. Ahmed; M.M. Alsardia; Ahmad Radzi Mat Isa; A. Shaari

    2012-01-01

    We report the electronic band structure and optical parameters of X-Phosphides (X=B, AI, Ga, In) by first-principles technique based on a new approximation known as modified Becke-Johnson (roB J). This potential is considered more accurate in elaborating excited states properties of insulators and semiconductors as compared to LDA and GGA. The present calculated band gaps values of BP, AlP, GaP, and InP are 1.867 eV, 2.268 eV, 2.090 eV, and 1.377 eV respectively, which are in close agreement to the experimental results. The band gap values trend in this study is as: E9 (mBJ-GGA/LDA) 〉 E9 (GGA) 〉 Eg (LDA). Optical parametric quantities (dielectric constant, refractive index, reflectivity and optical conductivity) which based on the band structure are aiso presented and discussed. BP, AlP, GaP, and InP have strong absorption in between the energy range 4-9 eV, 4-7 ev, 3-7 eV, and 2-7 eV respectively. Static dielectric constant, static refractive index and coefficient of reflectivity at zero frequency, within mBJ-GGA, are also calculated. BP, AIP, GaP, and InP show significant optical conductivity in the range 5.2-10 eV, 4.3-8 eV, 3.5- 7.2 eV, and 3.2-8 eV respectively. The present study endorses that the said compounds can be used in opto-electronic applications, for different energy ranges.

  1. Peculiar spectral and power spectral behaviour of the LMXB GX 13+1

    NARCIS (Netherlands)

    Schnerr, R. S.; Reerink, T.; van der Klis, M.; Homan, J.; Méndez, M.; Fender, R. P.; Kuulkers, E.

    2003-01-01

    We present results of an analysis of all 480 ks of Rossi X-ray Timing Explorer Proportional Counter Array data obtained from 17 May 1998 to 11 October 1998 on the luminous low mass X-ray binary GX 13+1. We analysed the spectral properties in colour-colour diagrams (CDs) and hardness-intensity diagra

  2. The puzzling orbital period evolution of the LMXB AX J1745.6-2901

    Science.gov (United States)

    Ponti, Gabriele; Nandra, Kirpal; Stella, Luigi; Muñoz-Darias, Teodoro

    2016-07-01

    The orbital period evolution of X-ray binaries provides fundamental clues to understanding mechanisms of angular momentum loss from these systems. I will present an X-ray eclipse timing analysis of the transient low mass X-ray binary AX J1745.6-2901. This system shows full eclipses and thus is one of the few objects for which accurate orbital evolution studies using this method can be carried out. We report on XMM-Newton and ASCA observations covering 30 complete X-ray eclipses spanning an interval of more than 20 years. We improve the determination of the orbital period to a relative precision of 2 × 10-8, two orders of magnitudes better than previous estimates. We determine, for the first time, a highly significant rate of decrease of the orbital period Pdot_orb = -4.03 ± 0.32 × 10-11 s/s. This is at least one order of magnitude larger than expected from conservative mass transfer and angular momentum losses due to gravitational waves and magnetic braking, and might result from either non-conservative mass transfer or be the product of magnetic activity changing the quadrupole moment of the companion star. Imprinted on the long term evolution of the orbit, we observe highly significant eclipse leads-delays of ˜ 10 - 30 s, characterised by a clear state dependence in which, on average, eclipses occur earlier during the hard state.

  3. Disk emission and absorption lines in LMXB. Note on the physical conditions of an absorbing material

    CERN Document Server

    Rozanska, Agata

    2014-01-01

    We show that the continuum X-ray spectrum of 4U 1630-472 with iron absorption lines can be satisfactorily modeled by the spectrum from an accretion disk atmosphere. We performed full radiative transfer calculations using our code ATM21 to model the emission from an accretion disk surface that is seen at different viewing angles. Computed models are then fitted to the high-resolution X-ray spectra of 4U 1630-472 obtained by {\\it Suzaku} satellite. Absorption lines of highly ionized iron originating in a hot accretion-disk atmospheres are important part of the observed line profile, and can be an alternative or complementary explanation to the wind model usually favored for this type of sources. Next, assuming that absorption lines originate from the wind illuminated by X-ray central source in LMXBs, we can put constrains on the wind location only if we know the volume density number of the absorbing material. There are a few derivations of the distance to the wind in X-ray binaries. We show here, that the dens...

  4. 77 FR 70147 - Fish and Wildlife Service 0648-XB088

    Science.gov (United States)

    2012-11-23

    ... Notice of Availability (NOA) in the Federal Register on April 12, 2010 (75 FR 18482). The official... (75 FR 41157) extending the public comment period an additional 45 days to August 30, 2010. During the... equestrian leaseholds; and commercial and institutional leaseholds. Up to 180 acres of development in Zones...

  5. Sigma observations of the low mass X-ray binaries of the galactic bulge

    Science.gov (United States)

    Goldwurm, A.; Denis, M.; Paul, J.; Faisse, S.; Roques, J. P.; Bouchet, L.; Vedrenne, G.; Mandrou, P.; Sunyaev, R.; Churazov, E.

    1995-01-01

    The soft gamma-ray telescope (35-1300 keV) SIGMA aboard the high energy GRANAT space observatory has been monitoring the Galactic Bulge region for more than 2000 h of effective time since March 1990. In the resulting average 35-75 keV image we detected ten sources at a level of greater than 5 standard deviations, 6 of which can be identified with low mass X-ray binaries (LMXB). Among them, one is the 1993 X-ray nova in Ophiuchus (GRS 1726-249), one is an X-ray pulsar (GX 1+4), two are associated with X-ray bursters (GX 354-0 and A 1742-294) and two with bursting X-ray binaries in the globular clusters Terzan 2 and Terzan 1. Their spectral and long term variability behavior as measured by SIGMMA are presented and discussed.

  6. Dynamical constraints on the neutron star mass in EXO 0748-676

    CERN Document Server

    Muñoz-Darias, T; O'Brien, K; Steeghs, D; Martínez-Pais, I G; Cornelisse, R; Charles, P A

    2009-01-01

    We present VLT intermediate resolution spectroscopy of UY Vol, the optical counterpart of the LMXB X-ray burster EXO 0748-676. By using Doppler tomography we detect narrow components within the broad He II 4542 A, 4686 A and 5412 A emission lines. The phase, velocity and narrowness of these lines are consistent with their arising from the irradiated hemisphere of the donor star, as has been observed in a number of LMXBs. Under this assumption we provide the first dynamical constraints on the stellar masses in this system. In particular, we measure K_2>K_em = 300 +/- 10 km/s. Using this value we derive 1 M_sun 1.5 M_sun for the case of a main sequence companion star. Our results are consistent with the presence of a massive neutron star as has been suggested by Ozel (2006), although we cannot discard the canonical value of ~1.4 M_sun.

  7. Detection of coherent millisecond pulsations at ~518 Hz in the LMXB Swift J1749.4-2807 (GRB060602B)

    NARCIS (Netherlands)

    Altamirano, D.; Wijnands, R.; van der Klis, M.; Patruno, A.; Watts, A.; Armas Padilla, M.; Cavecchi, Y.; Degenaar, N.; Kalamkar, M.; Kaur, R.; Yang, Y.J.; Casella, P.; Linares, M.; Soleri, P.; Rea, N.

    2010-01-01

    On April 10th, it was discovered (ATel #2548) using INTEGRAL that the neutron-star X-ray binary Swift J1749.4-2807 (Wijnands et al. 2009, MNRAS, 393, 126) was again in outburst. Using follow-up Swift and INTEGRAL observations the source activity was confirmed (ATel #2548 and #2561). On April 14th, 2

  8. The INTEGRAL long monitoring of persistent Ultra Compact X-ray Bursters

    OpenAIRE

    Fiocchi, M.; Bazzano, A.; Ubertini, P.; Bird, A. J.; Natalucci, L; Sguera, V.

    2008-01-01

    The combination of compact objects, short period variability and peculiar chemical composition of the Ultra Compact X-ray Binaries make up a very interesting laboratory to study accretion processes and thermonuclear burning on the neutron star surface. The improved large optical telescopes and more sensitive X-ray satellites have increased the number of known Ultra Compact X-ray Binaries allowing their study with unprecedented detail. We analyze the average properties common to all ultra comp...

  9. Galactic Gamma-Ray Bursters The Cosmic-Ray Sources at all Energies

    CERN Document Server

    Dar, Arnon

    1999-01-01

    We propose a new paradigm for the origin of nonsolar hadronic cosmic rays (CRs) at all energies: Highly relativistic, narrowly collimated jets from the birth or collapse of neutron stars in our Galaxy accelerate ambient disk and halo matter to CR energies and disperse it in hot spots which they form when they stop in the Galactic halo. Such events, seen as cosmological gamma-ray bursts in other galaxies when their beamed radiation happens to point towards Earth, account for many observed properties of the main hadronic component of CRs in a more natural way than all previously discussed CR sources.

  10. New insights into the quasi-periodic X-ray burster GS 0836-429

    CERN Document Server

    Aranzana, E; Kuulkers, E

    2015-01-01

    GS 0836-429 is a neutron star X-ray transient that displays Type-I X-ray bursts. In 2003 and 2004 it experienced two outbursts in X-rays. We present here an analysis of the system bursting properties during these outbursts. We studied the evolution of the 2003-2004 outbursts in soft X-rays using RXTE (2.5-12 keV; ASM), and in hard X-rays with INTEGRAL (17-80 keV, IBIS/ISGRI). Using data from the JEM-X monitor onboard INTEGRAL we detected 61 Type-I X-ray bursts, and confirm that the source displayed a quasi-periodic burst recurrence time of about 2.3 hours. We improve the characterization of the fuel composition, as well as the description of the typical burst durations and fluences. We estimate the average value of $\\alpha$ to be $49\\pm\\,3$. This value together with the observed burst profiles indicate a regime of a mixed He/H runaway triggered by unstable helium ignition. In addition, we report the detection of four series of double bursts, with burst recurrence times of $\\leq\\,20$ minutes. The measured recu...

  11. The Rapid Burster and its X-ray bursts: extremes of accretion and thermonuclear burning

    OpenAIRE

    Klis, van der, M.; Zand, in 't, J.J.M.; Watts, A.; Bagnoli, T.

    2015-01-01

    X-ray bursts originate from accreting neutron stars (NSs) in X-ray binaries (XRBs). They come in two flavours: thermonuclear bursts are due to the sudden runaway burning of the material accreted on the surface; accretion bursts signal a sudden change in the mass accretion rate, leading to enhanced emission in the innermost regions of the accretion flow. While thermonuclear bursts have been observed from 105 NSs as of writing, accretion bursts remain enigmatically confined to only two sources....

  12. Taxonomy of gamma ray burster data using a self-organizing neural network

    Energy Technology Data Exchange (ETDEWEB)

    Baumgart, C.W.

    1993-12-31

    This paper summarizes the results of a signal taxonomy study of gamma ray burst (GRB) data acquired with sensors on-board the Pioneer-Venus Orbiter (PVO) spacecraft. GRB events produce large fluxes of gamma rays with durations of seconds to minutes and have been observed since the early 1970`s. The true nature of GRBs is still unknown and several competing theories exist. A fundamental point of contention among such theories is whether or not different types of GRB exist. If different types of GRBs are discovered in the existing PVO data base, the differences may correlate with their position or source characteristics. Hence, the goal of this project was to use artificial neural networks to perform signal taxonomy on the GRB data base to determine if unique classes or types of GRBs exist. A total of 26 signal features were identified, some of which can be associated directly with some characteristic of the GRB, such as duration, peak count rate, and gamma ray spectrum hardness. Additional features that were selected included the number of zero crossings in the wavelet transform and the fractal dimension of each signal. A self organizing neural network was used with the signal features to search for correlations among the signals contained in the database. The results of this analysis revealed an intrinsic dimensionality of 2 or 3 in the database. That is, it appears as though 2 or 3 distinct types of GRB may exist. In particular, two of the classes contain roughly 90% of the signals in the database of GRB signals we had to work with. These two classes are similar in characteristics but are still sufficiently distinct from one another to form separate categories. The third class of GRB is definitely distinct from the first two.

  13. Codimension-two homoclinic bifurcations underlying spike adding in the Hindmarsh-Rose burster

    CERN Document Server

    Linaro, Daniele; Desroches, Mathieu; Storace, Marco

    2011-01-01

    The well-studied Hindmarsh-Rose model of neural action potential is revisited from the point of view of global bifurcation analysis. This slow-fast system of three paremeterised differential equations is arguably the simplest reduction of Hodgkin-Huxley models capable of exhibiting all qualitatively important distinct kinds of spiking and bursting behaviour. First, keeping the singular perturbation parameter fixed, a comprehensive two-parameter bifurcation diagram is computed by brute force. Of particular concern is the parameter regime where lobe-shaped regions of irregular bursting undergo a transition to stripe-shaped regions of periodic bursting. The boundary of each stripe represents a fold bifurcation that causes a smooth spike-adding transition where the number of spikes in each burst is increased by one. Next, numerical continuation studies reveal that the global structure is organised by various curves of homoclinic bifurcations. In particular the lobe to stripe transition is organised by a sequence ...

  14. Fireballs from Quark Stars in the CFL Phase: Application to Gamma Ray Bursters

    CERN Document Server

    Ouyed, R; Vogt, C

    2005-01-01

    Recent studies of photon-generation mechanisms in the color-superconducting Color-Flavor Locked (CFL) phase of dense quark matter have found gamma-ray emissivities in excess of ~ 10^{50} erg cm^{-3} s^{-1} for temperatures in the 10-30 MeV range. We suggest that this property can trigger gamma-ray bursts (GRBs) and associated fireballs at the surface of hypothetical hot (newly born) quark stars with an energy release of up to 10^{48}-10^{50} erg within a fraction of a millisecond. If surrounded by an accretion disk following its formation, the star's bursting activity can last from tens of milliseconds to hundreds of seconds releasing up to 10^{52} erg in total energy. We discuss typical features of observed GRBs within our model and explain how quark stars in the CFL phase might constitute natural candidates for corresponding inner engines.

  15. Canards in a minimal piecewise-linear square-wave burster

    Science.gov (United States)

    Desroches, M.; Fernández-García, S.; Krupa, M.

    2016-07-01

    We construct a piecewise-linear (PWL) approximation of the Hindmarsh-Rose (HR) neuron model that is minimal, in the sense that the vector field has the least number of linearity zones, in order to reproduce all the dynamics present in the original HR model with classical parameter values. This includes square-wave bursting and also special trajectories called canards, which possess long repelling segments and organise the transitions between stable bursting patterns with n and n + 1 spikes, also referred to as spike-adding canard explosions. We propose a first approximation of the smooth HR model, using a continuous PWL system, and show that its fast subsystem cannot possess a homoclinic bifurcation, which is necessary to obtain proper square-wave bursting. We then relax the assumption of continuity of the vector field across all zones, and we show that we can obtain a homoclinic bifurcation in the fast subsystem. We use the recently developed canard theory for PWL systems in order to reproduce the spike-adding canard explosion feature of the HR model as studied, e.g., in Desroches et al., Chaos 23(4), 046106 (2013).

  16. Swift follow-up of the newly discovered burster millisecond pulsar IGR J17511-3057

    DEFF Research Database (Denmark)

    Bozzo, E.; Ferrigno, C.; Kuulkers, E.; Falanga, M.; Chenevez, Jérôme; Brandt, Søren Kristian; Beckmann, V.; Bird, A.; Domingo, A.; Ebisawa, K.; Jonker, P.; Kretschmar, P.; Markwardt, C.; Oosterbroek, T.; Paizis, A.; Risquez, D.; Sanchez-Fernandez, C.; Shaw, S.; Wijnands, R.

    2.5 ks were accumulated in window timing (WT) mode. A thermonuclear type-I X-ray burst was discovered in the WT light curve of the source at 2009-09-14 00:51:37 UTC with an exponential decay time of ~12.5 s. This burst is most likely a He burst. The WT 0.5-10 keV X-ray spectrum is well described...

  17. XbD Video 2, Taxonomy of Experience (ToE) [Online

    DEFF Research Database (Denmark)

    2013-01-01

    This is the second video in the Experience-based Designing series: It describes the Taxonomy of Experience, a structural way of looking at human experiences of almost any kind.This hierarchical model is useful to researchers and decision makers as a general method or tool for guiding the collection...

  18. XbD Video 3, The SEEing process of qualitative data analysis

    DEFF Research Database (Denmark)

    2013-01-01

    This is the third video in the Experience-based Designing series. It presents a live classroom demonstration of a nine step qualitative data analysis process called SEEing: The process is useful for uncovering or discovering deeper layers of 'meaning' and meaning structures in an experience. These...

  19. 熊出没 注意!——2011款Scion xB

    Institute of Scientific and Technical Information of China (English)

    Hilton

    2010-01-01

    对于我们国内的朋友来说,Scion似乎属于稀缺的品牌,其稀缺的程度足以和宾利、迈巴赫等豪车相提并论。这倒不是说它的产品定位亦如此高端,而是因为它是只针对北美市场而生的品牌。如此说来,我倒觉得有必要将Scion介绍一番。

  20. Inpatients’ opinions on a hospital in Portugal [v1; ref status: indexed, http://f1000r.es/xb

    Directory of Open Access Journals (Sweden)

    Carina C Silva

    2013-02-01

    Full Text Available Background: Little is known about the relationship between the opinions of inpatients and the degree to which hospitals are improving in performance over time. The aim of this study was to determine the personal assessment level of inpatients or their representatives regarding aspects of health care in an internal medicine ward. Methods: We carried out a questionnaire in September 2011 with 284 discharged patients and patient representatives, focusing on their opinions about the department, health professionals and amenities, with response options ranging from 1 (very bad to 5 (very good. The relationships between domains from the questionnaire and socio-demographic factors were examined using a t-test and one-way ANOVA. Results: The response rate was 78%. The patients showed a slightly higher mean score (m for factors in the medical care domain than did the patient representatives (m = 4.51 vs. m = 4.27; p = 0.014. The mean score of all the items in all domains was 4.24; this allowed us to determine the difference from the overall mean (DIFM for medical care (DIFM = 0.18; p = 0.000, foods (DIFM = –0.31; p = 0.000, diagnostic tests (DIFM = –0.15; p = 0.036 and transport (DIFM = –0.41; p = 0.000. Respondents with a medium or higher educational level gave lower scores to the domains food (m = 3.74; p = 0.004, diagnostic tests (m = 3.72; p = 0.04 and transport (m = 3.62; p = 0.025 than those with lower educational levels. The domains facilities (m = 2.4; p = 0.04 and diagnostic tests (m = 3.63; p = 0.009 were given lower scores by those aged <50 years compared with older respondents. Conclusions: Our findings suggest that the evaluation of the responders will allow the hospital management to make improvements in the quality of care.

  1. Search for the Xb and other hidden-beauty states in the π+π−Υ(1S) channel at ATLAS

    Czech Academy of Sciences Publication Activity Database

    Aad, G.; Abbott, B.; Abdallah, J.; Böhm, Jan; Chudoba, Jiří; Havránek, Miroslav; Hejbal, Jiří; Jakoubek, Tomáš; Kepka, Oldřich; Kupčo, Alexander; Kůs, Vlastimil; Lokajíček, Miloš; Lysák, Roman; Marčišovský, Michal; Mikeštíková, Marcela; Němeček, Stanislav; Šícho, Petr; Staroba, Pavel; Svatoš, Michal; Taševský, Marek; Vrba, Václav

    2015-01-01

    Roč. 740, Jan (2015), 199-217. ISSN 0370-2693 R&D Projects: GA MŠk(CZ) LG13009 Institutional support: RVO:68378271 Keywords : experimental results * ATLAS * CERN LHC Coll Subject RIV: BF - Elementary Particles and High Energy Physics Impact factor: 6.131, year: 2014

  2. Raman-spectroscopical investigations of glasses in the systems Li2X-B2O3-SiO2 with X = O, Cl2

    International Nuclear Information System (INIS)

    Raman spectra have been made with glasses of two series of these systems. In variating the Li2O-content it was possible to show the development of the relation of three- and fourfold co-ordinated boron from the borate bands. The formation of nonbridging oxygens at SiO4-tetrahedra is favoured in comparison to the forming of pyro- and ortho-borate groups with one and two nonbridging oxygens per BO3. The substitution of a part of lithium oxide by lithium chloride leads to phase separated glasses in the region of immiscibility border and their spectra will be more and more indefinite with growing immiscibility. The authors use the Raman spectra to confirm a lithium borate rich matrix for a glass with the same B2O3 and SiO2 content. (author)

  3. Low-temperature and high-pressure xB5SR study of the strongly correlated CeNiSn Hx compounds

    Science.gov (United States)

    Isnard, O.; Rusu, C.; Dudric, R.; Andreica, D.; Amato, A.; Chevalier, B.

    2016-06-01

    Hydrogen insertion in the CeNiSn Kondo semiconductor induces antiferromagnetic ordering for CeNiSnH below TN=4.5 K whereas CeNiSn H1.8 orders ferromagnetically below TC=7.0 K . We present a detailed investigation of these CeNiSn Hx compounds by means of muon spin spectroscopy performed at both ambient and high pressure (up to 23 kbar). It is shown that both magnetic ordering temperatures are sensitive to the applied pressure but in opposite directions, i.e., d/TC d p =-0.17 K kba r-1 for CeNiSn H1.8 and d/TN d p =0.016 K kba r-1 for CeNiSnH, respectively. This difference is discussed in terms of hydrogen-induced modification of the balance between the Ruderman-Kittel-Kasuya-Yosida (RKKY) and the Kondo interactions. The µSR study demonstrates that the CeNiSnH and CeNiSn H1.8 are on different sides of Doniach's dome. The behavior of the CeNiSn H1.8 is interpreted as resulting from an increase of the hybridization between 4 f and 5 d states and a concomitant steep increase of the Kondo temperature upon applying pressure. In the quest for a quantum critical point, an estimated pressure of about 35 kbar is expected to suppress the magnetism in CeNiSn H1.8 .

  4. Some structural and optical properties of (Bi2O3)x(ZnO)60-x(B2O3)40 glasses

    Czech Academy of Sciences Publication Activity Database

    Tichá, H.; Kincl, Miloslav; Tichý, Ladislav

    2013-01-01

    Roč. 138, 2-3 (2013), s. 633-639. ISSN 0254-0584 Institutional support: RVO:61389013 Keywords : glasses * Raman spectroscopy and scattering * Fourier transform infrared spectroscopy Subject RIV: CA - Inorganic Chemistry Impact factor: 2.129, year: 2013

  5. Preparation and Characterization of Mg1-xB2 Bulk Samples and Cu/Nb Sheathed Wires with Low Grade Amorphous Boron Powder

    DEFF Research Database (Denmark)

    Grivel, Jean-Claude; Alexiou, Aikaterini; Rubesova, Katerina;

    2014-01-01

    MgB2 bulk and wire samples were prepared using cheap, low grade amorphous boron powders. Based on chemical analysis performed on the starting reagents, three nominal stoichiometries were studied. It was found that the structural and superconducting properties of the bulk samples were not affected...... by the composition, but that residual Mg was left in the wires for the nominal MgB2 composition. In contrast, slightly Mg-deficient compositions were free from residual Mg and exhibited higher critical current densities. The MgB2 phase formation kinetics was not influenced by the variations in the...... nominal powder composition....

  6. Tunable deep ultraviolet femtosecond sum frequency laser based on Ba1-xB2-y-zO4SixAlyGaz crystal%Ba1-xB2-y-z O4SixAly Gaz晶体和频可调谐深紫外飞秒激光器∗

    Institute of Scientific and Technical Information of China (English)

    孟祥昊; 刘华刚; 黄见洪; 戴殊韬; 邓晶; 阮开明; 陈金明; 林文雄

    2015-01-01

    Tunable coherent deep ultraviolet (DUV) light sources, especially ultrashort pulse DUV lasers have great appli-cations in the fields of time-resolved, material processing, spectroscopy, laser spectroscopy and laser fusion. In the UV region, the best choice of generating the laser pulses in the femtosecond or picosecond regime is the frequency up-conversation technique based on second order nonlinearities. Over the past three decades, quite a lot of nonlinear crystals, such as LiB3O5, β-BaB2O4, KBe2BO3F2 and Ba1−xB2−y−zO4SixAlyGaz have been developed and employed for gener-ating the femtosecond pulses in the blue, ultraviolet, and even the deep-ultraviolet region. A tunable deep ultraviolet femtosecond laser is experimentally studied based on the new nonlinear crystal Ba1−xB2−y−zO4SixAlyGaz It is a kind of low-temperature phase barium metaborate single crystal belonging to a trigonal system, doped with one or more elements selected from Si, Al and Ga. As an optimized β-BaB2O4 crystal, Ba1−xB2−y−zO4SixAlyGaz completely overcomes the shortcomings of deliquescence compared withβ-BaB2O4, and its nonlinear efficiency and optical damage threshold have also been greatly improved. Using two crystals as second harmonic generation is to compensate for the spatial walk-off effect and the light path walk-off due to refraction effect The optical axis of the second Ba1−xB2−y−zO4SixAlyGaz is twice the phase matching angle with respect to the first one. In a femtosecond regime, short pulse provides high efficient frequency conversation due to their high peak powers, but the group velocity mismatch is a cognitive factor to limit conversion efficiency. It is obvious that after the frequency doubling, the second harmonic pulse and fundamental pulse separate from each other. The second harmonic pulse lags behind the fundamental pulse as they propagate through the crystal and the second harmonic pulse is broadened into a longer pulse duration than the fundamental pulse The method to compensate for the group velocity mismatch is to adjust the path length between the fundamental and second harmonic pulse by means of time delay line. It consists of beam splitters and mirrors. Tunable deep ultraviolet pulse within a wavelength range from 192.5 to 210 nm is produced, with a maximum average power of 5.8 mW, under a 2.78 W fundamental power. The average power of second harmonic, third harmonic and fourth harmonic are 1.28 W, 194 mW and 5.8 mW at the fundamental wavelength of 800 nm, corresponding to conversion efficiencies of 46.14%, 15.16% and 3%from the previous stage, respectively. The duration of the third harmonic pulse is 640.4 fs at 266.7 nm as measured by the cross-correlation technique.%介绍了一种基于新型非线性晶体Ba1−xB2−y−zO4SixAlyGaz 的可调谐深紫外飞秒激光光源.从理论上分析了基频光和倍频光在通过非线性晶体时所造成的空间走离和群速度失配,为了补偿空间走离以及波长调谐过程中晶体折射造成的光束偏离现象,将两块相同的倍频晶体成镜像放置来产生二次谐波.并调节延迟线的长度来补偿基频光和倍频光之间的群速度失配,从而提高和频转换效率.然后通过和频方式进行三倍频和四倍频来突破晶体相位匹配条件的限制,产生了波长低于200 nm的深紫外飞秒激光.利用钛宝石激光器提供基频光光源,最终在250—300 nm,192.5—210 nm范围内获得了高重频、可调谐超短脉冲紫外和深紫外激光.并在基频光波长为800 nm时,得到的二倍频、三倍频和四倍频的功率分别为1.28 W,194 mW和5.8 mW,相对于前一级的转换效率依次为46.14%,15.16%和3%.采用互相关法测量得到266.7 nm紫外激光的脉冲宽度约为640.4 fs.

  7. A soft X-ray spectral episode for the Clocked Burster, GS 1826-24 as measured by Swift and NuSTAR

    DEFF Research Database (Denmark)

    Chenevez, J.; Galloway, D.K.; in ’t Zand, J.J.M.;

    2016-01-01

    % mEdd within the range of previous observations. However, the best-fit spectral model, adopting the double Comptonization used previously, exhibits significantly softer components. We detect seven type-I X-ray bursts, all significantly weaker (and with shorter rise and decay times) than observed...

  8. Phantom bursting is highly sensitive to noise and unlikely to account for slow bursting in beta-cells

    DEFF Research Database (Denmark)

    Pedersen, Morten Gram

    2007-01-01

    cells are subjected to stochastic fluctuations in plasma membrane currents, which are likely to disturb the bursting mechanism and transform medium bursters into spikers or very fast bursters. We present a polynomial, minimal, phantom burster model and show that noise modifies the plateau fraction and......-called compound bursting can be converted to apparent slow bursting by noise, which could explain why compound bursting and mixed Ca oscillations are seen mainly in intact islets....

  9. Comparative Genomics between Two Xenorhabdus bovienii Strains Highlights Differential Evolutionary Scenarios within an Entomopathogenic Bacterial Species.

    Science.gov (United States)

    Bisch, Gaëlle; Ogier, Jean-Claude; Médigue, Claudine; Rouy, Zoé; Vincent, Stéphanie; Tailliez, Patrick; Givaudan, Alain; Gaudriault, Sophie

    2016-01-01

    Bacteria of the genus Xenorhabdus are symbionts of soil entomopathogenic nematodes of the genus Steinernema. This symbiotic association constitutes an insecticidal complex active against a wide range of insect pests. Within Xenorhabdus bovienii species, the X. bovienii CS03 strain (Xb CS03) is nonvirulent when directly injected into lepidopteran insects, and displays a low virulence when associated with its Steinernema symbiont. The genome of Xb CS03 was sequenced and compared with the genome of a virulent strain, X. bovienii SS-2004 (Xb SS-2004). The genome size and content widely differed between the two strains. Indeed, Xb CS03 had a large genome containing several specific loci involved in the inhibition of competitors, including a few NRPS-PKS loci (nonribosomal peptide synthetases and polyketide synthases) producing antimicrobial molecules. Consistently, Xb CS03 had a greater antimicrobial activity than Xb SS-2004. The Xb CS03 strain contained more pseudogenes than Xb SS-2004. Decay of genes involved in the host invasion and exploitation (toxins, invasins, or extracellular enzymes) was particularly important in Xb CS03. This may provide an explanation for the nonvirulence of the strain when injected into an insect host. We suggest that Xb CS03 and Xb SS-2004 followed divergent evolutionary scenarios to cope with their peculiar life cycle. The fitness strategy of Xb CS03 would involve competitor inhibition, whereas Xb SS-2004 would quickly and efficiently kill the insect host. Hence, Xenorhabdus strains would have widely divergent host exploitation strategies, which impact their genome structure. PMID:26769959

  10. Phantom bursting is highly sensitive to noise and unlikely to account for slow bursting in beta-cells

    DEFF Research Database (Denmark)

    Pedersen, Morten Gram

    2007-01-01

    Pancreatic beta-cells show bursting electrical activity with a wide range of burst periods ranging from a few seconds, often seen in isolated cells, over tens of seconds (medium bursting), usually observed in intact islets, to several minutes. The phantom burster model [Bertram, R., Previte, J...... cells are subjected to stochastic fluctuations in plasma membrane currents, which are likely to disturb the bursting mechanism and transform medium bursters into spikers or very fast bursters. We present a polynomial, minimal, phantom burster model and show that noise modifies the plateau fraction and...... lowers the burst period dramatically in phantom bursters. It is therefore unlikely that slow bursting in single cells is driven by the slow phantom bursting mechanism, but could instead be driven by oscillations in glycolysis, which we show are stable to random ion channel fluctuations. Moreover, so...

  11. The application of GxA8xB9nther Tulip retrievable inferior vena cava filter in interventional treatment for acute deep venous thrombosis of lower extremity

    International Nuclear Information System (INIS)

    Objective: To discuss the therapeutic efficacy and manipulation skill of Gunther Tulip retrievable inferior vena cava filter in interventional treatment for acute deep venous thrombosis of lower extremity. Methods: From September 2007 to April 2008, a total of 36 patients with acute deep venous thrombosis of lower extremity were treated in our hospital. The time of the onset of disease ranged from 1 day to 12 days. The precipitation causes included prolonged lying in bed due to surgery or bone fracture (n = 18) and postpartum (n = 5), while no obvious precipitation causes could be found in 13 patients. Pulmonary embolism was coexisted in 12 cases. Clinically, the affected limb was swelling and painful, the skin was cyan-purple or pale in color with higher skin temperature. The circumferential length of the affected thigh was 3-10 cm longer than that of normal side. Patients with coexisted pulmonary embolism had the clinical presentation of dyspnea, chest pain, hemoptysis, etc. Gunther Tulip retrievable inferior vena cava filter was implanted via femoral venous access or via right internal jugular venous access, which was followed by intravenous transcatheter thrombolysis. Vascular ultrasonography and angiography were performed 45-75 days after the treatment to confirm that there was no fresh or free thrombus in the veins of lower limb or in the pulmonary arteries. When it was confirmed, Gunther Tulip retrievable inferior vena cava filter was taken out via right internal jugular venous access, which was followed by inferior venacavography. After the procedure anticoagulation and antibiotic medication were employed for 3-5 days. A follow-up for 4-10 months was made. Results: A total of 36 Gunther Tulip retrievable inferior vena cava filters were successfully implanted by one procedure, the average time cost for the filter delivery was 1.5 minutes (0.5-5 minutes). During the delivery procedure, the amplitude of elastic displacement of filter was less than 2 mm. One filter was implanted with a tilt of 25 degrees, and no newly-developed clinical manifestations of pulmonary embolism appeared after filter implant. In twelve patients Gunther Tulip filters were successfully retrieved by single manipulation in 45-75 days after filter delivery, and the retrieval procedure took the mean time of 4.4 minutes (2-15 minutes). Inferior venacavography confirmed that no vascular perforation or rupture occurred. In the remaining 24 patients the filters were kept in inferior vena cava and no clinical symptoms related to pulmonary embolism or inferior vena cava occlusion were observed during the follow-up period. Conclusion: Gunther Tulip retrievable inferior vena cava filter has many advantages in clinical use. The filter can be accurately placed to the scheduled position, it is very powerful in capturing the thrombus, it can be hold in the inferior vena cava for long time (long time window for thrombolysis therapy) before it is planed to be retrieved, and its retrieval success is very high. Moreover, with high technical successful rate the implantation of Gunther Tulip retrievable inferior vena cava filter is very safe and effective for the interventional treatment of acute deep venous thrombosis of lower extremity. (authors)

  12. Existence of flips and minimal models for 3-folds in char p

    OpenAIRE

    Birkar, Caucher

    2013-01-01

    We will prove the following results for $3$-fold pairs $(X,B)$ over an algebraically closed field $k$ of characteristic $p>5$: log flips exist for $\\Q$-factorial dlt pairs $(X,B)$; log minimal models exist for projective klt pairs $(X,B)$ with pseudo-effective $K_X+B$; the log canonical ring $R(K_X+B)$ is finitely generated for projective klt pairs $(X,B)$ when $K_X+B$ is a big $\\Q$-divisor; semi-ampleness holds for a nef and big $\\Q$-divisor $D$ if $D-(K_X+B)$ is nef and big and $(X,B)$ is p...

  13. NGC 300 X-1 and IC 10 X-1: a new breed of black hole binary?

    Science.gov (United States)

    Barnard, R.; Clark, J. S.; Kolb, U. C.

    2008-09-01

    Context: IC 10 X-1 has recently been confirmed as a black hole (BH) + Wolf-Rayet (WR) X-ray binary, and NGC 300 X-1 is thought to be. The only other known BH+WR candidate is Cygnus X-3. IC 10 X-1 and NGC 300 X-1 have similar X-ray properties, with 0.3-10 keV luminosities ~1038 erg s-1, and their X-ray lightcurves exhibit orbital periods ~30 h. Aims: We investigate similarities between IC 10 X-1 and NGC 300 X-1, as well as differences between these systems and the known Galactic BH binary systems. Methods: We have examined all four XMM-Newton observations of NGC 300 X-1, as well as the single XMM-Newton observation of IC 10 X-1. For each observation, we extracted lightcurves and spectra from the pn, MOS1 and MOS2 cameras; power density spectra were constructed from the lightcurves, and the X-ray emission spectra were modeled. Results: Each source exhibits power density spectra that are well described by a power law with index, γ, ~1. Such variability is characteristic of turbulence in wind accretion or disc-accreting X-ray binaries (XBs) in the high state. In this state, Galactic XBs with known BH primaries have soft, thermal emission; however the emission spectra of NGC 300 X-1 and IC 10 X-1 in the XMM-Newton observations are predominantly non-thermal. Furthermore, the Observation 1 spectrum of NGC 300 X-1 is strikingly similar to that of IC 10 X-1. Conclusions: The remarkable similarity between the behaviour of NGC 300 X-1 in Observation 1 and that of IC 10 X-1 lends strong evidence for NGC 300 X-1 being a BH+WR binary. Our spectral modeling rules out Bondi-Hoyle accretion onto a neutron star (NS) for NGC 300 X-1, but not a disc-accreting NS+WR system, nor a NS low mass X-ray binary (LMXB) that is merely coincident with the WR. We favour disc accretion for both systems, but cannot exclude Bondi-Hoyle accretion onto a BH. The unusual spectra of NGC 300 X-1 and IC 10 X-1 may be due to these systems existing in a persistently high state, whereas all known BH LMXBs

  14. Bursting oscillations, bifurcation and synchronization in neuronal systems

    International Nuclear Information System (INIS)

    Highlights: → We investigate bursting oscillations and related bifurcation in the modified Morris-Lecar neuron. → Two types of fast-slow bursters are analyzed in detail. → We show the properties of some crucial bifurcation points. → Synchronization transition and the neural excitability are explored in the coupled bursters. - Abstract: This paper investigates bursting oscillations and related bifurcation in the modified Morris-Lecar neuron. It is shown that for some appropriate parameters, the modified Morris-Lecar neuron can exhibit two types of fast-slow bursters, that is 'circle/fold cycle' bursting and 'subHopf/homoclinic' bursting with class 1 and class 2 neural excitability, which have different neuro-computational properties. By means of the analysis of fast-slow dynamics and phase plane, we explore bifurcation mechanisms associated with the two types of bursters. Furthermore, the properties of some crucial bifurcation points, which can determine the type of the burster, are studied by the stability and bifurcation theory. In addition, we investigate the influence of the coupling strength on synchronization transition and the neural excitability in two electrically coupled bursters with the same bursting type. More interestingly, the multi-time-scale synchronization transition phenomenon is found as the coupling strength varies.

  15. Drug: D02304 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D02304 Drug Lysine ... (USAN/INN); L-Lysine ... C6H14N2O2 146.1055 146.1876 D02304.gif Amino Acid Same a ... I.V. SOLUTION ADDITIVES B05XB Amino acids B05XB03 Lysine ... D02304 Lysine ... (USAN/INN) CAS: 56-87-1 PubChem: 784 ...

  16. Fracture of explosively compacted aluminum particles in a cylinder

    Science.gov (United States)

    Frost, David; Loiseau, Jason; Goroshin, Sam; Zhang, Fan; Milne, Alec; Longbottom, Aaron

    2015-06-01

    The explosive compaction, fracture and dispersal of aluminum particles contained within a cylinder have been investigated experimentally and computationally. The aluminum particles were weakly confined in a cardboard tube and surrounded a central cylindrical burster charge. The compaction and fracture of the particles are visualized with flash radiography and the subsequent fragment dispersal with high-speed photography. The aluminum fragments produced are much larger than the original aluminum particles and similar in shape to those generated from the explosive fracture of a solid aluminum cylinder, suggesting that the shock transmitted into the aluminum compacts the powder to near solid density. The casing of the burster explosive (plastic-, copper-, and un-cased charges were used) had little influence on the fragment size. The effect of an air gap between the burster and the aluminum particles was also investigated. The particle motion inferred from the radiographs is compared with the predictions of a multimaterial hydrocode.

  17. Doppler Tomography of XTE J2123-058 and Other Neutron Star LMXBs

    OpenAIRE

    Hynes, R.I.; Charles, P. A.; C. A. Haswell; Casares, J.; Zurita, C.

    2000-01-01

    We describe Doppler tomography obtained in the 1998 outburst of the neutron star low mass X-ray binary (LMXB) XTE J2123-058. This analysis, and other aspects of phase-resolved spectroscopy, indicate similarities to SW Sex systems, except that anomalous emission kinematics are seen in HeII, whilst phase 0.5 absorption is confined to H alpha. This separation of these effects may provide tighter constraints on models in the LMXB case than is possible for SW Sex systems. We will compare results f...

  18. Theory of optical flashes

    International Nuclear Information System (INIS)

    The theory of optical flashes created by x- and γ-ray burst heating of stars in binaries is reviewed. Calculations of spectra due to steady-state x-ray reprocessing and estimates of the fundamental time scales for the non-steady case are discussed. The results are applied to the extant optical data from x-ray and γ-ray bursters. Finally, I review predictions of flashes from γ-ray bursters detectable by a state of the art all-sky optical monitor

  19. Drug: D07746 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D07746 Drug Colistin (INN); CL; Sogecoli (TN) C52H97N16O13R D07746.gif Bacillus pol...TINAL ANTIINFECTIVES A07AA Antibiotics A07AA10 Colistin D07746 Colistin (INN) J ANTIINFECTIVES FOR SYSTEMIC ...USE J01 ANTIBACTERIALS FOR SYSTEMIC USE J01X OTHER ANTIBACTERIALS J01XB Polymyxins J01XB01 Colistin D07746 Colistin...ction inhibitors Polymyxins Colistin [ATC:A07AA10 J01XB01] D07746 Colistin (INN) CAS: 1066-17-7 PubChem: 510

  20. 起伏多相管流压降计算方法的研究%Pressure Drop Account Method Study for Fluctuation Multiphase Pipe Flow

    Institute of Scientific and Technical Information of China (English)

    喻西崇; 冯叔初

    2000-01-01

    摘要以Pipephase多相流软件和西安交通大学多相流软件为基础,筛选出几种适用于油田现场,精度较好的压降组合模型.在众多压降组合关系式中,DEF、MUBE、XB-BAR-BB-CW-MW、XB-BAR-DEF-CW-MW和XB-BAR-MB-CW-MW等组合压降相关式计算多相管流准确性较高.

  1. Hunting for the Xb via radiative decays

    OpenAIRE

    Li, Gang; Wang, Wei

    2014-01-01

    In this paper, we study radiative decays of Xb , the counterpart of the famous X(3872) in the bottomonium-sector as a candidate for meson–meson molecule, into the γϒ(nS) ( n=1,2,3 ). Since it is likely that the Xb is below the BB¯⁎ threshold and the mass difference between the neutral and charged bottom meson is small compared to the binding energy of the Xb , the isospin violating decay mode Xb→ϒ(nS)π+π− would be greatly suppressed. This will promote the importance of the radiative decays. W...

  2. Big Game Hunting in the Andromeda Galaxy: identifiying and weighing black holes in low mass X-ray Binaries

    Science.gov (United States)

    Barnard, R.

    2004-07-01

    We have devised a new technique for identifying stellar mass black holes in low mass X-ray binaries, and have applied it to XMM-Newton observations of two X-ray sources in M31. In particular we search for low accretion rate power density spectra; these are very similar for all LMXB, whether the primary is a black hole or a neutron star. Galactic neutron star LMXB exhibit these distinctive PDS at very low luminosities ( ˜ 1036 erg s-1) while black hole LMXB can exhibit them at luminosities > 1038 erg s-1! Following the work of van der Klis (1994), we assume a maximum accretion rate (as a fraction of the Eddington limit) for low accretion rate PDS that is constant for all LMXB, and obtain an empirical value of ˜ 10% Eddington. We have so far discovered two candidate black hole binaries in M31, exhibiting low accretion rate PDS at up to 3×1038 and 5×1037 erg s-1. If we assume that they are at 5×1037 erg s-1 is likely to have a black hole primary.

  3. M31 globular cluster structures and the presence of X-ray binaries

    CERN Document Server

    Agar, J R R

    2013-01-01

    [Abridged] M31 has several times more globular clusters (GCs) than the Milky Way. It contains a correspondingly larger number of low mass X-ray binaries (LMXBs) associated with GCs, and can be used to investigate the GC properties which lead to X-ray binary formation. The best tracer of the spatial structure of M31 GCs is high-resolution imaging from the Hubble Space Telescope, and we have used HST data to derive structural parameters for 29 LMXB-hosting M31 GCs. These measurements are combined with structural parameters from the literature for a total of 41 (of 50 known) LMXB GCs and a comparison sample of 65 non-LMXB GCs. Structural parameters measured in blue bandpasses are found to show smaller core radii and higher concentrations than those measured in red bandpasses; this difference is enhanced in LMXB clusters and could be related to stellar population differences. Clusters with LMXBs show higher collision rates for their mass compared to those without LMXBs and collision rates estimated at the core ra...

  4. Chandra detection of increased X-ray activity from SAX J1747.0-2853

    Science.gov (United States)

    Clavel, M.; Tomsick, J. A.; Terrier, R.; Goldwurm, A.

    2016-06-01

    We report the detection of a bright halo in the Chandra ACIS-I observation obtained on 2016 May 17 (ObsID 18852, MJD 57525). The shape of this diffuse emission is consistent with a dust scattering halo surrounding the neutron star LMXB SAX J1747.0-2853, which is outside of the field of view.

  5. INTEGRAL finds renewed X-ray activity of the Neutron star X-ray transient SAX J1750.8-2900

    DEFF Research Database (Denmark)

    Sanchez-Fernandez, Celia; Chenevez, Jérôme; Kuulkers, Erik;

    2015-01-01

    INTEGRAL Galactic bulge monitoring observations (ATel #438) on UT 13 September 2015 18:50-22:32 reveal renewed X-ray activity from the low-mass X-ray binary transient and Type I X-ray burster SAX J1750.8-2900 (IAU Circ. #6597). The last outburst from this source was reported in 2011 (ATels #3170,...

  6. Hubble Space Telescope STIS Observations of GRB 000301C: CCD Imaging and Near-Ultraviolet MAMA Spectroscopy

    NARCIS (Netherlands)

    A. Smette; A.S. Fruchter; Th.R. Gull; K.C. Sahu; L. Petro; H. Ferguson; J. Rhoads; D.J. Lindler; R.A.M.J. Wijers

    2001-01-01

    We present Space Telescope Imaging Spectrograph observations of the optical transient (OT) counterpart of the gamma-ray burster GRB 000301C obtained 5 days after the burst, on 2000 March 6. CCD clear-aperture imaging reveals a R~=21.50+/-0.15 source with no apparent host galaxy. An 8000 s, 1150 Å

  7. Bifurcation of a Saddle-Node Limit Cycle with Homoclinic Orbits Satisfying the Small Lobe Condition in a Leech Neuron Model

    Institute of Scientific and Technical Information of China (English)

    YOOER Chi-Feng; XU Jian-Xue; ZHANG Xin-Hua

    2009-01-01

    Mechanism of period-adding cascades with chaos in a reduced leech neuron model is suggested as the bifurcation of a saddle-node limit cycle with homoclinic orbits satisfying the "small lobe condition",instead of the blue-sky catastrophe.In every spiking adding,the new spike emerges at the end of the spiking phase of the bursters.

  8. GENERAL: Bifurcation of a Saddle-Node Limit Cycle with Homoclinic Orbits Satisfying the Small Lobe Condition in a Leech Neuron Model

    Science.gov (United States)

    Yooer, Chi-Feng; Xu, Jian-Xue; Zhang, Xin-Hua

    2009-08-01

    Mechanism of period-adding cascades with chaos in a reduced leech neuron model is suggested as the bifurcation of a saddle-node limit cycle with homoclinic orbits satisfying the “small lobe condition", instead of the blue-sky catastrophe. In every spiking adding, the new spike emerges at the end of the spiking phase of the bursters.

  9. Hubble Space Telescope STIS observations of GRB 000301C: CCD imaging and near-ultraviolet MAMA spectroscopy

    DEFF Research Database (Denmark)

    Smette, A.; Fruchter, A.S.; Gull, T.R.;

    2001-01-01

    We present Space Telescope Imaging Spectrograph observations of the optical transient (OT) counterpart of the c-ray burster GRB 000301C obtained 5 days after the burst, on 2000 March 6. CCD clear-aperture imaging reveals a R similar or equal to 21.50 +/- 0.15 source with no apparent host galaxy. ...

  10. The dance of the double stars

    International Nuclear Information System (INIS)

    The paper concerns pairs of stars orbiting one another. The evolutionary path model for close binary stars, involving a mass transfer of gases between the stars, is described. The life history of a single star; cataclysmic variables; the algol paradox, matter and lagranges' point; x-ray binaries and bursters; and pulsars; are all briefly discussed. (U.K.)

  11. Dance of the double stars

    Energy Technology Data Exchange (ETDEWEB)

    Theokas, A.

    1985-09-19

    The paper concerns pairs of stars orbiting one another. The evolutionary path model for close binary stars, involving a mass transfer of gases between the stars, is described. The life history of a single star; cataclysmic variables; the algol paradox, matter and lagranges' point; x-ray binaries and bursters; and pulsars; are all briefly discussed.

  12. INTEGRAL confirms the detection of renewed activity from the NS transient H 1658-298

    DEFF Research Database (Denmark)

    Sanchez-Fernandez, C.; Eckert, D.; Bozzo, E.;

    2015-01-01

    Crab, 4.5-sigma significance in the 20-40 keV energy band) by IBIS, the Imager Onboard the INTEGRAL Satellite. H 1658-298 is a known X-ray burster. Therefore we have searched for Type-I burst activity in the JEM-X data during these observations, but no indications of burst activity have been found. We...

  13. THE NEAREST BISYMMETRIC SOLUTIONS OF LINEAR MATRIX EQUATIONS

    Institute of Scientific and Technical Information of China (English)

    Zhen-yun Peng; Xi-yan Hu; Lei Zhang

    2004-01-01

    The necessary and sufficient conditions for the existence of and the expressions for bismmetric soutions of the matrix equation(Ⅰ)A1X1B1+A2X2B2+…AkXkBk=D,(Ⅱ)A1XB1+A2XB2+…+AkXBk=D and (Ⅲ)(A1XB1,A2XB2,…,AkXBK)=(D1,D2,…,Dk) are derived by using kronecker product and Moore-Penrose generalized inverse of matrices. In addition, in corresponding solution set of the matrix equations, the explicit expression of the nearest matrix to a given matrix in the Frobenius norm is given.Numerical methods and numerical experiments of finding the nearest solutions are also provided.

  14. Drug: D02138 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D02138 Drug Colistin sulfate (JP16/USP); Coly-Mycin S; Colymycin S (TN) (C52H97N16O...13R)2. 5H2SO4 D02138.gif Antibacterial Same as: C13768 ATC code: A07AA10 J01XB01 Colistin A (R = -CH3) Colistin...INTESTINAL ANTIINFECTIVES A07AA Antibiotics A07AA10 Colistin D02138 Colistin sulfate (JP16/USP) J ANTIINFECT...IVES FOR SYSTEMIC USE J01 ANTIBACTERIALS FOR SYSTEMIC USE J01X OTHER ANTIBACTERIALS J01XB Polymyxins J01XB01 Colistin D02138 Colistin...erials Others Cell membrane function inhibitors Polymyxins Colistin [ATC:A07AA10 J01XB01] D02138 Colistin su

  15. Periodic orbits of circle homeomorphisms with a break point

    International Nuclear Information System (INIS)

    Let fθ(x) = F0(x) + θ (mod1), x is an element of S1 , θ is an element of [0,1] be a family of preserving orientation circle homeomorphisms with a single break point xb, i.e. with a jump in the first derivative F0 at the point x = xb. Suppose that F'0(x) is absolutely continuous on [xb, xb +1] and F''0(x) is an element of Lα([0,1]) for some α> 1. Consider fθ with rational rotation number ρθ = p/q of rank n, i.e. p/q = [k1, k2, ...,kn]. We prove that for sufficiently large n, the homeomorphism fθ has either a unique periodic orbit of period q or two periodic orbits of period q. Also the renormalization behaviour of fθ with rational rotation number p ρθ = p/q is studied. (author)

  16. Ranks of the Common Solution to Six Quaternion Matrix Equations

    Institute of Scientific and Technical Information of China (English)

    Qing-wen Wang; Yan Zhou; Qin Zhang

    2011-01-01

    A new expression is established for the common solution to six classical linear quaternion matrix equations A1X = C1, XB1 = C3, A2X = C2, XB2 = C4, A3XB3 = C5, A4XB4 = C6 which was investigated recently by Wang, Chang and Ning (Q. Wang, H. Chang, Q. Ning, The common solution to six quaternion matrix equations with applications, Appl. Math. Comput. 195: 721-732 (2008)). Formulas are derived for the maximal and minimal ranks of the common solution to this system. Moreover, corresponding results on some special cases are presented. As an application, a necessary and sufficient condition is presented for the invariance of the rank of the general solution to this system. Some known results can be regarded as the special cases of the results in this paper.

  17. X(3872) and its bottomonium counterpart at ATLAS

    CERN Document Server

    Kordas, Kostantinos; The ATLAS collaboration

    2016-01-01

    We present the measurement of the differential cross-section of the X(3872) state through its decays to $J/\\psi \\pi^+ \\pi^-$ final state . The cross-section was extracted for both prompt and non-prompt production. The existence of the X(3872) suggests the presence of its bottomonium counterpart $X_b$. Search for $X_b$ with the ATLAS experiment in several final states, including $\\Upsilon \\pi^+ \\pi^-$, is presented.

  18. X(3872) and its bottomonium counterpart at ATLAS

    CERN Document Server

    Kordas, Kostantinos; The ATLAS collaboration

    2016-01-01

    We present the measurement of the differential cross-section of the X(3872) state through its decays to J/psi pi pi final state . The cross-section was extracted for both prompt and non-prompt production. The existence of the X(3872) suggests the presence of its bottomonium counterpart X_b. Search for X_b with the ATLAS experiment in several final states, including Upsilon pi pi, is presented.

  19. Development of X-band high power pulsed klystrons

    International Nuclear Information System (INIS)

    A 30MW X-band (11.424GHz) pulsed klystron (XB50K) has been tested up to a peak power of 26MW with a pulse duration of 50ns at a beam voltage of 470kV. A 100MW X-band pulsed klystron (XB72K) has been tested up to a peak power of 79MW with a pulse duration of 50ns at a beam voltage of 580kV. (author)

  20. A Spatially Detailed Model of Isometric Contraction Based on Competitive Binding of Troponin I Explains Cooperative Interactions between Tropomyosin and Crossbridges.

    Science.gov (United States)

    Land, Sander; Niederer, Steven A

    2015-08-01

    Biophysical models of cardiac tension development provide a succinct representation of our understanding of force generation in the heart. The link between protein kinetics and interactions that gives rise to high cooperativity is not yet fully explained from experiments or previous biophysical models. We propose a biophysical ODE-based representation of cross-bridge (XB), tropomyosin and troponin within a contractile regulatory unit (RU) to investigate the mechanisms behind cooperative activation, as well as the role of cooperativity in dynamic tension generation across different species. The model includes cooperative interactions between regulatory units (RU-RU), between crossbridges (XB-XB), as well more complex interactions between crossbridges and regulatory units (XB-RU interactions). For the steady-state force-calcium relationship, our framework predicts that: (1) XB-RU effects are key in shifting the half-activation value of the force-calcium relationship towards lower [Ca(2+)], but have only small effects on cooperativity. (2) XB-XB effects approximately double the duty ratio of myosin, but do not significantly affect cooperativity. (3) RU-RU effects derived from the long-range action of tropomyosin are a major factor in cooperative activation, with each additional unblocked RU increasing the rate of additional RU's unblocking. (4) Myosin affinity for short (1-4 RU) unblocked stretches of actin of is very low, and the resulting suppression of force at low [Ca(2+)] is a major contributor in the biphasic force-calcium relationship. We also reproduce isometric tension development across mouse, rat and human at physiological temperature and pacing rate, and conclude that species differences require only changes in myosin affinity and troponin I/troponin C affinity. Furthermore, we show that the calcium dependence of the rate of tension redevelopment k(tr) is explained by transient blocking of RU's by a temporary decrease in XB-RU effects. PMID:26262582

  1. A Spatially Detailed Model of Isometric Contraction Based on Competitive Binding of Troponin I Explains Cooperative Interactions between Tropomyosin and Crossbridges.

    Directory of Open Access Journals (Sweden)

    Sander Land

    2015-08-01

    Full Text Available Biophysical models of cardiac tension development provide a succinct representation of our understanding of force generation in the heart. The link between protein kinetics and interactions that gives rise to high cooperativity is not yet fully explained from experiments or previous biophysical models. We propose a biophysical ODE-based representation of cross-bridge (XB, tropomyosin and troponin within a contractile regulatory unit (RU to investigate the mechanisms behind cooperative activation, as well as the role of cooperativity in dynamic tension generation across different species. The model includes cooperative interactions between regulatory units (RU-RU, between crossbridges (XB-XB, as well more complex interactions between crossbridges and regulatory units (XB-RU interactions. For the steady-state force-calcium relationship, our framework predicts that: (1 XB-RU effects are key in shifting the half-activation value of the force-calcium relationship towards lower [Ca(2+], but have only small effects on cooperativity. (2 XB-XB effects approximately double the duty ratio of myosin, but do not significantly affect cooperativity. (3 RU-RU effects derived from the long-range action of tropomyosin are a major factor in cooperative activation, with each additional unblocked RU increasing the rate of additional RU's unblocking. (4 Myosin affinity for short (1-4 RU unblocked stretches of actin of is very low, and the resulting suppression of force at low [Ca(2+] is a major contributor in the biphasic force-calcium relationship. We also reproduce isometric tension development across mouse, rat and human at physiological temperature and pacing rate, and conclude that species differences require only changes in myosin affinity and troponin I/troponin C affinity. Furthermore, we show that the calcium dependence of the rate of tension redevelopment k(tr is explained by transient blocking of RU's by a temporary decrease in XB-RU effects.

  2. Formation of Black Hole Low-mass X-Ray Binaries in Hierarchical Triple Systems

    Science.gov (United States)

    Naoz, Smadar; Fragos, Tassos; Geller, Aaron; Stephan, Alexander P.; Rasio, Frederic A.

    2016-05-01

    The formation of black hole (BH) low-mass X-ray binaries (LMXB) poses a theoretical challenge, as low-mass companions are not expected to survive the common-envelope scenario with the BH progenitor. Here we propose a formation mechanism that skips the common-envelope scenario and relies on triple-body dynamics. We study the evolution of hierarchical triples following the secular dynamical evolution up to the octupole-level of approximation, including general relativity, tidal effects, and post-main-sequence evolution such as mass loss, changes to stellar radii, and supernovae. During the dynamical evolution of the triple system the “eccentric Kozai-Lidov” mechanism can cause large eccentricity excitations in the LMXB progenitor, resulting in three main BH-LMXB formation channels. Here we define BH-LMXB candidates as systems where the inner BH-companion star crosses its Roche limit. In the “eccentric” channel (∼81% of the LMXBs in our simulations) the donor star crosses its Roche limit during an extreme eccentricity excitation while still on a wide orbit. Second, we find a “giant” LMXB channel (∼11%), where a system undergoes only moderate eccentricity excitations but the donor star fills its Roche-lobe after evolving toward the giant branch. Third, we identify a “classical” channel (∼8%), where tidal forces and magnetic braking shrink and circularize the orbit to short periods, triggering mass-transfer. Finally, for the giant channel we predict an eccentric (∼0.3–0.6) preferably inclined (∼40°, ∼140°) tertiary, typically on a wide enough orbit (∼104 au) to potentially become unbound later in the triple evolution. While this initial study considers only one representative system and neglects BH natal kicks, we expect our scenario to apply across a broad region of parameter space for triple-star systems.

  3. Depth of initial ideals of normal edge rings

    CERN Document Server

    Hibi, Takayuki; Kimura, Kyouko; O'Keefe, Augustine B

    2011-01-01

    Let $G$ be a finite graph on the vertex set $[d] = \\{1, ..., d \\}$ with the edges $e_1, ..., e_n$ and $K[\\tb] = K[t_1, ..., t_d]$ the polynomial ring in $d$ variables over a field $K$. The edge ring of $G$ is the semigroup ring $K[G]$ which is generated by those monomials $\\tb^e = t_it_j$ such that $e = \\{i, j\\}$ is an edge of $G$. Let $K[\\xb] = K[x_1, ..., x_n]$ be the polynomial ring in $n$ variables over $K$ and define the surjective homomorphism $\\pi : K[\\xb] \\to K[G]$ by setting $\\pi(x_i) = \\tb^{e_i}$ for $i = 1, ..., n$. The toric ideal $I_G$ of $G$ is the kernel of $\\pi$. It will be proved that, given integers $f$ and $d$ with $6 \\leq f \\leq d$, there exist a finite connected nonbipartite graph $G$ on $[d]$ together with a reverse lexicographic order $<_{\\rev}$ on $K[\\xb]$ and a lexicographic order $<_{\\lex}$ on $K[\\xb]$ such that (i) $K[G]$ is normal, (ii) $\\depth K[\\xb]/\\ini_{<_{\\rev}}(I_G) = f$ and (iii) $K[\\xb]/\\ini_{<_{\\lex}}(I_G)$ is Cohen--Macaulay, where $\\ini_{<_{\\rev}}(I_G)$ (r...

  4. Studies on radiolabeled streptavidin-biotin and its use as an indirect immunoimaging system

    International Nuclear Information System (INIS)

    The purpose of this research was to study the biotin-streptavidin system coupled to an antigen-antibody system to amplify the sensitivity of tumor detection. Human serum albumin (HSA) was used as an antigen and conjugated to Sepharose 4B beads. The beads-HSA were used as a tumor model. Rabbit-anti human serum albumin antibody (Ab) was used as antibody and derivatized with biotin (AbXB). Streptavidin (STA) radiolabeled with I-125 and In-111 was used to detect the antigenic sites. The three areas of research included chemical studies, in vitro binding studies, and biodistribution studies. The conjugation reactions of biotin to Ab, diethylenetriaminepentaacetic acid (DTPA) to STA, and the radiolabeling of STA conjugates with In-111 were investigated. The in vitro binding assay was performed in two steps. The AbXB was bound first to beads-HSA in excess. The unbound AbXB was removed and a molar excess of beads-HSA/AbXB was then incubated with I-125 or In-111 labeled STA. For the biodistribution studies, AbXB was injected into a tail vein of rats with beads-HSA localized in lungs. The In-111 or I-125 labeled STA was injected 24 and 48 hours after the administration of the AbXB. These biodistribution studies indicated no amplification of the target to normal organ ratios as compared to In-111 labeled antibody

  5. Search for a new bottomonium state decaying to $\\Upsilon(1S)\\pi^+ \\pi^-$ in pp collisions at $\\sqrt{s}$ = 8 TeV

    CERN Document Server

    Chatrchyan, Serguei; Sirunyan, Albert M; Tumasyan, Armen; Adam, Wolfgang; Bergauer, Thomas; Dragicevic, Marko; Erö, Janos; Fabjan, Christian; Friedl, Markus; Fruehwirth, Rudolf; Ghete, Vasile Mihai; Hörmann, Natascha; Hrubec, Josef; Jeitler, Manfred; Kiesenhofer, Wolfgang; Knünz, Valentin; Krammer, Manfred; Krätschmer, Ilse; Liko, Dietrich; Mikulec, Ivan; Rabady, Dinyar; Rahbaran, Babak; Rohringer, Christine; Rohringer, Herbert; Schöfbeck, Robert; Strauss, Josef; Taurok, Anton; Treberer-Treberspurg, Wolfgang; Waltenberger, Wolfgang; Wulz, Claudia-Elisabeth; Mossolov, Vladimir; Shumeiko, Nikolai; Suarez Gonzalez, Juan; Alderweireldt, Sara; Bansal, Monika; Bansal, Sunil; Cornelis, Tom; De Wolf, Eddi A; Janssen, Xavier; Knutsson, Albert; Luyckx, Sten; Mucibello, Luca; Ochesanu, Silvia; Roland, Benoit; Rougny, Romain; Staykova, Zlatka; Van Haevermaet, Hans; Van Mechelen, Pierre; Van Remortel, Nick; Van Spilbeeck, Alex; Blekman, Freya; Blyweert, Stijn; D'Hondt, Jorgen; Kalogeropoulos, Alexis; Keaveney, James; Lowette, Steven; Maes, Michael; Olbrechts, Annik; Tavernier, Stefaan; Van Doninck, Walter; Van Mulders, Petra; Van Onsem, Gerrit Patrick; Villella, Ilaria; Caillol, Cécile; Clerbaux, Barbara; De Lentdecker, Gilles; Favart, Laurent; Gay, Arnaud; Hreus, Tomas; Léonard, Alexandre; Marage, Pierre Edouard; Mohammadi, Abdollah; Perniè, Luca; Reis, Thomas; Seva, Tomislav; Thomas, Laurent; Vander Velde, Catherine; Vanlaer, Pascal; Wang, Jian; Adler, Volker; Beernaert, Kelly; Benucci, Leonardo; Cimmino, Anna; Costantini, Silvia; Dildick, Sven; Garcia, Guillaume; Klein, Benjamin; Lellouch, Jérémie; Marinov, Andrey; Mccartin, Joseph; Ocampo Rios, Alberto Andres; Ryckbosch, Dirk; Sigamani, Michael; Strobbe, Nadja; Thyssen, Filip; Tytgat, Michael; Walsh, Sinead; Yazgan, Efe; Zaganidis, Nicolas; Basegmez, Suzan; Beluffi, Camille; Bruno, Giacomo; Castello, Roberto; Caudron, Adrien; Ceard, Ludivine; Da Silveira, Gustavo Gil; Delaere, Christophe; Du Pree, Tristan; Favart, Denis; Forthomme, Laurent; Giammanco, Andrea; Hollar, Jonathan; Jez, Pavel; Lemaitre, Vincent; Liao, Junhui; Militaru, Otilia; Nuttens, Claude; Pagano, Davide; Pin, Arnaud; Piotrzkowski, Krzysztof; Popov, Andrey; Selvaggi, Michele; Vidal Marono, Miguel; Vizan Garcia, Jesus Manuel; Beliy, Nikita; Caebergs, Thierry; Daubie, Evelyne; Hammad, Gregory Habib; Alves, Gilvan; Correa Martins Junior, Marcos; Martins, Thiago; Pol, Maria Elena; Henrique Gomes E Souza, Moacyr; Aldá Júnior, Walter Luiz; Carvalho, Wagner; Chinellato, Jose; Custódio, Analu; Da Costa, Eliza Melo; De Jesus Damiao, Dilson; De Oliveira Martins, Carley; Fonseca De Souza, Sandro; Malbouisson, Helena; Malek, Magdalena; Matos Figueiredo, Diego; Mundim, Luiz; Nogima, Helio; Prado Da Silva, Wanda Lucia; Santoro, Alberto; Sznajder, Andre; Tonelli Manganote, Edmilson José; Vilela Pereira, Antonio; Bernardes, Cesar Augusto; De Almeida Dias, Flavia; Tomei, Thiago; De Moraes Gregores, Eduardo; Lagana, Caio; Mercadante, Pedro G; Novaes, Sergio F; Padula, Sandra; Genchev, Vladimir; Iaydjiev, Plamen; Piperov, Stefan; Rodozov, Mircho; Sultanov, Georgi; Vutova, Mariana; Dimitrov, Anton; Hadjiiska, Roumyana; Kozhuharov, Venelin; Litov, Leander; Pavlov, Borislav; Petkov, Peicho; Bian, Jian-Guo; Chen, Guo-Ming; Chen, He-Sheng; Jiang, Chun-Hua; Liang, Dong; Liang, Song; Meng, Xiangwei; Tao, Junquan; Wang, Xianyou; Wang, Zheng; Asawatangtrakuldee, Chayanit; Ban, Yong; Guo, Yifei; Li, Qiang; Li, Wenbo; Liu, Shuai; Mao, Yajun; Qian, Si-Jin; Wang, Dayong; Zhang, Linlin; Zou, Wei; Avila, Carlos; Carrillo Montoya, Camilo Andres; Chaparro Sierra, Luisa Fernanda; Gomez, Juan Pablo; Gomez Moreno, Bernardo; Sanabria, Juan Carlos; Godinovic, Nikola; Lelas, Damir; Plestina, Roko; Polic, Dunja; Puljak, Ivica; Antunovic, Zeljko; Kovac, Marko; Brigljevic, Vuko; Kadija, Kreso; Luetic, Jelena; Mekterovic, Darko; Morovic, Srecko; Tikvica, Lucija; Attikis, Alexandros; Mavromanolakis, Georgios; Mousa, Jehad; Nicolaou, Charalambos; Ptochos, Fotios; Razis, Panos A; Finger, Miroslav; Finger Jr, Michael; Assran, Yasser; Elgammal, Sherif; Ellithi Kamel, Ali; Kuotb Awad, Alaa Metwaly; Mahmoud, Mohammed; Radi, Amr; Kadastik, Mario; Müntel, Mait; Murumaa, Marion; Raidal, Martti; Rebane, Liis; Tiko, Andres; Eerola, Paula; Fedi, Giacomo; Voutilainen, Mikko; Härkönen, Jaakko; Karimäki, Veikko; Kinnunen, Ritva; Kortelainen, Matti J; Lampén, Tapio; Lassila-Perini, Kati; Lehti, Sami; Lindén, Tomas; Luukka, Panja-Riina; Mäenpää, Teppo; Peltola, Timo; Tuominen, Eija; Tuominiemi, Jorma; Tuovinen, Esa; Wendland, Lauri; Tuuva, Tuure; Besancon, Marc; Couderc, Fabrice; Dejardin, Marc; Denegri, Daniel; Fabbro, Bernard; Faure, Jean-Louis; Ferri, Federico; Ganjour, Serguei; Givernaud, Alain; Gras, Philippe; Hamel de Monchenault, Gautier; Jarry, Patrick; Locci, Elizabeth; Malcles, Julie; Millischer, Laurent; Nayak, Aruna; Rander, John; Rosowsky, André; Titov, Maksym; Baffioni, Stephanie; Beaudette, Florian; Benhabib, Lamia; Bluj, Michal; Busson, Philippe; Charlot, Claude; Daci, Nadir; Dahms, Torsten; Dalchenko, Mykhailo; Dobrzynski, Ludwik; Florent, Alice; Granier de Cassagnac, Raphael; Haguenauer, Maurice; Miné, Philippe; Mironov, Camelia; Naranjo, Ivo Nicolas; Nguyen, Matthew; Ochando, Christophe; Paganini, Pascal; Sabes, David; Salerno, Roberto; Sirois, Yves; Veelken, Christian; Zabi, Alexandre; Agram, Jean-Laurent; Andrea, Jeremy; Bloch, Daniel; Brom, Jean-Marie; Chabert, Eric Christian; Collard, Caroline; Conte, Eric; Drouhin, Frédéric; Fontaine, Jean-Charles; Gelé, Denis; Goerlach, Ulrich; Goetzmann, Christophe; Juillot, Pierre; Le Bihan, Anne-Catherine; Van Hove, Pierre; Gadrat, Sébastien; Beauceron, Stephanie; Beaupere, Nicolas; Boudoul, Gaelle; Brochet, Sébastien; Chasserat, Julien; Chierici, Roberto; Contardo, Didier; Depasse, Pierre; El Mamouni, Houmani; Fan, Jiawei; Fay, Jean; Gascon, Susan; Gouzevitch, Maxime; Ille, Bernard; Kurca, Tibor; Lethuillier, Morgan; Mirabito, Laurent; Perries, Stephane; Sgandurra, Louis; Sordini, Viola; Vander Donckt, Muriel; Verdier, Patrice; Viret, Sébastien; Xiao, Hong; Tsamalaidze, Zviad; Autermann, Christian; Beranek, Sarah; Bontenackels, Michael; Calpas, Betty; Edelhoff, Matthias; Feld, Lutz; Heracleous, Natalie; Hindrichs, Otto; Klein, Katja; Ostapchuk, Andrey; Perieanu, Adrian; Raupach, Frank; Sammet, Jan; Schael, Stefan; Sprenger, Daniel; Weber, Hendrik; Wittmer, Bruno; Zhukov, Valery; Ata, Metin; Caudron, Julien; Dietz-Laursonn, Erik; Duchardt, Deborah; Erdmann, Martin; Fischer, Robert; Güth, Andreas; Hebbeker, Thomas; Heidemann, Carsten; Hoepfner, Kerstin; Klingebiel, Dennis; Knutzen, Simon; Kreuzer, Peter; Merschmeyer, Markus; Meyer, Arnd; Olschewski, Mark; Padeken, Klaas; Papacz, Paul; Pieta, Holger; Reithler, Hans; Schmitz, Stefan Antonius; Sonnenschein, Lars; Steggemann, Jan; Teyssier, Daniel; Thüer, Sebastian; Weber, Martin; Cherepanov, Vladimir; Erdogan, Yusuf; Flügge, Günter; Geenen, Heiko; Geisler, Matthias; Haj Ahmad, Wael; Hoehle, Felix; Kargoll, Bastian; Kress, Thomas; Kuessel, Yvonne; Lingemann, Joschka; Nowack, Andreas; Nugent, Ian Michael; Perchalla, Lars; Pooth, Oliver; Stahl, Achim; Asin, Ivan; Bartosik, Nazar; Behr, Joerg; Behrenhoff, Wolf; Behrens, Ulf; Bell, Alan James; Bergholz, Matthias; Bethani, Agni; Borras, Kerstin; Burgmeier, Armin; Cakir, Altan; Calligaris, Luigi; Campbell, Alan; Choudhury, Somnath; Costanza, Francesco; Diez Pardos, Carmen; Dooling, Samantha; Dorland, Tyler; Eckerlin, Guenter; Eckstein, Doris; Flucke, Gero; Geiser, Achim; Glushkov, Ivan; Grebenyuk, Anastasia; Gunnellini, Paolo; Habib, Shiraz; Hauk, Johannes; Hellwig, Gregor; Horton, Dean; Jung, Hannes; Kasemann, Matthias; Katsas, Panagiotis; Kleinwort, Claus; Kluge, Hannelies; Krämer, Mira; Krücker, Dirk; Kuznetsova, Ekaterina; Lange, Wolfgang; Leonard, Jessica; Lipka, Katerina; Lohmann, Wolfgang; Lutz, Benjamin; Mankel, Rainer; Marfin, Ihar; Melzer-Pellmann, Isabell-Alissandra; Meyer, Andreas Bernhard; Mnich, Joachim; Mussgiller, Andreas; Naumann-Emme, Sebastian; Novgorodova, Olga; Nowak, Friederike; Olzem, Jan; Perrey, Hanno; Petrukhin, Alexey; Pitzl, Daniel; Placakyte, Ringaile; Raspereza, Alexei; Ribeiro Cipriano, Pedro M; Riedl, Caroline; Ron, Elias; Sahin, Mehmet Özgür; Salfeld-Nebgen, Jakob; Schmidt, Ringo; Schoerner-Sadenius, Thomas; Sen, Niladri; Stein, Matthias; Walsh, Roberval; Wissing, Christoph; Aldaya Martin, Maria; Blobel, Volker; Enderle, Holger; Erfle, Joachim; Garutti, Erika; Gebbert, Ulla; Görner, Martin; Gosselink, Martijn; Haller, Johannes; Heine, Kristin; Höing, Rebekka Sophie; Kaussen, Gordon; Kirschenmann, Henning; Klanner, Robert; Kogler, Roman; Lange, Jörn; Marchesini, Ivan; Peiffer, Thomas; Pietsch, Niklas; Rathjens, Denis; Sander, Christian; Schettler, Hannes; Schleper, Peter; Schlieckau, Eike; Schmidt, Alexander; Schröder, Matthias; Schum, Torben; Seidel, Markus; Sibille, Jennifer; Sola, Valentina; Stadie, Hartmut; Steinbrück, Georg; Thomsen, Jan; Troendle, Daniel; Usai, Emanuele; Vanelderen, Lukas; Barth, Christian; Baus, Colin; Berger, Joram; Böser, Christian; Butz, Erik; Chwalek, Thorsten; De Boer, Wim; Descroix, Alexis; Dierlamm, Alexander; Feindt, Michael; Guthoff, Moritz; Hartmann, Frank; Hauth, Thomas; Held, Hauke; Hoffmann, Karl-Heinz; Husemann, Ulrich; Katkov, Igor; Komaragiri, Jyothsna Rani; Kornmayer, Andreas; Lobelle Pardo, Patricia; Martschei, Daniel; Mozer, Matthias Ulrich; Müller, Thomas; Niegel, Martin; Nürnberg, Andreas; Oberst, Oliver; Ott, Jochen; Quast, Gunter; Rabbertz, Klaus; Ratnikov, Fedor; Röcker, Steffen; Schilling, Frank-Peter; Schott, Gregory; Simonis, Hans-Jürgen; Stober, Fred-Markus Helmut; Ulrich, Ralf; Wagner-Kuhr, Jeannine; Wayand, Stefan; Weiler, Thomas; Zeise, Manuel; Anagnostou, Georgios; Daskalakis, Georgios; Geralis, Theodoros; Kesisoglou, Stilianos; Kyriakis, Aristotelis; Loukas, Demetrios; Markou, Athanasios; Markou, Christos; Ntomari, Eleni; Topsis-giotis, Iasonas; Gouskos, Loukas; Panagiotou, Apostolos; Saoulidou, Niki; Stiliaris, Efstathios; Aslanoglou, Xenofon; Evangelou, Ioannis; Flouris, Giannis; Foudas, Costas; Kokkas, Panagiotis; Manthos, Nikolaos; Papadopoulos, Ioannis; Paradas, Evangelos; Bencze, Gyorgy; Hajdu, Csaba; Hidas, Pàl; Horvath, Dezso; Sikler, Ferenc; Veszpremi, Viktor; Vesztergombi, Gyorgy; Zsigmond, Anna Julia; Beni, Noemi; Czellar, Sandor; Molnar, Jozsef; Palinkas, Jozsef; Szillasi, Zoltan; Karancsi, János; Raics, Peter; Trocsanyi, Zoltan Laszlo; Ujvari, Balazs; Swain, Sanjay Kumar; Beri, Suman Bala; Bhatnagar, Vipin; Dhingra, Nitish; Gupta, Ruchi; Kaur, Manjit; Mehta, Manuk Zubin; Mittal, Monika; Nishu, Nishu; Sharma, Archana; Singh, Jasbir; Kumar, Ashok; Kumar, Arun; Ahuja, Sudha; Bhardwaj, Ashutosh; Choudhary, Brajesh C; Kumar, Ajay; Malhotra, Shivali; Naimuddin, Md; Ranjan, Kirti; Saxena, Pooja; Sharma, Varun; Shivpuri, Ram Krishen; Banerjee, Sunanda; Bhattacharya, Satyaki; Chatterjee, Kalyanmoy; Dutta, Suchandra; Gomber, Bhawna; Jain, Sandhya; Jain, Shilpi; Khurana, Raman; Modak, Atanu; Mukherjee, Swagata; Roy, Debarati; Sarkar, Subir; Sharan, Manoj; Singh, Anil; Abdulsalam, Abdulla; Dutta, Dipanwita; Kailas, Swaminathan; Kumar, Vineet; Mohanty, Ajit Kumar; Pant, Lalit Mohan; Shukla, Prashant; Topkar, Anita; Aziz, Tariq; Chatterjee, Rajdeep Mohan; Ganguly, Sanmay; Ghosh, Saranya; Guchait, Monoranjan; Gurtu, Atul; Kole, Gouranga; Kumar, Sanjeev; Maity, Manas; Majumder, Gobinda; Mazumdar, Kajari; Mohanty, Gagan Bihari; Parida, Bibhuti; Sudhakar, Katta; Wickramage, Nadeesha; Banerjee, Sudeshna; Dugad, Shashikant; Arfaei, Hessamaddin; Bakhshiansohi, Hamed; Etesami, Seyed Mohsen; Fahim, Ali; Jafari, Abideh; Khakzad, Mohsen; Mohammadi Najafabadi, Mojtaba; Paktinat Mehdiabadi, Saeid; Safarzadeh, Batool; Zeinali, Maryam; Grunewald, Martin; Abbrescia, Marcello; Barbone, Lucia; Calabria, Cesare; Chhibra, Simranjit Singh; Colaleo, Anna; Creanza, Donato; De Filippis, Nicola; De Palma, Mauro; Fiore, Luigi; Iaselli, Giuseppe; Maggi, Giorgio; Maggi, Marcello; Marangelli, Bartolomeo; My, Salvatore; Nuzzo, Salvatore; Pacifico, Nicola; Pompili, Alexis; Pugliese, Gabriella; Selvaggi, Giovanna; Silvestris, Lucia; Singh, Gurpreet; Venditti, Rosamaria; Verwilligen, Piet; Zito, Giuseppe; Abbiendi, Giovanni; Benvenuti, Alberto; Bonacorsi, Daniele; Braibant-Giacomelli, Sylvie; Brigliadori, Luca; Campanini, Renato; Capiluppi, Paolo; Castro, Andrea; Cavallo, Francesca Romana; Codispoti, Giuseppe; Cuffiani, Marco; Dallavalle, Gaetano-Marco; Fabbri, Fabrizio; Fanfani, Alessandra; Fasanella, Daniele; Giacomelli, Paolo; Grandi, Claudio; Guiducci, Luigi; Marcellini, Stefano; Masetti, Gianni; Meneghelli, Marco; Montanari, Alessandro; Navarria, Francesco; Odorici, Fabrizio; Perrotta, Andrea; Primavera, Federica; Rossi, Antonio; Rovelli, Tiziano; Siroli, Gian Piero; Tosi, Nicolò; Travaglini, Riccardo; Albergo, Sebastiano; Cappello, Gigi; Chiorboli, Massimiliano; Costa, Salvatore; Giordano, Ferdinando; Potenza, Renato; Tricomi, Alessia; Tuve, Cristina; Barbagli, Giuseppe; Ciulli, Vitaliano; Civinini, Carlo; D'Alessandro, Raffaello; Focardi, Ettore; Frosali, Simone; Gallo, Elisabetta; Gonzi, Sandro; Gori, Valentina; Lenzi, Piergiulio; Meschini, Marco; Paoletti, Simone; Sguazzoni, Giacomo; Tropiano, Antonio; Benussi, Luigi; Bianco, Stefano; Fabbri, Franco; Piccolo, Davide; Fabbricatore, Pasquale; Ferretti, Roberta; Ferro, Fabrizio; Lo Vetere, Maurizio; Musenich, Riccardo; Robutti, Enrico; Tosi, Silvano; Benaglia, Andrea; Dinardo, Mauro Emanuele; Fiorendi, Sara; Gennai, Simone; Ghezzi, Alessio; Govoni, Pietro; Lucchini, Marco Toliman; Malvezzi, Sandra; Manzoni, Riccardo Andrea; Martelli, Arabella; Menasce, Dario; Moroni, Luigi; Paganoni, Marco; Pedrini, Daniele; Ragazzi, Stefano; Redaelli, Nicola; Tabarelli de Fatis, Tommaso; Buontempo, Salvatore; Cavallo, Nicola; De Cosa, Annapaola; Fabozzi, Francesco; Iorio, Alberto Orso Maria; Lista, Luca; Meola, Sabino; Merola, Mario; Paolucci, Pierluigi; Azzi, Patrizia; Bacchetta, Nicola; Bisello, Dario; Branca, Antonio; Carlin, Roberto; Checchia, Paolo; Dorigo, Tommaso; Fantinel, Sergio; Galanti, Mario; Gasparini, Fabrizio; Gasparini, Ugo; Giubilato, Piero; Gozzelino, Andrea; Gulmini, Michele; Kanishchev, Konstantin; Lacaprara, Stefano; Lazzizzera, Ignazio; Margoni, Martino; Maron, Gaetano; Meneguzzo, Anna Teresa; Pazzini, Jacopo; Pozzobon, Nicola; Ronchese, Paolo; Simonetto, Franco; Torassa, Ezio; Tosi, Mia; Vanini, Sara; Zotto, Pierluigi; Zucchetta, Alberto; Zumerle, Gianni; Gabusi, Michele; Ratti, Sergio P; Riccardi, Cristina; Vitulo, Paolo; Biasini, Maurizio; Bilei, Gian Mario; Fanò, Livio; Lariccia, Paolo; Mantovani, Giancarlo; Menichelli, Mauro; Nappi, Aniello; Romeo, Francesco; Saha, Anirban; Santocchia, Attilio; Spiezia, Aniello; Androsov, Konstantin; Azzurri, Paolo; Bagliesi, Giuseppe; Bernardini, Jacopo; Boccali, Tommaso; Broccolo, Giuseppe; Castaldi, Rino; Ciocci, Maria Agnese; D'Agnolo, Raffaele Tito; Dell'Orso, Roberto; Fiori, Francesco; Foà, Lorenzo; Giassi, Alessandro; Grippo, Maria Teresa; Kraan, Aafke; Ligabue, Franco; Lomtadze, Teimuraz; Martini, Luca; Messineo, Alberto; Moon, Chang-Seong; Palla, Fabrizio; Rizzi, Andrea; Savoy-Navarro, Aurore; Serban, Alin Titus; Spagnolo, Paolo; Squillacioti, Paola; Tenchini, Roberto; Tonelli, Guido; Venturi, Andrea; Verdini, Piero Giorgio; Vernieri, Caterina; Barone, Luciano; Cavallari, Francesca; Del Re, Daniele; Diemoz, Marcella; Grassi, Marco; Longo, Egidio; Margaroli, Fabrizio; Meridiani, Paolo; Micheli, Francesco; Nourbakhsh, Shervin; Organtini, Giovanni; Paramatti, Riccardo; Rahatlou, Shahram; Rovelli, Chiara; Soffi, Livia; Amapane, Nicola; Arcidiacono, Roberta; Argiro, Stefano; Arneodo, Michele; Bellan, Riccardo; Biino, Cristina; Cartiglia, Nicolo; Casasso, Stefano; Costa, Marco; Degano, Alessandro; Demaria, Natale; Mariotti, Chiara; Maselli, Silvia; Migliore, Ernesto; Monaco, Vincenzo; Musich, Marco; Obertino, Maria Margherita; Pastrone, Nadia; Pelliccioni, Mario; Potenza, Alberto; Romero, Alessandra; Ruspa, Marta; Sacchi, Roberto; Solano, Ada; Staiano, Amedeo; Tamponi, Umberto; Belforte, Stefano; Candelise, Vieri; Casarsa, Massimo; Cossutti, Fabio; Della Ricca, Giuseppe; Gobbo, Benigno; La Licata, Chiara; Marone, Matteo; Montanino, Damiana; Penzo, Aldo; Schizzi, Andrea; Zanetti, Anna; Chang, Sunghyun; Kim, Tae Yeon; Nam, Soon-Kwon; Kim, Dong Hee; Kim, Gui Nyun; Kim, Ji Eun; Kong, Dae Jung; Lee, Sangeun; Oh, Young Do; Park, Hyangkyu; Son, Dong-Chul; Kim, Jae Yool; Kim, Zero Jaeho; Song, Sanghyeon; Choi, Suyong; Gyun, Dooyeon; Hong, Byung-Sik; Jo, Mihee; Kim, Hyunchul; Kim, Tae Jeong; Lee, Kyong Sei; Park, Sung Keun; Roh, Youn; Choi, Minkyoo; Kim, Ji Hyun; Park, Chawon; Park, Inkyu; Park, Sangnam; Ryu, Geonmo; Choi, Young-Il; Choi, Young Kyu; Goh, Junghwan; Kim, Min Suk; Kwon, Eunhyang; Lee, Byounghoon; Lee, Jongseok; Lee, Sungeun; Seo, Hyunkwan; Yu, Intae; Grigelionis, Ignas; Juodagalvis, Andrius; Castilla-Valdez, Heriberto; De La Cruz-Burelo, Eduard; Heredia-de La Cruz, Ivan; Lopez-Fernandez, Ricardo; Martínez-Ortega, Jorge; Sánchez Hernández, Alberto; Villasenor-Cendejas, Luis Manuel; Carrillo Moreno, Salvador; Vazquez Valencia, Fabiola; Salazar Ibarguen, Humberto Antonio; Casimiro Linares, Edgar; Morelos Pineda, Antonio; Reyes-Santos, Marco A; Krofcheck, David; Butler, Philip H; Doesburg, Robert; Reucroft, Steve; Silverwood, Hamish; Ahmad, Muhammad; Asghar, Muhammad Irfan; Butt, Jamila; Hoorani, Hafeez R; Khalid, Shoaib; Khan, Wajid Ali; Khurshid, Taimoor; Qazi, Shamona; Shah, Mehar Ali; Shoaib, Muhammad; Bialkowska, Helena; Boimska, Bożena; Frueboes, Tomasz; Górski, Maciej; Kazana, Malgorzata; Nawrocki, Krzysztof; Romanowska-Rybinska, Katarzyna; Szleper, Michal; Wrochna, Grzegorz; Zalewski, Piotr; Brona, Grzegorz; Bunkowski, Karol; Cwiok, Mikolaj; Dominik, Wojciech; Doroba, Krzysztof; Kalinowski, Artur; Konecki, Marcin; Krolikowski, Jan; Misiura, Maciej; Wolszczak, Weronika; Almeida, Nuno; Bargassa, Pedrame; Beirão Da Cruz E Silva, Cristóvão; Faccioli, Pietro; Ferreira Parracho, Pedro Guilherme; Gallinaro, Michele; Nguyen, Federico; Rodrigues Antunes, Joao; Seixas, Joao; Varela, Joao; Vischia, Pietro; Afanasiev, Serguei; Bunin, Pavel; Gavrilenko, Mikhail; Golutvin, Igor; Gorbunov, Ilya; Kamenev, Alexey; Karjavin, Vladimir; Konoplyanikov, Viktor; Lanev, Alexander; Malakhov, Alexander; Matveev, Viktor; Moisenz, Petr; Palichik, Vladimir; Perelygin, Victor; Shmatov, Sergey; Skatchkov, Nikolai; Smirnov, Vitaly; Zarubin, Anatoli; Evstyukhin, Sergey; Golovtsov, Victor; Ivanov, Yury; Kim, Victor; Levchenko, Petr; Murzin, Victor; Oreshkin, Vadim; Smirnov, Igor; Sulimov, Valentin; Uvarov, Lev; Vavilov, Sergey; Vorobyev, Alexey; Vorobyev, Andrey; Andreev, Yuri; Dermenev, Alexander; Gninenko, Sergei; Golubev, Nikolai; Kirsanov, Mikhail; Krasnikov, Nikolai; Pashenkov, Anatoli; Tlisov, Danila; Toropin, Alexander; Epshteyn, Vladimir; Erofeeva, Maria; Gavrilov, Vladimir; Lychkovskaya, Natalia; Popov, Vladimir; Safronov, Grigory; Semenov, Sergey; Spiridonov, Alexander; Stolin, Viatcheslav; Vlasov, Evgueni; Zhokin, Alexander; Andreev, Vladimir; Azarkin, Maksim; Dremin, Igor; Kirakosyan, Martin; Leonidov, Andrey; Mesyats, Gennady; Rusakov, Sergey V; Vinogradov, Alexey; Belyaev, Andrey; Boos, Edouard; Dubinin, Mikhail; Dudko, Lev; Ershov, Alexander; Gribushin, Andrey; Klyukhin, Vyacheslav; Kodolova, Olga; Lokhtin, Igor; Markina, Anastasia; Obraztsov, Stepan; Petrushanko, Sergey; Savrin, Viktor; Snigirev, Alexander; Azhgirey, Igor; Bayshev, Igor; Bitioukov, Sergei; Kachanov, Vassili; Kalinin, Alexey; Konstantinov, Dmitri; Krychkine, Victor; Petrov, Vladimir; Ryutin, Roman; Sobol, Andrei; Tourtchanovitch, Leonid; Troshin, Sergey; Tyurin, Nikolay; Uzunian, Andrey; Volkov, Alexey; Adzic, Petar; Djordjevic, Milos; Ekmedzic, Marko; Krpic, Dragomir; Milosevic, Jovan; Aguilar-Benitez, Manuel; Alcaraz Maestre, Juan; Battilana, Carlo; Calvo, Enrique; Cerrada, Marcos; Chamizo Llatas, Maria; Colino, Nicanor; De La Cruz, Begona; Delgado Peris, Antonio; Domínguez Vázquez, Daniel; Fernandez Bedoya, Cristina; Fernández Ramos, Juan Pablo; Ferrando, Antonio; Flix, Jose; Fouz, Maria Cruz; Garcia-Abia, Pablo; Gonzalez Lopez, Oscar; Goy Lopez, Silvia; Hernandez, Jose M; Josa, Maria Isabel; Merino, Gonzalo; Navarro De Martino, Eduardo; Puerta Pelayo, Jesus; Quintario Olmeda, Adrián; Redondo, Ignacio; Romero, Luciano; Santaolalla, Javier; Soares, Mara Senghi; Willmott, Carlos; Albajar, Carmen; de Trocóniz, Jorge F; Brun, Hugues; Cuevas, Javier; Fernandez Menendez, Javier; Folgueras, Santiago; Gonzalez Caballero, Isidro; Lloret Iglesias, Lara; Piedra Gomez, Jonatan; Brochero Cifuentes, Javier Andres; Cabrillo, Iban Jose; Calderon, Alicia; Chuang, Shan-Huei; Duarte Campderros, Jordi; Fernandez, Marcos; Gomez, Gervasio; Gonzalez Sanchez, Javier; Graziano, Alberto; Jorda, Clara; Lopez Virto, Amparo; Marco, Jesus; Marco, Rafael; Martinez Rivero, Celso; Matorras, Francisco; Munoz Sanchez, Francisca Javiela; Rodrigo, Teresa; Rodríguez-Marrero, Ana Yaiza; Ruiz-Jimeno, Alberto; Scodellaro, Luca; Vila, Ivan; Vilar Cortabitarte, Rocio; Abbaneo, Duccio; Auffray, Etiennette; Auzinger, Georg; Bachtis, Michail; Baillon, Paul; Ball, Austin; Barney, David; Bendavid, Joshua; Benitez, Jose F; Bernet, Colin; Bianchi, Giovanni; Bloch, Philippe; Bocci, Andrea; Bonato, Alessio; Bondu, Olivier; Botta, Cristina; Breuker, Horst; Camporesi, Tiziano; Cerminara, Gianluca; Christiansen, Tim; Coarasa Perez, Jose Antonio; Colafranceschi, Stefano; D'Alfonso, Mariarosaria; D'Enterria, David; Dabrowski, Anne; David Tinoco Mendes, Andre; De Guio, Federico; De Roeck, Albert; De Visscher, Simon; Di Guida, Salvatore; Dobson, Marc; Dupont-Sagorin, Niels; Elliott-Peisert, Anna; Eugster, Jürg; Franzoni, Giovanni; Funk, Wolfgang; Georgiou, Georgios; Giffels, Manuel; Gigi, Dominique; Gill, Karl; Giordano, Domenico; Girone, Maria; Giunta, Marina; Glege, Frank; Gomez-Reino Garrido, Robert; Gowdy, Stephen; Guida, Roberto; Hammer, Josef; Hansen, Magnus; Harris, Philip; Hartl, Christian; Hinzmann, Andreas; Innocente, Vincenzo; Janot, Patrick; Karavakis, Edward; Kousouris, Konstantinos; Krajczar, Krisztian; Lecoq, Paul; Lee, Yen-Jie; Lourenco, Carlos; Magini, Nicolo; Malgeri, Luca; Mannelli, Marcello; Masetti, Lorenzo; Meijers, Frans; Mersi, Stefano; Meschi, Emilio; Moser, Roland; Mulders, Martijn; Musella, Pasquale; Nesvold, Erik; Orsini, Luciano; Palencia Cortezon, Enrique; Perez, Emmanuelle; Perrozzi, Luca; Petrilli, Achille; Pfeiffer, Andreas; Pierini, Maurizio; Pimiä, Martti; Piparo, Danilo; Plagge, Michael; Quertenmont, Loic; Racz, Attila; Reece, William; Rolandi, Gigi; Rovere, Marco; Sakulin, Hannes; Santanastasio, Francesco; Schäfer, Christoph; Schwick, Christoph; Sekmen, Sezen; Sharma, Archana; Siegrist, Patrice; Silva, Pedro; Simon, Michal; Sphicas, Paraskevas; Spiga, Daniele; Stieger, Benjamin; Stoye, Markus; Tsirou, Andromachi; Veres, Gabor Istvan; Vlimant, Jean-Roch; Wöhri, Hermine Katharina; Worm, Steven; Zeuner, Wolfram Dietrich; Bertl, Willi; Deiters, Konrad; Erdmann, Wolfram; Gabathuler, Kurt; Horisberger, Roland; Ingram, Quentin; Kaestli, Hans-Christian; König, Stefan; Kotlinski, Danek; Langenegger, Urs; Renker, Dieter; Rohe, Tilman; Bachmair, Felix; Bäni, Lukas; Bianchini, Lorenzo; Bortignon, Pierluigi; Buchmann, Marco-Andrea; Casal, Bruno; Chanon, Nicolas; Deisher, Amanda; Dissertori, Günther; Dittmar, Michael; Donegà, Mauro; Dünser, Marc; Eller, Philipp; Freudenreich, Klaus; Grab, Christoph; Hits, Dmitry; Lecomte, Pierre; Lustermann, Werner; Mangano, Boris; Marini, Andrea Carlo; Martinez Ruiz del Arbol, Pablo; Meister, Daniel; Mohr, Niklas; Moortgat, Filip; Nägeli, Christoph; Nef, Pascal; Nessi-Tedaldi, Francesca; Pandolfi, Francesco; Pape, Luc; Pauss, Felicitas; Peruzzi, Marco; Quittnat, Milena; Ronga, Frederic Jean; Rossini, Marco; Sala, Leonardo; Sanchez, Ann - Karin; Starodumov, Andrei; Takahashi, Maiko; Tauscher, Ludwig; Thea, Alessandro; Theofilatos, Konstantinos; Treille, Daniel; Urscheler, Christina; Wallny, Rainer; Weber, Hannsjoerg Artur; Amsler, Claude; Chiochia, Vincenzo; Favaro, Carlotta; Ivova Rikova, Mirena; Kilminster, Benjamin; Millan Mejias, Barbara; Robmann, Peter; Snoek, Hella; Taroni, Silvia; Verzetti, Mauro; Yang, Yong; Cardaci, Marco; Chen, Kuan-Hsin; Ferro, Cristina; Kuo, Chia-Ming; Li, Syue-Wei; Lin, Willis; Lu, Yun-Ju; Volpe, Roberta; Yu, Shin-Shan; Bartalini, Paolo; Chang, Paoti; Chang, You-Hao; Chang, Yu-Wei; Chao, Yuan; Chen, Kai-Feng; Dietz, Charles; Grundler, Ulysses; Hou, George Wei-Shu; Hsiung, Yee; Kao, Kai-Yi; Lei, Yeong-Jyi; Lu, Rong-Shyang; Majumder, Devdatta; Petrakou, Eleni; Shi, Xin; Shiu, Jing-Ge; Tzeng, Yeng-Ming; Wang, Minzu; Asavapibhop, Burin; Suwonjandee, Narumon; Adiguzel, Aytul; Bakirci, Mustafa Numan; Cerci, Salim; Dozen, Candan; Dumanoglu, Isa; Eskut, Eda; Girgis, Semiray; Gokbulut, Gul; Gurpinar, Emine; Hos, Ilknur; Kangal, Evrim Ersin; Kayis Topaksu, Aysel; Onengut, Gulsen; Ozdemir, Kadri; Ozturk, Sertac; Polatoz, Ayse; Sogut, Kenan; Sunar Cerci, Deniz; Tali, Bayram; Topakli, Huseyin; Vergili, Mehmet; Akin, Ilina Vasileva; Aliev, Takhmasib; Bilin, Bugra; Bilmis, Selcuk; Deniz, Muhammed; Gamsizkan, Halil; Guler, Ali Murat; Karapinar, Guler; Ocalan, Kadir; Ozpineci, Altug; Serin, Meltem; Sever, Ramazan; Surat, Ugur Emrah; Yalvac, Metin; Zeyrek, Mehmet; Gülmez, Erhan; Isildak, Bora; Kaya, Mithat; Kaya, Ozlem; Ozkorucuklu, Suat; Sonmez, Nasuf; Bahtiyar, Hüseyin; Barlas, Esra; Cankocak, Kerem; Günaydin, Yusuf Oguzhan; Vardarli, Fuat Ilkehan; Yücel, Mete; Levchuk, Leonid; Sorokin, Pavel; Brooke, James John; Clement, Emyr; Cussans, David; Flacher, Henning; Frazier, Robert; Goldstein, Joel; Grimes, Mark; Heath, Greg P; Heath, Helen F; Kreczko, Lukasz; Lucas, Chris; Meng, Zhaoxia; Metson, Simon; Newbold, Dave M; Nirunpong, Kachanon; Paramesvaran, Sudarshan; Poll, Anthony; Senkin, Sergey; Smith, Vincent J; Williams, Thomas; Bell, Ken W; Belyaev, Alexander; Brew, Christopher; Brown, Robert M; Cockerill, David JA; Coughlan, John A; Harder, Kristian; Harper, Sam; Ilic, Jelena; Olaiya, Emmanuel; Petyt, David; Radburn-Smith, Benjamin Charles; Shepherd-Themistocleous, Claire; Tomalin, Ian R; Womersley, William John; Bainbridge, Robert; Buchmuller, Oliver; Burton, Darren; Colling, David; Cripps, Nicholas; Cutajar, Michael; Dauncey, Paul; Davies, Gavin; Della Negra, Michel; Ferguson, William; Fulcher, Jonathan; Futyan, David; Gilbert, Andrew; Guneratne Bryer, Arlo; Hall, Geoffrey; Hatherell, Zoe; Hays, Jonathan; Iles, Gregory; Jarvis, Martyn; Karapostoli, Georgia; Kenzie, Matthew; Lane, Rebecca; Lucas, Robyn; Lyons, Louis; Magnan, Anne-Marie; Marrouche, Jad; Mathias, Bryn; Nandi, Robin; Nash, Jordan; Nikitenko, Alexander; Pela, Joao; Pesaresi, Mark; Petridis, Konstantinos; Pioppi, Michele; Raymond, David Mark; Rogerson, Samuel; Rose, Andrew; Seez, Christopher; Sharp, Peter; Sparrow, Alex; Tapper, Alexander; Vazquez Acosta, Monica; Virdee, Tejinder; Wakefield, Stuart; Wardle, Nicholas; Chadwick, Matthew; Cole, Joanne; Hobson, Peter R; Khan, Akram; Kyberd, Paul; Leggat, Duncan; Leslie, Dawn; Martin, William; Reid, Ivan; Symonds, Philip; Teodorescu, Liliana; Turner, Mark; Dittmann, Jay; Hatakeyama, Kenichi; Kasmi, Azeddine; Liu, Hongxuan; Scarborough, Tara; Charaf, Otman; Cooper, Seth; Henderson, Conor; Rumerio, Paolo; Avetisyan, Aram; Bose, Tulika; Fantasia, Cory; Heister, Arno; Lawson, Philip; Lazic, Dragoslav; Rohlf, James; Sperka, David; St John, Jason; Sulak, Lawrence; Alimena, Juliette; Bhattacharya, Saptaparna; Christopher, Grant; Cutts, David; Demiragli, Zeynep; Ferapontov, Alexey; Garabedian, Alex; Heintz, Ulrich; Jabeen, Shabnam; Kukartsev, Gennadiy; Laird, Edward; Landsberg, Greg; Luk, Michael; Narain, Meenakshi; Segala, Michael; Sinthuprasith, Tutanon; Speer, Thomas; Breedon, Richard; Breto, Guillermo; Calderon De La Barca Sanchez, Manuel; Chauhan, Sushil; Chertok, Maxwell; Conway, John; Conway, Rylan; Cox, Peter Timothy; Erbacher, Robin; Gardner, Michael; Houtz, Rachel; Ko, Winston; Kopecky, Alexandra; Lander, Richard; Miceli, Tia; Pellett, Dave; Pilot, Justin; Ricci-Tam, Francesca; Rutherford, Britney; Searle, Matthew; Smith, John; Squires, Michael; Tripathi, Mani; Wilbur, Scott; Yohay, Rachel; Andreev, Valeri; Cline, David; Cousins, Robert; Erhan, Samim; Everaerts, Pieter; Farrell, Chris; Felcini, Marta; Hauser, Jay; Ignatenko, Mikhail; Jarvis, Chad; Rakness, Gregory; Schlein, Peter; Takasugi, Eric; Traczyk, Piotr; Valuev, Vyacheslav; Weber, Matthias; Babb, John; Clare, Robert; Ellison, John Anthony; Gary, J William; Hanson, Gail; Heilman, Jesse; Jandir, Pawandeep; Liu, Hongliang; Long, Owen Rosser; Luthra, Arun; Malberti, Martina; Nguyen, Harold; Shrinivas, Amithabh; Sturdy, Jared; Sumowidagdo, Suharyo; Wilken, Rachel; Wimpenny, Stephen; Andrews, Warren; Branson, James G; Cerati, Giuseppe Benedetto; Cittolin, Sergio; Evans, David; Holzner, André; Kelley, Ryan; Lebourgeois, Matthew; Letts, James; Macneill, Ian; Padhi, Sanjay; Palmer, Christopher; Petrucciani, Giovanni; Pieri, Marco; Sani, Matteo; Sharma, Vivek; Simon, Sean; Sudano, Elizabeth; Tadel, Matevz; Tu, Yanjun; Vartak, Adish; Wasserbaech, Steven; Würthwein, Frank; Yagil, Avraham; Yoo, Jaehyeok; Barge, Derek; Campagnari, Claudio; Danielson, Thomas; Flowers, Kristen; Geffert, Paul; George, Christopher; Golf, Frank; Incandela, Joe; Justus, Christopher; Kovalskyi, Dmytro; Krutelyov, Vyacheslav; Magaña Villalba, Ricardo; Mccoll, Nickolas; Pavlunin, Viktor; Richman, Jeffrey; Rossin, Roberto; Stuart, David; To, Wing; West, Christopher; Apresyan, Artur; Bornheim, Adolf; Bunn, Julian; Chen, Yi; Di Marco, Emanuele; Duarte, Javier; Kcira, Dorian; Ma, Yousi; Mott, Alexander; Newman, Harvey B; Pena, Cristian; Rogan, Christopher; Spiropulu, Maria; Timciuc, Vladlen; Veverka, Jan; Wilkinson, Richard; Xie, Si; Zhu, Ren-Yuan; Azzolini, Virginia; Calamba, Aristotle; Carroll, Ryan; Ferguson, Thomas; Iiyama, Yutaro; Jang, Dong Wook; Liu, Yueh-Feng; Paulini, Manfred; Russ, James; Vogel, Helmut; Vorobiev, Igor; Cumalat, John Perry; Drell, Brian Robert; Ford, William T; Gaz, Alessandro; Luiggi Lopez, Eduardo; Nauenberg, Uriel; Smith, James; Stenson, Kevin; Ulmer, Keith; Wagner, Stephen Robert; Alexander, James; Chatterjee, Avishek; Eggert, Nicholas; Gibbons, Lawrence Kent; Hopkins, Walter; Khukhunaishvili, Aleko; Kreis, Benjamin; Mirman, Nathan; Nicolas Kaufman, Gala; Patterson, Juliet Ritchie; Ryd, Anders; Salvati, Emmanuele; Sun, Werner; Teo, Wee Don; Thom, Julia; Thompson, Joshua; Tucker, Jordan; Weng, Yao; Winstrom, Lucas; Wittich, Peter; Winn, Dave; Abdullin, Salavat; Albrow, Michael; Anderson, Jacob; Apollinari, Giorgio; Bauerdick, Lothar AT; Beretvas, Andrew; Berryhill, Jeffrey; Bhat, Pushpalatha C; Burkett, Kevin; Butler, Joel Nathan; Chetluru, Vasundhara; Cheung, Harry; Chlebana, Frank; Cihangir, Selcuk; Elvira, Victor Daniel; Fisk, Ian; Freeman, Jim; Gao, Yanyan; Gottschalk, Erik; Gray, Lindsey; Green, Dan; Gutsche, Oliver; Hare, Daryl; Harris, Robert M; Hirschauer, James; Hooberman, Benjamin; Jindariani, Sergo; Johnson, Marvin; Joshi, Umesh; Kaadze, Ketino; Klima, Boaz; Kunori, Shuichi; Kwan, Simon; Linacre, Jacob; Lincoln, Don; Lipton, Ron; Lykken, Joseph; Maeshima, Kaori; Marraffino, John Michael; Martinez Outschoorn, Verena Ingrid; Maruyama, Sho; Mason, David; McBride, Patricia; Mishra, Kalanand; Mrenna, Stephen; Musienko, Yuri; Newman-Holmes, Catherine; O'Dell, Vivian; Prokofyev, Oleg; Ratnikova, Natalia; Sexton-Kennedy, Elizabeth; Sharma, Seema; Spalding, William J; Spiegel, Leonard; Taylor, Lucas; Tkaczyk, Slawek; Tran, Nhan Viet; Uplegger, Lorenzo; Vaandering, Eric Wayne; Vidal, Richard; Whitmore, Juliana; Wu, Weimin; Yang, Fan; Yun, Jae Chul; Acosta, Darin; Avery, Paul; Bourilkov, Dimitri; Chen, Mingshui; Cheng, Tongguang; Das, Souvik; De Gruttola, Michele; Di Giovanni, Gian Piero; Dobur, Didar; Drozdetskiy, Alexey; Field, Richard D; Fisher, Matthew; Fu, Yu; Furic, Ivan-Kresimir; Hugon, Justin; Kim, Bockjoo; Konigsberg, Jacobo; Korytov, Andrey; Kropivnitskaya, Anna; Kypreos, Theodore; Low, Jia Fu; Matchev, Konstantin; Milenovic, Predrag; Mitselmakher, Guenakh; Muniz, Lana; Remington, Ronald; Rinkevicius, Aurelijus; Skhirtladze, Nikoloz; Snowball, Matthew; Yelton, John; Zakaria, Mohammed; Gaultney, Vanessa; Hewamanage, Samantha; Linn, Stephan; Markowitz, Pete; Martinez, German; Rodriguez, Jorge Luis; Adams, Todd; Askew, Andrew; Bochenek, Joseph; Chen, Jie; Diamond, Brendan; Haas, Jeff; Hagopian, Sharon; Hagopian, Vasken; Johnson, Kurtis F; Prosper, Harrison; Veeraraghavan, Venkatesh; Weinberg, Marc; Baarmand, Marc M; Dorney, Brian; Hohlmann, Marcus; Kalakhety, Himali; Yumiceva, Francisco; Adams, Mark Raymond; Apanasevich, Leonard; Bazterra, Victor Eduardo; Betts, Russell Richard; Bucinskaite, Inga; Callner, Jeremy; Cavanaugh, Richard; Evdokimov, Olga; Gauthier, Lucie; Gerber, Cecilia Elena; Hofman, David Jonathan; Khalatyan, Samvel; Kurt, Pelin; Lacroix, Florent; Moon, Dong Ho; O'Brien, Christine; Silkworth, Christopher; Strom, Derek; Turner, Paul; Varelas, Nikos; Akgun, Ugur; Albayrak, Elif Asli; Bilki, Burak; Clarida, Warren; Dilsiz, Kamuran; Duru, Firdevs; Griffiths, Scott; Merlo, Jean-Pierre; Mermerkaya, Hamit; Mestvirishvili, Alexi; Moeller, Anthony; Nachtman, Jane; Newsom, Charles Ray; Ogul, Hasan; Onel, Yasar; Ozok, Ferhat; Sen, Sercan; Tan, Ping; Tiras, Emrah; Wetzel, James; Yetkin, Taylan; Yi, Kai; Barnett, Bruce Arnold; Blumenfeld, Barry; Bolognesi, Sara; Giurgiu, Gavril; Gritsan, Andrei; Hu, Guofan; Maksimovic, Petar; Martin, Christopher; Swartz, Morris; Whitbeck, Andrew; Baringer, Philip; Bean, Alice; Benelli, Gabriele; Kenny III, Raymond Patrick; Murray, Michael; Noonan, Daniel; Sanders, Stephen; Stringer, Robert; Wood, Jeffrey Scott; Barfuss, Anne-Fleur; Chakaberia, Irakli; Ivanov, Andrew; Khalil, Sadia; Makouski, Mikhail; Maravin, Yurii; Saini, Lovedeep Kaur; Shrestha, Shruti; Svintradze, Irakli; Gronberg, Jeffrey; Lange, David; Rebassoo, Finn; Wright, Douglas; Baden, Drew; Calvert, Brian; Eno, Sarah Catherine; Gomez, Jaime; Hadley, Nicholas John; Kellogg, Richard G; Kolberg, Ted; Lu, Ying; Marionneau, Matthieu; Mignerey, Alice; Pedro, Kevin; Peterman, Alison; Skuja, Andris; Temple, Jeffrey; Tonjes, Marguerite; Tonwar, Suresh C; Apyan, Aram; Bauer, Gerry; Busza, Wit; Cali, Ivan Amos; Chan, Matthew; Di Matteo, Leonardo; Dutta, Valentina; Gomez Ceballos, Guillelmo; Goncharov, Maxim; Gulhan, Doga; Kim, Yongsun; Klute, Markus; Lai, Yue Shi; Levin, Andrew; Luckey, Paul David; Ma, Teng; Nahn, Steve; Paus, Christoph; Ralph, Duncan; Roland, Christof; Roland, Gunther; Stephans, George; Stöckli, Fabian; Sumorok, Konstanty; Velicanu, Dragos; Wolf, Roger; Wyslouch, Bolek; Yang, Mingming; Yilmaz, Yetkin; Yoon, Sungho; Zanetti, Marco; Zhukova, Victoria; Dahmes, Bryan; De Benedetti, Abraham; Gude, Alexander; Haupt, Jason; Kao, Shih-Chuan; Klapoetke, Kevin; Kubota, Yuichi; Mans, Jeremy; Pastika, Nathaniel; Rusack, Roger; Sasseville, Michael; Singovsky, Alexander; Tambe, Norbert; Turkewitz, Jared; Acosta, John Gabriel; Cremaldi, Lucien Marcus; Kroeger, Rob; Oliveros, Sandra; Perera, Lalith; Rahmat, Rahmat; Sanders, David A; Summers, Don; Avdeeva, Ekaterina; Bloom, Kenneth; Bose, Suvadeep; Claes, Daniel R; Dominguez, Aaron; Eads, Michael; Gonzalez Suarez, Rebeca; Keller, Jason; Kravchenko, Ilya; Lazo-Flores, Jose; Malik, Sudhir; Meier, Frank; Snow, Gregory R; Dolen, James; Godshalk, Andrew; Iashvili, Ia; Jain, Supriya; Kharchilava, Avto; Kumar, Ashish; Rappoccio, Salvatore; Wan, Zongru; Alverson, George; Barberis, Emanuela; Baumgartel, Darin; Chasco, Matthew; Haley, Joseph; Massironi, Andrea; Nash, David; Orimoto, Toyoko; Trocino, Daniele; Wood, Darien; Zhang, Jinzhong; Anastassov, Anton; Hahn, Kristan Allan; Kubik, Andrew; Lusito, Letizia; Mucia, Nicholas; Odell, Nathaniel; Pollack, Brian; Pozdnyakov, Andrey; Schmitt, Michael; Stoynev, Stoyan; Sung, Kevin; Velasco, Mayda; Won, Steven; Berry, Douglas; Brinkerhoff, Andrew; Chan, Kwok Ming; Hildreth, Michael; Jessop, Colin; Karmgard, Daniel John; Kolb, Jeff; Lannon, Kevin; Luo, Wuming; Lynch, Sean; Marinelli, Nancy; Morse, David Michael; Pearson, Tessa; Planer, Michael; Ruchti, Randy; Slaunwhite, Jason; Valls, Nil; Wayne, Mitchell; Wolf, Matthias; Antonelli, Louis; Bylsma, Ben; Durkin, Lloyd Stanley; Hill, Christopher; Hughes, Richard; Kotov, Khristian; Ling, Ta-Yung; Puigh, Darren; Rodenburg, Marissa; Smith, Geoffrey; Vuosalo, Carl; Winer, Brian L; Wolfe, Homer; Berry, Edmund; Elmer, Peter; Halyo, Valerie; Hebda, Philip; Hegeman, Jeroen; Hunt, Adam; Jindal, Pratima; Koay, Sue Ann; Lujan, Paul; Marlow, Daniel; Medvedeva, Tatiana; Mooney, Michael; Olsen, James; Piroué, Pierre; Quan, Xiaohang; Raval, Amita; Saka, Halil; Stickland, David; Tully, Christopher; Werner, Jeremy Scott; Zenz, Seth Conrad; Zuranski, Andrzej; Brownson, Eric; Lopez, Angel; Mendez, Hector; Ramirez Vargas, Juan Eduardo; Alagoz, Enver; Benedetti, Daniele; Bolla, Gino; Bortoletto, Daniela; De Mattia, Marco; Everett, Adam; Hu, Zhen; Jones, Matthew; Jung, Kurt; Koybasi, Ozhan; Kress, Matthew; Leonardo, Nuno; Lopes Pegna, David; Maroussov, Vassili; Merkel, Petra; Miller, David Harry; Neumeister, Norbert; Shipsey, Ian; Silvers, David; Svyatkovskiy, Alexey; Wang, Fuqiang; Xie, Wei; Xu, Lingshan; Yoo, Hwi Dong; Zablocki, Jakub; Zheng, Yu; Parashar, Neeti; Adair, Antony; Akgun, Bora; Ecklund, Karl Matthew; Geurts, Frank JM; Li, Wei; Michlin, Benjamin; Padley, Brian Paul; Redjimi, Radia; Roberts, Jay; Zabel, James; Betchart, Burton; Bodek, Arie; Covarelli, Roberto; de Barbaro, Pawel; Demina, Regina; Eshaq, Yossof; Ferbel, Thomas; Garcia-Bellido, Aran; Goldenzweig, Pablo; Han, Jiyeon; Harel, Amnon; Miner, Daniel Carl; Petrillo, Gianluca; Vishnevskiy, Dmitry; Zielinski, Marek; Bhatti, Anwar; Ciesielski, Robert; Demortier, Luc; Goulianos, Konstantin; Lungu, Gheorghe; Malik, Sarah; Mesropian, Christina; Arora, Sanjay; Barker, Anthony; Chou, John Paul; Contreras-Campana, Christian; Contreras-Campana, Emmanuel; Duggan, Daniel; Ferencek, Dinko; Gershtein, Yuri; Gray, Richard; Halkiadakis, Eva; Hidas, Dean; Lath, Amitabh; Panwalkar, Shruti; Park, Michael; Patel, Rishi; Rekovic, Vladimir; Robles, Jorge; Salur, Sevil; Schnetzer, Steve; Seitz, Claudia; Somalwar, Sunil; Stone, Robert; Thomas, Scott; Thomassen, Peter; Walker, Matthew; Cerizza, Giordano; Hollingsworth, Matthew; Rose, Keith; Spanier, Stefan; Yang, Zong-Chang; York, Andrew; Bouhali, Othmane; Eusebi, Ricardo; Flanagan, Will; Gilmore, Jason; Kamon, Teruki; Khotilovich, Vadim; Montalvo, Roy; Osipenkov, Ilya; Pakhotin, Yuriy; Perloff, Alexx; Roe, Jeffrey; Safonov, Alexei; Sakuma, Tai; Suarez, Indara; Tatarinov, Aysen; Toback, David; Akchurin, Nural; Cowden, Christopher; Damgov, Jordan; Dragoiu, Cosmin; Dudero, Phillip Russell; Kovitanggoon, Kittikul; Lee, Sung Won; Libeiro, Terence; Volobouev, Igor; Appelt, Eric; Delannoy, Andrés G; Greene, Senta; Gurrola, Alfredo; Johns, Willard; Maguire, Charles; Mao, Yaxian; Melo, Andrew; Sharma, Monika; Sheldon, Paul; Snook, Benjamin; Tuo, Shengquan; Velkovska, Julia; Arenton, Michael Wayne; Boutle, Sarah; Cox, Bradley; Francis, Brian; Goodell, Joseph; Hirosky, Robert; Ledovskoy, Alexander; Lin, Chuanzhe; Neu, Christopher; Wood, John; Gollapinni, Sowjanya; Harr, Robert; Karchin, Paul Edmund; Kottachchi Kankanamge Don, Chamath; Lamichhane, Pramod; Sakharov, Alexandre; Belknap, Donald; Borrello, Laura; Carlsmith, Duncan; Cepeda, Maria; Dasu, Sridhara; Duric, Senka; Friis, Evan; Grothe, Monika; Hall-Wilton, Richard; Herndon, Matthew; Hervé, Alain; Klabbers, Pamela; Klukas, Jeffrey; Lanaro, Armando; Loveless, Richard; Mohapatra, Ajit; Ojalvo, Isabel; Perry, Thomas; Pierro, Giuseppe Antonio; Polese, Giovanni; Ross, Ian; Sarangi, Tapas; Savin, Alexander; Smith, Wesley H; Swanson, Joshua

    2013-01-01

    The results of a search for the bottomonium counterpart, denoted as $X_b$, of the exotic charmonium state X(3872) is presented. The analysis is based on a sample of pp collisions at $\\sqrt{s}$ = 8 TeV collected by the CMS experiment at the LHC, corresponding to an integrated luminosity of 20.7 inverse femtobarns. The search looks for the exclusive decay channel $X_b \\to \\Upsilon(1S) \\pi^+ \\pi^-$ followed by $\\Upsilon(1S) \\to \\mu^+ \\mu^-$. No evidence for an $X_b$ signal is observed. Upper limits are set at the 95% confidence level on the ratio of the inclusive production cross sections times the branching fractions to $\\Upsilon(1S) \\pi^+ \\pi^-$ of the $X_b$ and the $\\Upsilon$(2S). The upper limits on the ratio are in the range 0.9-5.4% for $X_b$ masses between 10 and 11 GeV. These are the first upper limits on the production of a possible $X_b$ at a hadron collider.

  6. Evaluation of an analytic linear Boltzmann transport equation solver for high-density inhomogeneities

    Energy Technology Data Exchange (ETDEWEB)

    Lloyd, S. A. M.; Ansbacher, W. [Department of Physics and Astronomy, University of Victoria, Victoria, British Columbia V8W 3P6 (Canada); Department of Physics and Astronomy, University of Victoria, Victoria, British Columbia V8W 3P6 (Canada) and Department of Medical Physics, British Columbia Cancer Agency-Vancouver Island Centre, Victoria, British Columbia V8R 6V5 (Canada)

    2013-01-15

    Purpose: Acuros external beam (Acuros XB) is a novel dose calculation algorithm implemented through the ECLIPSE treatment planning system. The algorithm finds a deterministic solution to the linear Boltzmann transport equation, the same equation commonly solved stochastically by Monte Carlo methods. This work is an evaluation of Acuros XB, by comparison with Monte Carlo, for dose calculation applications involving high-density materials. Existing non-Monte Carlo clinical dose calculation algorithms, such as the analytic anisotropic algorithm (AAA), do not accurately model dose perturbations due to increased electron scatter within high-density volumes. Methods: Acuros XB, AAA, and EGSnrc based Monte Carlo are used to calculate dose distributions from 18 MV and 6 MV photon beams delivered to a cubic water phantom containing a rectangular high density (4.0-8.0 g/cm{sup 3}) volume at its center. The algorithms are also used to recalculate a clinical prostate treatment plan involving a unilateral hip prosthesis, originally evaluated using AAA. These results are compared graphically and numerically using gamma-index analysis. Radio-chromic film measurements are presented to augment Monte Carlo and Acuros XB dose perturbation data. Results: Using a 2% and 1 mm gamma-analysis, between 91.3% and 96.8% of Acuros XB dose voxels containing greater than 50% the normalized dose were in agreement with Monte Carlo data for virtual phantoms involving 18 MV and 6 MV photons, stainless steel and titanium alloy implants and for on-axis and oblique field delivery. A similar gamma-analysis of AAA against Monte Carlo data showed between 80.8% and 87.3% agreement. Comparing Acuros XB and AAA evaluations of a clinical prostate patient plan involving a unilateral hip prosthesis, Acuros XB showed good overall agreement with Monte Carlo while AAA underestimated dose on the upstream medial surface of the prosthesis due to electron scatter from the high-density material. Film measurements

  7. Evaluation of an analytic linear Boltzmann transport equation solver for high-density inhomogeneities

    International Nuclear Information System (INIS)

    Purpose: Acuros external beam (Acuros XB) is a novel dose calculation algorithm implemented through the ECLIPSE treatment planning system. The algorithm finds a deterministic solution to the linear Boltzmann transport equation, the same equation commonly solved stochastically by Monte Carlo methods. This work is an evaluation of Acuros XB, by comparison with Monte Carlo, for dose calculation applications involving high-density materials. Existing non-Monte Carlo clinical dose calculation algorithms, such as the analytic anisotropic algorithm (AAA), do not accurately model dose perturbations due to increased electron scatter within high-density volumes. Methods: Acuros XB, AAA, and EGSnrc based Monte Carlo are used to calculate dose distributions from 18 MV and 6 MV photon beams delivered to a cubic water phantom containing a rectangular high density (4.0–8.0 g/cm3) volume at its center. The algorithms are also used to recalculate a clinical prostate treatment plan involving a unilateral hip prosthesis, originally evaluated using AAA. These results are compared graphically and numerically using gamma-index analysis. Radio-chromic film measurements are presented to augment Monte Carlo and Acuros XB dose perturbation data. Results: Using a 2% and 1 mm gamma-analysis, between 91.3% and 96.8% of Acuros XB dose voxels containing greater than 50% the normalized dose were in agreement with Monte Carlo data for virtual phantoms involving 18 MV and 6 MV photons, stainless steel and titanium alloy implants and for on-axis and oblique field delivery. A similar gamma-analysis of AAA against Monte Carlo data showed between 80.8% and 87.3% agreement. Comparing Acuros XB and AAA evaluations of a clinical prostate patient plan involving a unilateral hip prosthesis, Acuros XB showed good overall agreement with Monte Carlo while AAA underestimated dose on the upstream medial surface of the prosthesis due to electron scatter from the high-density material. Film measurements support

  8. The radial distribution of X-ray binaries and globular clusters in NGC 4649 and their relation with the local stellar mass density

    International Nuclear Information System (INIS)

    We investigate the radial distribution of the low-mass X-ray binary (LMXB) population in the elliptical galaxy NGC 4649, using Chandra and Hubble data to separate the field and globular cluster (GC) populations. GCs with LMXBs have the same radial distribution as the parent red and blue GCs. The radial profile of field LMXBs follows the V-band profile within the D25 of NGC 4649. Using the spatial information provided by our data, we find that the global galaxy-wide relations among cumulative number and luminosity of LMXBs and the integrated stellar mass hold on local scales within D25. An excess of field LMXBs with respect to the V-band light is observed in the galaxy's outskirts, which may be partially due to unidentified GC sources or to a rejuvenated field LMXB population caused by past merging interactions.

  9. RXTE Observations of 1A 1744-361: Correlated Spectral and Timing Behavior

    CERN Document Server

    Bhattacharya, S; Swank, J H; Markwardt, C B; Bhattacharyya, Sudip; Strohmayer, Tod E.; Swank, Jean H.; Markwardt, Craig B.

    2006-01-01

    We analyze Rossi X-ray Timing Explorer (RXTE) Proportional Counter Array (PCA) data of the transient low mass X-ray binary (LMXB) system 1A 1744-361. We explore the X-ray intensity and spectral evolution of the source, perform timing analysis, and find that 1A 1744-361 shows `atoll' behavior during the outbursts. The color-color diagram indicates that this LMXB was observed in a low intensity spectrally hard (low-hard) state and in a high intensity `banana' state. The low-hard state shows a horizontal pattern in the color-color diagram, and the previously reported `dipper QPO' appears only during this state. We also perform energy spectral analyses, and report the first detection of broad iron emission line and iron absorption edge from 1A 1744-361.

  10. Doppler Tomography of XTE J2123-058 and Other Neutron Star LMXBs

    CERN Document Server

    Hynes, R I; Haswell, C A; Casares, J; Zurita, C

    2000-01-01

    We describe Doppler tomography obtained in the 1998 outburst of the neutron star low mass X-ray binary (LMXB) XTE J2123-058. This analysis, and other aspects of phase-resolved spectroscopy, indicate similarities to SW Sex systems, except that anomalous emission kinematics are seen in HeII, whilst phase 0.5 absorption is confined to H alpha. This separation of these effects may provide tighter constraints on models in the LMXB case than is possible for SW Sex systems. We will compare results for other LMXBs which appear to show similar kinematics and discuss how models for the SW Sex phenomenon can be adapted to these systems. Finally we will summarise the limited Doppler tomography performed on the class of neutron star LMXBs as a whole, and discuss whether any common patterns can yet be identified.

  11. Forced bursting and transition mechanism in CO oxidation with three time scales

    Institute of Scientific and Technical Information of China (English)

    Li Xiang-Hong; Bi Qin-Sheng

    2013-01-01

    The mathematical model of CO oxidation with three time scales on platinum group metals is investigated,in which order gaps between the time scales related to external perturbation and the rates associated with different chemical reaction steps exist.Forced bursters,such as point-point type forced bursting and point-cycle type forced bursting,are presented.The bifurcation mechanism of forced bursting is novel,and the phenomenon where two different kinds of spiking states coexist in point-cycle type forced bursting has not been reported in previous work.A double-parameter bifurcation set of the fast subsystem is explored to reveal the transition mechanisms of different forced bursters with parameter variation.

  12. Forced bursting and transition mechanism in CO oxidation with three time scales

    International Nuclear Information System (INIS)

    The mathematical model of CO oxidation with three time scales on platinum group metals is investigated, in which order gaps between the time scales related to external perturbation and the rates associated with different chemical reaction steps exist. Forced bursters, such as point—point type forced bursting and point—cycle type forced bursting, are presented. The bifurcation mechanism of forced bursting is novel, and the phenomenon where two different kinds of spiking states coexist in point—cycle type forced bursting has not been reported in previous work. A double-parameter bifurcation set of the fast subsystem is explored to reveal the transition mechanisms of different forced bursters with parameter variation. (general)

  13. Mixed-mode oscillations in a multiple time scale phantom bursting system

    OpenAIRE

    Krupa, Maciej; Vidal, Alexandre; Desroches, Mathieu; Clément, Frédérique

    2012-01-01

    38 pages, 16 figures. International audience In this work we study mixed mode oscillations in a model of secretion of GnRH (Gonadotropin Releasing Hormone). The model is a phantom burster consisting of two feedforward coupled FitzHugh-Nagumo systems, with three time scales. The forcing system (Regulator) evolves on the slowest scale and acts by moving the slow nullcline of the forced system (Secretor). There are three modes of dynamics: pulsatility (transient relaxation oscillation), su...

  14. A Ritzian interpretation of variable stars

    Science.gov (United States)

    Fritzius, Robert S.

    2000-09-01

    A revived version of de Sitter's 1913 ``binary stars'' argument against Ritz's Galilean relativity general electrodynamic theory provides a means of explaining of the mechanism underlying the apparent variability of variable stars, pulsars, and gamma-ray bursters. Numerical code to compute c+v induced intensity peaks and blueshift chirps for spectroscopic binaries provides graphical displays for comparison with observed light curves and spectra for different classes of variable stars. .

  15. Inelastic Branch of the Stellar Reaction $^{14}$O$(\\alpha,p)^{17}$F

    CERN Multimedia

    Hass, M; Van duppen, P L E

    2002-01-01

    We propose to use the upgraded REX-ISOLDE beam energy to study the astrophysically important $^{14}$O($\\alpha$, p)$^{17}$F reaction in time reverse kinematics. In particular, we will use the highly efficient miniball + CD detection system to measure the previously undetermined inelastic proton branch of the 1$^-$ state at 6.15 MeV in $^{18}$Ne. This state dominates the reaction rate under X-ray burster conditions.

  16. How to Tell a Jet from a Balloon: A Proposed Test for Beaming in Gamma Ray Bursts

    OpenAIRE

    Rhoads, James E.

    1997-01-01

    If gamma ray bursts are highly collimated, the energy requirements of each event may be reduced by several (~ 4-6) orders of magnitude, and the event rate increased correspondingly. Extreme conditions in gamma ray bursters lead to highly relativistic motions (bulk Lorentz factors Gamma > 100). This results in strong forward beaming of the emitted radiation in the observer's rest frame. Thus, all information on gamma ray bursts comes from those ejecta emitted in a narrow cone (opening angle 1/...

  17. Inferring network properties of cortical neurons with synaptic coupling and parameter dispersion

    OpenAIRE

    Dipanjan eRoy; Viktor eJirsa

    2013-01-01

    Computational models at different space-time scales allow us to understand the fundamental mechanisms that govern neural processes and relate uniquely these processes to neuroscience data. In this work, we propose a novel neurocomputational unit (a mesoscopic model which tell us about the interaction between local cortical nodes in a large scale neural mass model) of bursters that qualitatively captures the complex dynamics exhibited by a full network of parabolic bursting neurons. We observe...

  18. A Search for Astrophysical Burst Signals at the Sudbury Neutrino Observatory

    CERN Document Server

    Aharmim, B; Anthony, A E; Barros, N; Beier, E W; Bellerive, A; Beltran, B; Bergevin, M; Biller, S D; Boudjemline, K; Boulay, M G; Cai, B; Chan, Y D; Chauhan, D; Chen, M; Cleveland, B T; Cox, G A; Dai, X; Deng, H; Detwiler, J A; DiMarco, M; Diamond, M D; Doe, P J; Doucas, G; Drouin, P -L; Duncan, F A; Dunford, M; Earle, E D; Elliott, S R; Evans, H C; Ewan, G T; Farine, J; Fergani, H; Fleurot, F; Ford, R J; Formaggio, J A; Gagnon, N; Goon, J TM; Graham, K; Guillian, E; Habib, S; Hahn, R L; Hallin, A L; Hallman, E D; Harvey, P J; Hazama, R; Heintzelman, W J; Heise, J; Helmer, R L; Hime, A; Howard, C; Huang, M; Jagam, P; Jamieson, B; Jelley, N A; Jerkins, M; Keeter, K J; Klein, J R; Kormos, L L; Kos, M; Kraus, C; Krauss, C B; Krueger, A; Kutter, T; Kyba, C C M; Lange, R; Law, J; Lawson, I T; Lesko, K T; Leslie, J R; Levine, I; Loach, J C; MacLellan, R; Majerus, S; Mak, H B; Maneira, J; Martin, R; McCauley, N; McDonald, A B; McGee, S R; Miller, M L; Monreal, B; Monroe, J; Nickel, B G; Noble, A J; O'Keeffe, H M; Oblath, N S; Ollerhead, R W; Gann, G D Orebi; Oser, S M; Ott, R A; Peeters, S J M; Poon, A W P; Prior, G; Reitzner, S D; Rielage, K; Robertson, B C; Robertson, R G H; Schwendener, M H; Secrest, J A; Seibert, S R; Simard, O; Simpson, J J; Sinclair, D; Skensved, P; Sonley, T J; Stonehill, L C; Tesic, G; Tolich, N; Tsui, T; Van Berg, R; VanDevender, B A; Virtue, C J; Wall, B L; Waller, D; Tseung, H Wan Chan; Wark, D L; Watson, P J S; Wendland, J; West, N; Wilkerson, J F; Wilson, J R; Wouters, J M; Wright, A; Yeh, M; Zhang, F; Zuber, K

    2013-01-01

    The Sudbury Neutrino Observatory (SNO) has confirmed the standard solar model and neutrino oscillations through the observation of neutrinos from the solar core. In this paper we present a search for neutrinos associated with sources other than the solar core, such as gamma-ray bursters and solar flares. We present a new method for looking for temporal coincidences between neutrino events and astrophysical bursts of widely varying intensity. No correlations were found between neutrinos detected in SNO and such astrophysical sources.

  19. Analysis of the Quiescent Low-Mass X-ray Binary Population in Galactic Globular Clusters

    CERN Document Server

    Heinke, C O; Lugger, P M; Cohn, H N; Edmonds, P D; Lloyd, D A; Cool, A M

    2003-01-01

    Quiescent low-mass X-ray binaries (qLMXBs) containing neutron stars have been identified in several globular clusters using Chandra or XMM X-ray observations, using their soft thermal spectra. We report a complete census of the qLMXB population in these clusters, identifying three additional probable qLMXBs in NGC 6440. We conduct several analyses of the qLMXB population, and compare it with the harder, primarily CV, population of low-luminosity X-ray sources with 10^31LMXB sample suggests an average system mass of 1.5^{+0.3}_{-0.2} Msun, consistent with a neutron star and low-mass companion. Spectral analysis reveals that no globular cluster qLMXBs, other than the transient in NGC 6440, require an additional hard power-law component as often observed in field qLMXBs. We identify an empirical lower luminosity limit of 10^32 ergs/s among globular cluster qLMXBs. The bolometric luminosity range of qLMXBs implies (in the deep crustal heating model of Bro...

  20. Exploring $X(5568)$ as a meson molecule

    CERN Document Server

    Agaev, S S; Sundu, H

    2016-01-01

    The parameters, i.e. the mass and decay constant of the exotic $X_b(5568)$ state newly observed by D0 Collaboration, as well as the decay width of the process $X_b \\to B_s^{0}\\pi^{+}$ are explored using $B\\overline{K}$ molecule assumption on its structure. Computational methods employed here encompass QCD two-point and light-cone sum rules, latter being considered in the soft-meson approximation. The obtained results are compared with the data of the D0 Collaboration, as well as with the predictions of the diquark-antidiquark model. This comparison strengthens the diquark-antidiquark picture for the $X_b(5568)$ state rather than a meson molecule structure.

  1. AcEST: BP919437 [AcEST

    Lifescience Database Archive (English)

    Full Text Available B96_SALTO Peptidase S9, prolyl oligopeptidase activ... 33 7.1 tr|Q2SPP8|Q2SPP8_HAHCH Predicted phosphohydrol...4 GRSRIYTLPFEGGVPRLITPLGPSYLHGWSPDGKQLAYCAERNGNFDVYV 163 >tr|A4XB96|A4XB96_SALTO Peptidase S9, prolyl oligop...in OS=Des... 35 2.4 tr|A6LG82|A6LG82_PARD8 Periplasmic component of the Tol biopolym... 33 7.1 tr|A4XB96|A4X...6LG82_PARD8 Periplasmic component of the Tol biopolymer transport system OS=Parabacteroides distasonis (stra...|B7DGU5|B7DGU5_DESSA Sua5/YciO/YrdC/YwlC family protein OS=Desulfovibrio salexigens DSM 2638 Alig

  2. Measurement of Two- and Three-Nucleon Short-Range Correlation Probabilities in Nuclei

    Energy Technology Data Exchange (ETDEWEB)

    K. S. Egiyan; N. B. Dashyan; M. M. Sargsian; M. I. Strikman; L. B. Weinstein; G. Adams; P. Ambrozewicz; M. Anghinolfi; B. Asavapibhop; G. Asryan; H. Avakian; H. Baghdasaryan; N. Baillie; J. P. Ball; N. A. Baltzell; V. Batourine; M. Battaglieri; I. Bedlinskiy; M. Bektasoglu; M. Bellis; N. Benmouna; A. S. Biselli; B. E. Bonner; S. Bouchigny; S. Boiarinov; R. Bradford; D. Branford; W. K. Brooks; S. Bültmann; V. D. Burkert; C. Bultuceanu; J. R. Calarco; S. L. Careccia; D. S. Carman; B. Carnahan; S. Chen; P. L. Cole; P. Coltharp; P. Corvisiero; D. Crabb; H. Crannell; J. P. Cummings; E. De Sanctis; R. DeVita; P. V. Degtyarenko; H. Denizli; L. Dennis; K. V. Dharmawardane; C. Djalali; G. E. Dodge; J. Donnelly; D. Doughty; P. Dragovitsch; M. Dugger; S. Dytman; O. P. Dzyubak; H. Egiyan; L. Elouadrhiri; A. Empl; P. Eugenio; R. Fatemi; G. Fedotov; R. J. Feuerbach; T. A. Forest; H. Funsten; G. Gavalian; N. G. Gevorgyan; G. P. Gilfoyle; K. L. Giovanetti; F. X. Girod; J. T. Goetz; E. Golovatch; R. W. Gothe; K. A. Griffioen; M. Guidal; M. Guillo; N. Guler; L. Guo; V. Gyurjyan; C. Hadjidakis; J. Hardie; F. W. Hersman; K. Hicks; I. Hleiqawi; M. Holtrop; J. Hu; M. Huertas; C. E. Hyde-Wright; Y. Ilieva; D. G. Ireland; B. S. Ishkhanov; M. M. Ito; D. Jenkins; H. S. Jo; K. Joo; H. G. Juengst; J. D. Kellie; M. Khandaker; K. Y. Kim; K. Kim; W. Kim; A. Klein; F. J. Klein; A. Klimenko; M. Klusman; L. H. Kramer; V. Kubarovsky; J. Kuhn; S. E. Kuhn; S. Kuleshov; J. Lachniet; J. M. Laget; J. Langheinrich; D. Lawrence; T. Lee; K. Livingston; L. C. Maximon; S. McAleer; B. McKinnon; J. W. C. McNabb; B. A. Mecking; M. D. Mestayer; C. A. Meyer; T. Mibe; K. Mikhailov; R. Minehart; M. Mirazita; R. Miskimen; V. Mokeev; S. A. Morrow; J. Mueller; G. S. Mutchler; P. Nadel-Turonski; J. Napolitano; R. Nasseripour; S. Niccolai; G. Niculescu; I. Niculescu; B. B. Niczyporuk; R. A. Niyazov; G. V. O' Rielly; M. Osipenko; A. I. Ostrovidov; K. Park; E. Pasyuk; C. Peterson; J. Pierce; N. Pivnyuk; D. Pocanic; O. Pogorelko; E. Polli; S. Pozdniakov; B. M. Preedom; J. W. Price; Y. Prok; D. Protopopescu; L. M. Qin; B. A. Raue; G. Riccardi; G. Ricco; M. Ripani; B. G. Ritchie; F. Ronchetti; G. Rosner; P. Rossi; D. Rowntree; P. D. Rubin; F. Sabatié; C. Salgado; J. P. Santoro; V. Sapunenko; R. A. Schumacher; V. S. Serov; Y. G. Sharabian; J. Shaw; E. S. Smith; L. C. Smith; D. I. Sober; A. Stavinsky; S. Stepanyan; B. E. Stokes; P. Stoler; S. Strauch; R. Suleiman; M. Taiuti; S. Taylor; D. J. Tedeschi; R. Thompson; A. Tkabladze; S. Tkachenko; L. Todor; C. Tur; M. Ungaro; M. F. Vineyard; A. V. Vlassov; D. P. Weygand; M. Williams; E. Wolin; M. H. Wood; A. Yegneswaran; J. Yun; L. Zana; and J. Zhang

    2006-03-01

    The ratios of inclusive electron scattering cross sections of 4He, 12C, and 56Fe to 3He have been measured at 1<xB<3. At Q2>1.4 GeV2, the ratios exhibit two separate plateaus, at 1.5<xB<2 and at xB>2.25. This pattern is predicted by models that include 2- and 3-nucleon short-range correlations (SRC). Relative to A=3, the per-nucleon probabilities of 3-nucleon SRC are 2.3, 3.1, and 4.4 times larger for A=4, 12, and 56. This is the first measurement of 3-nucleon SRC probabilities in nuclei.

  3. X-band klystrons for Japan Linear Collider

    International Nuclear Information System (INIS)

    To achieve the acceleration gradient of 100 MeV/m necessary for the future linear collider in X-band, an RF power source which could produce more than 100 MW peak power with the pulse duration of 500 nsec is needed even with the factor 4 RF pulse compression system. As the first step for the development of the 100 MW class klystrons in X-band (11.424 GHz), a 30 MW class klystron named XB-50K was tested several times since 1990. XB-50K was tested up to the peak power of 18 MW with the pulse duration of 100 ns. A new 100 MW class klystron named XB-72K was designed and fabricated. Some test results of this klystron are reported. (Author) 9 refs., 3 figs., 2 tabs

  4. Parter, Periodic and Coperiodic Functions on Groups and their Characterization

    Directory of Open Access Journals (Sweden)

    M. H. Hooshmand

    2013-06-01

    Full Text Available Decomposer functional equations were introduced by the author and have been completely solved on arbitrary groups. Their solutions are as decomposer functions and play important role regarding to decomposition (factorization of groups by their two subsets. In this paper, we introduce an important class of strong decomposer functions, namely parter (or cyclic decomposer functions. As some important applications of this topic, we characterize all periodic , coperiodic functions in arbitrary groups and give general solution of their functional equations: f(bx = f(x , f(xb = f(x, f(bx = bf(x and f(xb = f(xb. Moreover, we characterize all parter functions in arbitrary groups and completely solve the decomposer equation with the condition which its ∗-range is a cyclic subgroup of G. Finally, we give some functional characterization for related projections and b-parts functions and also, we introduce some uniqueness conditions for b-parts of real numbers.

  5. On the absence of plasma wave emissions and the magnetic field orientation in the distant magnetosheath

    Science.gov (United States)

    Coroniti, F. V.; Greenstadt, E. W.; Moses, S. L.; Tsurutani, B. T.; Smith, E. J.

    1994-01-01

    In early September, 1983 ISEE-3 made a long traversal of the distant dawnside magnetosheath starting near x = -150 R(sub E) downstream. The distant magnetosheath often contains moderately intense plasma wave emissions at frequencies from several hundred Hz to 5 kHz. However, over time scales of many days, a clear correlation exists between the occurrence of the plasma waves and the cone angle (theta(sub xB)) between the magnetic field and the plasma flow velocity (x-direction). For theta(sub xB) large (small), the plasma wave amplitudes are near background (high). Sudden (less than 1 minute) changes in the local magnetic field orientation produce correspondingly sudden changes in the wave amplitudes. Statistically, the wave amplitudes decrease continuously with increasing theta(sub xB).

  6. Gamma-ray attenuation coefficients in some heavy metal oxide borate glasses at 662 keV

    International Nuclear Information System (INIS)

    The linear attenuation coefficient (μ) and mass attenuation coefficients (μ/ρ) of glasses in three systems: xPbO(1-x)B2O3, 0.25PbO.xCdO(0.75-x)B2O3 and xBi2O3(1-x)B2O3 were measured at 662 keV. Appreciable variations were noted in the attenuation coefficients due to changes in the chemical composition of glasses. In addition to this, absorption cross-sections per atom were also calculated. A comparison of shielding properties of these glasses with standar d shielding materials like lead, lead glass and concrete has proven that these glasses have a potential application as transparent radiation shielding. (orig.)

  7. Research on the Physicochemical Property of the Starch in Different Cassava Varieties%不同品种的木薯淀粉理化特性研究

    Institute of Scientific and Technical Information of China (English)

    杨栋林; 陈燕珍; 庞月圆; 刘晓灿; 谭涛

    2009-01-01

    [Objective] The physical and chemical characteristics of cassava starch was studied.[Method] The cassava variety: bread cassava with large leaf and white skin(DB), bread cassava with small leaf and white skin (XB), bread cassava with large leaf and red skin(DH) being taken as experimental material, the physical and chemical property such as the content of protein, the light transmittance, the stability of frozen and condensation/precipitation, and cassava shape of these varieties was tested.[Results] The order of the content of protein from high to low was: XB>DH>DB;the light transmittance, DB>XB>DH;there was no difference in the stability of frozen and condensation/precipitation among varieties;and there was difference in the cassava shape among varieties.[Conclusion] The scientific reference for the deep processing and development and utilization of cassava was provided.%[目的]研究木薯淀粉的理化特性.[方法]以大叶白皮面包木薯(DB)、小叶白皮面包木薯(XB)、大叶红皮面包木薯(DH)为试验材料,测定其蛋白质含量、透光率、冷冻稳定性、凝沉稳定性及颗粒形态等理化特性.[结果]蛋白质含量的高低为:XB>DH>DB;透光率的大小为:DB>XB>DH;冷冻稳定性及凝沉稳定性差异不大;淀粉的颗粒形态有差异.[结论]试验为木薯的深加工及开发利用提供了科学的参考依据.

  8. Darstellung, Charakterisierung und magnetische Eigenschaften von Übergangsmetallboriden des Th 7 Fe 3 -Typs

    OpenAIRE

    Missé Ndong, Patrick Richard

    2012-01-01

    In this work the synthesis, characterization and magnetic properties of new ternary and quaternary transition metal borides with Th7Fe3-type structure were reported. The new compounds were synthesized by arc­melting the elements in a water­cooled copper crucible under argon. In the first part of this work powder samples and single crystals of the ternary boride phases MxRh7-xB3 and MRu6B3 (M = Cr, Mn, Fe, Co, Ni) have been investigated. In the MxRh7-xB3 series single phases were obtained for ...

  9. Evidence for mass-loading of the Venus magnetosheath

    International Nuclear Information System (INIS)

    The observed magnetic field configuration in the Venus magnetosheath contains information about the solar wind mass-loading processes occurring as a result of the extension of the neutral atmosphere into the magnetosheath. In this paper, magnetic field signatures of various mass-loading processes are discussed and experimental results from the Pioneer Venus Orbiter magnetometer experiment are examined for evidence of these signatures. The data suggest that the -V(bar)XB(bar) acceleration process, stochastic pickup of ionospheric ions, and J(bar)XB(bar) force scavenging at the ionopause all occur at various times. 16 references

  10. Next-to-leading order corrections in exclusive meson production

    International Nuclear Information System (INIS)

    We analyze in detail the size of next-to-leading order corrections to hard exclusive meson production within the collinear factorization approach. Corrections to the cross section are found to be huge at small xB and substantial in typical fixed-target kinematics. With the models we take for nucleon helicity-flip distributions, the transverse target polarization asymmetry in vector meson production is strongly affected by radiative corrections, except at large xB. Its overall size is very small for ρ production but can be large in the ω channel. (orig.)

  11. 78 FR 3402 - Marine Mammals; File No. 16919

    Science.gov (United States)

    2013-01-16

    ... was published in the Federal Register (77 FR 27717) that a request for a permit to conduct research on... National Oceanic and Atmospheric Administration RIN 0648-XB173 Marine Mammals; File No. 16919 AGENCY... the authority of the Marine Mammal Protection Act of 1972, as amended (16 U.S.C. 1361 et seq.),...

  12. 77 FR 9627 - Marine Mammals

    Science.gov (United States)

    2012-02-17

    ... National Oceanic and Atmospheric Administration RIN 0648-XB005 Marine Mammals AGENCY: National Marine.../2\\ W. 4th Avenue, Olympia, WA 98501, has applied in due form for a permit to take marine mammals in... subject permit is requested under the authority of the Marine Mammal Protection Act of 1972, as...

  13. 77 FR 34352 - Marine Mammals; File No. 17178

    Science.gov (United States)

    2012-06-11

    ... (77 FR 19646) that a request for a permit to import marine mammal parts for scientific research had... National Oceanic and Atmospheric Administration RIN 0648-XB139 Marine Mammals; File No. 17178 AGENCY... 1208 Greate Road, Gloucester Point, VA 23062 to import marine mammal parts for scientific...

  14. 78 FR 51146 - Marine Mammals; File No. 14535

    Science.gov (United States)

    2013-08-20

    ... INFORMATION: On April 9, 2013, notice was published in the Federal Register (78 FR 21112) that a request for... National Oceanic and Atmospheric Administration RIN 0648-XB161 Marine Mammals; File No. 14535 AGENCY... Marine Mammal Protection Act of 1972, as amended (16 U.S.C. 1361 et seq.); and the regulations...

  15. 77 FR 19646 - Marine Mammals; File No. 17178

    Science.gov (United States)

    2012-04-02

    ... National Oceanic and Atmospheric Administration RIN 0648-XB139 Marine Mammals; File No. 17178 AGENCY... permit to import marine mammal parts for scientific research. DATES: Written, telefaxed, or email.... SUPPLEMENTARY INFORMATION: The subject permit is requested under the authority of the Marine Mammal...

  16. 77 FR 33444 - Marine Mammals; File No. 17217

    Science.gov (United States)

    2012-06-06

    ... Register (77 FR 22563) that a request for a public display permit, had been submitted by the above-named... National Oceanic and Atmospheric Administration RIN 0648-XB159 Marine Mammals; File No. 17217 AGENCY... Mammal Protection Act of 1972, as amended (16 U.S.C. 1361 et seq.) and the regulations governing...

  17. 77 FR 14352 - Marine Mammals

    Science.gov (United States)

    2012-03-09

    ... published in the Federal Register (76 FR 30919) that a request for a permit to conduct research on humpback... National Oceanic and Atmospheric Administration RIN 0648-XB065 Marine Mammals AGENCY: National Marine... permit has been issued under the authority of the Marine Mammal Protection Act of 1972, as amended (16...

  18. A System of Four Matrix Equations over von Neumann Regular Rings and Its Applications

    Institute of Scientific and Technical Information of China (English)

    Qing Wen WANG

    2005-01-01

    We consider the system of four linear matrix equations A1X = C1, XB2 = C2, A3XB3 = C3 and A4XB4 = C4 over(R) , an arbitrary yon Neumann regular ring with identity. A necessary and sufficient condition for the existence and the expression of the general solution to the system are derived. As applications, necessary and sufficient conditions are given for the system of matrix equations A1X = C1 and A3X = C3 to have a bisymmetric solution, the system of matrix equations A1X = C1and A3XB3 = C3 to have a perselfconjugate solution over(R) with an involution and char ≠(R)2,respectively. The representations of such solutions are also presented. Moreover, some auxiliary results on other systems over(R)are obtained. The previous known results on some systems of matrix equations are special cases of the new results.

  19. Diversity, Biocontrol, and Plant Growth Promoting Abilities of Xylem Residing Bacteria from Solanaceous Crops

    Directory of Open Access Journals (Sweden)

    Gauri A. Achari

    2014-01-01

    Full Text Available Eggplant (Solanum melongena L. is one of the solanaceous crops of economic and cultural importance and is widely cultivated in the state of Goa, India. Eggplant cultivation is severely affected by bacterial wilt caused by Ralstonia solanacearum that colonizes the xylem tissue. In this study, 167 bacteria were isolated from the xylem of healthy eggplant, chilli, and Solanum torvum Sw. by vacuum infiltration and maceration. Amplified rDNA restriction analysis (ARDRA grouped these xylem residing bacteria (XRB into 38 haplotypes. Twenty-eight strains inhibited growth of R. solanacearum and produced volatile and diffusible antagonistic compounds and plant growth promoting substances in vitro. Antagonistic strains XB86, XB169, XB177, and XB200 recorded a biocontrol efficacy greater than 85% against BW and exhibited 12%–22 % increase in shoot length in eggplant in the greenhouse screening. 16S rRNA based identification revealed the presence of 23 different bacterial genera. XRB with high biocontrol and plant growth promoting activities were identified as strains of Staphylococcus sp., Bacillus sp., Streptomyces sp., Enterobacter sp., and Agrobacterium sp. This study is the first report on identity of bacteria from the xylem of solanaceous crops having traits useful in cultivation of eggplant.

  20. Diversity, biocontrol, and plant growth promoting abilities of xylem residing bacteria from solanaceous crops.

    Science.gov (United States)

    Achari, Gauri A; Ramesh, Raman

    2014-01-01

    Eggplant (Solanum melongena L.) is one of the solanaceous crops of economic and cultural importance and is widely cultivated in the state of Goa, India. Eggplant cultivation is severely affected by bacterial wilt caused by Ralstonia solanacearum that colonizes the xylem tissue. In this study, 167 bacteria were isolated from the xylem of healthy eggplant, chilli, and Solanum torvum Sw. by vacuum infiltration and maceration. Amplified rDNA restriction analysis (ARDRA) grouped these xylem residing bacteria (XRB) into 38 haplotypes. Twenty-eight strains inhibited growth of R. solanacearum and produced volatile and diffusible antagonistic compounds and plant growth promoting substances in vitro. Antagonistic strains XB86, XB169, XB177, and XB200 recorded a biocontrol efficacy greater than 85% against BW and exhibited 12%-22 % increase in shoot length in eggplant in the greenhouse screening. 16S rRNA based identification revealed the presence of 23 different bacterial genera. XRB with high biocontrol and plant growth promoting activities were identified as strains of Staphylococcus sp., Bacillus sp., Streptomyces sp., Enterobacter sp., and Agrobacterium sp. This study is the first report on identity of bacteria from the xylem of solanaceous crops having traits useful in cultivation of eggplant. PMID:24963298

  1. Drug: D04221 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available ne D04221 Fluorometholone acetate (USAN) D DERMATOLOGICALS D07 CORTICOSTEROIDS, D...ERMATOLOGICAL PREPARATIONS D07A CORTICOSTEROIDS, PLAIN D07AB Corticosteroids, moderately potent (group II) D...07AB06 Fluorometholone D04221 Fluorometholone acetate (USAN) D07X CORTICOSTEROIDS, OTHER COMBINATIONS D07XB

  2. Drug: D07201 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available classification [BR:br08303] D DERMATOLOGICALS D07 CORTICOSTEROIDS, DERMATOLOGICA...L PREPARATIONS D07A CORTICOSTEROIDS, PLAIN D07AB Corticosteroids, moderately potent (group II) D07AB07 Flupr...ednidene D07201 Fluprednidene (INN) D07X CORTICOSTEROIDS, OTHER COMBINATIONS D07XB Corticosteroids, moderate

  3. Drug: D04208 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available ssification [BR:br08303] D DERMATOLOGICALS D07 CORTICOSTEROIDS, DERMATOLOGICAL PR...ne D04208 Flumethasone (USAN); Flumetasone (INN) D07X CORTICOSTEROIDS, OTHER COMBINATIONS D07XB Corticostero...EPARATIONS D07A CORTICOSTEROIDS, PLAIN D07AB Corticosteroids, moderately potent (group II) D07AB03 Flumetaso

  4. 77 FR 12009 - Marine Mammals; File No. 16991

    Science.gov (United States)

    2012-02-28

    ... applicant proposes to examine the biology and ecology of harbor seals and monitor health and condition of... National Oceanic and Atmospheric Administration RIN 0648-XB033 Marine Mammals; File No. 16991 AGENCY: National Marine Fisheries Service (NMFS), National Oceanic and Atmospheric Administration (NOAA),...

  5. 77 FR 19646 - International Whaling Commission; 64th Annual Meeting; Nominations

    Science.gov (United States)

    2012-04-02

    ... National Oceanic and Atmospheric Administration RIN 0648-XB127 International Whaling Commission; 64th... a call for nominees for the U.S. Delegation to the July 2012 International Whaling Commission (IWC... International Convention for the Regulation of Whaling, 1946. The U.S. IWC Commissioner has responsibility...

  6. 77 FR 25408 - International Whaling Commission; 64th Annual Meeting; Announcement of Public Meetings

    Science.gov (United States)

    2012-04-30

    ... National Oceanic and Atmospheric Administration RIN 0648-XB150 International Whaling Commission; 64th... annual International Whaling Commission (IWC) meeting. DATES: The public meeting will be held June 5... the United States under the International Convention for the Regulation of Whaling, 1946. The U.S....

  7. 77 FR 14349 - Availability of Report: California Eelgrass Mitigation Policy

    Science.gov (United States)

    2012-03-09

    ... National Oceanic and Atmospheric Administration RIN 0648-XB068 Availability of Report: California Eelgrass... Administration (NOAA), Commerce. ACTION: Notice of availability; request for comments. SUMMARY: NMFS is providing... strong protection strategy because of the important biological, physical, and economic values it...

  8. Study of short-range correlation in nuclei via measurement of the 4He(,ee'pp) and 4He(e,e'pn) reaction

    International Nuclear Information System (INIS)

    This thesis reports on a simultaneous measurement of the 4He(e,e'p), 4He(e,e'pp), and 4He(e,e'pn) reactions at Q2 = 2 (GeV/c)2 and xB > 1 for an (e,e'p) missing momentum range of 400 to 830 MeV/c.

  9. Dicty_cDB: Contig-U03667-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available re callus 7d ... 46 1.6 1 ( DY490191 ) sh1-xb10_l0.s2 adult sheep fracture callus p...9OML22049076HT OML2 Ovis aries cDNA, mRNA se... 46 1.6 1 ( DY496264 ) sh2P0018H02_F.ab1 adult sheep fractu

  10. 77 FR 14351 - New England Fishery Management Council; Public Meeting

    Science.gov (United States)

    2012-03-09

    ...: (401) 421-0700; fax: (401) 455-3050. Council address: New England Fishery Management Council, 50 Water... National Oceanic and Atmospheric Administration RIN 0648-XB073 New England Fishery Management Council... Council (Council) is scheduling a public meeting of its Scientific and Statistical Committee (SSC),...

  11. Re4As6S3, a thio-spinel-related cluster system

    DEFF Research Database (Denmark)

    Besnard, Celine; Svensson, Christer; Ståhl, Kenny;

    2003-01-01

    rhenium atoms form tetrahedral clusters linked via tetrahedral arsenic clusters to produce an NaCl-type arrangement. The oxidation state of rhenium is IV and the number of electrons shared by the rhenium atoms in the cluster is 12. The structure is based on an ordered defect thio-spinel A((1-x))B(2)X(4...

  12. Classification of Gaia 16aay as a Type II SN around maximum

    Science.gov (United States)

    Piascik, A. S.; Steele, I. A.

    2016-02-01

    We conducted a spectroscopic observation of transient Gaia16aay (AT2016xb, PS16zf) at 2016-02-05T01:39:36.563 UT. This transient was found by the Gaia Photometric Science Alerts and Pan-STARRS surveys on 2016-01-25.

  13. Assistance tool commissioner of new algorithms of systems planning of therapy with ionizing; Herramienta de asistencia en el comisionado de nuevos algoritmos de sistemas de planificacion de terapia con radiaciones ionizantes

    Energy Technology Data Exchange (ETDEWEB)

    Reinado, D.; Ricos, B.; Alonso, S.; Chinillach, N.; Bellido, P.; Tortosa, R.

    2013-07-01

    The Commissioner of a new scheduling algorithm is associated with a high number of hours of work and measures. In order to optimize the development of the Commissioner for the AAA algorithms and Acuros XB within planning Eclipse (V.10) system marketed by Varian and have developed a tool in Microsoft Excel format where the different tests have been included to perform. (Author)

  14. Azimuthal correlation between the $(\\vec{p}_l,\\vec{p}_{X_b})$ and $(\\vec{p}_l,\\vec{P}_t)$ planes in the semileptonic rest frame decay of a polarized top quark: An $O(\\alpha_s)$ effect

    CERN Document Server

    Groote, S; Kadeer, A; Körner, J G

    2006-01-01

    The azimuthal correlation between the planes formed by the vectors $(\\vec{p}_l,\\vec{p}_{X_b})$ and $(\\vec{p}_l,\\vec{P}_t)$ in the semileptonic rest frame decay of a polarized top quark $t(\\uparrow) \\to X_b + l^+ + \

  15. On the Solutions of Some Linear Complex Quaternionic Equations

    Directory of Open Access Journals (Sweden)

    Cennet Bolat

    2014-01-01

    Full Text Available Some complex quaternionic equations in the type AX-XB=C are investigated. For convenience, these equations were called generalized Sylvester-quaternion equations, which include the Sylvester equation as special cases. By the real matrix representations of complex quaternions, the necessary and sufficient conditions for the solvability and the general expressions of the solutions are obtained.

  16. On the solutions of some linear complex quaternionic equations.

    Science.gov (United States)

    Bolat, Cennet; İpek, Ahmet

    2014-01-01

    Some complex quaternionic equations in the type AX - XB = C are investigated. For convenience, these equations were called generalized Sylvester-quaternion equations, which include the Sylvester equation as special cases. By the real matrix representations of complex quaternions, the necessary and sufficient conditions for the solvability and the general expressions of the solutions are obtained. PMID:25101318

  17. Tidal capture formation of low-mass X-ray binaries from wide binaries in the field

    Science.gov (United States)

    Michaely, Erez; Perets, Hagai B.

    2016-06-01

    We present a dynamical formation scenario for low mass X-ray binaries (LMXBs) in the field, focusing on black hole (BH) LMXBs. In this formation channel, LMXBs are formed from wide binaries (>1000 au) with a BH component and a stellar companion. The wide binary is perturbed by fly-bys of field stars, its orbit random walks, until driven into a sufficiently eccentric orbit such that the binary components tidally interact and the binary evolves to become a short period binary, which eventually evolves into an LMXB. We consider several models for the formation and survival of such wide binaries, and calculate the LMXB formation rates for each model. We find that models where BHs form through direct collapse with no/little natal kicks can give rise to high formation rates comparable with those inferred from observations. This formation scenario had several observational signatures: (1) the number density of LMXBs generally follows the background stellar density, beside the densest regions, where the dependence is stronger, (2) the mass function of the BH stellar companion should be comparable to the mass function of the background stellar population, likely peaking at 0.4-0.6 M⊙, and (3) the LMXBs orbit should not correlate with the spin of the BH. These aspects generally differ from the expectations from previously suggested LMXB formation models following common envelope binary stellar evolution. We note that neutron star LMXBs can similarly form from wide binaries, but their formation rate through this channel is likely significantly smaller due to their much higher natal kicks.

  18. The X-ray luminosity functions of field low-mass X-ray binaries in early-type galaxies: Evidence for a stellar age dependence

    Energy Technology Data Exchange (ETDEWEB)

    Lehmer, B. D.; Tzanavaris, P.; Yukita, M. [The Johns Hopkins University, Homewood Campus, Baltimore, MD 21218 (United States); Berkeley, M.; Basu-Zych, A.; Hornschemeier, A. E.; Ptak, A. [NASA Goddard Space Flight Center, Code 662, Greenbelt, MD 20771 (United States); Zezas, A. [Physics Department, University of Crete, Heraklion (Greece); Alexander, D. M. [Department of Physics, University of Durham, South Road, Durham DH1 3LE (United Kingdom); Bauer, F. E. [Pontificia Universidad Catolica de Chile, Departamento de Astronomia y Astrofisica, Casilla 306, Santiago 22 (Chile); Brandt, W. N. [Department of Astronomy and Astrophysics, Pennsylvania State University, University Park, PA 16802 (United States); Fragos, T. [IESL, Foundation for Research and Technology, 71110 Heraklion, Crete (Greece); Kalogera, V. [Department of Physics and Astronomy, Northwestern University, 2145 Sheridan Road, Evanston, IL 60208 (United States); Sivakoff, G. R. [Department of Physics, University of Alberta, CCIS 4-183 Edmonton, AB T6G 2E1 (Canada)

    2014-07-01

    We present direct constraints on how the formation of low-mass X-ray binary (LMXB) populations in galactic fields depends on stellar age. In this pilot study, we utilize Chandra and Hubble Space Telescope (HST) data to detect and characterize the X-ray point source populations of three nearby early-type galaxies: NGC 3115, 3379, and 3384. The luminosity-weighted stellar ages of our sample span ≈3-10 Gyr. X-ray binary population synthesis models predict that the field LMXBs associated with younger stellar populations should be more numerous and luminous per unit stellar mass than older populations due to the evolution of LMXB donor star masses. Crucially, the combination of deep Chandra and HST observations allows us to test directly this prediction by identifying and removing counterparts to X-ray point sources that are unrelated to the field LMXB populations, including LMXBs that are formed dynamically in globular clusters, Galactic stars, and background active galactic nuclei/galaxies. We find that the 'young' early-type galaxy NGC 3384 (≈2-5 Gyr) has an excess of luminous field LMXBs (L {sub X} ≳ (5-10) × 10{sup 37} erg s{sup –1}) per unit K-band luminosity (L{sub K} ; a proxy for stellar mass) than the 'old' early-type galaxies NGC 3115 and 3379 (≈8-10 Gyr), which results in a factor of ≈2-3 excess of L {sub X}/L{sub K} for NGC 3384. This result is consistent with the X-ray binary population synthesis model predictions; however, our small galaxy sample size does not allow us to draw definitive conclusions on the evolution field LMXBs in general. We discuss how future surveys of larger galaxy samples that combine deep Chandra and HST data could provide a powerful new benchmark for calibrating X-ray binary population synthesis models.

  19. The X-ray luminosity functions of field low-mass X-ray binaries in early-type galaxies: Evidence for a stellar age dependence

    International Nuclear Information System (INIS)

    We present direct constraints on how the formation of low-mass X-ray binary (LMXB) populations in galactic fields depends on stellar age. In this pilot study, we utilize Chandra and Hubble Space Telescope (HST) data to detect and characterize the X-ray point source populations of three nearby early-type galaxies: NGC 3115, 3379, and 3384. The luminosity-weighted stellar ages of our sample span ≈3-10 Gyr. X-ray binary population synthesis models predict that the field LMXBs associated with younger stellar populations should be more numerous and luminous per unit stellar mass than older populations due to the evolution of LMXB donor star masses. Crucially, the combination of deep Chandra and HST observations allows us to test directly this prediction by identifying and removing counterparts to X-ray point sources that are unrelated to the field LMXB populations, including LMXBs that are formed dynamically in globular clusters, Galactic stars, and background active galactic nuclei/galaxies. We find that the 'young' early-type galaxy NGC 3384 (≈2-5 Gyr) has an excess of luminous field LMXBs (L X ≳ (5-10) × 1037 erg s–1) per unit K-band luminosity (LK ; a proxy for stellar mass) than the 'old' early-type galaxies NGC 3115 and 3379 (≈8-10 Gyr), which results in a factor of ≈2-3 excess of L X/LK for NGC 3384. This result is consistent with the X-ray binary population synthesis model predictions; however, our small galaxy sample size does not allow us to draw definitive conclusions on the evolution field LMXBs in general. We discuss how future surveys of larger galaxy samples that combine deep Chandra and HST data could provide a powerful new benchmark for calibrating X-ray binary population synthesis models.

  20. The Evolution of Normal Galaxy X-Ray Emission through Cosmic History: Constraints from the 6 MS Chandra Deep Field-South

    Science.gov (United States)

    Lehmer, B. D.; Basu-Zych, A. R.; Mineo, S.; Brandt, W. N.; Eufrasio, R. T.; Fragos, T.; Hornschemeier, A. E.; Luo, B.; Xue, Y. Q.; Bauer, F. E.; Gilfanov, M.; Ranalli, P.; Schneider, D. P.; Shemmer, O.; Tozzi, P.; Trump, J. R.; Vignali, C.; Wang, J.-X.; Yukita, M.; Zezas, A.

    2016-07-01

    We present measurements of the evolution of normal-galaxy X-ray emission from z\\quad ≈ 0–7 using local galaxies and galaxy samples in the ≈6 Ms Chandra Deep Field-South (CDF-S) survey. The majority of the CDF-S galaxies are observed at rest-frame energies above 2 keV, where the emission is expected to be dominated by X-ray binary (XRB) populations; however, hot gas is expected to provide small contributions to the observed-frame ≲1 keV emission at z ≲ 1. We show that a single scaling relation between X-ray luminosity ({L}{{X}}) and star-formation rate (SFR) literature, is insufficient for characterizing the average X-ray emission at all redshifts. We establish that scaling relations involving not only SFR, but also stellar mass ({M}\\star ) and redshift, provide significantly improved characterizations of the average X-ray emission from normal galaxy populations at z\\quad ≈ 0–7. We further provide the first empirical constraints on the redshift evolution of X-ray emission from both low-mass XRB (LMXB) and high-mass XRB (HMXB) populations and their scalings with {M}\\star and SFR, respectively. We find {L}2-10{keV}(LMXB)/{M}\\star \\propto {(1+z)}2-3 and {L}2-10{keV}(HMXB)/SFR \\propto \\quad (1+z), and show that these relations are consistent with XRB population-synthesis model predictions, which attribute the increase in LMXB and HMXB scaling relations with redshift as being due to declining host galaxy stellar ages and metallicities, respectively. We discuss how emission from XRBs could provide an important source of heating to the intergalactic medium in the early universe, exceeding that of active galactic nuclei.

  1. Identifying crucial parameter correlations maintaining bursting activity.

    Directory of Open Access Journals (Sweden)

    Anca Doloc-Mihu

    2014-06-01

    Full Text Available Recent experimental and computational studies suggest that linearly correlated sets of parameters (intrinsic and synaptic properties of neurons allow central pattern-generating networks to produce and maintain their rhythmic activity regardless of changing internal and external conditions. To determine the role of correlated conductances in the robust maintenance of functional bursting activity, we used our existing database of half-center oscillator (HCO model instances of the leech heartbeat CPG. From the database, we identified functional activity groups of burster (isolated neuron and half-center oscillator model instances and realistic subgroups of each that showed burst characteristics (principally period and spike frequency similar to the animal. To find linear correlations among the conductance parameters maintaining functional leech bursting activity, we applied Principal Component Analysis (PCA to each of these four groups. PCA identified a set of three maximal conductances (leak current, [Formula: see text]Leak; a persistent K current, [Formula: see text]K2; and of a persistent Na+ current, [Formula: see text]P that correlate linearly for the two groups of burster instances but not for the HCO groups. Visualizations of HCO instances in a reduced space suggested that there might be non-linear relationships between these parameters for these instances. Experimental studies have shown that period is a key attribute influenced by modulatory inputs and temperature variations in heart interneurons. Thus, we explored the sensitivity of period to changes in maximal conductances of [Formula: see text]Leak, [Formula: see text]K2, and [Formula: see text]P, and we found that for our realistic bursters the effect of these parameters on period could not be assessed because when varied individually bursting activity was not maintained.

  2. An explanation of the Z-track sources

    OpenAIRE

    Church, M. J.; Halai, G. S.; Balucinska-Church, M.

    2006-01-01

    We present an explanation of the Z-track phenomenon based on spectral fitting of RXTE observations of GX340+0 using the emission model previously shown to describe the dipping LMXB. In our Z-track model, the soft apex is a quiescent state of the source with lowest luminosity. Moving away from this point by ascending the normal branch the strongly increasing luminosity of the Accretion Disc Corona (ADC) Comptonized emission L_ADC provides substantial evidence for a large increase of mass accre...

  3. On the masses and evolutionary status of the black hole binary GX 339-4: a twin system of XTE J1550-564?

    OpenAIRE

    Munoz-Darias, T.; Casares, J.; Martinez-Pais, I.G.

    2008-01-01

    We apply the K-correction to the black hole low-mass X-ray binary (LMXB) GX 339-4 which implies MX? 6 M? by only assuming that the companion is more massive than ?0.17 M?, the lower limit allowed by applying a ‘stripped-giant’ model. This evolutionary model successfully reproduces the observed properties of the system. We obtain a maximum mass for the companion of M2? 1.1 M? and an upper limit to the mass ratio of q(=M2/MX) ? 0.125. The high X-ray activity displayed by the source suggests a r...

  4. Spectroscopic Identification of the Infrared Counterpart to GX5-1

    OpenAIRE

    Bandyopadhyay, R.M.; Shahbaz, T.; Charles, P. A.

    2003-01-01

    Using CGS4 on UKIRT, we have obtained a 1.95-2.45 micron infrared spectrum of the primary candidate counterpart to the bright Z LMXB GX5-1. IR photometry by Naylor, Charles, & Longmore (1992) and the astrometry of Jonker et al. (2000) had previously identified this star as the most likely counterpart to GX5-1. The spectrum presented here clearly shows Brackett gamma and He lines in emission, for the first time confirming the identity of the counterpart. Similar to our previous spectroscopy of...

  5. Discovery of periodic dips in the light curve of GX 13+1: the X-ray orbital ephemeris of the source

    OpenAIRE

    Iaria, R.; Di Salvo, T.; Burderi, L.; Riggio, A.; D'Aì, A.; Robba, N.

    2014-01-01

    The bright low-mass X-ray binary (LMXB) GX 13+1 is one of the most peculiar Galactic binary systems. A periodicity of 24.27 d with a formal statistical error of 0.03 d was observed in its power spectrum density obtained with RXTE All Sky Monitor (ASM) data spanning 14 years. Starting from a recent study, indicating GX 13+1 as a possible dipping source candidate, we systematically searched for periodic dips in the X-ray light curves of GX 13+1 from 1996 up to 2013 using RXTE/ASM, and MAXI data...

  6. Collective Properties of X-ray Binary Populations of Galaxies III. The Low-mass X-ray Binary Luminosity Function

    OpenAIRE

    Bhadkamkar, Harshal; Ghosh, Pranab

    2013-01-01

    Continuing our exploration of the collective properties of low-mass X-ray binaries (LMXBs) in the stellar fields of normal galaxies, we compute in this paper the expected X-ray luminosity function (XLF) of LMXBs, starting from the results of the previous paper in the series (Paper II). We treat separately two classes of LMXB evolution, the first being close systems whose initial orbital periods are below the bifurcation period, wherein the companion is on the main sequence when Roche-lobe con...

  7. Evolution of Low-Mass X-ray Binaries: the Effect of Donor Evaporation

    CERN Document Server

    Jia, Kun

    2016-01-01

    Millisecond pulsars (MSPs) are thought to originate from low-mass X-ray binaries (LMXBs). The discovery of eclipsing radio MSPs including redbacks and black widows indicates that evaporation of the donor star by the MSP's irradiation takes place during the LMXB evolution. In this work, we investigate the effect of donor evaporation on the secular evolution of LMXBs, considering different evaporation efficiencies and related angular momentum loss. We find that for widening LMXBs, the donor star leaves a less massive white dwarf than without evaporation; for contracting systems, evaporation can speed up the evolution, resulting in dynamically unstable mass transfer and possibly the formation of isolated MSPs.

  8. NuSTAR Observations of the State Transition of Millisecond Pulsar Binary PSR J1023+0038

    DEFF Research Database (Denmark)

    Tendulkar, Shriharsh P.; Yang, Chengwei; An, Hongjun;

    2014-01-01

    We report NuSTAR observations of the millisecond pulsar-low-mass X-ray binary (LMXB) transition system PSR J1023+0038 from 2013 June and October, before and after the formation of an accretion disk around the neutron star. Between June 10 and 12, a few days to two weeks before the radio disappear...... state changes in the similar transition systems PSR J1824-2452I and XSS J1227.0-4859 and discuss possible interpretations based on the transitions in the inner disk....

  9. Echo Tomography of Sco X-1 using Bowen Fluorescence Lines

    CERN Document Server

    Casares, J; Martínez-Pais, I G; Cornelisse, R; Charles, P A; Marsh, T R; Dhillon, V S; Steeghs, D

    2005-01-01

    We present preliminary results of a simultaneous X-ray/optical campaign of the prototypical LMXB Sco X-1 at 1-10 Hz time resolution. Lightcurves of the high excitation Bowen/HeII emission lines were obtained through narrow interference filters with ULTRACAM, and these were cross-correlated with X-ray lightcurves. We find evidence for correlated variability, in particular when Sco X-1 enters the Flaring Branch. The Bowen/HeII lightcurves lag the X-ray lightcurves with a light travel time which is consistent with reprocessing in the companion star.

  10. Correlation between Hard X-ray Peak Flux and Soft X-ray Peak Flux in the Outburst Rise of Low Mass X-ray Binaries

    OpenAIRE

    Yu, Wenfei; van der Klis, Michiel; Fender, Rob

    2004-01-01

    We have analyzed {\\it Rossi} X-ray timing explorer (RXTE) pointed observations of the outbursts of black hole and neutron star soft X-ray transients in which an initial low/hard state or `island' state, followed by a transition to a softer state, was observed. In three sources, the black hole transient XTE J1550-564, the neutron star transient Aquila X-1 and a quasi-persistent neutron star low mass X-ray binary (LMXB) 4U 1705-44, two such outbursts were found. We find that the flux of the sof...

  11. Long Type I X-ray Bursts and Neutron Star Interior Physics

    OpenAIRE

    Cumming, Andrew; Macbeth, Jared; Zand, J. J. M. in't; Page, Dany

    2005-01-01

    Superbursts are very energetic Type I X-ray bursts discovered in recent years by long term monitoring of X-ray bursters, believed to be due to unstable ignition of carbon in the deep ocean of the neutron star. A number of "intermediate duration" bursts have also been observed, probably associated with ignition of a thick helium layer. We investigate the sensitivity of these long X-ray bursts to the thermal profile of the neutron star crust and core. We first compare cooling models of superbur...

  12. The Thermal Evolution following a Superburst on an Accreting Neutron Star

    OpenAIRE

    Cumming, Andrew; Macbeth, Jared

    2004-01-01

    Superbursts are very energetic Type I X-ray bursts discovered in recent years by long term monitoring of X-ray bursters, and believed to be due to unstable ignition of carbon in the deep ocean of the neutron star. In this Letter, we follow the thermal evolution of the surface layers as they cool following the burst. The resulting lightcurves agree very well with observations for layer masses and energy releases in the range expected from ignition calculations. At late times, the cooling flux ...

  13. Review of low-mass X-ray binaries near the Galactic center

    OpenAIRE

    Lutovinov, A.; Grebenev, S.; Molkov, S.; Sunyaev, R.

    2003-01-01

    Results of observations of several LMXBs in the Galactic center region carried out with the ART-P telescope on board \\Granat observatory are briefly reviewed. More than dozen sources were revealed in this region during five series of observations which were performed with the ART-P telescope in 1990-1992. The investigation of the spectral evolution of persistent emission of two X-ray bursters GX3+1 and KS1731-260, discussion of QPO and spectral variations detected from the very bright Z-sourc...

  14. Results from the Antarctic Muon and Neutrino Detector Array (AMANDA)

    CERN Document Server

    Cowen, D F

    2003-01-01

    We show new results from both the older and newer incarnations of AMANDA (AMANDA-B10 and AMANDA-II, respectively). These results demonstrate that AMANDA is a functioning, multipurpose detector with significant physics and astrophysics reach. They include a new higher-statistics measurement of the atmospheric muon neutrino flux and preliminary results from searches for a variety of sources of ultrahigh energy neutrinos: generic point sources, gamma-ray bursters and diffuse sources producing muons in the detector, and diffuse sources producing electromagnetic or hadronic showers in or near the detector.

  15. New Eyes on the Universe Twelve Cosmic Mysteries and the Tools We Need to Solve Them

    CERN Document Server

    Webb, Stephen

    2012-01-01

    "New Eyes on the Universe -- Twelve Cosmic Mysteries and the Tools We Need to Solve Them" gives an up-to-date broad overview of some of the key issues in modern astronomy and cosmology. It describes the vast amount of observational data that the new generation of observatories and telescopes are currently producing, and how that data might solve some of the outstanding puzzles inherent in our emerging world view. Included are questions such as: What is causing the Universe to blow itself apart? What could be powering the luminous gamma-ray bursters? Where is all the matter in the Uni

  16. INTEGRAL monitoring of unusually long X-ray bursts

    DEFF Research Database (Denmark)

    Chenevez, Jérôme; Falanga, M.; Kuulkers, E.;

    2008-01-01

    exceptional burst events lasting more than ~10 minutes. Half of the dozen so-called intermediate long bursts registered so far have been observed by INTEGRAL. The goal is to derive a comprehensive picture of the relationship between the nuclear ignition processes and the accretion states of the system leading......X-ray bursts are thermonuclear explosions on the surface of accreting neutron stars in X-ray binaries. As most of the known X-ray bursters are frequently observed by INTEGRAL, an international collaboration have been taking advantage of its instrumentation to specifically monitor the occurrence of...

  17. X-ray Spectral Diagnostics of $\\gamma$-Ray Burst Environments

    CERN Document Server

    Paerels, F B S; Heise, J; Liedahl, D A; Paerels, Frits; Kuulkers, Erik; Heise, John; Liedahl, Duane A.

    2000-01-01

    Recently, the detection of discrete features in the X-ray afterglow spectra of GRB970508 and GRB970828 was reported. The most natural interpretation of these features is that they are redshifted Fe K emission complexes. The identification of the line emission mechanism has drastic implications for the inferred mass of radiating material, end hence the nature of the burst site. X-ray spectroscopy provides a direct observational constraint on these properties of gamma-ray bursters. We briefly discuss how these constraints arise, in the context of an application to the spectrum of GRB970508.

  18. Beasts in Lambda-CDM Zoo

    CERN Document Server

    Dolgov, A D

    2016-01-01

    Recent astronomical discoveries of supermassive black holes (quasars), gamma-bursters, supernovae, and dust at high redshifts, z = (5 --10), are reviewed. Such a dense population of the early universe is at odds with the conventional mechanisms of its possible origin. Similar data from the contemporary universe, which are also in conflict with natural expectations, are considered too. Two possible mechanisms are suggested, at least one of which can potentially solve all these problems. As a by-product of the last model, an abundant cosmological antimatter may be created.

  19. Focused study of thermonuclear bursts on neutron stars

    DEFF Research Database (Denmark)

    Chenevez, Jérôme

    X-ray bursters are a class of Low Mass X-Ray Binaries where accreted material from a donor star undergoes rapid thermonuclear burning in the surface layers of a neutron star. The flux released can temporarily exceed the Eddington limit and drive the photosphere to large radii. Such photospheric...... detection would thus probe the nuclear burning as well as the gravitational redshift from the neutron star. Moreover, likely observations of atomic X-ray spectral components reflected from the inner accretion disk have been reported. The high spectral resolution capabilities of Simbol X may therefore make...

  20. Focused study of thermonuclear bursts on neutron stars

    DEFF Research Database (Denmark)

    Chenevez, Jérôme

    2009-01-01

    X-ray bursters form a class of Low Mass X-Ray Binaries where accreted material from a donor star undergoes rapid thermonuclear burning in the surface layers of a neutron star. The flux released can temporarily exceed the Eddington limit and drive the photosphere to large radii. Such photospheric...... Simbol-X and NuSTAR. A positive detection would thus probe the nuclear burning as well as the gravitational redshift from the neutron star. Moreover, likely observations of atomic X-ray spectral components reflected from the inner accretion disk have been reported. The high spectral resolution...

  1. Long X-ray burst monitoring with INTEGRAL

    DEFF Research Database (Denmark)

    X-ray bursts are thermonuclear explosions on the surface of accreting neutron stars in low mass X-ray binary systems. In the frame of the INTEGRAL observational Key Programme over the Galactic Center a good number of the known X-ray bursters are frequently being monitored. An international....... Of special interest are low luminosity bursting sources that exhibit X-ray bursts of very different durations allowing to study the transition from a hydrogen-rich bursting regime to a pure helium regime and from helium burning to carbon burning. I will present results obtained from INTEGRAL archive...

  2. Systematic Uncertainties in the Spectroscopic Measurements of Neutron-Star Masses and Radii from Thermonuclear X-ray Bursts. III. Absolute Flux Calibration

    OpenAIRE

    Guver, Tolga; Ozel, Feryal; Marshall, Herman; Psaltis, Dimitrios; Guainazzi, Matteo; Diaz-Trigo, Maria

    2015-01-01

    Many techniques for measuring neutron star radii rely on absolute flux measurements in the X-rays. As a result, one of the fundamental uncertainties in these spectroscopic measurements arises from the absolute flux calibrations of the detectors being used. Using the stable X-ray burster, GS 1826-238, and its simultaneous observations by Chandra HETG/ACIS-S and RXTE/PCA as well as by XMM-Newton EPIC-pn and RXTE/PCA, we quantify the degree of uncertainty in the flux calibration by assessing the...

  3. Mixed-mode synchronization between two inhibitory neurons with post-inhibitory rebound

    Science.gov (United States)

    Nagornov, Roman; Osipov, Grigory; Komarov, Maxim; Pikovsky, Arkady; Shilnikov, Andrey

    2016-07-01

    We study an array of activity rhythms generated by a half-center oscillator (HCO), represented by a pair of reciprocally coupled neurons with post-inhibitory rebounds (PIR). Such coupling-induced bursting possesses two time scales, one for fast spiking and another for slow quiescent periods, is shown to exhibit an array of synchronization properties. We discuss several HCO configurations constituted by two endogenous bursters, by tonic-spiking and quiescent neurons, as well as mixed-mode configurations composed of neurons of different type. We demonstrate that burst synchronization can be accompanied by complex, often chaotic, interactions of fast spikes within synchronized bursts.

  4. INTEGRAL reports renewed activity from KS 1741-293

    DEFF Research Database (Denmark)

    Chenevez, Jérôme; Kuulkers, E.; Alfonso-Garzón, J.; Beckmann, V.; Brandt, Søren Kristian; Bird, T.; Courvoisier, T.; Domingo, A.; Ebisawa, K.; Jonker, P.; Kretschmar, P.; Oosterbroek, T.; Paizis, A.; Sanchez-Fernandez, C.; Wijnands, R.

    2010-01-01

    The low-mass X-ray binary and burster source KS 1741-293 has been detected during recent INTEGRAL Galactic bulge (see ATel #438) observations by the JEM-X instrument. On February 25, 2010, between UTC 13:04 and 14:08, KS 1741-293 was detected at a 3-10 keV flux of 9 +/- 4 mCrab, and an upper limit...... the same energy bands. The region will be observed again by INTEGRAL on March 10, and the regular INTEGRAL monitoring of the Galactic bulge will continue until April 17, 2010. We encourage follow-up observations of this source at all wavelengths....

  5. Observations of accretion discs in interacting binaries

    Science.gov (United States)

    Honey, William Bruce

    Cataclysmic and X-ray binaries (CV and LMXB) are considered, and new observations of both types of source are considered. Chapter 1 gives an introduction to the subject and presents a study of the evolution and period relationships of these objects. Chapter 2 studies the superoutburst of a system. The observational data presented in the Chapter are used to place constraints on the geometry of the system, and also upon the theoretical models examined; only eccentric disc models are found to be acceptable. A tidally dominated eccentric accretion disc is considered, and good agreement between the observations and a tidally distorted disc simulation is achieved. In Chapter 3, a search for the superhump phenomenon is conducted. No such superhump behavior was found. These observations support the ideas first raised in Chapter 2 of the importance of tidal behavior in dwarf novae. Chapter 4 reviews observations of black hole candidates, and lists the generally expected 'fingerprint' thought to be associated with black holes in binary systems. Chapter 5 reports on observations of the LMXB GX339-4 and the discovery of the period for the system. Constraints on the system parameters are given and a model is presented that is compatible with the observations. Chapter 6 reviews the work done and considers other important observational evidence that is to be found in the literature and is pertinent to the work in this thesis.

  6. Discovery and identification of infrared counterpart candidates of four Galactic centre low mass X-ray binaries

    CERN Document Server

    Curran, P A; Heras, J A Zurita

    2011-01-01

    The near infrared (nIR)/optical counterparts of low mass X-ray binaries (LMXBs) are often observationally dim and reside in high source density fields which make their identification problematic; however, without such a counterpart identification we are unable to investigate many of the properties of LMXB systems. Here, in the context of a larger identification campaign, we examine the fields of four LMXB systems near the Galactic centre, in a bid to identify nIR/optical counterparts to the previously detected X-ray point sources. We obtain nIR/optical images of the fields with the ESO - New Technology Telescope and apply standard photometric and astrometric calibrations; these data are supplemented by Spitzer-GLIMPSE catalog data. On the basis of positional coincidence with the arcsecond accurate X-ray positions, we identify unambiguous counterpart candidates for XTE J1637-498, IGR J17379-3747, IGR J17585-3057 and GX 9+1. We propose tentative nIR counterparts of four LMXBs which require further investigation...

  7. Low-Mass X-Ray Binaries, Millisecond Radio Pulsars, and the Cosmic Star Formation Rate

    CERN Document Server

    White, N E; White, Nicholas E.; Ghosh, Pranab

    1998-01-01

    We report on the implications of the peak in the cosmic star-formation rate (SFR) at redshift z ~ 1.5 for the resulting population of low-mass X-ray binaries(LMXB) and for that of their descendants, the millisecond radio pulsars (MRP). Since the evolutionary timescales of LMXBs, their progenitors, and their descendants are thought be significant fractions of the time-interval between the SFR peak and the present epoch, there is a lag in the turn-on of the LMXB population, with the peak activity occurring at z ~ 0.5 - 1.0. The peak in the MRP population is delayed further, occurring at z < 0.5. We show that the discrepancy between the birthrate of LMXBs and MRPs, found under the assumption of a stead-state SFR, can be resolved for the population as a whole when the effects of a time-variable SFR are included. A discrepancy may persist for LMXBs with short orbital periods, although a detailed population synthesis will be required to confirm this. Further, since the integrated X-ray luminosity distribution of...

  8. The X-ray luminosity function of low mass X-ray binaries in early-type galaxies, their metal-rich, and metal-poor globular clusters

    CERN Document Server

    Peacock, Mark B

    2015-01-01

    We present the X-ray luminosity function (XLF) of low mass X-ray binaries (LMXBs) in the globular clusters (GCs) and fields of seven early-types galaxies. These galaxies are selected to have both deep Chandra observations, which allow their LMXB populations to be observed to X-ray luminosities of $10^{37}-10^{38}$ erg/s, and HST optical mosaics which enable the X-ray sources to be separated into field LMXBs, GC LMXBs, and contaminating background and foreground sources. We find that at all luminosities the number of field LMXBs per stellar mass is similar in these galaxies. This suggests that the field LMXB populations in these galaxies are not effected by the GC specific frequency, and that properties such as binary fraction and the stellar initial mass function are either similar across the sample, or change in a way that does not effect the number of LMXBs. We compare the XLF of the field LMXBs to that of the GC LMXBs and find that they are significantly different with a p-value of $3\\times10^{-6}$ (equiva...

  9. Discovery and modelling of disc precession in the M31 X-ray binary Bo 158?

    CERN Document Server

    Barnard, R; Haswell, C A; Kolb, U; Murray, J R

    2005-01-01

    The low mass X-ray binary (LMXB) associated with the M31 globular cluster Bo 158 is known to exhibit intensity dips on a ~2.78 hr period. This is due to obscuration of the X-ray source on the orbital period by material on the outer edge of the accretion disc. However, the depth of dipping varied from <10% to \\~83% in three archival XMM-Newton observations of Bo 158. Previous work suggested that the dip depth was anticorrelated with the X-ray luminosity. However, we present results from three new XMM-Newton observations that suggest that the evolution of dipping is instead due to precession of the accretion disc. Such precession is expected in neutron star LMXBs with mass ratios <0.3 (i.e. with orbital periods <4 hr), such as the Galactic dipping LMXB 4U 1916-053. We simulated the accretion disc of Bo 158 using cutting-edge 3D smoothed particle hydrodynamics (SPH), and using the observed parameters. Our results show disc variability on two time-scales. The disc precesses in a prograde direction on a p...

  10. Swift-BAT Survey of Galactic Sources: Catalog and Properties of the populations

    CERN Document Server

    Voss, R

    2010-01-01

    We study the populations of X-ray sources in the Milky Way in the 15-55 keV band using a deep survey with the BAT instrument aboard the Swift observatory. We present the logN-logS distributions of the various source types and we analyze their variability and spectra. For the low-mass X-ray binaries (LMXBs) and the high-mass X-ray binaries (HMXBs) we derive the luminosity functions to a limiting luminosity of L_X~7 times10^{34} erg s/s. Our results confirm the previously found flattening of the LMXB luminosity function below a luminosity of L_X~10^{37} erg s/s. The luminosity function of the HMXBs is found to be significantly flatter in the 15-55 keV band than in the 2-10 keV band. From the luminosity functions we estimate the ratios of the hard X-ray luminosity from HMXBs to the star-formation rate, and the LMXB luminosity to the stellar mass. We use these to estimate the X-ray emissivity in the local universe from X-ray binaries and show that it constitutes only a small fraction of the hard X-ray background.

  11. The nature of the Island and Banana States in Atoll sources and a Unified Model for Low Mass X-ray Binaries

    CERN Document Server

    Church, M J; Balucinska-Church, M

    2013-01-01

    We propose an explanation of the Island and Banana states and the relation between Atoll and Z-track sources, constituting a unified model for Low Mass X-ray Binaries (LMXB). We find a dramatic transition at a luminosity of 1 - 2.10^{37} erg/s above which the high energy cut-off E_CO of the Comptonized emission in all sources is low at a few keV. There is thermal equilibrium between the neutron star at ~2 keV and the Comptonizing accretion disk corona (ADC) causing the low E_CO in the Banana state of Atolls and all states of the Z-track sources. Below this luminosity, E_CO increases towards 100 keV causing the hardness of the island state. Thermal equilibrium is lost, the ADC becoming much hotter than the neutron star via an additional coronal heating mechanism. This suggests a unified model of LMXB: the Banana state is a basic state with the mass accretion rate Mdot increasing, corresponding to the Normal Branch of Z-track sources. The Island state has high ADC temperature, this state not existing in the Z-t...

  12. ASTRO-H White Paper - Low-mass X-ray Binaries

    CERN Document Server

    Done, C; Cackett, E; Herder, J W den; Dotani, T; Enoto, T; Ferrigno, C; Kallman, T; Kohmura, T; Laurent, P; Miller, J; Mineshige, S; Mori, H; Nakazawa, K; Paerels, F; Sakurai, S; Soong, Y; Sugita, S; Takahashi, H; Tamagawa, T; Tanaka, Y; Terada, Y; Uno, S

    2014-01-01

    There is still 10-20% uncertainty on the neutron star (NS) mass-radius relation. These uncertainties could be reduced by an order of magnitude through an unambiguous measure of M/R from the surface redshift of a narrow line, greatly constraining the Equation of State for ultra-dense material. It is possible that the SXS on ASTRO-H can detect this from an accreting neutron star with low surface velocity in the line of sight i.e. either low inclination or low spin. Currently there is only one known low inclination LMXB, Ser X-1, and one known slow spin LMXB, J17480-2446 in Terzan 5. Ser X-1 is a persistent source which is always in the soft state (banana branch), where the accreting material should form a equatorial belt around the neutron star. A pole-on view should then allow the NS surface to be seen directly. A 100 ks observation should allow us to measure M/R if there are any heavy elements in the photosphere at the poles. Conversely, J17480-2446 in Terzan 5 is a transient accretion powered millisecond pul...

  13. XTE J1701-462 and its Implications for the Nature of Subclasses in Low-Magnetic-Field Neutron Star Low-Mass X-Ray Binaries

    CERN Document Server

    Homan, Jeroen; Fridriksson, Joel K; Remillard, Ronald A; Wijnands, Rudy; Mendez, Mariano; Lin, Dacheng; Altamirano, Diego; Casella, Piergiorgio; Belloni, Tomaso; Lewin, Walter H G

    2010-01-01

    We report on an analysis of RXTE data of the transient neutron star low-mass X-ray binary (NS-LMXB) XTE J1701-462, obtained during its 2006-2007 outburst. The X-ray properties of the source changed between those of various types of NS-LMXB subclasses. At high luminosities the source switched between two types of Z source behavior and at low luminosities we observed a transition from Z source to atoll source behavior. These transitions between subclasses primarily manifest themselves as changes in the shapes of the tracks in X-ray color-color and hardness-intensity diagrams, but they are accompanied by changes in the kHz quasi-periodic oscillations, broad-band variability, burst behavior, and/or X-ray spectra. We find that the low-energy X-ray flux is a good parameter to track the gradual evolution of the tracks in color-color and hardness-intensity diagrams, allowing us to resolve the evolution of the source in greater detail than before and relate the observed properties to other NS-LMXBs. We further find th...

  14. Tidal capture formation of Low Mass X-Ray Binaries from wide binaries in the field

    CERN Document Server

    Michaely, Erez

    2015-01-01

    We present a potentially efficient dynamical formation scenario for Low Mass X-ray Binaries (LMXBs) in the field, focusing on black-hole (BH) LMXBs. In this formation channel LMXBs are formed from wide binaries $(>1000$ AU) with a BH component and a stellar companion. The wide binary is perturbed by fly-by's of field stars and its orbit random-walks and changes over time. This diffusion process can drive the binary into a sufficiently eccentric orbit such that the binary components tidally interact at peri-center and the binary evolves to become a short period binary, which eventually evolves into an LMXB. The formation rate of LMXBs through this channel mostly depends on the number of such BH wide binaries progenitors, which in turn depends on the velocity kicks imparted to BHs (or NSs) at birth. We consider several models for the formation and survival of such wide binaries, and calculate the LMXB formation rates for each model. We find that models where BHs form through direct collapse with no/little natal...

  15. Models of low-mass helium white dwarfs including gravitational settling, thermal and chemical diffusion, and rotational mixing

    CERN Document Server

    Istrate, Alina; Tauris, Thomas M; Langer, Norbert; Stancliffe, Richard J; Grassitelli, Luca

    2016-01-01

    A large number of extremely low-mass helium white dwarfs (ELM WDs) have been discovered in recent years. The majority of them are found in close binary systems suggesting they are formed either through a common-envelope phase or via stable mass transfer in a low-mass X-ray binary (LMXB) or a cataclysmic variable (CV) system. Here, we investigate the formation of these objects through the LMXB channel with emphasis on the proto-WD evolution in environments with different metallicities. We study, for the first time, the combined effects of rotational mixing and element diffusion (e.g. gravitational settling, thermal and chemical diffusion) on the evolution of proto-WDs and on the cooling properties of the resulting WDs. We present state-of-the-art binary stellar evolution models computed with MESA for metallicities between Z=0.0002 and Z=0.02, producing WDs with masses between 0.16-0.45 M$_{\\odot}$. Our results confirm that element diffusion plays a significant role in the evolution of proto-WDs that experience...

  16. XMM-NEWTON FINDS THAT SAX J1750.8–2900 MAY HARBOR THE HOTTEST, MOST LUMINOUS KNOWN NEUTRON STAR

    International Nuclear Information System (INIS)

    We have performed the first sensitive X-ray observation of the low-mass X-ray binary (LMXB) SAX J1750.8–2900 in quiescence with XMM-Newton. The spectrum was fit to both a classical blackbody model, and a non-magnetized, pure hydrogen neutron star (NS) atmosphere model. A power-law component was added to these models, but we found that it was not required by the fits. The distance to SAX J1750.8–2900 is known to be D = 6.79 kpc from a previous analysis of photospheric radius expansion bursts. This distance implies a bolometric luminosity (as given by the NS atmosphere model) of (1.05 ± 0.12) × 1034 (D/6.79 kpc)2 erg s–1, which is the highest known luminosity for a NS LMXB in quiescence. One simple explanation for this surprising result could be that the crust and core of the NS were not in thermal equilibrium during the observation. We argue that this was likely not the case, and that the core temperature of the NS in SAX J1750.8–2900 is unusually high.

  17. Energy Crisis in Astrophysics (Black Holes vs. N-Body Metrics)

    CERN Document Server

    Alley, C O; Mizobuchi, Y; Yilmaz, H; Alley, Carroll O; Leiter, Darryl L; Mizobuchi, Yutaka; Yilmaz, Huseyin

    1999-01-01

    The recent observation of the gamma ray burster GRB 990123, requiring at least two solar masses of energy in gamma radiation alone, created an energy crisis in astrophysics (Schilling 1999). We discuss a theorem which states that, of all four-dimensional curved spacetime theories of gravity viable with respect to the four classical weak field tests, only one unique case, the Yilmaz theory, has interactive N-body (multiparticle) solutions and this unique case has no event horizons. The theorem provides strong theoretical support for Robertson's explanation of the large energy output of the gamma ray burster GRB 990123 (Robertson 1999b). This explanation requires a switch from black holes (a 1-body solution with horizon) to the case of horizon-free interactive N-body solutions. In addition to the good news that the long sought N-body solutions are found, this unique case enjoys further strong support from other areas of gravitational physics. This development does not rule out GRB models with beaming, which can...

  18. Thermonuclear bursts from slowly and rapidly accreting neutron stars

    Science.gov (United States)

    Linares, Manuel

    2012-07-01

    Models of thermonuclear burning on accreting neutron stars predict different ignition regimes, depending mainly on the mass accretion rate per unit area. For more than three decades, testing these regimes observationally has met with only partial success. I will present recent results from the Fermi-GBM all-sky X-ray burst monitor, which is yielding robust measurements of recurrence time of rare and highly energetic thermonuclear bursts at the lowest mass accretion rates. I will also present RXTE observations of thermonuclear bursts at high mass accretion rates, including the discovery of millihertz quasi-periodic oscillations and several bursting regimes in a neutron star transient and 11 Hz X-ray pulsar. This unusual neutron star, with higher magnetic field and slower rotation than any other known burster, showed copious bursting activity when the mass accretion rate varied between 10% and 50% of the Eddington rate. I will discuss the role of fuel composition and neutron star spin in setting the burst properties of this system, and the possible implications for the rest of thermonuclear bursters.

  19. HST\\/STIS observations of GRB000301C CCD imaging and NUV MAMA spectroscopy

    CERN Document Server

    Smette, A; Gull, T R; Sahu, K C; Petro, L; Ferguson, H; Rhoads, J E; Lindler, D; Gibbons, R A; Hogg, D W; Kouveliotou, C; Livio, M; Macchetto, D; Metzger, M R; Pedersen, H; Pian, E; Thorsett, S E; Wijers, R A M J; Fynbo, J P U; Gorosabel, J; Hjorth, J; Jensen, B L; Levine, A; Smith, D A; Cline, T; Hurley, K; Trombka, J I

    2000-01-01

    We present HST/STIS observations of the optical counterpart (OT) of the gamma-ray burster GRB 000301C obtained on 2000 March 6, five days after the burst. CCD clear aperture imaging reveals a R ~ 21.50+/-0.15 source with no apparent host galaxy. An 8000 s, 1150 18 on the line-of-sight to the OT. This value is conservatively a lower limit to the GRB redshift. However, the facts that large N(HI) system are usually considered as progenitors of present day galaxies and that other OTs are found associated with star forming galaxies strongly suggest that it is the GRB redshift. In any case, this represents the largest direct redshift determination of a gamma-ray burster to date. Our data are compatible with an OT spectrum represented by a power-law with an intrinsic index \\alpha = 1.2((f_nu \\propto nu^-alpha) and no extinction in the host galaxy or with alpha = 0.5 and extinction by a SMC-like dust in the OT rest-frame with A_V = 0.15. The large N(HI) and the lack of detected host is similar to the situation for d...

  20. The first COMPTEL Source Catalogue

    CERN Document Server

    Schönfelder, V; Blom, J J; Blömen, H; Collmar, W; Connors, A; Diehl, R; Hermsen, W; Iyudin, A; Kippen, R M; Knödlseder, J; Kuiper, L; Lichti, G G; McConnell, M; Morris, D; Much, R P; Oberlack, U G; Ryan, J; Stacy, G; Steinle, H; Strong, A; Suleiman, R; Van Dijk, R; Varendorff, M; Winkler, C M; Williams, O R

    2000-01-01

    The imaging Compton telescope COMPTEL aboard NASA's Compton Gamma-RayObservatory has opened the MeV gamma-ray band as a new window to astronomy.COMPTEL provided the first complete all-sky survey in the energy range 0.75 to30 MeV. The catalogue, presented here, is largely restricted to publishedresults. It contains firm as well as marginal detections of continuum and lineemitting sources and presents upper limits for various types of objects. Thenumbers of the most significant detections are 32 for steady sources and 31 forgamma-ray bursters. Among the continuum sources, detected so far, are spin-downpulsars, stellar black-hole candidates, supernova remnants, interstellarclouds, nuclei of active galaxies, gamma-ray bursters, and the Sun during solarflares. Line detections have been made in the light of the 1.809 MeV 26Al line,the 1.157 MeV 44Ti line, the 847 and 1238 keV 56Co lines and the neutroncapture line at 2.223 MeV. For the identification of galactic sources, amodelling of the diffuse galactic emission ...

  1. Fast and slow magnetic deflagration fronts in Type I X-ray bursts

    CERN Document Server

    Cavecchi, Yuri; Watts, Anna L; Braithwaite, Jonathan

    2015-01-01

    Type I X-ray bursts are produced by thermonuclear runaways that develop on accreting neutron stars. Once one location ignites, the flame propagates across the surface of the star. Flame propagation is fundamental in order to understand burst properties like rise time and burst oscillations. Previous work quantified the effects of rotation on the front, showing that the flame propagates as a deflagration and that the front strongly resembles a hurricane. However the effect of magnetic fields was not investigated, despite the fact that magnetic fields strong enough to have an effect on the propagating flame are expected to be present on many bursters. In this paper we show how the coupling between fluid layers introduced by an initially vertical magnetic field plays a decisive role in determining the character of the fronts that are responsible for the Type I bursts. In particular, on a star spinning at 450 Hz (typical among the bursters) we test seed magnetic fields of $10^{7} - 10^{10}$ G and find that for th...

  2. Explosive Containment Chamber Vulnerability to Chemical Munition Fragment Impact

    Energy Technology Data Exchange (ETDEWEB)

    Benham, R.A.; Fischer, S.H.; Kipp, M.E.; Martinez, R.R.

    1999-02-01

    Scenarios in which the explosive burster charge in a chemical munition accidentally detonates inside demilitarization containment chambers are analyzed. The vulnerability of an inner Auxiliary Pressure Vessel and the primary Explosive Containment Chamber to impact by fragments from the largest explosive charge expected to be placed in these chambers (M426, 8 inch, chemical, 7 lbs Comp B) is evaluated. Numerical (CTH) and empirical (ConWep) codes are used to characterize the munition fragments, and assess the consequences of their impact and penetration on the walls of these vessels. Both pristine and corroded configurations of the munition have been considered, with and without liquid agent fill. When the munition burster charge detonates, munition case fragments impact and perforate the Auxiliary Pressure Vessel wall, resulting in extensive breakup of this inner chamber and the formation of additional fragments. These residual munition case and Auxiliary Pressure Vessel fragments have sufficient mass and velocity to crater the Explosive Containment Chamber inner wall layer, with accompanying localized permanent deformation (bulging) of both the inner and outer chamber walls. The integrity of the Explosive Containment Chamber was retained under all of the APV / munition configurations considered in this study, with no evidence that primary (munition) or secondary (munition and Auxiliary Pressure Vessel) fragments will perforate the inner chamber wall. Limited analyses of munition detonation without the Auxiliary Pressure Vessel present indicate that some munition span fragments could form under those conditions that have sufficient mass and velocity to perforate the inner wall of the Explosive Containment Chamber.

  3. Time evolution of an irreversible recombination process

    International Nuclear Information System (INIS)

    The time evolution of the irreversible catalytic recombination process, A + B → inert is studied both analytically as well as by computer simulation. A rate equation describing this process is derived. For situations where one of the species poisons the catalyst, the minority species, under certain conditions, is found to decay exponentially. Computer simulation results also indicate exponential decay for intermediate times. Near the poisoning transition, xA ≅ xB, the average relaxation time is found to diverge as τ ∼ (1)/(0.5-xA)γ with γ ≅ 1.3. Here xA and xB are the compositions of A and B in the gas. (author). 6 refs, 4 figs

  4. Working with the ineffable: Toward a process of understanding and communicating qualitative research knowledge and experience through design

    DEFF Research Database (Denmark)

    Coxon, Ian Robert

    2013-01-01

    The work described in this paper addresses the conference call for "New processes, tools or approaches that facilitate knowledge exchange and collaboration" between academia and creative people. It introduces a research-for-design program that we at the Experience-based Designing Centre in Denmark...... have been working on and with for the past year. It will present a program of teaching, research and industry collaboration that is essentially a knowledge gathering and information exchange program that is in itself a work-in-progress. We refer to this work as the four pillars of Experience......-based Designing (XbD). The discussion will centre on XbD as we currently practice it with a view to exploring new opportunities for improvement within the whole Experience-based Designing process. The four pillars involving Exploring, Understanding, Sharing and Showing How are staging points for the input of new...

  5. Production of the bottom analogs and the spin partner of the X(3872) at hadron colliders

    International Nuclear Information System (INIS)

    Using the Monte Carlo event generator tools Pythia and Herwig, we simulate the production of bottom/charm meson and antimeson pairs at hadron colliders in proton-proton/antiproton collisions. With these results, we derive an order-of-magnitude estimate for the production rates of the bottom analogs and the spin partner of the X(3872) as hadronic molecules at the LHC and Tevatron experiments. We find that the cross sections for these processes are at the nb level, so that the current and future data sets from the Tevatron and LHC experiments offer a significant discovery potential. We further point out that the Xb/Xb2 should be reconstructed in the γΥ(nS)(n = 1, 2, 3), Υ(1S)π+π-π0, or χbJπ+π- instead of the Υ(nS)π+π- final states. (orig.)

  6. Dosimetric evaluation of photon dose calculation under jaw and MLC shielding

    International Nuclear Information System (INIS)

    Purpose: The accuracy of photon dose calculation algorithms in out-of-field regions is often neglected, despite its importance for organs at risk and peripheral dose evaluation. The present work has assessed this for the anisotropic analytical algorithm (AAA) and the Acuros-XB algorithms implemented in the Eclipse treatment planning system. Specifically, the regions shielded by the jaw, or the MLC, or both MLC and jaw for flattened and unflattened beams have been studied.Methods: The accuracy in out-of-field dose under different conditions was studied for two different algorithms. Measured depth doses out of the field, for different field sizes and various distances from the beam edge were compared with the corresponding AAA and Acuros-XB calculations in water. Four volumetric modulated arc therapy plans (in the RapidArc form) were optimized in a water equivalent phantom, PTW Octavius, to obtain a region always shielded by the MLC (or MLC and jaw) during the delivery. Doses to different points located in the shielded region and in a target-like structure were measured with an ion chamber, and results were compared with the AAA and Acuros-XB calculations. Photon beams of 6 and 10 MV, flattened and unflattened were used for the tests.Results: Good agreement between calculated and measured depth doses was found using both algorithms for all points measured at depth greater than 3 cm. The mean dose differences (±1SD) were −8%± 16%, −3%± 15%, −16%± 18%, and −9%± 16% for measurements vs AAA calculations and −10%± 14%, −5%± 12%, −19%± 17%, and −13%± 14% for Acuros-XB, for 6X, 6 flattening-filter free (FFF), 10X, and 10FFF beams, respectively. The same figures for dose differences relative to the open beam central axis dose were: −0.1%± 0.3%, 0.0%± 0.4%, −0.3%± 0.3%, and −0.1%± 0.3% for AAA and −0.2%± 0.4%, −0.1%± 0.4%, −0.5%± 0.5%, and −0.3%± 0.4% for Acuros-XB. Buildup dose was overestimated with AAA, while Acuros-XB gave

  7. Investigation into glasses of K2O-B2O3 system by ESCA and 11B NMR

    International Nuclear Information System (INIS)

    States of oxygen atoms are analyzed on the example of glasses of xK2Ox(1-x)B2O3 system for determining the role of the degree of coherence in occurrence of ''boric anomaly''. O3-3 and O3-4 oxygen atoms are shown to exist in potassium-borate glasses of xK2Ox(1-x)B2O3 system in the 0 ≤ x ≤ 0.3 range of values. Non-bridging oxygen atoms are formed in BO3 groups at x > 0.3. Existence of O4-4 type oxygen atoms in the given glasses is hardly probably, and it is supposed that ''boric anomaly'' is not associated with variation of the degree of coherence and formation of non-bridging oxygen atoms

  8. The Real and Complex Hermitian Solutions to a System of Quaternion Matrix Equations with Applications

    Directory of Open Access Journals (Sweden)

    Shao-Wen Yu

    2012-01-01

    Full Text Available We establish necessary and sufficient conditions for the existence of and the expressions for the general real and complex Hermitian solutions to the classical system of quaternion matrix equations A1X=C1,XB1=C2, and  A3XA3*=C3. Moreover, formulas of the maximal and minimal ranks of four real matrices X1,X2,X3, and X4 in solution X=X1+X2i+X3j+X4k to the system mentioned above are derived. As applications, we give necessary and sufficient conditions for the quaternion matrix equations A1X=C1,XB1=C2,A3XA3*=C3, and  A4XA4*=C4 to have real and complex Hermitian solutions.

  9. Degree of Conversion and BisGMA, TEGDMA, UDMA Elution from Flowable Bulk Fill Composites

    Directory of Open Access Journals (Sweden)

    Edina Lempel

    2016-05-01

    Full Text Available The degree of conversion (DC and the released bisphenol A diglycidyl ether dimethacrylate (BisGMA, triethylene glycol dimethacrylate (TEGDMA and urethane dimethacrylate (UDMA monomers of bulk-fill composites compared to that of conventional flowable ones were assessed using micro-Raman spectroscopy and high performance liquid chromatography (HPLC. Four millimeter-thick samples were prepared from SureFil SDR Flow (SDR, X-tra Base (XB, Filtek Bulk Fill (FBF and two and four millimeter samples from Filtek Ultimate Flow (FUF. They were measured with micro-Raman spectroscopy to determine the DC% of the top and the bottom surfaces. The amount of released monomers in 75% ethanol extraction media was measured with HPLC. The differences between the top and bottom DC% were significant for each material. The mean DC values were in the following order for the bottom surfaces: SDR_4mm_20s > FUF_2mm_20s > XB_4mm_20s > FBF_4mm_20s > XB_4mm_10s > FBF_4mm_10s > FUF_4mm_20s. The highest rate in the amount of released BisGMA and TEGDMA was found from the 4 mm-thick conventional flowable FUF. Among bulk-fills, FBF showed a twenty times higher amount of eluted UDMA and twice more BisGMA; meanwhile, SDR released a significantly higher amount of TEGDMA. SDR bulk-fill showed significantly higher DC%; meanwhile XB, FBF did not reach the same level DC, as that of the 2 mm-thick conventional composite at the bottom surface. Conventional flowable composites showed a higher rate of monomer elution compared to the bulk-fills, except FBF, which showed a high amount of UDMA release.

  10. Drug: D06216 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available ATOLOGICALS D07 CORTICOSTEROIDS, DERMATOLOGICAL PREPARATIONS D07A CORTICOSTEROIDS...nide sodium phosphate (USAN) D07X CORTICOSTEROIDS, OTHER COMBINATIONS D07XB Corticosteroids, moderately pote...IC HORMONAL PREPARATIONS, EXCL. SEX HORMONES AND INSULINS H02 CORTICOSTEROIDS FOR... SYSTEMIC USE H02A CORTICOSTEROIDS FOR SYSTEMIC USE, PLAIN H02AB Glucocorticoids H02AB08 Triamcinolone D0621...SE C05AA Corticosteroids C05AA12 Triamcinolone D06216 Triamcinolone acetonide sodium phosphate (USAN) D DERM

  11. Drug: D00983 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available ROIDS, DERMATOLOGICAL PREPARATIONS D07A CORTICOSTEROIDS,...ide (JP16/USP) D07X CORTICOSTEROIDS, OTHER COMBINATIONS D07XB Corticosteroids, moderately potent, other comb...IC HORMONAL PREPARATIONS, EXCL. SEX HORMONES AND INSULINS H02 CORTICOSTEROIDS FOR SYSTEMIC USE H02A CORTICOSTEROIDS...OR TOPICAL USE C05AA Corticosteroids C05AA12 Triamcinolone D00983 Triamcinolone acetonide (JP16/USP) D DERMATOLOGICALS D07 CORTICOSTE

  12. Drug: D07801 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available xamethasone phenylpropionate D DERMATOLOGICALS D07 CORTICOSTEROIDS, DERMATOLOGICAL PREPARATIONS D07A CORTICOSTEROIDS...ne phenylpropionate D07X CORTICOSTEROIDS, OTHER COMBINATIONS D07XB Corticosteroids, moderately potent, other...EXCL. SEX HORMONES AND INSULINS H02 CORTICOSTEROIDS FOR SYSTEMIC USE H02A CORTICOSTEROIDS...methasone phenylpropionate S02 OTOLOGICALS S02B CORTICOSTEROIDS S02BA Corticoster...oids S02BA06 Dexamethasone D07801 Dexamethasone phenylpropionate S03 OPHTHALMOLOGICAL AND OTOLOGICAL PREPARATIONS S03B CORTICOSTEROID

  13. Radiobiological impact of dose calculation algorithms on biologically optimized IMRT lung stereotactic body radiation therapy plans

    OpenAIRE

    Liang, X.; Penagaricano, J.; Zheng, D.; Morrill, S.; Zhang, X; Corry, P.; Griffin, R. J.; Han, E. Y.; Hardee, M.; Ratanatharathom, V.

    2016-01-01

    Background The aim of this study is to evaluate the radiobiological impact of Acuros XB (AXB) vs. Anisotropic Analytic Algorithm (AAA) dose calculation algorithms in combined dose-volume and biological optimized IMRT plans of SBRT treatments for non-small-cell lung cancer (NSCLC) patients. Methods Twenty eight patients with NSCLC previously treated SBRT were re-planned using Varian Eclipse (V11) with combined dose-volume and biological optimization IMRT sliding window technique. The total dos...

  14. Exotic Charmonium and Bottomonium-like Resonances

    International Nuclear Information System (INIS)

    Many new states in the charmonium and bottomonium mass region were recently discovered by the BaBar, Belle and CDF Collaborations. We use the QCD Sum Rule approach to study the possible structure of some of these states. In particular we identify the recently observed bottomonium-like resonance Z+b(10610) with the first excitation of the tetraquark Xb(1++), the analogue of the X(3872) state in the charm sector.

  15. Domain Modeling: NP_004183.2 [SAHG[Archive

    Lifescience Database Archive (English)

    Full Text Available NP_004183.2 chrX Crystal structure o f Maf do main o f human N-acetylsero to nin O -methyltransferase- ... like pro tein p2p5xb_ chrX/NP_004183.2/NP_004183.2_ho lo _10-2 ... 13.pdb blast 18A,19S,20A,21S,24R,65K,87A,171D 44E PO 4 0 ...

  16. Domain Modeling: NP_004183.2 [SAHG[Archive

    Lifescience Database Archive (English)

    Full Text Available NP_004183.2 chrY Crystal structure o f Maf do main o f human N-acetylsero to nin O -methyltransferase- ... like pro tein p2p5xb_ chrY/NP_004183.2/NP_004183.2_ho lo _10-2 ... 13.pdb blast 18A,19S,20A,21S,24R,65K,87A,171D 44E PO 4 0 ...

  17. GenBank blastx search result: AK111921 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK111921 001-013-A10 U35369.1 Enterococcus faecalis vancomycin resistance genes, response regulator (van...RB), protein histidine kinase (vanSB), D,D-carboxypeptidase (vanYB), putative D-2-hydroxyacid dehydrogenase (van...HB), D-Ala:D-Lac ligase (vanB), and putative D,D-dipeptidase (vanXB) genes, complete cds.|BCT BCT 7e-11 +1 ...

  18. GenBank blastx search result: AK104788 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK104788 001-039-E04 U35369.1 Enterococcus faecalis vancomycin resistance genes, response regulator (van...RB), protein histidine kinase (vanSB), D,D-carboxypeptidase (vanYB), putative D-2-hydroxyacid dehydrogenase (van...HB), D-Ala:D-Lac ligase (vanB), and putative D,D-dipeptidase (vanXB) genes, complete cds.|BCT BCT 3e-20 +2 ...

  19. Deforestation offsets water balance changes due to climate variability in the Xingu River in eastern Amazonia

    Science.gov (United States)

    Panday, Prajjwal K.; Coe, Michael T.; Macedo, Marcia N.; Lefebvre, Paul; Castanho, Andrea D. de Almeida

    2015-04-01

    Deforestation reduced forest cover in Brazil's Xingu River Basin (XB; area: 510,000 km2) from 90% of the basin in the 1970s to 75% in the 2000s. Such large-scale land cover changes can substantially alter regional water budgets, but their influence can be difficult to isolate from that of natural climate variability. In this study, we estimate changes to the XB water balance from the 1970s to the 2000s due to climate variations and deforestation, using a combination of long-term observations of rainfall and discharge; satellite-based estimates of evapotranspiration (MODIS) and surface water storage (GRACE); and numerical modeling estimates (IBIS) of water budget components (evapotranspiration, soil moisture, and discharge). Model simulations over this period suggest that climate variations alone accounted for a -82 mm decrease (mean per unit area) in annual discharge (-14%, from 8190 m3 s-1 to 7806 m3 s-1), due to a -2% decrease in precipitation and +3% increase in evapotranspiration. Deforestation alone caused a +34 mm increase in annual discharge (+6%), as a result of a -3% decrease in evapotranspiration and +1% increase in soil moisture across the XB. Climate variability and land cover change thus had opposite effects on the XB water balance, with climate effects masking deforestation-induced changes to the water budget. Protected areas, which cover 55% of the basin, have helped to mitigate the effects of past deforestation on water recycling in the Xingu. However, our results suggest that continued deforestation outside protected areas could trigger changes of sufficient magnitude to offset climate variability.

  20. Effects of gamma-ray irradiation on optical properties of ZnO-PbO-B2O3 glasses

    DEFF Research Database (Denmark)

    Sharma, G.; Thind, K.S.; Manupriya, -;

    2006-01-01

    Effects of gamma-ray irradiation on some optical properties of xZnO(.)2xPbO(.)(1-3x)B2O3 glasses have been studied in the wavelength range 300-800 nm. Decrease in transmittance indicates the formation of color-center defects. Values for the energy-band gap, the width of the energy tail above the...

  1. Degree of Conversion and BisGMA, TEGDMA, UDMA Elution from Flowable Bulk Fill Composites

    Science.gov (United States)

    Lempel, Edina; Czibulya, Zsuzsanna; Kovács, Bálint; Szalma, József; Tóth, Ákos; Kunsági-Máté, Sándor; Varga, Zoltán; Böddi, Katalin

    2016-01-01

    The degree of conversion (DC) and the released bisphenol A diglycidyl ether dimethacrylate (BisGMA), triethylene glycol dimethacrylate (TEGDMA) and urethane dimethacrylate (UDMA) monomers of bulk-fill composites compared to that of conventional flowable ones were assessed using micro-Raman spectroscopy and high performance liquid chromatography (HPLC). Four millimeter-thick samples were prepared from SureFil SDR Flow (SDR), X-tra Base (XB), Filtek Bulk Fill (FBF) and two and four millimeter samples from Filtek Ultimate Flow (FUF). They were measured with micro-Raman spectroscopy to determine the DC% of the top and the bottom surfaces. The amount of released monomers in 75% ethanol extraction media was measured with HPLC. The differences between the top and bottom DC% were significant for each material. The mean DC values were in the following order for the bottom surfaces: SDR_4mm_20s > FUF_2mm_20s > XB_4mm_20s > FBF_4mm_20s > XB_4mm_10s > FBF_4mm_10s > FUF_4mm_20s. The highest rate in the amount of released BisGMA and TEGDMA was found from the 4 mm-thick conventional flowable FUF. Among bulk-fills, FBF showed a twenty times higher amount of eluted UDMA and twice more BisGMA; meanwhile, SDR released a significantly higher amount of TEGDMA. SDR bulk-fill showed significantly higher DC%; meanwhile XB, FBF did not reach the same level DC, as that of the 2 mm-thick conventional composite at the bottom surface. Conventional flowable composites showed a higher rate of monomer elution compared to the bulk-fills, except FBF, which showed a high amount of UDMA release. PMID:27213361

  2. Influence of vehicle configuration and flight profile on X-30 sonic booms

    Science.gov (United States)

    Maglieri, Domenic J.; Sothcott, Victor E.; Hicks, John

    1990-10-01

    The role of vehicle configuration and the flight profile on sonic booms produced by the experimental NASP X-30 is investigated. Sonic boom signatures, overpressure levels, and footprints for X-30 are presented and compared with sonic boom measurements for F-104, SR-71, Concorde, XB-70, and STS Orbiter. Results show that the sonic boom signatures for X-30 fall within those of previous high-speed planes.

  3. ZnO-PbO-B2O3 glasses as gamma-ray shielding materials

    DEFF Research Database (Denmark)

    Singh, H.; Gerward, Leif; Singh, K.;

    2003-01-01

    Values of the gamma-ray mass-attenuation coefficient, the photon mean free path (MFP), the effective atomic number and the effective electron density have been determined experimentally for xZnO.2xPbO.(1-3x)B2O3 (x = 0.1-0.26) glasses at photon energies 511, 662, 1173 and 1332 keV and compared with...

  4. Latest B -physics results from ATLAS

    Science.gov (United States)

    Kirk, J.; Atlas Collaboration

    2016-07-01

    Recent B -physics measurements from the ATLAS detector at the LHC are presented using data collected during 2011 and 2012. Charmonium production cross-sections are measured and compared to theoretical predictions. First measurements of the production of J/ ψ mesons in association with vector bosons are presented. The first observation of an excited Bc meson and a search for the Xb are also reported.

  5. Evolution of gluon TMDs from small to moderate x

    Energy Technology Data Exchange (ETDEWEB)

    Tarasov, Andrey [Thomas Jefferson National Accelerator Facility (TJNAF), Newport News, VA (United States)

    2016-05-01

    Recently we obtained an evolution equation of gluon TMDs, which addresses a problem of unification of different kinematic regimes. It describes evolution in the whole range of Bjorken $x_B$ and the whole range of transverse momentum $k_\\perp$. In this notes I study different limits of this evolution equation and show how it yields several well-known and some previously unknown results.

  6. Spectroscopic Measurement of Neutral Particle Influx Ratio on EAST

    International Nuclear Information System (INIS)

    The spectra of HeI (587.6 nm), Hα (656.28 nm) and Dα (656.1 nm) of the helium discharges as well as the normal deuterium discharges have been measured with two optical spectroscopic multi-channel analysis (OMA) systems on the experimental advanced superconducting tokamak (EAST). The influx ratio of the sum of H and D to He spectral lines and the influx ratio of H to D are given. In this way the ratio of hydrogen/deuterium ion (S/XB)H/D to (S/XB)He as well as (S/XB)H/D is not very sensitive to the variation in the edge density and temperature. The low-density helium discharges are operated in order to reduce the recycling hydrogen fluxes; however, the effect is not obvious. The possible reason is that the number of helium discharges is not enough and the content of hydrogen in the wall is still very abundant, which is caused by frequent wall conditionings and the vacuum leakage. The H/(H+D) ratio decreases quickly after one lithium coating and reduces to less than 10% using several accumulated lithium wall conditioning. It is found that the deposited He atoms on the carbon wall will remain at a low level after several D2 discharges.

  7. X-band klystron modulator for the Accelerator Test Facility

    International Nuclear Information System (INIS)

    An X-band Klystron Modulator has been designed and constructed to drive two kinds of prototype X-band pulsed klystrons: (1) 30 MW klystron ( XB-50K) requiring a 450 kV beam voltage with a 0.5 μs flat top and (2) 120 MW klystron ( XB-72K) requiring a 550 kV beam voltage with a 0.5 μs flat top. The modulator generates 2.0 μs pulses with 37 kV voltage and 7,300 A peak current for the operation of the XB-72K. It is a conventional line-type modulator with a 6 section pulse forming network (PFN) which is resonantly charged and discharged by a thyratron switch at up to 200 pps. In order to reduce the size of the modulator, a special low inductance capacitors using a film coated thin Al-electrodes of 300 angstrom thickness has been developed for the PFN. Its output pulse voltage is stepped up to 15 times by a pulse transformer. The design, specifications and results of performance tests of the modulator are described in this paper

  8. The mean shape of transition and first-passage paths

    CERN Document Server

    Kim, Won Kyu

    2015-01-01

    We calculate the mean shape of transition paths and first-passage paths based on the one-dimensional Fokker-Planck equation in an arbitrary free energy landscape including a general inhomogeneous diffusivity profile. The transition path ensemble is the collection of all paths that do not revisit the start position $x_A$ and that terminate when first reaching the final position $x_B$. In contrast, a first-passage path can revisit but not cross its start position $x_A$ before it terminates at $x_B$. Our theoretical framework employs the forward and backward Fokker-Planck equations as well as first-passage, passage, last-passage and transition-path time distributions, for which we derive the defining integral equations. We show that the mean time at which the transition path ensemble visits an intermediate position $x$ is equivalent to the mean first-passage time of reaching the starting position $x_A$ from $x$ without ever visiting $x_B$. The mean shape of first-passage paths is related to the mean shape of tra...

  9. Microwave absorption properties of the nano-composite powders recovered from Nd-Fe-B bonded magnet scraps

    International Nuclear Information System (INIS)

    Nd-Fe-B bonded magnet scraps were recovered as the nano-composite powders composed of α-Fe, Fe xB and Nd2O3 by a disproportionation method and their electromagnetic wave absorption properties at the GHz range were characterized to recycle them as efficient absorbers. The bonded magnet scraps decomposed to NdH2, Fe xB and α-Fe at 873 K for 30-60 min in H2, of which NdH2 was converted to the corresponding fine particles of Nd2O3 by the subsequent oxidation at room temperature for 120 min in air. Resin-bonded discs prepared from the composites powders of α-Fe/Fe xB/Nd2O3 (mean diameter ≅ 20 nm), Fe xB (amorphous) and Nd2O3 particles showed the excellent electromagnetic wave absorption ability in a frequency range of 4.0-6.7 GHz, which shifted to the high GHz region side compared with binary composite ones of α-Fe/rare earth oxide

  10. Passivating boron silicate glasses for co-diffused high-efficiency n-type silicon solar cell application

    Energy Technology Data Exchange (ETDEWEB)

    Engelhardt, Josh, E-mail: josh.engelhardt@uni-konstanz.de; Frey, Alexander; Gloger, Sebastian; Hahn, Giso; Terheiden, Barbara [Department of Physics, University of Konstanz, 78457 Konstanz (Germany)

    2015-07-27

    Doping layers commonly have but one function: supplying the dopants to form a doped region within a substrate. This work presents B doping layers/stacks, which at the same time supply dopant atoms, passivate the B-doped crystalline Si surface sufficiently well (j{sub 0E} < 50 fA/cm{sup 2}), and show optical properties suitable for anti-reflective coating. Furthermore, these boron silicate glasses can act as a barrier against parasitic P in-diffusion during a co-diffusion step. The boron emitters diffused from the inductively coupled plasma plasma-enhanced chemical vapor-deposited B containing SiO{sub x} layers are investigated and optimized concerning passivation quality and contact properties for high-efficiency n-type solar Si cell designs. It is shown that even 10 nm thin SiO{sub x}:B films already allow for suitable emitter sheet resistance for screen-printed contacts. Furthermore, SiO{sub x}:B layers presented here allow for iV{sub OC} values of 675 mV and contact resistivity of 1 mΩcm{sup 2} for commercial Ag instead of Ag/Al pastes on the diffused boron emitter passivated with the SiO{sub x}:B layer supporting the contact formation. All of these properties can be achieved within one single B doping layer/stack.

  11. Observation of two distinct negative trions in tungsten disulfide monolayers

    Science.gov (United States)

    Boulesbaa, Abdelaziz; Huang, Bing; Wang, Kai; Lin, Ming-Wei; Mahjouri-Samani, Masoud; Rouleau, Christopher; Xiao, Kai; Yoon, Mina; Sumpter, Bobby; Puretzky, Alexander; Geohegan, David

    2015-09-01

    Ultrafast pump-probe spectroscopy of two-dimensional tungsten disulfide monolayers (2 D W S2) grown on sapphire substrates revealed two transient absorption spectral peaks that are attributed to distinct negative trions at ˜2.02 eV (T1) and ˜1.98 eV (T2) . The dynamics measurements indicate that trion formation by the probe is enabled by photodoped 2D WS2 crystals with electrons remaining after trapping of holes from excitons or free electron-hole pairs at defect sites in the crystal or on the substrate. Dynamics of the characteristic absorption bands of excitons XA and XB at ˜2.03 and ˜2.40 eV , respectively, were separately monitored and compared to the photoinduced absorption features. Selective excitation of the lowest exciton level XA using λpumpbleach of the XB exciton, indicating the involvement of holes participating in the bleach dynamics of exciton XB. Static electrical-doping photoabsorption measurements confirm the presence of an induced absorption peak similar to that of T2. Since the proposed trion formation process here involves exciton dissociation through hole trapping by defects in the 2D crystal or substrate, this discovery highlights the strong role of defects in defining optical and electrical properties of 2D metal chalcogenides, which is relevant to a broad spectrum of basic science and technological applications.

  12. Tuning protein-protein interactions using cosolvents: specific effects of ionic and non-ionic additives on protein phase behavior.

    Science.gov (United States)

    Hansen, Jan; Platten, Florian; Wagner, Dana; Egelhaaf, Stefan U

    2016-04-21

    Cosolvents are routinely used to modulate the (thermal) stability of proteins and, hence, their interactions with proteins have been studied intensely. However, less is known about their specific effects on protein-protein interactions, which we characterize in terms of the protein phase behavior. We analyze the phase behavior of lysozyme solutions in the presence of sodium chloride (NaCl), guanidine hydrochloride (GuHCl), glycerol, and dimethyl sulfoxide (DMSO). We experimentally determined the crystallization boundary (XB) and, in combination with data on the cloud-point temperatures (CPTs), the crystallization gap. In agreement with other studies, our data indicate that the additives might affect the protein phase behavior through electrostatic screening and additive-specific contributions. At high salt concentrations, where electrostatic interactions are screened, both the CPT and the XB are found to be linear functions of the additive concentration. Their slopes quantify the additive-specific changes of the phase behavior and thus of the protein-protein interactions. While the specific effect of NaCl is to induce attractions between proteins, DMSO, glycerol and GuHCl (with increasing strength) weaken attractions and/or induce repulsions. Except for DMSO, changes of the CPT are stronger than those of the XB. Furthermore, the crystallization gap widens in the case of GuHCl and glycerol and narrows in the case of NaCl. We relate these changes to colloidal interaction models, namely square-well and patchy interactions. PMID:27020538

  13. Measurement of Exclusive $π^0$ Electroproduction Structure Functions and their Relationship to Transverse Generalized Parton Distributions

    Energy Technology Data Exchange (ETDEWEB)

    Bedlinskiy, Ivan; Niccolai, Silvia; Stoler, Paul; Adhikari, Krishna; Aghasyan, Mher; Amaryan, Moskov; Anghinolfi, Marco; Avagyan, Harutyun; Baghdasaryan, Hovhannes; Ball, Jacques; Baltzell, Nathan; Battaglieri, Marco; Bennett, Robert; Biselli, Angela; Bookwalter, Craig; Boyarinov, Sergey; Briscoe, William; Brooks, Williams; Burkert, Volker; Carman, Daniel; Celentano, Andrea; Chandavar, Shloka; Charles, Gabriel; Contalbrigo, Marco; Crede, Volker; D& #x27; Angelo, Annalisa; Daniel, Aji; Dashyan, Natalya; De Vita, Raffaella; De Sanctis, Enzo; Deur, Alexandre; Djalali, Chaden; Doughty, David; Dupre, Raphael; Egiyan, Hovanes; El Alaoui, Ahmed; Elfassi, Lamiaa; Elouadrhiri, Latifa; Eugenio, Paul; Fedotov, Gleb; Fegan, Stuart; Fleming, Jamie; Forest, Tony; Garcon, Michel; Gevorgyan, Nerses; Giovanetti, Kevin; Girod, Francoi-Xavier; Gohn, Wesley; Gothe, Ralf; Graham, Lewis; Griffioen, Keith; Guegan, Baptiste; Guidal, Michel; Guo, Lei; Hafidi, Kawtar; Hakobyan, Hayk; Hanretty, Charles; Heddle, David; Hicks, Kenneth; Holtrop, Maurik; Ilieva, Yordanka; Ireland, David; Ishkhanov, Boris; Isupov, Evgeny; Jo, Hyon-Suk; Joo, Kyungseon; Keller, Dustin; Khanddaker, Mahbubul; Khertarpal, Puneet; Kim, Andrey; Kim, Wooyoung; Klein, Franz; Koirala, Suman; Kubarovsky, A; Kuhn, Sebastian; Kuleshov, Sergey; Kvaltine, Nicholas; Livingston, Kenneth; Lu, Haiyun; MacGregor, Ian; Mao, Yuqing; Markov, Nikolai; Martinez, D; Mayer, Michael; McKinnon, Bryan; Meyer, Curtis; Mineeva, Taisiya; Mirazita, Marco; Mokeev, Viktor; Moutarde, Herve; Munevar Espitia, Edwin; Munoz Camacho, Carlos; Nadel-Turonski, Pawel; Niculescu, Gabriel; Niculescu, Maria-Ioana; Osipenko, Mikhail; Ostrovidov, Alexander; Pappalardo, Luciano; Permuzyan, Rafayel; Park, Kijun; Park, Sungkyun; Pasyuk, Eugene; Pereira, Sergio; Phelps, Evan; Pisano, Silvia; Pogorelko, Oleg; Pozdnyakov, Sergey; Price, John; Procureur, Sebastien; Prok, Yelena; Protopopescu, Dan; Puckett, Andrew; Raue, Brian; Ricco, Giovanni; Rimal, Dipak; Ripani, Marco; Rosner, Guenther; Rossi, Patrizia; Sabatie, Franck; Saini, Mukesh; Salgado, Carlos; Saylor, Nicholas; Schott, Diane; Schumacher, Reinhard; Seder, Erin; Seraydaryan, Heghine; Sharabian, Youri; Smith, Gregory; Sober, Daniel; Sokhan, Daria; Stepanyan, Samuel; Strauch, Steffen; Taiuti, Mauro; Tang, Wei; Taylor, Charles; Tian, Ye; Tkachenko, Svyatoslav; Ungaro, Maurizio; Vineyard, Michael; Vlasov, Alexander; Voskanyan, Hakob; Voutier, Eric; Walford, Natalie; Watts, Daniel; Weinstein, Lawrence; Weygan, Dennis; Wood, Michael; Zachariou, Nicholas; Zhang, Jixie; Zhao, Zhiwen

    2012-09-01

    Exclusive $\\pi^0$ electroproduction at a beam energy of 5.75 GeV has been measured with the Jefferson Lab CLAS spectrometer. Differential cross sections were measured at more than 1800 kinematic values in $Q^2$, $x_B$, $t$, and $\\phi_\\pi$, in the $Q^2$ range from 1.0 to 4.6 GeV$^2$,\\ $-t$ up to 2 GeV$^2$, and $x_B$ from 0.1 to 0.58. Structure functions $\\sigma_T +\\epsilon \\sigma_L, \\sigma_{TT}$ and $\\sigma_{LT}$ were extracted as functions of $t$ for each of 17 combinations of $Q^2$ and $x_B$. The data were compared directly with two handbag-based calculations including both longitudinal and transversity GPDs. Inclusion of only longitudinal GPDs very strongly underestimates $\\sigma_T +\\epsilon \\sigma_L$ and fails to account for $\\sigma_{TT}$ and $\\sigma_{LT}$, while inclusion of transversity GPDs brings the calculations into substantially better agreement with the data. There is very strong sensitivity to the relative contributions of nucleon helicity flip and helicity non-flip processes. The results confirm that exclusive $\\pi^0$ electroproduction offers direct experimental access to the transversity GPDs.

  14. DFT investigation of endohedral boron oxide nanocapsules: Encapsulation of He, Ne, Ar, H, N, and Cl atoms

    International Nuclear Information System (INIS)

    Graphical abstract: Electronic structure and stabilization energy of fullerene shape boron oxide nanocapsules (X-B20O30, X = He, Ne, Ar, H, N, Cl) were calculated at B3LYP/6-31G∗∗ level of theory. Encapsulation of B20O30 by dopant atoms does not change the energy and degeneracy of HOMO with the exception of Cl-B20O30. Highlights: ► Electronic structure and stabilization energy of fullerene shape boron oxide nanocapsules (X-B20O30). ► Encapsulation of He, Ne, Ar, H, N, and Cl atoms. ► Boron oxide buckyball are potential candidate for gas storage. - Abstract: The electronic structure and stabilization energy of spherical and pyramidal shapes of boron oxide nanocapsules (X-B20O30, X = He, Ne, Ar, H, N, Cl) were investigated by long-range and dispersion corrected density functional theory (DFT + Disp) including CAM-B3LYP, B3LYP-D3, ωB97X-D and B2PLYP-D methods. Based on these calculations, the formation of nanocapsules is an exothermic process (except for Cl-B20O30). The spherical boron oxide nanocapsules are mainly stabilized by dispersion, while the stability of pyramidal complexes is mainly due to monomer relaxation energy. The theoretical results obtained in this work show that the boron oxide capsule is a good potential candidate for gas storage.

  15. Tetraquark states in the bottom sector and the status of the $Y_b$(10890) state

    CERN Document Server

    Patel, Smruti

    2016-01-01

    We have done the exploratory study of bottom tetraquarks ($[bq\\bar b \\bar q];{q\\in u,d}$) in the diquark-antidiquark framework with the inclusion of spin hyperfine, spin-orbit and tensor components of the one gluon exchange interaction. Our focus here is on the $Y_b$(10890) and other exotic states in the bottom sector. We have predicted some of the bottom counterparts to the charm tetraquark candidates. Our present study shows that if $Z_b(10610)$ and $Z_b(10650)$ are diquark-diantiquark states then they have to be first radial excitations only and we have predicted $Z_b(10650)$ state as first radial excitation of tetraquark state $X_b$ (10.143-10.230). We have identified $X_b$ state with $J^{PC}= 1^{+-}/0^{++}$ as being the analogue of $Z_c(3900)$. An observation of the $X_b$ will provide a deeper insight into the exotic hadron spectroscopy and is helpful to unravel the nature of the states connected by the heavy quark symmetry. We particularly focus on the lowest P wave $[bq][\\bar b\\bar q]$ states with $J^{...

  16. 萘降解菌的分离、鉴定及降解途径%Isolation and identification of naphthalene degrading bacteria and characterization of its degradation pathways

    Institute of Scientific and Technical Information of China (English)

    徐中阳; 陈雯莉

    2015-01-01

    从武汉市金口张公堤处污泥富集分离出2株能以萘为唯一碳源生长的优势降解菌株XA1和XB1,经形态学观察、生理生化鉴定及16S rDNA测序分析,确定它们属于荧光假单胞菌(Pseudomonas fluorescens).其最适生长温度均为28℃,最适生长pH分别为7.5和7.0.在最适生长条件下,菌株XA1、XB1以3%的接种量对500 mg/L萘的降解率在第3天时分别达到了93.4%和74.7%.采用PCR和琼脂糖凝胶电泳技术检测到XA1、XB1中有儿茶酚2,3-双加氧酶基因(nahH)等萘降解过程中的关键酶基因,与NCBI中发布的基因序列相比较,相似度均达到99%.

  17. Measurement of Exclusive $\\pi^0$ Electroproduction Structure Functions and their Relationship to Transversity GPDs

    CERN Document Server

    Bedlinskiy, I; Niccolai, S; Stoler, P; Adhikari, K P; Aghasyan, M; Amaryan, M J; Anghinolfi, M; Avakian, H; Baghdasaryan, H; Ball, J; Baltzell, N A; Battaglieri, M; Bennett, R P; Biselli, A S; Bookwalter, C; Boiarinov, S; Briscoe, W J; Brooks, W K; Burkert, V D; Carman, D S; Celentano, A; Chandavar, S; Charles, G; Contalbrigo, M; Crede, V; D'Angelo, A; Daniel, A; Dashyan, N; De Vita, R; De Sanctis, E; Deur, A; Djalali, C; Doughty, D; Dupre, R; Egiyan, H; Alaoui, A El; Fassi, L El; Elouadrhiri, L; Eugenio, P; Fedotov, G; Fegan, S; Fleming, J A; Forest, T A; Garçon, M; Gevorgyan, N; Giovanetti, K L; Girod, F X; Gohn, W; Gothe, R W; Graham, L; Griffioen, K A; Guegan, B; Guidal, M; Guo, L; Hafidi, K; Hakobyan, H; Hanretty, C; Heddle, D; Hicks, K; Holtrop, M; Ilieva, Y; Ireland, D G; Ishkhanov, B S; Isupov, E L; Jo, H S; Joo, K; Keller, D; Khandaker, M; Khetarpal, P; Kim, A; Kim, W; Klein, F J; Koirala, S; Kubarovsky, A; Kuhn, S E; Kuleshov, S V; Kvaltine, N D; Livingston, K; Lu, H Y; MacGregor, I J D; Mao, Y; Markov, N; Martinez, D; Mayer, M; McKinnon, B; Meyer, C A; Mineeva, T; Mirazita, M; Mokeev, V; Moutarde, H; Munevar, E; Camacho, C Munoz; Nadel-Turonski, P; Niculescu, G; Niculescu, I; Osipenko, M; Ostrovidov, A I; Pappalardo, L L; Paremuzyan, R; Park, K; Park, S; Pasyuk, E; Pereira, S Anefalos; Phelps, E; Pisano, S; Pogorelko, O; Pozdniakov, S; Price, J W; Procureur, S; Prok, Y; Protopopescu, D; Puckett, A J R; Raue, B A; Ricco, G; Rimal, D; Ripani, M; Rosner, G; Rossi, P; Sabatié, F; Saini, M S; Salgado, C; Saylor, N; Schott, D; Schumacher, R A; Seder, E; Seraydaryan, H; Sharabian, Y G; Smith, G D; Sober, D I; Sokhan, D; Stepanyan, S S; Stepanyan, S; Strauch, S; Taiuti, M; Tang, W; Taylor, C E; Tian, Ye; Tkachenko, S; Ungaro, M; Vineyard, M F; Vlassov, A; Voskanyan, H; Voutier, E; Walford, N K; Watts, D P; Weinstein, L B; Weygand, D P; Wood, M H; Zachariou, N; Zhang, J; Zhao, Z W; Zonta, I

    2012-01-01

    Exclusive $\\pi^0$ electroproduction at a beam energy of 5.75 GeV has been measured with the Jefferson Lab CLAS spectrometer. Differential cross sections were measured at more than 1800 kinematic values in $Q^2$, $x_B$, $t$, and $\\phi_\\pi$, in the $Q^2$ range from 1.0 to 4.6 GeV$^2$,\\ $-t$ up to 2 GeV$^2$, and $x_B$ from 0.1 to 0.58. Structure functions $\\sigma_T +\\epsilon \\sigma_L, \\sigma_{TT}$ and $\\sigma_{LT}$ were extracted as functions of $t$ for each of 17 combinations of $Q^2$ and $x_B$. The data were compared directly with two handbag-based calculations including both longitudinal and transversity GPDs. Inclusion of only longitudinal GPDs very strongly underestimates $\\sigma_T +\\epsilon \\sigma_L$ and fails to account for $\\sigma_{TT}$ and $\\sigma_{LT}$, while inclusion of transversity GPDs brings the calculations into substantially better agreement with the data. There is very strong sensitivity to the relative contributions of nucleon helicity flip and helicity non-flip processes. The results confirm ...

  18. Ranks of a Constrained Hermitian Matrix Expression with Applications

    Directory of Open Access Journals (Sweden)

    Shao-Wen Yu

    2013-01-01

    Full Text Available We establish the formulas of the maximal and minimal ranks of the quaternion Hermitian matrix expression C4−A4XA4∗ where X is a Hermitian solution to quaternion matrix equations A1X=C1, XB1=C2, and A3XA3*=C3. As applications, we give a new necessary and sufficient condition for the existence of Hermitian solution to the system of matrix equations A1X=C1, XB1=C2, A3XA3*=C3, and A4XA4*=C4, which was investigated by Wang and Wu, 2010, by rank equalities. In addition, extremal ranks of the generalized Hermitian Schur complement C4−A4A3~A4∗ with respect to a Hermitian g-inverse A3~ of A3, which is a common solution to quaternion matrix equations A1X=C1 and XB1=C2, are also considered.

  19. Orthogonal hydrogen/halogen bonding in 1-(2-methoxyphenyl)-1H-imidazole-2(3H)-thione-I2 adduct: An experimental and theoretical study

    Science.gov (United States)

    El-Sheshtawy, Hamdy S.; Ibrahim, Mohamed M.; El-Mehasseb, Ibrahim; El-Kemary, Maged

    2015-05-01

    The molecular complex between 1-(2-methoxyphenyl)-1H-imidazole-2(3H)-thione (HmimOMe) and iodine (I2) was investigated. Single crystal of [(HmimOMe)radI2] adduct was grown by slow evaporation technique from chloroform at room temperature. Spectroscopic techniques such as FT-IR and Raman techniques, as well as elemental and thermal analysis were used to characterize the complex. The crystal structure shows that the formed adduct stabilized by two noncovalent interactions, namely, hydrogen bond (HB) and halogen bond (XB). Orthogonal HB/XB associated with iodine atom (I) was observed and fully characterized. The ability of iodine to behave as hydrogen bond acceptor and halogen bond donor was held responsible for the orthogonal HB/XB presence. In addition, the structure of HmimOMeradI2 was investigated theoretically using MP2/aug-cc-pVDZ level of theory. Natural bond orbital analysis (NBO) was used to investigate the molecular orbitals interactions and orbitals stabilization energies.

  20. The low-mass X-ray binary-millisecond radio pulsar birthrate problem revisited

    Institute of Scientific and Technical Information of China (English)

    2010-01-01

    We investigate the birthrate problem for low-mass X-ray binaries(LMXBs) and millisecond radio pulsars(MRPs) in this paper.We consider intermediate-mass and low-mass X-ray binaries(I/LMXBs) to be the progenitors of MRPs,and calculate their evolutionary response to the cosmic star formation rate(SFR) both semi-analytically and numerically.With a typical value(1 Gyr) of the LMXB lifetime,one may expect comparable birthrates of LMXBs and MRPs,but the calculated number of LMXBs is an order of magnitude higher than that observed in the Galaxy.Instead,we suggest that the birthrate problem could be solved if most MRPs have evolved from faint to rather than bright LMXBs.The former may have a population of-104 in the Galaxy.

  1. X-Ray Binary Populations in a Cosmological Context, Including NuSTAR Predictions

    Science.gov (United States)

    Cardiff, Ann Hornschemeier

    2011-01-01

    The new ultradeep 4 Ms Chandra Deep Field South has afforded the deepest view ever of X-ray binary populations. We report on the latest results on both LMXB and HMXB evolution out to redshifts of approximately four, including comparison with the latest theoretical models, using this deepest-ever view of the X-ray universe with Chandra. The upcoming NuSTAR mission will open up X-ray binary populations in the hard X-ray band, similar to the pioneering work of Fabbiano et al. in the Einstein era. We report on plans to study both Local Group and starburst galaxies as well as the implications those observations may have for X-ray binary populations in galaxies contributing to the Cosmic X-ray Background.

  2. IR spectra of the microquasar GRS 1915+105 during a low state

    CERN Document Server

    Harlaftis, E T; Castro-Tirado, A J

    2001-01-01

    There is controversy regarding the nature of the suspected donor star to the microquasar GRS 1915+105, and hence whether GRS 1915+105 is a high mass X-ray binary (HMXB) or a low-mass X-ray binary (LMXB). In order to clarify this issue, we obtained an infrared (J, H and K) spectrum of GRS 1915+105 in its low state which shows a steeper continuum than the prototype X-ray binary Sco X-1. We did not detect any HeII emission at 2.189 microns from GRS 1915+105 in our quiescent spectrum, indicating that the line is transient and is only observed during episodes of high X-ray activity. For our instrument configuration, there is no detection of the 12CO lines which are characteristic of late-type stars either in GRS1915+105 or Sco X-1.

  3. K2 and MAXI observations of Sco X-1 - Evidence for disc precession?

    CERN Document Server

    Hakala, Pasi; Barclay, Thomas; Charles, Phil

    2015-01-01

    Sco X-1 is the archetypal low mass X-ray binary (LMXB) and the brightest persistent extra-solar X-ray source in the sky. It was included in the K2 Campaign 2 field and was observed continuously for 71 days with 1 minute time resolution. In this paper we report these results and underline the potential of K2 for similar observations of other accreting compact binaries. We reconfirm that Sco X-1 shows a bimodal distribution of optical "high" and "low" states and rapid transitions between them on timescales less than 3 hours (or 0.15 orbits). We also find evidence that this behaviour has a typical systemic timescale of 4.8 days, which we interpret as a possible disc precession period in the system. Finally, we confirm the complex optical vs. X-ray correlation/anticorrelation behaviour for "high" and "low" optical states respectively.

  4. Monitoring of Transient Black Hole Candidates observed in the INTEGRAL survey

    CERN Document Server

    Capitanio, F; Bird, A J; Ubertini, P; Federici, M

    2007-01-01

    The INTEGRAL/IBIS survey was performed collecting all the GPS and GCDE data together with all the available public data . The second catalogue, published in 2006 by Bird et al., is dominated by detection of 113 X-ray binaries, with 38 being high-mass and 67 low-mass. In most systems the compact object is a neutron star, but the sample also contains 4 confirmed Black Holes and 6 LMXB black hole candidates (BHC). There are also, in additional, 6 tentative associations as BHCs based simply on spectral and timing properties. In the sample of 12 sources (BHC and tentatively associated BHC) there are 7 transient sources that went into outbursts during the INTEGRAL survey observations. We present here the monitoring of the time and spectral evolution of these 7 outbursts.

  5. Multiband Echo Tomography of Sco X-1

    CERN Document Server

    Mu~noz-Darias, T; Casares, J; Marsh, T R; Cornelisse, R; Steeghs, D; Dhillon, V S; Charles, P A

    2005-01-01

    We present preliminary results of a simultaneous X-ray/optical campaign of the prototypical LMXB Sco X-1 at 1-10 Hz time resolution. Lightcurves of the high excitation Bowen/HeII emission lines and a red continuum at lambda ~ 6000 Ang were obtained through narrow interference filters with ULTRACAM, and these were cross-correlated with simultaneous RXTE X-ray lightcurves. We find evidence for correlated variability, in particular when Sco X-1 enters the Flaring Branch. The Bowen/HeII lightcurves lag the X-ray lightcurves with a light travel time which is consistent with reprocessing in the companion star while the continuum lightcurves have shorter delays consistent with reprocessing in the accretion disc

  6. The low-mass X-ray binary-millisecond radio pulsar birthrate problem revisited

    CERN Document Server

    Hailang, Dai

    2009-01-01

    We investigate the birthrate problem for low-mass X-ray binaries (LMXBs) and millisecond radio pulsars (MRPs) in this paper. We consider intermediate-mass and low-mss X-ray binaries (I/LMXBs) as the progenitors of MRPs, and calculate their evolutionary response to the cosmic star formation rate (SFR) both semi-analytically and numerically. With typical value (~1 Gyr) of the LMXB lifetime, one may expect comparable birthrates of LMXBs and MRPs, but the calculated number of LMXBs is an order of magnitude higher than observed in the Galaxy. Instead, we suggest that the birthrate problem could be solved if most MRPs have evolved from faint rather bright LMXBs. The former may have a population of ~ 104 in the Galaxy.

  7. The quasi-periodic oscillations and very low frequency noise of Scorpius X-1 as transient chaos - A dripping handrail?

    Science.gov (United States)

    Scargle, Jeffrey D.; Steiman-Cameron, Thomas; Young, Karl; Donoho, David L.; Crutchfield, James P.; Imamura, James

    1993-01-01

    We present evidence that the quasi-periodic oscillations (QPO) and very low frequency noise (VLFN) characteristic of many accretion sources are different aspects of the same physical process. We analyzed a long, high time resolution EXOSAT observation of the low-mass X-ray binary (LMXB) Sco X-1. The X-ray luminosity varies stochastically on time scales from milliseconds to hours. The nature of this variability - as quantified with both power spectrum analysis and a new wavelet technique, the scalegram - agrees well with the dripping handrail accretion model, a simple dynamical system which exhibits transient chaos. In this model both the QPO and VLFN are produced by radiation from blobs with a wide size distribution, resulting from accretion and subsequent diffusion of hot gas, the density of which is limited by an unspecified instability to lie below a threshold.

  8. Bowen fluorescence from companion stars in x-ray Binaries

    Directory of Open Access Journals (Sweden)

    J. Casares

    2004-01-01

    Full Text Available Este art culo examina una nueva t ecnica para detectar estrellas compa~neras en los LMXB y las transitorias de rayos X durante la transferencia de masa utilizando las l neas NIII uorescentes de Bowen en 4634-4640. Estas l neas se reprocesan muy e cientemente en las atm osferas de las estrellas compa~neras proporcionando estimaciones de las velocidades K2 y funciones de masas. Este m etodo se aplic o a Sco X-1, X 822-371 y GB339-4 el cual, en este ultimo caso, proporciona una evidencia din amica de la presencia de un agujero negro acreciente. Tambi en se presentan resultados preliminares de una campa~na VLT sobre V801 Ara, V926 Sco y XTE J1814-338.

  9. Young pre-Low-Mass X-ray Binaries in propeller phase : Nature of the 6.7-hour periodic X-ray source 1E 161348-5055 in RCW 103

    CERN Document Server

    Bhadkamkar, Harshal

    2009-01-01

    Discovery of the 6.7-hour periodicity in the X-ray source 1E 161348-5055 in RCW 103 has led to investigations of the nature of this periodicity. We explore a model for 1E 161348-5055, wherein a fast-spinning neutron star with a magnetic field $\\sim 10^{12}$ G in a young pre-Low-Mass X-ray Binary (pre-LMXB) with an eccentric orbit of period 6.7 hr operates in the "propeller" phase. The 6.7-hr light curve of 1E 161348-5055 can be quantitatively accounted by a model of orbitally-modulated mass transfer through a viscous accretion disk and subsequent propeller emission (both Illarionov-Sunyaev type and Romanova-Lovelace et al type), and spectral and other properties are also in agreement. Formation and evolution of model systems are shown to be in accordance both with standard theories.

  10. Is the Lack of Pulsations in Low Mass X-Ray Binaries due to Comptonizing Coronae?

    CERN Document Server

    Gogus, E; Gilfanov, M; Gogus, Ersin

    2006-01-01

    The spin periods of the neutron stars in most Low Mass X-ray Binary (LMXB) systems still remain undetected. One of the models to explain the absence of coherent pulsations has been the suppression of the beamed signal by Compton scattering of X-ray photons by electrons in a surrounding corona. We point out that simultaneously with wiping out the pulsation signal, such a corona will upscatter (pulsating or not) X-ray emission originating at and/or near the surface of the neutron star leading to appearance of a hard tail of Comptonized radiation in the source spectrum. We analyze the hard X-ray spectra of a selected set of LMXBs and demonstrate that the optical depth of the corona is not likely to be large enough to cause the pulsations to disappear.

  11. The Thermal Evolution following a Superburst on an Accreting Neutron Star

    Science.gov (United States)

    Cumming, Andrew; Macbeth, Jared

    2004-03-01

    Superbursts are very energetic type I X-ray bursts discovered in recent years by long-term monitoring of X-ray bursters and are believed to be due to unstable ignition of carbon in the deep ocean of the neutron star. In this Letter, we follow the thermal evolution of the surface layers as they cool following the burst. The resulting light curves agree very well with observations for layer masses in the range 1025-1026 g expected from ignition calculations and for an energy release >~1017 ergs g-1 during the flash. We show that at late times the cooling flux from the layer decays as a power law F~t-4/3, giving timescales for quenching of normal type I bursting of weeks, in good agreement with observational limits. We show that simultaneous modeling of superburst light curves and quenching times promises to constrain both the thickness of the fuel layer and the energy deposited.

  12. The Thermal Evolution following a Superburst on an Accreting Neutron Star

    CERN Document Server

    Cumming, A; Cumming, Andrew; Macbeth, Jared

    2004-01-01

    Superbursts are very energetic Type I X-ray bursts discovered in recent years by long term monitoring of X-ray bursters, and believed to be due to unstable ignition of carbon in the deep ocean of the neutron star. In this Letter, we follow the thermal evolution of the surface layers as they cool following the burst. The resulting lightcurves agree very well with observations for layer masses and energy releases in the range expected from ignition calculations. At late times, the cooling flux from the layer decays as a power law in time, giving timescales for quenching of normal Type I bursting of weeks, in good agreement with observational limits. We show that simultaneous modelling of superburst lightcurves and quenching times promises to constrain both the thickness of the fuel layer and the energy deposited.

  13. A superburst from GX 3+1

    OpenAIRE

    Kuulkers, Erik

    2001-01-01

    I found one long X-ray flare from the X-ray burster GX 3+1 in almost 6 years of observations with the RXTE All Sky Monitor (ASM). The event had a peak flux of about 1.1 Crab (1.5-12 keV), lasted between 4.4 and 16.2 hours and exhibited a fluence of more than about 5x10^{41} erg for a source distance of 5 kpc. During the exponential-like decay, with an exponential decay time of 1.6 hours, spectral softening is seen. The total ASM effective exposure time on GX 3+1 is estimated to be around a ye...

  14. Compression and model reduction: A case study

    Energy Technology Data Exchange (ETDEWEB)

    LoFaro, T. [Washington State Univ., Pullman, WA (United States); Kopell, N. [Boston Univ., Boston, MA (United States)

    1995-12-31

    We discuss a method by which the dynamics of a network of coupled neurons can be captured in a one-dimensional map. The network used as an example of this technique consists of a pair of neurons, one of which is an endogenous burster and the other excitable, but not bursting in the absence of phasic input. The reduction is accomplished by decomposing the flow into fast and slow subsystems, each operating on a distinct time scale. A {open_quotes}map of knees{close_quotes} is constructed using singular perturbation techniques. A concise expression for this map is developed by introducing time coordinates to each stable branch of the slow manifold. The compression associated with the fast subsystem is used to determine the qualitative properties of the map.

  15. Larval biometry of Simulium rubrithorax (Diptera: Simuliidae and size comparison between populations in the states of Minas Gerais and Roraima, Brazil

    Directory of Open Access Journals (Sweden)

    Alvan-Aguilar Miriam Adriana

    2003-01-01

    Full Text Available The number of larval instars of Simulium (Hemicnetha rubrithorax Lutz (Diptera: Nematocera was determined using the lateral length of the head capsule. In this study 1,035 larvae, of different sizes, were measured (639 from the state of Roraima and 396 from the state of Minas Gerais. A frequency distribution analysis was carried out on the measurements of the lateral length of the head capsule to determine the number of larval instars. The limits of each instar were defined by the lower frequency of the measurements falling in a range of values, by the presence of the "egg burster" that characterizes the first larval instar, and by the developmental stage of the gill histoblast. The determination of the instar number was tested using a Student's t-test (p 0.05 were observed between them.

  16. Bursting Ca2+ Oscillations and Synchronization in Coupled Cells

    Institute of Scientific and Technical Information of China (English)

    JI Quan-Bao; LU Qi-Shao; Yang Zhuo-Qin; Duan Li-Xia

    2008-01-01

    A mathematical model proposed by Grubelnk et al. [Biophys. Chem. 94 (2001) 59] is employed to study the physiological role of mitochondria and the cytosolic proteins in generating complex Ca2+ oscillations. Intracellular bursting calcium oscillations of point-point, point cycle and two-folded limit cycle types are observed and explanations are given based on the fast/slow dynamical analysis, especially for point-cycle and two-folded limit cycle types, which have not been reported before. Furthermore, synchronization of coupled bursters of Ca2+oscillations via gap junctions and the effect of bursting types on synchronization of coupled cells are studied. It is argued that bursting oscillations of point-point type may be superior to achieve synchronization than that of point-cycle type.

  17. INTEGRAL monitoring of unusually long X-ray bursts

    DEFF Research Database (Denmark)

    Thermonuclear bursts on the surface of accreting neutron stars in low mass X-ray binaries have been studied for many years and have in a few cases confirmed theoretical models of nuclear ignition and burning mechanisms. The large majority of X-ray bursts last less than 100s. A good number of the...... known X-ray bursters are frequently observed by INTEGRAL, in particular in the frame of the Key Programmes. Taking advantage of the INTEGRAL instrumentation, an international collaboration led by the JEM-X team at the Danish National Space Institute has been monitoring the occurrence of uncommon burst...... events lasting more than a few minutes. Of special interest are exceptional X-ray bursts which duration about a few tens of minutes is intermediate between usual short bursts and hour long superbursts. The processes driving such long bursts are not yet fully understood: depending on the composition of...

  18. X-ray astronomy

    International Nuclear Information System (INIS)

    This book contains the lectures, and the most important seminars held at the NATO meeting on X-Ray astronomy in Erice, July 1979. The meeting was an opportune forum to discuss the results of the first 8-months of operation of the X-ray satellite, HEAO-2 (Einstein Observatory) which was launched at the end of 1978. Besides surveying these results, the meeting covered extragalactic astronomy, including the relevant observations obtained in other portions of the electromagnetic spectrum (ultra-violet, optical, infrared and radio). The discussion on galactic X-ray sources essentially covered classical binaries, globular clusters and bursters and its significance to extragalactic sources and to high energy astrophysics was borne in mind. (orig.)

  19. Explosive Transient Camera (ETC) Program

    Science.gov (United States)

    Ricker, George

    1991-01-01

    Since the inception of the ETC program, a wide range of new technologies was developed to support this astronomical instrument. The prototype unit was installed at ETC Site 1. The first partially automated observations were made and some major renovations were later added to the ETC hardware. The ETC was outfitted with new thermoelectrically-cooled CCD cameras and a sophisticated vacuum manifold, which, together, made the ETC a much more reliable unit than the prototype. The ETC instrumentation and building were placed under full computer control, allowing the ETC to operate as an automated, autonomous instrument with virtually no human intervention necessary. The first fully-automated operation of the ETC was performed, during which the ETC monitored the error region of the repeating soft gamma-ray burster SGR 1806-21.

  20. Incompressibility of strange matter

    CERN Document Server

    Sinha, M N; Dey, J; Dey, M; Ray, S; Bhowmick, S; Sinha, Monika; Bagchi, Manjari; Dey, Jishnu; Dey, Mira; Ray, Subharthi; Bhowmick, Siddhartha

    2002-01-01

    Strange stars calculated from a realistic equation of state (EOS) show compact objects in the mass radius curve, when they are solved for gravitational fields via TOV equation. Many of the observed stars seem to fit in with this kind of compactness irrespective of whether they are X-ray pulsars, bursters or soft $\\gamma$ repeaters or radio pulsars. Calculated incompressibility of this strange matter shows continuity with that of nuclear matter. This is important in the cosmic separation of phase scenario. We compare our calculations of incompressibility with that of a nuclear matter EOS. This EOS has a continuous transition to ud-matter at about five times normal density. From a look at the consequent velocity of sound it is found that the transition to ud-matter seems necessary.

  1. Stability of strange stars (SS) derived from a realistic equation of state

    CERN Document Server

    Sinha, M N; Dey, M; Ray, S; Bhowmick, S; Sinha, Monika; Dey, Jishnu; Dey, Mira; Ray, Subharthi; Bhowmick, Siddhartha

    2002-01-01

    A realistic equation of state (EOS) leads to realistic strange stars (ReSS) which are compact in the mass radius plot, close to the Schwarzchild limiting line (Dey et al 1998). Many of the observed stars fit in with this kind of compactness, irrespective of whether they are X-ray pulsars, bursters or soft $\\gamma$ repeaters or even radio pulsars. We point out that a change in the radius of a star can be small or large, when its mass is increasing and this depends on the position of a particular star on the mass radius curve. We carry out a stability analysis against radial oscillations and compare with the EOS of other strange star (SS) models. We find that the ReSS is stable and an M-R region can be identified to that effect.

  2. X-ray spectra of bursting neutron stars

    International Nuclear Information System (INIS)

    The global properties of type-I x-ray bursts can be successfully accounted for by the thermonuclear shell flash model of accreting neutron stars. According to this model, the luminosity of a relatively large burst approaches to the Eddington luminosity. We calculate the atmospheric structure and the photon energy spectrum of x-ray bursting neutron star taking account of comptonization. From the x-ray spectrum, theoretical color temperature-luminosity diagram is obtained. Observational color temperature-luminosity diagram of x-ray burster is constructed using data of Japanese x-ray sutellite Tenma. Comparing our theoretical diagram with observational ones, we can estimate a mass-radius relation of neutron stars and distances to the galactic center. (Mori, K.)

  3. Simulation and physical model based gamma-ray burst afterglow analysis

    CERN Document Server

    van Eerten, Hendrik

    2015-01-01

    Advances in our numerical and theoretical understanding of gamma-ray burst afterglow processes allow us to construct models capable of dealing with complex relativistic jet dynamics and non-thermal emission, that can be compared directly to data from instruments such as Swift. Because afterglow blast waves and power law spectra are intrinsically scale-invariant under changes of explosion energy and medium density, templates can be generated from large-scale hydrodynamics simulations. This allows for iterative template-based model fitting using the physical model parameters (quantifying the properties of the burster, emission and observer) directly as fit variables. Here I review how such an approach to afterglow analysis works in practice, paying special attention to the underlying model assumptions, possibilities, caveats and limitations of this type of analysis. Because some model parameters can be degenerate in certain regions of parameter space, or unconstrained if data in a limited number of a bands is a...

  4. A Novel Approach In The Detection Of Muon Neutrino To Tau Neutrino Oscillation From Extragalactic Neutrinos

    CERN Document Server

    Iyer, S R

    2001-01-01

    A novel approach is proposed for studying the νμ → ν τ oscillation and detection of extragalactic neutrinos. Active Galactic Nuclei (AGN), Gamma Ray Bursters (GRB) and Topological Defects are believed to be sources of ultrahigh energy νμ and ντ. These astrophysical sources provide a long baseline of 100Mpc, or more, for possible detection of νμ → ντ oscillation with mixing parameter Δm2 down to 10 −17 eV2, many orders of magnitude below the current accelerator experiments. The propagation characteristics of upward going muon and tau neutrinos is studied to show that high energy tau neutrinos cascade down in energy as they propagate through the Earth, producing an enhancement of the incoming tau neutrino flux in the low energy region. By contrast, high energy muon neutrinos get attenuated as they traverse the Earth. It is observed that the relative steepness of the incoming neutrino flux...

  5. Light Curves for Rapidly-Rotating Neutron Stars

    CERN Document Server

    Cadeau, C; Leahy, D; Campbell, S S; Cadeau, Coire; Morsink, Sharon M.; Leahy, Denis; Campbell, Sheldon S.

    2006-01-01

    We present raytracing computations for light emitted from the surface of a rapidly-rotating neutron star in order to construct light curves for X-ray pulsars and bursters. These calculations are for realistic models of rapidly-rotating neutron stars which take into account both the correct exterior metric and the oblate shape of the star. We find that the most important effect arising from rotation comes from the oblate shape of the rotating star. We find that approximating a rotating neutron star as a sphere introduces serious errors in fitted values of the star's radius and mass if the rotation rate is very large. However, in most cases acceptable fits to the ratio M/R can be obtained with the spherical approximation.

  6. Electron-scale shear instabilities: magnetic field generation and particle acceleration in astrophysical jets

    CERN Document Server

    Alves, E P; Fonseca, R A; Silva, L O

    2014-01-01

    Strong shear flow regions found in astrophysical jets are shown to be important dissipation regions, where the shear flow kinetic energy is converted into electric and magnetic field energy via shear instabilities. The emergence of these self-consistent fields make shear flows significant sites for radiation emission and particle acceleration. We focus on electron-scale instabilities, namely the collisionless, unmagnetized Kelvin-Helmholtz instability (KHI) and a large-scale dc magnetic field generation mechanism on the electron scales. We show that these processes are important candidates to generate magnetic fields in the presence of strong velocity shears, which may naturally originate in energetic matter outburst of active galactic nuclei and gamma-ray bursters. We show that the KHI is robust to density jumps between shearing flows, thus operating in various scenarios with different density contrasts. Multidimensional particle-in-cell (PIC) simulations of the KHI, performed with OSIRIS, reveal the emergen...

  7. Fast X-ray transient, IGR J17464-2811 detected with INTEGRAL

    DEFF Research Database (Denmark)

    Brandt, Søren; Budtz-Jørgensen, Carl; Chenevez, Jérôme; Lund, Niels; Oxborrow, Carol Anne; Westergaard, Niels Jørgen Stenfeldt

    2006-01-01

    interval to be RA = 266.810 deg, DEC = -28.185 (J2000), with a 90% error radius of 1 arcmin. In the 3-8 keV band the burst showed a fast rise and an exponential decay with a time constant of about 70 seconds. In the 8-30 keV band the burst showed a gradual rise over 25 seconds followed by an exponential...... decay with a time constant of about 30 seconds, indicating a spectral softening characteristic of Type-I X-ray bursters. The burst reached a peak flux of 1.0 Crab in the JEM-X 3-30 keV band. The outburst was also clearly detected and localized with ISGRI up to 30 keV. 10 weak sources are found within...

  8. The INTEGRAL Galactic bulge monitoring program: the first 1.5 years

    DEFF Research Database (Denmark)

    Kuulkers, E.; Shaw, S.E.; Paizis, A.;

    2007-01-01

    start of the monitoring up to 2006, April 21, i.e., for a period of about one and a half year, during three visibility seasons. We focus on the short (hour), medium (month) and long-term (year) variability in the hard X-ray bands, i.e., 20-60 keV and 60-150 keV. When available, we discuss the......-ray flares or outbursts in X-ray bursters, which have a duration of the order of weeks are accompanied by soft X- ray drops. On the other hand, hard X-ray drops can be accompanied by soft X-ray flares/outbursts. During the course of our program we found a number of new sources, IGR J17354-3255, IGR 17453...

  9. Collective properties of neutron-star X-ray binary populations of galaxies. II. Pre-low-mass X-ray binary properties, formation rates, and constraints

    International Nuclear Information System (INIS)

    We continue our exploration of the collective properties of neutron-star X-ray binaries in the stellar fields (i.e., outside globular clusters) of normal galaxies. In Paper I of this series, we considered high-mass X-ray binaries (HMXBs). In this paper (Paper II), we consider low-mass X-ray binaries (LMXBs), whose evolutionary scenario is very different from that of HMXBs. We consider the evolution of primordial binaries up to the stage where the neutron star just formed in the supernova explosion of the primary is in a binary with its low-mass, unevolved companion, and this binary has circularized tidally, producing what we call a pre-low-mass X-ray binary (pre-LMXB). We study the constraints on the formation of such pre-LMXBs in detail (since these are low-probability events), and calculate their collective properties and formation rates. To this end, we first consider the changes in the binary parameters in the various steps involved, viz., the common-envelope phase, the supernova, and the tidal evolution. This naturally leads to a clarification of the constraints. We then describe our calculation of the evolution of the distributions of primordial binary parameters into those of pre-LMXB parameters, following the standard evolutionary scenario for individual binaries. We display the latter as both bivariate and monovariate distributions, discuss their essential properties, and indicate the influences of some essential factors on these. Finally, we calculate the formation rate of these pre-LMXBs. The results of this paper will be used in a subsequent one to compute the expected X-ray luminosity function of LMXBs.

  10. EVIDENCE FOR GAMMA-RAY EMISSION FROM THE LOW-MASS X-RAY BINARY SYSTEM FIRST J102347.6+003841

    International Nuclear Information System (INIS)

    The low-mass X-ray binary (LMXB) system FIRST J102347.6+003841 hosts a newly born millisecond pulsar (MSP) PSR J1023+0038 that was revealed as the first and only known rotation-powered MSP in a quiescent LMXB. While the system is shown to have an accretion disk before 2002, it remains unclear how the accretion disk has been removed in order to reveal the radio pulsation in 2007. In this Letter, we report the discovery of γ-rays spatially consistent with FIRST J102347.6+003841, at a significance of seven standard deviations, using data obtained by the Fermi Gamma-ray Space Telescope. The γ-ray spectrum can be described by a power law (PL) with a photon index of 2.9 ± 0.2, resulting in an energy flux above 200 MeV of (5.5 ± 0.9) x 10-12 erg cm-2 s-1. The γ-rays likely originate from the MSP PSR J1023+0038, but also possibly from an intrabinary shock between the pulsar and its companion star. To complement the γ-ray study, we also re-investigate the XMM-Newton data taken in 2004 and 2008. Our X-ray spectral analysis suggests that a broken PL with two distinct photon indices describes the X-ray data significantly better than a single PL. This indicates that there exists two components and that both components appear to vary with the orbital phase. The evidence for γ-ray emission conforms with a recent suggestion that γ-rays from PSR J1023+0038 may be responsible for ejecting the disk material out of the system.

  11. Collective properties of neutron-star X-ray binary populations of galaxies. II. Pre-low-mass X-ray binary properties, formation rates, and constraints

    Energy Technology Data Exchange (ETDEWEB)

    Bhadkamkar, H. [Astronomy and Astrophysics, Raman Research Institute, Bengaluru 560080 (India); Ghosh, P. [Department of Astronomy and Astrophysics, Tata Institute of Fundamental Research, Mumbai 400005 (India)

    2014-04-01

    We continue our exploration of the collective properties of neutron-star X-ray binaries in the stellar fields (i.e., outside globular clusters) of normal galaxies. In Paper I of this series, we considered high-mass X-ray binaries (HMXBs). In this paper (Paper II), we consider low-mass X-ray binaries (LMXBs), whose evolutionary scenario is very different from that of HMXBs. We consider the evolution of primordial binaries up to the stage where the neutron star just formed in the supernova explosion of the primary is in a binary with its low-mass, unevolved companion, and this binary has circularized tidally, producing what we call a pre-low-mass X-ray binary (pre-LMXB). We study the constraints on the formation of such pre-LMXBs in detail (since these are low-probability events), and calculate their collective properties and formation rates. To this end, we first consider the changes in the binary parameters in the various steps involved, viz., the common-envelope phase, the supernova, and the tidal evolution. This naturally leads to a clarification of the constraints. We then describe our calculation of the evolution of the distributions of primordial binary parameters into those of pre-LMXB parameters, following the standard evolutionary scenario for individual binaries. We display the latter as both bivariate and monovariate distributions, discuss their essential properties, and indicate the influences of some essential factors on these. Finally, we calculate the formation rate of these pre-LMXBs. The results of this paper will be used in a subsequent one to compute the expected X-ray luminosity function of LMXBs.

  12. Broad band X-ray spectra of M31 sources with BeppoSAX

    Science.gov (United States)

    Trinchieri, G.; Israel, G. L.; Chiappetti, L.; Belloni, T.; Stella, L.; Primini, F.; Fabbiano, P.; Pietsch, W.

    1999-08-01

    We present the first spectral study of the X-ray emitting stellar sources in M31 in the energy band from ~ 0.1 to 10 keV. We find that the globular cluster sources have spectral characteristics consistent with those of the Milky Way object, namely that the spectrum can be described by a thermal model with ~ 6-20 keV from ~ 2 to 10 keV. Evidence of high absorption in some of these sources is most likely an indication that they lie in or behind the HI ring in the disk of the galaxy. We also find one peculiar globular cluster source, with spectral characteristics more typically associated with either High Mass X-ray Binaries or black hole candidates. We therefore suggest that either the source has been wrongly identified with a globular cluster or that the system contains a Black Hole. We confirm earlier report that the spectrum of the bulge of M31 is consistent with the superposition of many LMXB spectra. It is likely that a large fraction of the ~ 15-30 keV detection obtained from the PDS instrument is associated with the bulge, thus extending the spectral data for this complex of sources up to ~ 30 keV. The high energy part of the spectrum can be parameterized with typical LMXB spectra, while at low energies an additional component is required. No significant variability is observed within the BeppoSAX observation, while a few sources appear to have varied (brightened) since ROSAT and Einstein observations.

  13. A Search for Novae in the M31 Globular Cluster System

    Science.gov (United States)

    Tomaney, Austin; Crotts, Arlin; Shafter, Allen

    1992-12-01

    Roughly 10% of all low mass X-ray binaries (LMXB's, neutron star - low mass sequence close binaries) are found in Galactic globular clusters (GC's) implying an enhancement per unit mass of roughly three orders of magnitude of these objects inside GC's compared with the field. Fabian, Pringle and Rees (1975) suggested that these lcose binary systems may be formed via tidal capture in the dense cluster cores. Similar arguments are likely to apply to nova systems which are cataclysmic variables (CV's) consisting of a close binary white dwarf - low mass main sequence star. Supporting arguments include the discovery over the past century of two novae in Galactic GC's, and the existence of low luminosity X-ray sources in GC's (Hertz and Grindlay 1983). In addition, surveys for novae in M31 indicate that the specfic density of novae in its bulge is an order of magnitude higher than its disk and it has been argued by Ciardullo et al. (1987) that novae in the bulge of M31 have been spawned inside GC's and subsequently ejected into the field. We present the results of a search (during 1988 and 1989) of over 200 M31 GC's using a fibre multi-object spectrograph to detect Hα emission, a signature of a potential nova eruptions. No eruptions were detected over an effective survey time of one year for the entire known M31 GC system. Although the lower mass of white dwarfs compared with neutron stars implies their effective capture cross section is smaller, we argue that since novae occur much more frequently on high mass white dwarfs this survey provides a sensitive test to the number of high mass CV's in GC's and their enhancement is unlikely to be as high as LMXB's.

  14. QTL Mapping for Hull Thickness and Related Traits in Hybrid Rice Xieyou 9308

    Institute of Scientific and Technical Information of China (English)

    LUO Li-li; ZHANG Ying-xin; CHEN Dai-bo; ZHAN Xiao-deng; SHEN Xi-hong; CHENG Shi-hua; CAO Li-yong

    2014-01-01

    We conducted a quantitative trait locus (QTL) analysis of 165 rice recombinant inbred lines derived from a cross between Zhonghui 9308 (Z9308) and Xieqingzao B (XB) in Hainan and Hangzhou, China. Grain thickness (GT), brown rice thickness (BRT), hull thickness (HT) and milling quality were used for QTL mapping. HT was significantly and positively correlated with GT and BRT. Twenty-nine QTLs were detected with phenotypic effects ranging from 2.80% to 21.27%. Six QTLs, qGT3, qBRT3, qBRT4, qHT6.1, qHT8 and qHT11, were detected repeatedly across two environments. Inherited from XB, qHT6.1, qHT8 and qHT11 showed stable expression, explaining 9.92%, 21.27% and 10.83% of the phenotypic variances in Hainan and 9.61%, 6.40%and 6.71%in Hangzhou, respectively. Additionally, the QTL cluster between RM5944 and RM5626 on chromosome 3 was probably responsible for GT and milling quality. The cluster between RM6992 and RM6473 on chromosome 4 played an important role in grain filling. Three near isogenic lines (NILs), X345, X338 and X389, were selected because they contained homozygous fragments from Zhonghui 9308, corresponding to qHT6.1, qHT8 and qHT11, respectively. The hull of XB was thicker than those of X345, X338 and X389. In all the lines, qHT6.1, qHT8 and qHT11 that regulated rice HT were stably inherited with obvious genetic effects.

  15. Xenomicrobiology: a roadmap for genetic code engineering.

    Science.gov (United States)

    Acevedo-Rocha, Carlos G; Budisa, Nediljko

    2016-09-01

    Biology is an analytical and informational science that is becoming increasingly dependent on chemical synthesis. One example is the high-throughput and low-cost synthesis of DNA, which is a foundation for the research field of synthetic biology (SB). The aim of SB is to provide biotechnological solutions to health, energy and environmental issues as well as unsustainable manufacturing processes in the frame of naturally existing chemical building blocks. Xenobiology (XB) goes a step further by implementing non-natural building blocks in living cells. In this context, genetic code engineering respectively enables the re-design of genes/genomes and proteins/proteomes with non-canonical nucleic (XNAs) and amino (ncAAs) acids. Besides studying information flow and evolutionary innovation in living systems, XB allows the development of new-to-nature therapeutic proteins/peptides, new biocatalysts for potential applications in synthetic organic chemistry and biocontainment strategies for enhanced biosafety. In this perspective, we provide a brief history and evolution of the genetic code in the context of XB. We then discuss the latest efforts and challenges ahead for engineering the genetic code with focus on substitutions and additions of ncAAs as well as standard amino acid reductions. Finally, we present a roadmap for the directed evolution of artificial microbes for emancipating rare sense codons that could be used to introduce novel building blocks. The development of such xenomicroorganisms endowed with a 'genetic firewall' will also allow to study and understand the relation between code evolution and horizontal gene transfer. PMID:27489097

  16. The mean shape of transition and first-passage paths.

    Science.gov (United States)

    Kim, Won Kyu; Netz, Roland R

    2015-12-14

    Based on the one-dimensional Fokker-Planck equation in an arbitrary free energy landscape including a general inhomogeneous diffusivity profile, we analytically calculate the mean shape of transition paths and first-passage paths, where the shape of a path is defined as the kinetic profile in the plane spanned by the mean time and the position. The transition path ensemble is the collection of all paths that do not revisit the start position x(A) and that terminate when first reaching the final position x(B). In contrast, a first-passage path can revisit its start position x(A) before it terminates at x(B). Our theoretical framework employs the forward and backward Fokker-Planck equations as well as first-passage, passage, last-passage, and transition-path time distributions, for which we derive the defining integral equations. We show that the mean shape of transition paths, in other words the mean time at which the transition path ensemble visits an intermediate position x, is equivalent to the mean first-passage time of reaching the position x(A) when starting from x without ever visiting x(B). The mean shape of first-passage paths is related to the mean shape of transition paths by a constant time shift. Since for a large barrier height U, the mean first-passage time scales exponentially in U, while the mean transition path time scales linearly inversely in U, the time shift between first-passage and transition path shapes is substantial. We present explicit examples of transition path shapes for linear and harmonic potentials and illustrate our findings by trajectories obtained from Brownian dynamics simulations. PMID:26671359

  17. Tetraquark states in the bottom sector and the status of the Y_b(10890) state

    Science.gov (United States)

    Patel, Smruti; Vinodkumar, P. C.

    2016-07-01

    We have performed an exploratory study of bottom tetraquarks ([bqbar{b} bar{q}];{qin u,d}) in the diquark-antidiquark framework with the inclusion of spin hyperfine, spin-orbit and tensor components of the one gluon exchange interaction. Our focus here is on the Y_b(10890) and other exotic states in the bottom sector. We have predicted some of the bottom counterparts to the charm tetraquark candidates. Our present study shows that if Z_b(10610) and Z_b(10650) are diquark-diantiquark states then they have to be first radial excitations only and we have predicted the Z_b(10650) state as first radial excitation of tetraquark state X_b (10.143-10.230). We have identified X_b state with J^PC= 1^{+-}/0^{++} as being the analog of Z_c(3900). The observation of the X_b will provide a deeper insight into the exotic hadron spectroscopy and is helpful to unravel the nature of the states connected by the heavy quark symmetry. We particularly focus on the lowest P-wave [bq][bar{b}bar{q}] states with J^PC=1^{-} by computing their leptonic, hadronic, and radiative decay widths to predict the status of the still controversial Y_b(10890) state. Apart from this, we have also shown here the possibility of mixing of P-wave states. In the case of mixing of the 1^{-} state with different spin multiplicities, we found that the predicted masses of the mixed P states differ from the Y_b(10890) state only by ± 20 MeV energy difference, which can be helpful to resolve further the structure of Y_b(10890).

  18. An Optimization Problem for Predicting the Maximal Effect of Degradation of Mechanical Structures

    DEFF Research Database (Denmark)

    Achtziger, W.; Bendsøe, Martin P.; Taylor, J. E.

    2000-01-01

    gives insight in terms of a mechanical interpretation of the optimization problem. We derive an equivalent convex problem formulation and a convex dual problem, and for dyadic matrices A(i) a quadratic programming problem formulation is developed. A nontrivial numerical example is included, based on the......This paper deals with a nonlinear nonconvex optimization problem that models prediction of degradation in discrete or discretized mechanical structures. The mathematical difficulty lies in equality constraints of the form Σ(i=1)(m) 1/yi A(i) x=b, where A(i) are symmetric and positive semidefinite...

  19. Stark-modulation spectroscopy of the B(1)[3Π] state of PbO

    International Nuclear Information System (INIS)

    We report detailed spectroscopic measurements of the X(0)[1Σ+](v=0)→B(1)[3Π](v=5) transition in PbO. Using a Stark-modulated laser absorption technique, we have measured the hyperfine constant of 207PbO in the B(1) state, as well as the B(1)(v=5) rotational constant, X-B isotope shifts, etc. The hyperfine constant of the B(1) state is of interest as a benchmark for calculations of PbO electronic structure related to experiments to search for the electric dipole moment of the electron

  20. Deeply Virtual Compton Scattering on the Neutron: JLab Experiment E08-025

    Science.gov (United States)

    Benali, Meriem; Mazouz, Malek; Fonvieille, Helene

    2016-03-01

    This paper gives the preliminary results of the experimental cross section for deeply virtual Compton scattering on the neutron (en → enγ). The E08-025 experiment was performed at Jefferson Lab Hall A. We measured the (D(e; eX - H(e; e'γ)X) unpolarized cross section and we extracted, for the first time, a non-zero contribution of (neutron-DVCS + coherent-deuteron-DVCS) at Q2 = 1.75 GeV2 and xB = 0.36.

  1. Deeply Virtual Compton Scattering off the neutron

    Energy Technology Data Exchange (ETDEWEB)

    M. Mazouz; A. Camsonne; C. Munoz Camacho; C. Ferdi; G. Gavalian; E. Kuchina; M. Amarian; K. A. Aniol; M. Beaumel; H. Benaoum; P. Bertin; M. Brossard; J.-P. Chen; E. Chudakov; B. Craver; F. Cusanno; C.W. de Jager; A. Deur; R. Feuerbach; J.-M. Fieschi; S. Frullani; M. Garcon; F. Garibaldi; O. Gayou; R. Gilman; J. Gomez; P. Gueye; P.A.M. Guichon; B. Guillon; O. Hansen; D. Hayes; D. Higinbotham; T. Holmstrom; C.E. Hyde; H. Ibrahim; R. Igarashi; X. Jiang; H.S. Jo; L.J. Kaufman; A. Kelleher; A. Kolarkar; G. Kumbartzki; G. Laveissiere; J.J. LeRose; R. Lindgren; N. Liyanage; H.-J. Lu; D.J. Margaziotis; Z.-E. Meziani; K. McCormick; R. Michaels; B. Michel; B. Moffit; P. Monaghan; S. Nanda; V. Nelyubin; M. Potokar; Y. Qiang; R.D. Ransome; J.-S. Real; B. Reitz; Y. Roblin; J. Roche; F. Sabatie; A. Saha; S. Sirca; K. Slifer; P. Solvignon; R. Subedi; V. Sulkosky; P.E. Ulmer; E. Voutier; K. Wang; L.B. Weinstein; B. Wojtsekhowski; X. Zheng; L. Zhu

    2007-12-01

    The present experiment exploits the interference between the Deeply Virtual Compton Scattering (DVCS) and the Bethe-Heitler processes to extract the imaginary part of DVCS amplitudes on the neutron and on the deuteron from the helicity-dependent D$({\\vec e},e'\\gamma)X$ cross section measured at $Q^2$=1.9 GeV$^2$ and $x_B$=0.36. We extract a linear combination of generalized parton distributions (GPDs) particularly sensitive to $E_q$, the least constrained GPD. A model dependent constraint on the contribution of the up and down quarks to the nucleon spin is deduced.

  2. Étude de marché pour le service Skeeble

    OpenAIRE

    Ben Sliman, Kevin; Ahr, Anthony

    2013-01-01

    L’entreprise xb83studio est une entreprise de développement d’applications qui a pour produit phare Skeeble. Ce service est un système de gestion de contenus. Il est accessible depuis internet. Il permet aux particuliers et aux entreprises de créer des applications pour Smartphone sous les systèmes d’exploitation Apple et Android. Il est convivial à utiliser et ne nécessite aucune connaissance particulière pour être utiliser. Monsieur Bertschy a pour objectif de vendre son service à environ 1...

  3. Effects of configurational disorder on the elastic properties of icosahedral boron-rich alloys based on B6O, B13C2, and B4C, and their mixing thermodynamics

    Science.gov (United States)

    Ektarawong, A.; Simak, S. I.; Hultman, L.; Birch, J.; Tasnádi, F.; Wang, F.; Alling, B.

    2016-04-01

    The elastic properties of alloys between boron suboxide (B6O) and boron carbide (B13C2), denoted by (B6O)1-x(B13C2)x, as well as boron carbide with variable carbon content, ranging from B13C2 to B4C are calculated from first-principles. Furthermore, the mixing thermodynamics of (B6O)1-x(B13C2)x is studied. A superatom-special quasirandom structure approach is used for modeling different atomic configurations, in which effects of configurational disorder between the carbide and suboxide structural units, as well as between boron and carbon atoms within the units, are taken into account. Elastic properties calculations demonstrate that configurational disorder in B13C2, where a part of the C atoms in the CBC chains substitute for B atoms in the B12 icosahedra, drastically increase the Young's and shear modulus, as compared to an atomically ordered state, B12(CBC). These calculated elastic moduli of the disordered state are in excellent agreement with experiments. Configurational disorder between boron and carbon can also explain the experimentally observed almost constant elastic moduli of boron carbide as the carbon content is changed from B4C to B13C2. The elastic moduli of the (B6O)1-x(B13C2)x system are also practically unchanged with composition if boron-carbon disorder is taken into account. By investigating the mixing thermodynamics of the alloys, in which the Gibbs free energy is determined within the mean-field approximation for the configurational entropy, we outline the pseudo-binary phase diagram of (B6O)1-x(B13C2)x. The phase diagram reveals the existence of a miscibility gap at all temperatures up to the melting point. Also, the coexistence of B6O-rich as well as ordered or disordered B13C2-rich domains in the material prepared through equilibrium routes is predicted.

  4. Multiplicities of charged pions and kaons from semi-inclusive deep-inelastic scattering by the proton and the deuteron

    CERN Document Server

    Airapetian, A; Akopov, Z; Aschenauer, E C; Augustyniak, W; Avakian, R; Avetissian, A; Avetisyan, E; Belostotski, S; Blok, H P; Borissov, A; Bowles, J; Brodski, I; Bryzgalov, V; Burns, J; Capiluppi, M; Capitani, G P; Cisbani, E; Ciullo, G; Contalbrigo, M; Dalpiaz, P F; Deconinck, W; De Leo, R; De Nardo, L; De Sanctis, E; Diefenthaler, M; Di Nezza, P; Düren, M; Ehrenfried, M; Elbakian, G; Ellinghaus, F; Fabbri, R; Fantoni, A; Felawka, L; Frullani, S; Gabbert, D; Gapienko, G; Gapienko, V; Garibaldi, F; Gavrilov, G; Gharibyan, V; Giordano, F; Gliske, S; Golembiovskaya, M; Hadjidakis, C; Hartig, M; Hasch, D; Hillenbrand, A; Hoek, M; Holler, Y; Hristova, I; Imazu, Y; Ivanilov, A; Izotov, A; Jackson, H E; Jo, H S; Joosten, S; Kaiser, R; Karyan, G; Keri, T; Kinney, E; Kisselev, A; Kobayashi, N; Korotkov, V; Kozlov, V; Kravchenko, P; Krivokhijine, V G; Lagamba, L; Lapikás, L; Lehmann, I; Lenisa, P; Ruiz, A López; Lorenzon, W; Ma, B -Q; Mahon, D; Maiheu, B; Makins, N C R; Manaenkov, S I; Manfré, L; Mao, Y; Marianski, B; de la Ossa, A Martinez; Marukyan, H; Miller, C A; Miyachi, Y; Movsisyan, A; Murray, M; Mussgiller, A; Nappi, E; Naryshkin, Y; Nass, A; Negodaev, M; Nowak, W -D; Pappalardo, L L; Perez-Benito, R; Petrosyan, A; Raithel, M; Reimer, P E; Reolon, A R; Riedl, C; Rith, K; Rosner, G; Rostomyan, A; Rubin, J; Ryckbosch, D; Salomatin, Y; Sanftl, F; Schäfer, A; Schnell, G; Seitz, B; Shibata, T -A; Shutov, V; Stancari, M; Statera, M; Steffens, E; Steijger, J J M; Stewart, J; Stinzing, F; Taroian, S; Terkulov, A; Truty, R; Trzcinski, A; Tytgat, M; Van Haarlem, Y; Van Hulse, C; Veretennikov, D; Vilardi, I; Vogel, C; Wang, S; Yaschenko, S; Ye, Z; Yen, S; Yu, W; Zagrebelnyy, V; Zeiler, D; Zihlmann, B; Zupranski, P

    2012-01-01

    Multiplicities in semi-inclusive deep-inelastic scattering are presented for each charge state of \\pi^\\pm and K^\\pm mesons. The data were collected by the HERMES experiment at the HERA storage ring using 27.6 GeV electron and positron beams incident on a hydrogen or deuterium gas target. The results are presented as a function of the kinematic quantities x_B, Q^2, z, and P_h\\perp. They represent a unique data set for identified hadrons that will significantly enhance our understanding of the fragmentation of quarks into final-state hadrons in deep-inelastic scattering.

  5. 新生儿的较量——实况2010 VS FIFA 10

    Institute of Scientific and Technical Information of China (English)

    小球谜

    2010-01-01

    FIFA与实况系列的暗战早已不是什么秘密.而关于两者孰优孰劣的争论也不是一天两天的事情了。由于PS3尚未破解,而XB360在国内尚不普及,所以无论是FIFA还是实况,大部分玩家的选择还是PC平台。

  6. Drug: D00985 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available CAL USE C05AA Corticosteroids C05AA12 Triamcinolone D00985 Triamcinolone hexacetonide (USP/INN) D DERMATOLOGICALS D07 CORTICOSTEROIDS..., DERMATOLOGICAL PREPARATIONS D07A CORTICOSTEROIDS, PLAI...CL. SEX HORMONES AND INSULINS H02 CORTICOSTEROIDS FOR SYSTEMIC USE H02A CORTICOSTEROIDS...e (USP/INN) D07X CORTICOSTEROIDS, OTHER COMBINATIONS D07XB Corticosteroids, moderately potent, other combina...N D07AB Corticosteroids, moderately potent (group II) D07AB09 Triamcinolone D00985 Triamcinolone hexacetonid

  7. Drug: D02174 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available ne acetate (JAN/USP) D DERMATOLOGICALS D07 CORTICOSTEROIDS, DERMATOLOGICAL PREPARATIONS D07A CORTICOSTEROIDS...te (JAN/USP) D07X CORTICOSTEROIDS, OTHER COMBINATIONS D07XB Corticosteroids, moderately potent, other combin... SEX HORMONES AND INSULINS H02 CORTICOSTEROIDS FOR SYSTEMIC USE H02A CORTICOSTEROIDS...thasone acetate (JAN/USP) S02 OTOLOGICALS S02B CORTICOSTEROIDS S02BA Corticostero...ids S02BA06 Dexamethasone D02174 Dexamethasone acetate (JAN/USP) S03 OPHTHALMOLOGICAL AND OTOLOGICAL PREPARATIONS S03B CORTICOSTEROID

  8. Drug: D07799 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available 05AA09 Dexamethasone D07799 Dexamethasone 21-tebutate D DERMATOLOGICALS D07 CORTICOSTEROIDS, DERMATOLOGICAL ...PREPARATIONS D07A CORTICOSTEROIDS, PLAIN D07AB Corticosteroids, moderately potent (group II) D07AB19 Dexamet...hasone D07799 Dexamethasone 21-tebutate D07X CORTICOSTEROIDS, OTHER COMBINATIONS D07XB Corticosteroids, mode...ARATIONS, EXCL. SEX HORMONES AND INSULINS H02 CORTICOSTEROIDS FOR SYSTEMIC USE H02A CORTICOSTEROIDS...sone 21-tebutate S02 OTOLOGICALS S02B CORTICOSTEROIDS S02BA Corticosteroids S02BA

  9. Drug: D00975 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available C05AA Corticosteroids C05AA09 Dexamethasone D00975 Dexamethasone sodium phosphate (JAN/USP) D DERMATOLOGICALS D07 CORTICOSTEROIDS..., DERMATOLOGICAL PREPARATIONS D07A CORTICOSTEROIDS, PLAIN D...te (JAN/USP) D07X CORTICOSTEROIDS, OTHER COMBINATIONS D07XB Corticosteroids, moderately potent, other combin...REPARATIONS, EXCL. SEX HORMONES AND INSULINS H02 CORTICOSTEROIDS FOR SYSTEMIC USE H02A CORTICOSTEROIDS FOR S...mbination S01CB01 Dexamethasone D00975 Dexamethasone sodium phosphate (JAN/USP) S02 OTOLOGICALS S02B CORTICOSTEROIDS

  10. Drug: D02591 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available efurate (USAN/INN) D DERMATOLOGICALS D07 CORTICOSTEROIDS, DERMATOLOGICAL PREPARATIONS D07A CORTICOSTEROIDS, ...te (USAN/INN) D07X CORTICOSTEROIDS, OTHER COMBINATIONS D07XB Corticosteroids, moderately potent, other combi..., EXCL. SEX HORMONES AND INSULINS H02 CORTICOSTEROIDS FOR SYSTEMIC USE H02A CORTICOSTEROIDS...ne D02591 Dexamethasone acefurate (USAN/INN) S02 OTOLOGICALS S02B CORTICOSTEROIDS...AND OTOLOGICAL PREPARATIONS S03B CORTICOSTEROIDS S03BA Corticosteroids S03BA01 Dexamethasone D02591 Dexameth

  11. Drug: D02592 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available thasone beloxil (USAN) D DERMATOLOGICALS D07 CORTICOSTEROIDS, DERMATOLOGICAL PREPARATIONS D07A CORTICOSTEROIDS... PREPARATIONS, EXCL. SEX HORMONES AND INSULINS H02 CORTICOSTEROIDS FOR SYSTEMIC USE H02A CORTICOSTEROIDS FOR...2592 Dexamethasone beloxil (USAN) S02 OTOLOGICALS S02B CORTICOSTEROIDS S02BA Corticosteroids S02BA06 Dexamet...hasone D02592 Dexamethasone beloxil (USAN) S03 OPHTHALMOLOGICAL AND OTOLOGICAL PREPARATIONS S03B CORTICOSTEROIDS...oxil (USAN) D07X CORTICOSTEROIDS, OTHER COMBINATIONS D07XB Corticosteroids, moder

  12. Drug: D07796 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available steroids C05AA09 Dexamethasone D07796 Dexamethasone 21-acetate D DERMATOLOGICALS D07 CORTICOSTEROIDS, DERMAT...OLOGICAL PREPARATIONS D07A CORTICOSTEROIDS, PLAIN D07AB Corticosteroids, moderately potent (group II) D07AB1...9 Dexamethasone D07796 Dexamethasone 21-acetate D07X CORTICOSTEROIDS, OTHER COMBINATIONS D07XB Corticosteroi...L PREPARATIONS, EXCL. SEX HORMONES AND INSULINS H02 CORTICOSTEROIDS FOR SYSTEMIC USE H02A CORTICOSTEROIDS...thasone 21-acetate S02 OTOLOGICALS S02B CORTICOSTEROIDS S02BA Corticosteroids S02

  13. Drug: D07797 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available Dexamethasone D07797 Dexamethasone isonicotinate D DERMATOLOGICALS D07 CORTICOSTEROIDS, DERMATOLOGICAL PREPARATIONS D07A CORTICOSTER...ne D07797 Dexamethasone isonicotinate D07X CORTICOSTEROIDS, OTHER COMBINATIONS D07XB Corticosteroids, modera...EPARATIONS, EXCL. SEX HORMONES AND INSULINS H02 CORTICOSTEROIDS FOR SYSTEMIC USE H02A CORTICOSTEROIDS...examethasone isonicotinate S02 OTOLOGICALS S02B CORTICOSTEROIDS S02BA Corticoster...oids S02BA06 Dexamethasone D07797 Dexamethasone isonicotinate S03 OPHTHALMOLOGICAL AND OTOLOGICAL PREPARATIONS S03B CORTICOSTEROIDS

  14. Preliminary Design of the Low Speed Propulsion Air Intake of the LAPCAT-MR2 Aircraft

    Science.gov (United States)

    Meerts, C.; Steelant, J.; Hendrick, P.

    2011-08-01

    A supersonic air intake has been designed for the low speed propulsion system of the LAPCAT-MR2 aircraft. Development has been based on the XB-70 aircraft air intake which achieves extremely high performances over a wide operation range through the combined use of variable geometry and porous wall suction for boundary layer control. Design of the LAPCAT-MR2 intake has been operated through CFD simulations using DLR TAU-Code (perfect gas model - Menter SST turbulence model). First, a new boundary condition has been validated into the DLR TAU-Code (perfect gas model) for porous wall suction modelling. Standard test cases have shown surprisingly good agreement with both theoretical predictions and experimental results. Based upon this validation, XB-70 air intake performances have been assessed through CFD simulations over the subsonic, transonic and supersonic operation regions and compared to available flight data. A new simulation strategy was deployed avoiding numerical instabilities when initiating the flow in both transonic and supersonic operation modes. First, the flow must be initiated with a far field Mach number higher than the target flight Mach number. Additionally, the inlet backpressure may only be increased to its target value once the oblique shock pattern downstream the intake compression ramps is converged. Simulations using that strategy have shown excellent agreement with in-flight measurements for both total pressure recovery ratio and variable geometry schedule prediction. The demarcation between stable and unstable operation could be well reproduced. Finally, a modified version of the XB-70 air intake has been integrated in the elliptical intake on the LAPCAT vehicle. Operation of this intake in the LAPCAT-MR2 environment is under evaluation using the same simulation strategy as the one developed for the XB-70. Performances are assessed at several key operation points to assess viability of this design. This information will allow in a next

  15. Drug: D02049 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D02049 Drug Colistin sodium methanesulfonate (JP16); Colistimethate sodium (USP); C...tic category: 6125 ATC code: A07AA10 J01XB01 Colistin A component (R = 6-methyloctanoic acid) Colistin B com...08301] 6 Agents against pathologic organisms and parasites 61 Antibiotics 612 Acting mainly on gram-negative bacteria 6125 Colistin...s D02049 Colistin sodium methanesulfonate (JP16); Colistimethate sodium (USP) Anatomi...VES A07AA Antibiotics A07AA10 Colistin D02049 Colistin sodium methanesulfonate (JP16); Colistimethate sodium

  16. Short-term sandbar variability based on video imagery: Comparison between Time-Average and Time-Variance techniques

    Science.gov (United States)

    Guedes, R.M.C.; Calliari, L.J.; Holland, K.T.; Plant, N.G.; Pereira, P.S.; Alves, F.N.A.

    2011-01-01

    Time-exposure intensity (averaged) images are commonly used to locate the nearshore sandbar position (xb), based on the cross-shore locations of maximum pixel intensity (xi) of the bright bands in the images. It is not known, however, how the breaking patterns seen in Variance images (i.e. those created through standard deviation of pixel intensity over time) are related to the sandbar locations. We investigated the suitability of both Time-exposure and Variance images for sandbar detection within a multiple bar system on the southern coast of Brazil, and verified the relation between wave breaking patterns, observed as bands of high intensity in these images and cross-shore profiles of modeled wave energy dissipation (xD). Not only is Time-exposure maximum pixel intensity location (xi-Ti) well related to xb, but also to the maximum pixel intensity location of Variance images (xi-Va), although the latter was typically located 15m offshore of the former. In addition, xi-Va was observed to be better associated with xD even though xi-Ti is commonly assumed as maximum wave energy dissipation. Significant wave height (Hs) and water level (??) were observed to affect the two types of images in a similar way, with an increase in both Hs and ?? resulting in xi shifting offshore. This ??-induced xi variability has an opposite behavior to what is described in the literature, and is likely an indirect effect of higher waves breaking farther offshore during periods of storm surges. Multiple regression models performed on xi, Hs and ?? allowed the reduction of the residual errors between xb and xi, yielding accurate estimates with most residuals less than 10m. Additionally, it was found that the sandbar position was best estimated using xi-Ti (xi-Va) when xb was located shoreward (seaward) of its mean position, for both the first and the second bar. Although it is unknown whether this is an indirect hydrodynamic effect or is indeed related to the morphology, we found that this

  17. GenBank blastx search result: AK104788 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK104788 001-039-E04 AF310956.2 Enterococcus faecium response regulator (vanRB2), p...rotein histidine kinase (vanSB2), D,D-carboxypeptidase (vanYB2), VanWB2 (vanWB2), D-2-hydroxyacid dehydrogenase (van...HB2), D-alanine:D-lactate ligase (vanB2), and D,D-dipeptidase (vanXB2) genes, complete cds.|BCT BCT 5e-22 +2 ...

  18. GenBank blastx search result: AK104725 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK104725 001-038-B08 AF310956.2 Enterococcus faecium response regulator (vanRB2), p...rotein histidine kinase (vanSB2), D,D-carboxypeptidase (vanYB2), VanWB2 (vanWB2), D-2-hydroxyacid dehydrogenase (van...HB2), D-alanine:D-lactate ligase (vanB2), and D,D-dipeptidase (vanXB2) genes, complete cds.|BCT BCT 3e-16 +1 ...

  19. GenBank blastx search result: AK111921 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK111921 001-013-A10 AF310956.2 Enterococcus faecium response regulator (vanRB2), p...rotein histidine kinase (vanSB2), D,D-carboxypeptidase (vanYB2), VanWB2 (vanWB2), D-2-hydroxyacid dehydrogenase (van...HB2), D-alanine:D-lactate ligase (vanB2), and D,D-dipeptidase (vanXB2) genes, complete cds.|BCT BCT 6e-12 +1 ...

  20. Thermophysical Properties of Ammonium-Based Bis{(trifluoromethyl)sulfonyl}imide Ionic Liquids: Volumetric and Transport Properties

    Czech Academy of Sciences Publication Activity Database

    Machanová, Karolina; Boisset, A.; Sedláková, Zuzana; Anouti, M.; Bendová, Magdalena; Jacquemin, J.

    2012-01-01

    Roč. 57, č. 8 (2012), s. 2227-2235. ISSN 0021-9568. [European Conference on Thermophysical Properties /19./. Thessaloniki, 28.08.2011-01.09.2011] R&D Projects: GA ČR GP203/09/P141; GA MŠk(CZ) MEB021009 Grant ostatní: Égide PHC(FR) 22000XB Institutional support: RVO:67985858 Keywords : ionic liquids * density * transport properties Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.004, year: 2012

  1. Disease: H00880 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available e deaminase acting on the RNA 1 gene (ADAR1). Skin and conne...IM: 127400 PMID:16882194 (description, gene) Liu Y, Xiao SX, Peng ZH, Lei XB, Wang JM, Li Y, Li XL Two frame...shift mutations of the double-stranded RNA-specific adenosine deaminase gene in Chin...(DSH) is a pigmentary genodermatosis of autosomal dominant inheritance. It presents in infancy or early childhood as a mi...ctive tissue disease hsa04623(103) Cytosolic DNA-sensing pathway ADAR [HSA:103] [KO:K12968] MeSH: C535729 OM

  2. Existence of positive solutions for generalized Lyapunov equations via a coupled fixed point theorem

    CERN Document Server

    Berzig, Maher

    2012-01-01

    We consider the generalized continuous-time Lyapunov equation: $$ A^*XB + B^*XA =-Q, $$ where $Q$ is an $N\\times N$ Hermitian positive definite matrix and $A,B$ are arbitrary $N\\times N$ matrices. Under some conditions, using the coupled fixed point theorem of Bhaskar and Lakshmikantham, we establish the existence and uniqueness of Hermitian positive definite solution for such equation. Moreover, we provide an iteration method to find convergent sequences which converge to the solution if one exists.

  3. Proton and Neutron Momentum Distributions in A = 3 Asymmetric Nuclei

    CERN Document Server

    Hen, O; Gilad, S; Boeglin, W

    2014-01-01

    A proposal approved by the Jefferson Lab (JLab) PAC to study the proton-to-neutron momentum distribution ratio in A=3 nuclei via (e,e'p) scattering off 3He and 3H mirror nuclei. The experiment will measure the 3H(e,e'p) and 3He(e,e'p) cross-sections and cross-section ratios at Q2 = 2 and xB>1 kinematics, over a missing momentum range of 0 - 450 MeV/c. The experiment was approved in 2014 at part of the JLab Hall-A Tritium run period for a total run time of 12 days.

  4. The emergence of new DNA repeats and the divergence of primates.

    OpenAIRE

    Minghetti, P P; Dugaiczyk, A

    1993-01-01

    We have identified four genetic novelties that are fixed in specific primate lineages and hence can serve as phylogenetic time markers. One Alu DNA repeat is present in the human lineage but is absent from the great apes. Another Alu DNA repeat is present in the gorilla lineage but is absent from the human, chimpanzee, and orangutan. A progenitor Xba1 element is present in the human, chimpanzee, gorilla, and orangutan, but only in the human lineage did it give rise to a transposed progeny, Xb...

  5. Deeply Virtual Compton Scattering off the neutron

    International Nuclear Information System (INIS)

    The present experiment exploits the interference between the Deeply Virtual Compton Scattering (DVCS) and the Bethe-Heitler processes to extract the imaginary part of DVCS amplitudes on the neutron and on the deuteron from the helicity-dependent D((rvec e), e'γ)X cross section measured at Q2=1.9 GeV2 and xB=0.36. We extract a linear combination of generalized parton distributions (GPDs) particularly sensitive to Eq, the least constrained GPD. A model dependent constraint on the contribution of the up and down quarks to the nucleon spin is deduced

  6. Diphoton Rate of the Standard-Model-Like Higgs Boson in the Extra U(1) Extended MSSM

    OpenAIRE

    Cheung, Kingman; Lu, Chih-Ting; Yuan, Tzu-Chiang

    2012-01-01

    Motivated by the excess in the diphoton production rate of the Higgs boson at the Large Hadron Collider (LHC), we investigate the possibility that one of the CP-even Higgs bosons of the extra U(1) extended minimal supersymmetric standard model can give a consistent result. We scan the parameter space for a standard-model-like Higgs boson such that the mass is in the range of 124-127 GeV and the production rate \\sigma xB of the WW*, ZZ* modes are consistent with the standard model (SM) values ...

  7. A new evolution equation

    International Nuclear Information System (INIS)

    A new evolution equation is proposed for the gluon density relevant (GLR) for the region of small xB. It generalizes the GLR equation and allows deeper penetration in dense parton systems than the GLR equation does. This generalization consists of taking shadowing effects more comprehensively into account by including multi gluon correlations, and allowing for an arbitrary initial gluon distribution in a hadron. We solve the new equation for fixed αs. It is found that the effects of multi gluon correlations on the deep-inelastic structure function are small. (author) 15 refs, 5 figs, 2 tabs

  8. Open charm and beauty production at HERA

    International Nuclear Information System (INIS)

    Selected new results from the H1 and ZEUS collaborations on ep interactions at 300-318 GeV centre-of-mass energy are presented. The full pre-upgrade integrated luminosity of HERA of 110 pb-1 is used. Charm cross sections are measured up to high values of xB and Q2 and are found to be well described by NLO QCD in the 3 flavour scheme. Orbitally excited D mesons are observed; radial excitations are searched for, but are not seen. The first b cross section measurement is confirmed with a lifetime based method, establishing the excess over NLO QCD. (author)

  9. A study of accretion discs around rapidly rotating neutron stars in general relativity and its applications to four low mass X-ray binaries

    Science.gov (United States)

    Bhattacharyya, Sudip

    2002-02-01

    We calculate the accretion disc temperature profiles, disc luminosities and boundary layer luminosities for rapidly rotating neutron stars considering the full effect of general relativity. We compare the theoretical values of these quantities with their values inferred from EXOSAT data for four low mass X-ray binary sources: XB 1820-30, GX 17+2, GX 9+1 and GX 349+2 and constrain the values of several properties of these sources. According to our calculations, the neutron stars in GX 9+1 and GX 349+2 are rapidly rotating and stiffer equations of state are unfavoured.

  10. Deeply Virtual Compton Scattering off the neutron

    CERN Document Server

    Mazouz, M; Ferdi, C; Gavalian, G; Kuchina, E; Amarian, M; Aniol, K A; Beaumel, M; Benaoum, H; Bertin, P; Brossard, M; Chen, J P; Chudakov, E; Craver, B; Cusanno, F; De Jager, C W; Deur, A; Feuerbach, R; Fieschi, J M; Frullani, S; Garçon, M; Garibaldi, F; Gayou, O; Gilman, R; Gómez, J; Gueye, P; Guichon, P A M; Guillon, B; Hansen, O; Hayes, D; Higinbotham, D; Holmstrom, T; Hyde, C E; Ibrahim, H; Igarashi, R; Jiang, X; Jo, H S; Kaufman, L J; Kelleher, A; Kolarkar, A; Kumbartzki, G; Laveissière, G; Le Rose, J J; Lindgren, R; Liyanage, N; Lu, H J; Margaziotis, D J; Meziani, Z E; McCormick, K; Michaels, R; Michel, B; Moffit, B; Monaghan, P; Nanda, S; Nelyubin, V; Potokar, M; Qiang, Y; Ransome, R D; Real, J S; Reitz, B; Roblin, Y; Roche, J; Sabatie, F; Saha, A; Sirca, S; Slifer, K; Solvignon, P; Subedi, R; Sulkosky, V; Ulmer, P E; Voutier, E; Wang, K; Weinstein, L B; Wojtsekhowski, B; Zheng, X; Zhu, L

    2007-01-01

    The present experiment exploits the interference between the Deeply Virtual Compton Scattering (DVCS) and the Bethe-Heitler processes to extract the imaginary part of DVCS amplitudes on the neutron and on the deuteron from the helicity-dependent D$({\\vec e},e'\\gamma)X$ cross section measured at $Q^2$=1.9 GeV$^2$ and $x_B$=0.36. We extract a linear combination of generalized parton distributions (GPDs) particularly sensitive to $E_q$, the least constrained GPD. A model dependent constraint on the contribution of the up and down quarks to the nucleon spin is deduced.

  11. Spectrophotometric determination of Mercury (II by simultaneous micelle mediated extraction through ternary complex formation in water samples

    Directory of Open Access Journals (Sweden)

    Farzin Nekouei

    2014-06-01

    Full Text Available In this study, a micelle mediated extraction procedure for preconcentration of trace quantities of Hg(II as a prior step to its simultaneous spectrophotometric determination has been developed. The method is based on a ternary ion-association of Hg(II, Xylidyl Blue (XB and cationic surfactant (CTAB. Major factors affecting the efficiency of the method has been studied. The limit of detection (LOD under optimum conditions based on 3Sb was 4.65 ng mL-1. The proposed method has been applied for determination of trace amount of mercury in water samples with satisfactory results.

  12. Halogen-bonding in a new family of tris(haloanilato)metallate(III) magnetic molecular building blocks.

    Science.gov (United States)

    Atzori, Matteo; Artizzu, Flavia; Sessini, Elisa; Marchiò, Luciano; Loche, Danilo; Serpe, Angela; Deplano, Paola; Concas, Giorgio; Pop, Flavia; Avarvari, Narcis; Mercuri, Maria Laura

    2014-05-21

    Here we report on new tris(haloanilato)metallate(III) complexes with general formula [A]3[M(X2An)3] (A = (n-Bu)4N(+), (Ph)4P(+); M = Cr(III), Fe(III); X2An = 3,6-dihalo derivatives of 2,5-dihydroxybenzoquinone (H4C6O4), chloranilate (Cl2An(2-)), bromanilate (Br2An(2-)) and iodanilate (I2An(2-))), obtained by a general synthetic strategy, and their full characterization. The crystal structures of these Fe(III) and Cr(III) haloanilate complexes consist of anions formed by homoleptic complexes formulated as [M(X2An)3](3-) and (Et)3NH(+), (n-Bu)4N(+), or (Ph4)P(+) cations. All complexes exhibit octahedral coordination geometry with metal ions surrounded by six oxygen atoms from three chelate ligands. These complexes are chiral according to the metal coordination of three bidentate ligands, and both Λ and Δ enantiomers are present in their crystal lattice. The packing of [(n-Bu)4N]3[Cr(I2An)3] (5a) shows that the complexes form supramolecular dimers that are held together by two symmetry related I···O interactions (3.092(8) Å), considerably shorter than the sum of iodine and oxygen van der Waals radii (3.50 Å). The I···O interaction can be regarded as a halogen bond (XB), where the iodine behaves as the XB donor and the oxygen atom as the XB acceptor. This is in agreement with the properties of the electrostatic potential for [Cr(I2An)3](3-) that predicts a negative charge accumulation on the peripheral oxygen atoms and a positive charge accumulation on the iodine. The magnetic behaviour of all complexes, except 5a, may be explained by considering a set of paramagnetic non-interacting Fe(III) or Cr(III) ions, taking into account the zero-field splitting effect. The presence of strong XB interactions in 5a are able, instead, to promote antiferromagnetic interactions among paramagnetic centers at low temperature, as shown by the fit with the Curie-Weiss law, in agreement with the formation of halogen-bonded supramolecular dimers. PMID:24626345

  13. Gamma-ray attenuation coefficients in bismuth borate glasses

    International Nuclear Information System (INIS)

    Mass attenuation coefficients of glasses in the system: xBi2O3(1-x)B2O3 (x=0.30, 0.35, 0.40, 0.45 and 0.55) were determined at 356, 662, 1173 and 1332 keV photon energies using a narrow beam transmission method. Appreciable variations were observed in these coefficients due to changes in the chemical composition of glasses. These coefficients were then used to determine effective atomic numbers of glass samples, which were found to be constant with bismuth concentration and energy

  14. Generalized parton distributions and Deeply Virtual Compton Scattering in Color Glass Condensate model

    OpenAIRE

    Goeke, K.; Guzey, V.; Siddikov, M.

    2008-01-01

    Within the framework of the Color Glass Condensate model, we evaluate quark and gluon Generalized Parton Distributions (GPDs) and the cross section of Deeply Virtual Compton Scattering (DVCS) in the small-$x_{B}$ region. We demonstrate that the DVCS cross section becomes independent of energy in the limit of very small $x_{B}$, which clearly indicates saturation of the DVCS cross section. Our predictions for the GPDs and the DVCS cross section at high-energies can be tested at the future Elec...

  15. Bismuth and zinc double borate in Bi2O3-B2O3-ZnO system

    International Nuclear Information System (INIS)

    On the basis of DTA and X-ray phase analysis data phase diagram of 2Bi2O3xB2O3-ZnO system is plotted. Bismuth and zinc double borate 2Bi2O3xZnOxB2O3 is stated to be formed. It belongs to a monoclinic crystal system. All elementary cell parameters: a=16.43(8), b=10.27(6), c=5.607(3) A, β=95 ± 1, z=4 are determined

  16. Dosimetric comparison between VMAT with different dose calculation algorithms and protons for soft-tissue sarcoma radiotherapy

    Energy Technology Data Exchange (ETDEWEB)

    Fogliata, Antonella [Oncology Inst. of Southern Switzerland, Medical Physics Unit, Bellinzona (Switzerland)], e-mail: Antonella.Fogliata-Cozzi@eoc.ch; Scorsetti, Marta; Navarria, Piera [IRCCS Instituto Clinico Humanitas, Radiation Oncology, Rozzano, Milan (Italy)] [and others

    2013-04-15

    Background: To appraise the potential of volumetric modulated arc therapy (VMAT, RapidArc) and proton beams to simultaneously achieve target coverage and enhanced sparing of bone tissue in the treatment of soft-tissue sarcoma with adequate target coverage. Material and methods: Ten patients presenting with soft-tissue sarcoma of the leg were collected for the study. Dose was prescribed to 66.5 Gy in 25 fractions to the planning target volume (PTV) while significant maximum dose to the bone was constrained to 50 Gy. Plans were optimised according to the RapidArc technique with 6 MV photon beams or for intensity modulated protons. RapidArc photon plans were computed with: 1) AAA; 2) Acuros XB as dose to medium; and 3) Acuros XB as dose to water. Results: All plans acceptably met the criteria of target coverage (V{sub 95%} >90-95%) and bone sparing (D{sub 1cm}{sup 3} <50 Gy). Significantly higher PTV dose homogeneity was found for proton plans. Near-to-maximum dose to bone was similar for RapidArc and protons, while volume receiving medium/low dose levels was minimised with protons. Similar results were obtained for the remaining normal tissue. Dose distributions calculated with the dose to water option resulted 5% higher than corresponding ones computed as dose to medium. Conclusion: High plan quality was demonstrated for both VMAT and proton techniques when applied to soft-tissue sarcoma.

  17. Bottom-flavored hadrons from top-quark decay at next-to-leading order in the general-mass variable-flavor-number scheme

    International Nuclear Information System (INIS)

    We study the scaled-energy (xB) distribution of bottom-flavored hadrons (B) inclusively produced in top-quark decays at next-to-leading order (NLO) in the general-mass variable-flavor-number scheme endowed with realistic, nonperturbative fragmentation functions that are obtained through a global fit to e+e- data from CERN LEP1 and SLAC SLC exploiting their universality and scaling violations. Specifically, we study the effects of gluon fragmentation and finite bottom-quark and B-hadron masses. We find the NLO corrections to be significant. Gluon fragmentation leads to an appreciable reduction in the partial decay width at low values of xB. Hadron masses are responsible for the low-xB threshold, while the bottom-quark mass is of minor importance. Neglecting the latter, we also study the doubly differential distribution d2Γ/(dxBdcosθ) of the partial width of the decay t→bW+→Bℓ+νℓ+X, where θ is the decay angle of the charged lepton in the W-boson rest frame.

  18. Population Synthesis for Symbiotic X-ray Binaries

    CERN Document Server

    Lu, G -L; Postnov, K A; Yungelson, L R; Kuranov, A G; Wang, N

    2012-01-01

    Symbiotic X-ray binaries (SyXBs) comprise a rare class of low-mass X-ray binaries. We study the Galactic SyXBs, which we consider as detached binaries composed of low-mass giants and wind-fed neutron star companions, by simulation of the interaction of a magnetized neutron star (NS) with its environment and utilizing a population synthesis code. We focus mainly on the parameters that influence observational appearance of the SyXB: the donor wind velocity (vw) and the angular momentum distribution in the shell of matter settling onto NS. We estimate the birthrate of SyXB as $\\sim 4.1\\times 10^{-5}$ yr$^{-1}$ to $ \\sim 6.6\\times 10^{-6}$ yr$^{-1}$ and their number in the Galaxy as $\\sim$(100 -- 1000). Assumed stellar wind velocity from cool giants is the input parameter that influences the model SyXBs population most. Among known SyXBs or candidate systems, 4U 1954+31 and IGR J16358-4724 in which NS have very long spin periods may host quasi-spherically accreting NSs. GX 1+4 has a peculiar long-term spin behavi...

  19. Empirical potential study of the dissociative chemisorption of Si2H6 on the Si(001)2x1 surface

    International Nuclear Information System (INIS)

    Full text: Two models have been proposed for the epitaxial growth of silicon on the Si(001)2x1 surface from the dissociation of disilane (Si2H6). Molecular dynamics simulations and potential energy calculations have been performed to investigate this dissociative chemisorption process. These calculations have been carried out using the extended Brenner (XB) empirical potential. The minimum energy atomic configurations for SiH3, SiH2 and H-Si-Si-H (Si2H2) species chemisorbed on the Si(001)2x1 surface have been determined. The chemisorption of SiH3 radicals has been observed to occur predominantly at the dangling bond sites of the Si(001) surface. The most stable SiH2 configurations are found to be the on-dimer and intra-row structures. Seven different Si2H2 chemisorption structures have been investigated and the on-dimer-B structure found to be the most energetically favourable. These theoretically predicted structures are discussed in the light of recent experimental studies and the proposed models for silicon epitaxial growth. Comparison of the results of these XB potential energy calculations with all-electron ab initio cluster calculations has also been made for a number of these different chemisorption structures

  20. Effect of Mg content on the density and critical properties of in-situ reacted MgB2 bulk superconductor

    International Nuclear Information System (INIS)

    The effects of Mg content on the pore formation, density and critical properties were investigated in in-situ reacted MgB2 superconductors. The Mg1+xB2, (x=-0.2, 0.0, 0.05, 0.3, 1.0) bulk samples with different Mg contents were heat-treated at 900 degrees C for 1 h in an Ar atmosphere. The dimensional changes of a pellet's mass and volume after heat-treatment were measured. After heat-treatment process, the sample mass was decreased by Mg evaporation, but the sample volume was expanded by pore formation at the Mg site; therefore, the apparent density was decreased. Spherical pores the same as Mg particles were developed after heat-treatment in all samples, and the pore density was increased with increasing Mg content. As the x of Mg content was increased to 1.0, the apparent density of Mg1+xB2 samples was decreased due to a relatively larger reduction in a mass change. The critical current density of Mg excessive sample of x=0.05 showed the highest values over the applied magnetic fields because the excessive Mg may compensate Mg loss and enhance grain connectivity

  1. Study of semi-leptonic decay of B meson, in the ways lvD* and lvD with ALEPH detector at LEP: measurement of the fragmentation function of b quark and search for D** states

    International Nuclear Information System (INIS)

    This work is dedicated to the measurement of the fragmentation function of the quark b, with the ALEPH detector, at LEP. The main aspects of this measure is to be as independent as possible from any model. For this, we reconstruct the semi-leptonic decay modes of the B meson, in the ways lvD deg., lvD*+ and lvD+. In a first step, we describe the criteria used to select those modes. Then, we determine the fragmentation function by measuring the ratio XB = 2 EB / √ S, where EB is the B meson energy and √ s/2 the useful energy in the center of mass. The measure of EB needs a precise reconstruction of the neutrino energy, which is not detected. We present here the method that we used for this reconstruction. Once the acceptance correction is applied, we obtain, for the variable XB, a distribution with mean value: B > = 0.711 ± 0.009 (stat). To be as independent as possible of the model (Peterson function) used n the Monte-Carlo determination of the acceptance, we do an iterative calculation of the acceptance. We obtain B> = 0.712 ± 0.009(stat) ± 0.017 (syst). Furthermore, this measure depends of the D** contribution, badly known for now. Therefore, we search this contribution, using the events selected before, on the one hand by a direct observation, on the other hand by reconstructing the mass of the B meson. (author)

  2. Bottom-flavored hadrons from top-quark decay at next-to-leading order in the general-mass variable-flavor-number scheme

    International Nuclear Information System (INIS)

    We study the scaled-energy (xB) distribution of bottom-flavored hadrons (B) inclusively produced in top-quark decays at next-to-leading order (NLO) in the general-mass variable-flavor-number scheme endowed with realistic, nonperturbative fragmentation functions that are obtained through a global fit to e+e- data from CERN LEP1 and SLAC SLC exploiting their universality and scaling violations. Specifically, we study the effects of gluon fragmentation and finite bottom-quark and B-hadron masses. We find the NLO corrections to be significant. Gluon fragmentation leads to an appreciable reduction in the partial decay width at low values of xB. Hadron masses are responsible for the low-xB threshold, while the bottom-quark mass is of minor importance. Neglecting the latter, we also study the doubly differential distribution d2Γ/(dxBd cos θ) of the partial width of the decay t→ bW+ → Bl+νl+X, where θ is the decay angle of the charged lepton in the W-boson rest frame.

  3. Spectroscopy of mesonic molecules with heavy-light flavour mesons

    CERN Document Server

    Rathaud, D P

    2016-01-01

    In this work, we have calculated the mass spectra and decay properties of dimesonic (meson-antimeson) bound state in the variational scheme. The intermesonic interaction considered as the Hellmann potential and One Pion Exchange potential. The mass spectra of the $D\\bar{D^{*}}$, $D\\bar{D_{s}^{*}}$, $D_{s}\\bar{D^{*}}$, $D_{s}\\bar{D_{s}^{*}}$, $D^{*}\\bar{D^{*}}$, $D_{s}^{*}\\bar{D_{s}^{*}}$, $D\\bar{B^{*}}$, $D\\bar{B_{s}^{*}}$, $D_{s}\\bar{B^{*}}$, $D_{s}\\bar{B_{s}^{*}}$, $B^{*}\\bar{D}$,$B^{*}\\bar{D_{s}}$, $B\\bar{B^{*}}$, $B_{s}\\bar{B^{*}}$, $B_{c}\\bar{B^{*}}$, $B^{*}\\bar{B^{*}}$, $B^{*}\\bar{B_{s}^{*}}$, $B_{s}^{*}\\bar{B_{s}^{*}}$ etc.. are calculated. The states X(3872), $X_{2c}(4013)$ ,$Z_{b}(10610)/X_{b}$ and $Z_{b}(10650)/X_{b2}$ are compared with $D\\bar{D^{*}}$, $D^{*}\\bar{D^{*}}$, $B\\bar{B^{*}}$ and $B^{*}\\bar{B^{*}}$ dimesonic bound states. To probe the molecular structure of the compared states, we have calculated the decay properties sensitive to their long and short distance structure of hadorinc molecul...

  4. Measurements of gross erosion of Al in the DIII-D divertor

    Energy Technology Data Exchange (ETDEWEB)

    Chrobak, C., E-mail: chrobak@fusion.gat.com [General Atomics, P.O. Box 85608, San Diego, CA 92186-5608 (United States); Stangeby, P.C. [University of Toronto Institute for Aerospace Studies, Toronto M3H 5T6 (Canada); Leonard, A.W. [General Atomics, P.O. Box 85608, San Diego, CA 92186-5608 (United States); Rudakov, D.L. [University of California San Diego, 9500 Gilman Dr., La Jolla, CA 92093-0417 (United States); Wong, C.P.C. [General Atomics, P.O. Box 85608, San Diego, CA 92186-5608 (United States); McLean, A.G. [Lawrence Livermore National Laboratory, 700 East Ave, Livermore, CA 94550 (United States); Wright, G.M. [Massachusetts Institute of Technology, 77 Massachusetts Ave, Cambridge, MA 02139 (United States); Buchenauer, D.A.; Watkins, J.G.; Wampler, W.R. [Sandia National Laboratory, P.O. Box 5800, Albuquerque, NM 87185 (United States); Elder, J.D. [University of Toronto Institute for Aerospace Studies, Toronto M3H 5T6 (Canada); Doerner, R.P.; Nishijima, D.; Tynan, G.R. [University of California San Diego, 9500 Gilman Dr., La Jolla, CA 92093-0417 (United States)

    2015-08-15

    Aluminum (Al) is a convenient proxy for beryllium (Be) plasma material interaction studies since they have a number of physical and chemical similarities. Al samples were exposed at the lower outer strike point of an L-mode divertor plasma in DIII-D (conditions 7–11 × 10{sup 18} D-ions cm{sup −2} s{sup −1}, T{sub e} = 12–47 eV). The gross erosion rate was directly measured using post-mortem ion beam analysis of small 1 mm-sized samples where local re-deposition was determined to be negligible. The gross erosion rate was also calculated using spectroscopic methods, but these rates greatly underestimate the direct (i.e. non-spectroscopic) measurement. The direct measured erosion yields were within the range of published D{sup +} → Al ion beam sputtering yields. The ionizations per photon (S/XB) coefficients used in the spectroscopic analysis were determined in separate experiments using He plasmas at the PISCES-B linear plasma facility at UCSD. The measured S/XB coefficients were on average ∼6× higher than the theoretically calculated values.

  5. K(6S-4P) stimulated emission excited by bound-bound transitions of NaK

    International Nuclear Information System (INIS)

    The stimulated fluorescence emission in potassium atom excited by hybrid transitions involving heteronuclear molecules has been studied by a wavelength tunable pump laser. The emission lines are identified as 691.1 nm and 693.9 nm (6S-4P1/2,3/2) transitions. The stimulated character is confirmed by measurements of threshold, exponential increase and high intensity as well as temporal and polarization properties. The origin of the stimulated emission are both Four Wave Parametric Emission and Amplified Spontaneous Emission, with the first one dominant as indicated by intensity and temporal measurements. The main excitation mechanism is shown to be bound-bound NaK (X-B) transitions. This is confirmed by the absence of signal in pure potassium vapour, coincidence of excitation lines with NaK (X-B) bound-bound transitions in the excitation and absorption spectra. The fluorescence spectra have been also identified as NaK (B-X). The process observed proceeds via hybrid resonances. The measured exponential gain factor of the signal is γEp-6.6. Using this process the rate of energy transfer NaK(B) → K(4P), K7s = 8.8x10-9 cm3s-1 and K5d 1.6x10-10 cm3s-1 has been estimated. (author)

  6. Deep exclusive $\\pi^+$ electroproduction off the proton at CLAS

    CERN Document Server

    Park, K; Guidal, M; Laget, J M; Adhikari, K P; Aghasyan, M; Amaryan, M J; Anghinolfi, M; Avakian, H; Baghdasaryan, H; Ball, J; Baltzell, N A; Battaglieri, M; Bedlinsky, I; Bennett, R P; Biselli, A S; Bookwalter, C; Boiarinov, S; Briscoe, W J; Brooks, W K; Burkert, V B; Carman, D S; Celentano, A; Chandavar, S; Charles, G; Contalbrigo, M; D'Angelo, A; Daniel, A; Dashyan, N; De Vita, R; De Sanctis, E; Deur, A; Djalali, C; Dodge, G E; Doughty, D; Dupre, R; Egiyan, H; Alaoui, A El; Fassi, L El; Eugenio, P; Fedotov, G; Fegan, S; Fleming, J A; Forest, T A; Gar{\\c}con, M; Gevorgyan, N; Gilfoyle, G P; Giovanetti, K L; Girod, F X; Gohn, W; Golovatch, E; Graham, L; Griffioen, K A; Guegan, B; Guo, L; Hafidi, K; Hakobyan, H; Hanretty, C; Heddle, D; Hicks, K; Ho, D; Holtrop, M; Ilieva, Y; Ireland, D G; Ishkhanov, B S; Jenkins, D; Jo, H S; Keller, D; Khandaker, M; Khetarpal, P; Kim, A; Kim, W; Klein, F J; Koirala, S; Kubarovsky, A; Kubarovsky, V; Kuhn, S E; Kuleshov, S V; Livingston, K; Lu, H Y; MacGregor, I J D; Mao, Y; Markov, N; Martinez, D; Mayer, M; McKinnon, B; Meyer, C A; Mineeva, T; Mirazita, M; Mokeev, V; Moutarde, H; Munevar, E; Camacho, C Munoz; Nadel-Turonski, P; Nepali, C S; Niccolai, S; Niculescu, G; Niculescu, I; Osipenko, M; Ostrovidov, A I; Pappalardo, L L; Paremuzyan, R; Park, S; Pasyuk, E; Pereira, S Anefalos; Phelps, E; Pisano, S; Pogorelko, O; Pozdniakov, S; Price, J W; Procureur, S; Protopopescu, D; Puckett, A J R; Raue, B A; Ricco, G; Rimal, D; Ripani, M; Rosner, G; Rossi, P; Sabatie, F; Saini, M S; Salgado, C; Schott, D; Schumacher, R A; Seder, E; Seraydaryan, H; Sharabian, Y G; Smith, E S; Smith, G D; Sober, D I; Sokhan, D; Stepanyan, S S; Stoler, P; Strakovsky, I I; Strauch, S; Taiuti, M; Tang, W; Taylor, C E; Tian, Ye; Tkachenko, S; Trivedi, A; Ungaro, M; Vernarsky, B; Voskanyan, H; Voutier, E; Walford, N K; Watts, D P; Weinstein, L B; Weygand, D P; Wood, M H; Zachariou, N; Zhang, J; Zhao, Z W; Zonta, I

    2012-01-01

    The exclusive electroproduction of $\\pi^+$ above the resonance region was studied using the $\\rm{CEBAF}$ Large Acceptance Spectrometer ($\\rm{CLAS}$) at Jefferson Laboratory by scattering a 6-GeV continuous electron beam off a hydrogen target. The large acceptance and good resolution of $\\rm{CLAS}$, together with the high luminosity, allowed us to measure the cross section for the $\\gamma^* p \\to n \\pi^+$ process in 140 ($Q^2$, $x_B$, $t$) bins: $0.16<x_B<0.58$, 1.6 GeV$^2<$$Q^2$$<4.5$ GeV$^2$ and 0.1 GeV$^2<$$-t$$<5.3$ GeV$^2$. For most bins, the statistical accuracy is on the order of a few percent. Differential cross sections are compared to two theoretical models, based either on hadronic (Regge phenomenology) or on partonic (handbag diagram) degrees of freedom. Both can describe the gross features of the data reasonably well, but differ strongly in their ingredients. If the handbag approach can be validated in this kinematical region, our data contain the interesting potential to experim...

  7. High-pressure rare earth silicates: Lanthanum silicate with barium phosphate structure, holmium silicate apatite, and lutetium disilicate type X

    International Nuclear Information System (INIS)

    The phase relations of a wide selection of rare earth disilicates have been investigated up to 10 GPa and 1700 deg. C using piston cylinder and multi-anvil equipment. Single-crystal X-ray structures have been obtained for the following high-pressure phases: (1) La2.67(SiO4)2: monoclinic, space group C2/m, Z=2, a=9.419(2), b=5.445(1), c=7.214(1) A, β=115.71(3)o, R=0.042; disordered Ba3(PO4)2 structure type, with 3xb and 7xb superstructures identified. (2) Ho8.67(SiO4)6(OH)2: hexagonal, P63/m, Z=1, a=9.3221(4), c=6.7347(2) A, R=0.026; silicate hydroxyapatite. (3) Lu2Si2O7: tetragonal, P41212, Z=4, a=6.5620(2), c=11.9535(4) A, R=0.023; type X diorthosilicate structure, and the silicate analogue of tetragonal Er2Ge2O7

  8. The Tb-Re-B system: Phase equilibria and crystal structures

    International Nuclear Information System (INIS)

    The phase diagram at 1270 K of the Tb-Re-B system is constructed by X-ray analysis. The existence of the earlier known compounds is confirmed: Tb3ReB7 (Er3CrB7 structure type), TbReB4 (YCrB4 structure type, refined lattice parameters a = 5.9776(4), b = 11.5640(9), c = 3.6058(3) A) and Tb2ReB6 (Y2ReB6 structure type, refined lattice parameters a = 9.206(4), b = 11.56094), c = 3.669(1) A). New ternary compounds are found and their crystal structure are determined: Tb8Re13-xB12 (DRON-3M powder diffractometer, R3m space group, Pr8Re13-xB12 structure type, a 10.6233(6), c = 14.318(1) A, Nhkl = 286, R =0.095) and TbεRe4B4 (a single crystal method, the tetragonal incommensurate structure, a 10.624(9), c = 38.29(9) A). (author)

  9. Dosimetric comparison between VMAT with different dose calculation algorithms and protons for soft-tissue sarcoma radiotherapy

    International Nuclear Information System (INIS)

    Background: To appraise the potential of volumetric modulated arc therapy (VMAT, RapidArc) and proton beams to simultaneously achieve target coverage and enhanced sparing of bone tissue in the treatment of soft-tissue sarcoma with adequate target coverage. Material and methods: Ten patients presenting with soft-tissue sarcoma of the leg were collected for the study. Dose was prescribed to 66.5 Gy in 25 fractions to the planning target volume (PTV) while significant maximum dose to the bone was constrained to 50 Gy. Plans were optimised according to the RapidArc technique with 6 MV photon beams or for intensity modulated protons. RapidArc photon plans were computed with: 1) AAA; 2) Acuros XB as dose to medium; and 3) Acuros XB as dose to water. Results: All plans acceptably met the criteria of target coverage (V95% >90-95%) and bone sparing (D1cm3 <50 Gy). Significantly higher PTV dose homogeneity was found for proton plans. Near-to-maximum dose to bone was similar for RapidArc and protons, while volume receiving medium/low dose levels was minimised with protons. Similar results were obtained for the remaining normal tissue. Dose distributions calculated with the dose to water option resulted 5% higher than corresponding ones computed as dose to medium. Conclusion: High plan quality was demonstrated for both VMAT and proton techniques when applied to soft-tissue sarcoma

  10. Modeling of plasma distortions by laser-induced ablation spectroscopy (LIAS) and implications for the interpretation of LIAS measurements

    Science.gov (United States)

    Tokar, M. Z.; Gierse, N.; Philipps, V.; Samm, U.

    2015-09-01

    For the interpretation of the line radiation observed from laser induced ablation spectroscopy (LIAS) such parameters as the density and temperature of electrons within very compact clouds of atoms and singly charged ions of ablated material have to be known. Compared to the local plasma conditions prior to the laser pulse, these can be strongly changed during LIAS since new electrons are generated by the ionisation of particles ejected from the irradiated target. Because of their transience and spatial inhomogeneity it is technically difficult to measure disturbances induced in the plasma by LIAS. To overcome this uncertainty a numerical model has been elaborated, providing a self-consistent description for the spreading of ablated particles and accompanying modifications in the plasma. The results of calculations for LIAS performed on carbon-containing targets in Ohmic and additionally heated discharges in the tokamak TEXTOR are presented. Due to the increase in the electron density the ‘ionisation per photon’ ratio, S/XB factor, is significantly enhanced compared to unperturbed plasma conditions. The impact of the amount of material ablated and of the plasma conditions before LIAS on the level of the S/XB-enhancement is investigated.

  11. Dynamics of cross-bridge cycling, ATP hydrolysis, force generation, and deformation in cardiac muscle.

    Science.gov (United States)

    Tewari, Shivendra G; Bugenhagen, Scott M; Palmer, Bradley M; Beard, Daniel A

    2016-07-01

    Despite extensive study over the past six decades the coupling of chemical reaction and mechanical processes in muscle dynamics is not well understood. We lack a theoretical description of how chemical processes (metabolite binding, ATP hydrolysis) influence and are influenced by mechanical processes (deformation and force generation). To address this need, a mathematical model of the muscle cross-bridge (XB) cycle based on Huxley's sliding filament theory is developed that explicitly accounts for the chemical transformation events and the influence of strain on state transitions. The model is identified based on elastic and viscous moduli data from mouse and rat myocardial strips over a range of perturbation frequencies, and MgATP and inorganic phosphate (Pi) concentrations. Simulations of the identified model reproduce the observed effects of MgATP and MgADP on the rate of force development. Furthermore, simulations reveal that the rate of force re-development measured in slack-restretch experiments is not directly proportional to the rate of XB cycling. For these experiments, the model predicts that the observed increase in the rate of force generation with increased Pi concentration is due to inhibition of cycle turnover by Pi. Finally, the model captures the observed phenomena of force yielding suggesting that it is a result of rapid detachment of stretched attached myosin heads. PMID:25681584

  12. Is the decrease of the total electron energy density a covalence indicator in hydrogen and halogen bonds?

    Science.gov (United States)

    Angelina, Emilio L; Duarte, Darío J R; Peruchena, Nélida M

    2013-05-01

    In this work, halogen bonding (XB) and hydrogen bonding (HB) complexes were studied with the aim of analyzing the variation of the total electronic energy density H(r b ) with the interaction strengthening. The calculations were performed at the MP2/6-311++G(2d,2p) level of approximation. To explain the nature of such interactions, the atoms in molecules theory (AIM) in conjunction with reduced variational space self-consistent field (RVS) energy decomposition analysis were carried out. Based on the local virial theorem, an equation to decompose the total electronic energy density H(r b ) in two energy densities, (-G(r b )) and 1/4∇(2)ρ(r b ), was derived. These energy densities were linked with the RVS interaction energy components. Through the connection between both decomposition schemes, it was possible to conclude that the decrease in H(r b ) with the interaction strengthening observed in the HB as well as the XB complexes, is mainly due to the increase in the attractive electrostatic part of the interaction energy and in lesser extent to the increase in its covalent character, as is commonly considered. PMID:23187685

  13. Optical Properties of Eu3+ Doped Lead Borate Tellurite and Zinc Borate Tellurite Glasses

    Science.gov (United States)

    Shigihalli, N. B.; Rajaramakrishna, R.; Anavekar, R. V.

    2011-07-01

    This paper describes the synthesis and optical absorption studies of the glass system 20PbO-20TeO2-(60-x)B2O3-x Eu2O3 (x = 0,1 mol %) and 20ZnO-20TeO2-(60-x)B2O3-xEu2O3 (x = 0,1 mol %). These glass systems have been successfully prepared by the melt quenching technique. The X-ray diffractograms show broad peaks indicating glasses are amorphous. DSC thermograms show glass transition temperatures around 655K for PbO content and around 675 K for ZnO content glass samples. In the UV-Visible spectra, several absorption lines are observed. The absorption peaks are around 362, 375, 393 and 464 nm for both Eu3+ doped PbO and ZnO content glass systems. These correspond to transitions from ground state of 7F0 to the excited state of 5D4, 5G4, 5L6 and 5D2 respectively for both Eu3+ doped PbO and ZnO content glass systems. These glasses are expected to give interesting applications in the area of optical devices.

  14. Optical and structural properties of ZnO-PbO-B2O3 and ZnO-PbO-B2O3-SiO2 glasses

    International Nuclear Information System (INIS)

    Borate and borosilicate glasses with compositions of xZnO-2xPbO-(1-3x)B2O3 and xZnO-2xPbO-1/2(1-3x)B2O3-1/2(1-3x)SiO2 with x varying from 0.1 to 0.26 mole fraction were prepared by the conventional melt quench technique. Optical and structural properties have been determined by using ultraviolet-visible (UV/vis) and Fourier transform infrared (FTIR) spectroscopic techniques. Decreases in the band gap from 3.57 to 2.62 eV for borate glasses and from 3.00 to 2.35 eV for borosilicate glasses with an increase in the metal oxide content is observed. The density and molar volume has also been measured. Increases in density from 3.994 to 6.339 g cm-3 for borate and from 4.221 to 6.548 g cm-3 for borosilicate glasses are observed with an increase in metal oxide (PbO, ZnO or PbO+ZnO) content. Changes in the atomic structure with composition are observed due to the formation of BO4- units

  15. Evolution of surfaces properties for 100Cr6 steel by implantation and ionic mixing; Evolution des proprietes de surface de l`acier 100Cr6 par implantation et melange ioniques

    Energy Technology Data Exchange (ETDEWEB)

    Faussemagne, A.

    1996-07-09

    Physico-chemical characterizations performed on samples of 100Cr6 steel implanted both with boron and nitrogen revealed the formation of boron nitride along with the following new phases: Fe{sub 1-x}(B, N), Fe{sub 2-x}(B, N) and Fe{sub 3-x}(B, N). A thorough analysis of boron NITRIDE (5BN) indicates that a low ion current density (3 {mu}A.cm{sup -2}) in the case of the boron plus nitrogen sequence favours the formation of sp{sup 2} bonds (hexagonal-BN) while a higher ion current density (6{mu}A.cm{sup -2}) promotes sp{sup 3} bonds (cubic-BN) in the opposite sequence. Tribological tests carried out on these samples revealed that nitrogen and boron implantations do not lead to any significant improvement of friction and wear at variance with the results obtained by others authors. However, on a set samples accidentally contaminated with carbon during implantation, we noticed a considerable improvement of these tribological parameters. As this pollution is commonly encountered in surface treatment by ion beams, one can invoke this phenomenon to explain the origin of the discrepancy reported by the literature. Extensive investigations allowed us to conclude that surface carbon, whatever its origin (contamination, ion implantation or ion beam mixed coating), provided that its amount is sufficiently high ({>=}2 x 10{sup 16} C.cm{sup -2}), decreases the coefficient of friction by a factor 5 and reduces drastically ({approx} 100) the wear. A careful examination of the whole results led us to propose a theoretical model, based on the role of the asperities of the two bodies in contact, to explain the evolution of the coefficient of friction and wear with the amount of surface carbon. This analysis revealed that in order to improve friction and wear of 100Cr6 steel, one needs to coat this material with a well adherent carbon layer having a thickness higher than the asperity heights of the two bodies in contact. Finally, this study allowed us to develop a simple lower

  16. Evolution of surfaces properties for 100Cr6 steel by implantation and ionic mixing

    International Nuclear Information System (INIS)

    Physico-chemical characterizations performed on samples of 100Cr6 steel implanted both with boron and nitrogen revealed the formation of boron nitride along with the following new phases: Fe1-x(B, N), Fe2-x(B, N) and Fe3-x(B, N). A thorough analysis of boron NITRIDE 5BN) indicates that a low ion current density (3 μA.cm-2) in the case of the boron plus nitrogen sequence favours the formation of sp2 bonds (hexagonal-BN) while a higher ion current density (6μA.cm-2) promotes sp3 bonds cubic-BN) in the opposite sequence. Tribological tests carried out on these samples revealed that nitrogen and boron implantations do not lead to any significant improvement of friction and wear at variance with the results obtained by others authors. However, on a set samples accidentally contaminated with carbon during implantation, we noticed a considerable improvement of these tribological parameters. As this pollution is commonly encountered in surface treatment by ion beams, one can invoke this phenomenon to explain the origin of the discrepancy reported by the literature. Extensive investigations allowed us to conclude that surface carbon, whatever its origin (contamination, ion implantation or ion beam mixed coating), provided that its amount is sufficiently high (≥2 x 1016 C.cm-2), decreases the coefficient of friction by a factor 5 and reduces drastically (∼ 100) the wear. A careful examination of the whole results led us to propose a theoretical model, based on the role of the asperities of the two bodies in contact, to explain the evolution of the coefficient of friction and wear with the amount of surface carbon. This analysis revealed that in order to improve friction and wear of 100Cr6 steel, one needs to coat this material with a well adherent carbon layer having a thickness higher than the asperity heights of the two bodies in contact. Finally, this study allowed us to develop a simple lower-cost process for the improvement of the tribological properties of 100Cr6

  17. r-mode instability in quark stars with a crystalline crust

    Science.gov (United States)

    Rupak, Gautam; Jaikumar, Prashanth

    2013-12-01

    Among the oscillatory modes of neutron stars or quark stars, the r-mode is particularly interesting since it couples strongly to gravitational waves, which rapidly remove angular momentum from the star and spin it down. The r-mode can also provide a penetrating probe into the composition of such objects, where matter is compressed to the most extreme densities possible in nature. At these densities, exotic matter composed of subatomic particles—quarks—can manifest many interesting phases. We construct a model for quark stars that is a step towards resolving the puzzle of rapidly spinning pulsars in low mass X-ray binaries. The explanation makes use of a crystalline superconducting quark crust that is sufficiently robust to damp the r-mode, keeping the star spinning quickly. A crust made of neutrons or non-superconducting quark matter cannot damp the r-mode as effectively, thus, the fast spin rates observed in some LMXB pulsars may be an astrophysical signature of superconducting quark matter.

  18. An explanation of the Z-track sources

    CERN Document Server

    Church, M J; Balucinska-Church, M

    2006-01-01

    We present an explanation of the Z-track phenomenon based on spectral fitting of RXTE observations of GX340+0 using the emission model previously shown to describe the dipping LMXB. In our Z-track model, the soft apex is a quiescent state of the source with lowest luminosity. Moving away from this point by ascending the normal branch the strongly increasing luminosity of the Accretion Disc Corona (ADC) Comptonized emission L_ADC provides substantial evidence for a large increase of mass accretion rate Mdot. There are major changes in the neutron star blackbody emission, kT increasing to high values, the blackbody radius R_BB decreasing, these changes continuing monotonically on both normal and horizontal branches. The blackbody flux increases by a factor of ten to three times the Eddington flux so that the physics of the horizontal branch is dominated by the high radiation pressure of the neutron star, which we propose disrupts the inner disc, and an increase of column density is detected. We further propose ...

  19. NuSTAR Observations of the State Transition of Millisecond Pulsar Binary PSR J1023+0038

    CERN Document Server

    Tendulkar, Shriharsh P; An, Hongjun; Kaspi, Victoria M; Archibald, Anne M; Bassa, Cees; Bellm, Eric; Bogdanov, Slavko; Harrison, Fiona A; Hessels, Jason W T; Janssen, Gemma H; Lyne, Andrew G; Patruno, Alessandro; Stappers, Benjamin; Stern, Daniel; Tomsick, John A; Boggs, Steven E; Chakrabarty, Deepto; Christensen, Finn E; Craig, William W; Hailey, Charles A; Zhang, William

    2014-01-01

    We report NuSTAR observations of the millisecond pulsar - low mass X-ray binary (LMXB) transition system PSR J1023+0038 from June and October 2013, before and after the formation of an accretion disk around the neutron star. Between June 10-12, a few days to two weeks before the radio disappearance of the pulsar, the 3-79 keV X-ray spectrum was well fit by a simple power law with a photon index of Gamma=1.17 +/-0.08 (at 90% confidence) with a 3-79 keV luminosity of 7.4+/-0.4 x 10^32 erg/s. Significant orbital modulation was observed with a modulation fraction of 36+/-10%. During the October 19-21 observation, the spectrum is described by a softer power law (Gamma=1.66+/-0.06) with an average luminosity of 5.8+/-0.2 x 10^33 erg/s and a peak luminosity of ~1.2 x 10^34 erg/s observed during a flare. No significant orbital modulation was detected. The spectral observations are consistent with previous and current multi-wavelength observations and show the hard X-ray power law extending to 79 keV without a spectra...

  20. Discovery of periodic dips in the light curve of GX 13+1: the X-ray orbital ephemeris of the source

    CERN Document Server

    Iaria, R; Burderi, L; Riggio, A; D'Ai, A; Robba, N R

    2013-01-01

    The bright low-mass X-ray binary (LMXB) GX 13+1 is one of the most peculiar Galactic binary systems. A periodicity of 24.27 d with a formal statistical error of 0.03 d was observed in its power spectrum density obtained with RXTE All Sky Monitor (ASM) data spanning 14 years. Starting from a recent study, indicating GX 13+1 as a possible dipping source candidate, we systematically searched for periodic dips in the X-ray light curves of GX 13+1 from 1996 up to 2013 using RXTE/ASM, and MAXI data to determine for the first time the X-ray orbital ephemeris of GX 13+1. We searched for a periodic signal in the ASM and MAXI light curves, finding a common periodicity of 24.53 d. We folded the 1.3-5 keV and 5-12.1 keV ASM light curves and the 2-4 and 4-10 keV MAXI light curves at the period of 24.53 d finding a periodic dip. To refine the value of the period we used the timing technique dividing the ASM light curve in eight intervals and the MAXI light curve in two intervals, obtaining four and two dip arrival times fr...

  1. The absence of radio emission from the globular cluster G1

    CERN Document Server

    Miller-Jones, J C A; Sivakoff, G R; Heinke, C O; Miller, R E; Plotkin, R M; Di Stefano, R; Greene, J E; Ho, L C; Joseph, T D; Kong, A K H; Maccarone, T J

    2012-01-01

    The detections of both X-ray and radio emission from the cluster G1 in M31 have provided strong support for existing dynamical evidence for an intermediate mass black hole (IMBH) of mass 1.8 +/- 0.5 x 10^4 solar masses at the cluster center. However, given the relatively low significance and astrometric accuracy of the radio detection, and the non-simultaneity of the X-ray and radio measurements, this identification required further confirmation. Here we present deep, high angular resolution, strictly simultaneous X-ray and radio observations of G1. While the X-ray emission (L_X = 1.74^{+0.53}_{-0.44} x 10^{36} (d/750 kpc)^2 erg/s in the 0.5-10 keV band) remained fully consistent with previous observations, we detected no radio emission from the cluster center down to a 3-sigma upper limit of 4.7 microJy/beam. Our favored explanation for the previous radio detection is flaring activity from a black hole low mass X-ray binary (LMXB). We performed a new regression of the Fundamental Plane of black hole activity...

  2. XTE J1701-407 INTEGRAL and Swift observations

    DEFF Research Database (Denmark)

    Soldi, S.; Beckmann, V.; Eckert, D.;

    2008-01-01

    INTEGRAL has observed the Galactic center region starting September 18, 2008 through a long key program (KP) and several ToO observations of H1743-322. In the course of these observations, the neutron star LMXB XTE J1701-407 (Markwardt et al. 2008, ATel #1569 and ATel #1616, ATel #1621) has been...... detected by IBIS/ISGRI in the 20-80 keV band. The source was always outside the field of view of the X-ray monitor JEM-X. In the latest observation, the source was also detected in the 40-80 keV band with 14 ± 2 mCrab. Simultaneous to this observation a Swift ToO was performed, starting at 2008-10-18T14......:27 with an on-source time of 1.7 ksec. The combined spectrum of Swift/XRT and IBIS/ISGRI (33 ksec) can be represented by an absorbed power law with intrinsic NH = 2.2e22 1/cm^2 and photon index 2.1 ± 0.1. The model flux in the 2-50 keV band is 3e-10 erg/cm^2/sec. Assuming a maximum distance of 6 kpc...

  3. Measurement of the Radius of Neutron Stars with High S/N Quiescent Low-mass X-ray Binaries in Globular Clusters

    CERN Document Server

    Guillot, Sebastien; Webb, Natalie A; Rutledge, Robert E

    2013-01-01

    This paper presents the measurement of the neutron star (NS) radius using the thermal spectra from quiescent low-mass X-ray binaries (qLMXBs) inside globular clusters (GCs). Recent observations of NSs have presented evidence that cold ultra dense matter -- present in the core of NSs -- is best described by "normal matter" equations of state (EoSs). Such EoSs predict that the radii of NSs, Rns, are quasi-constant (within measurement errors, of ~10%) for astrophysically relevant masses (Mns > 0.5 Msun). The present work adopts this theoretical prediction as an assumption, and uses it to constrain a single Rns value from five qLMXB targets with available high signal-to-noise X-ray spectroscopic data. Employing a Markov-Chain Monte-Carlo approach, we produce the marginalized posterior distribution for Rns, constrained to be the same value for all five NSs in the sample. An effort was made to include all quantifiable sources of uncertainty into the uncertainty of the quoted radius measurement. These include the un...

  4. High-frequency and type-C QPOs from oscillating, precessing hot, thick flow

    Science.gov (United States)

    Fragile, P. Chris; Straub, Odele; Blaes, Omer

    2016-09-01

    Motivated by recent studies showing an apparent correlation between the high-frequency quasi-periodic oscillations (QPOs) and the low-frequency, type-C QPO in black hole low-mass X-ray binaries (LMXBs), we explore a model that explains all three QPOs in terms of an oscillating, precessing hot flow in the truncated-disc geometry. Our model favours attributing the two high-frequency QPOs, often occurring in a near 3:2 frequency ratio, to the breathing and vertical epicyclic frequency modes of the hot, thick flow, although we cannot rule out the Keplerian and m = -1 radial epicyclic modes. In either case, the type-C QPO is attributed to precession. The correlation of the QPOs comes from the fact that all three frequencies are associated with the same geometrical structure. While the exact QPO frequencies are sensitive to the black hole mass and spin, their evolution over the course of an outburst is mainly tied to the truncation radius between the geometrically thin, optically thick disc and the inner, hot flow. We show that, in the case of the LMXB GRO J1655-40, this model can explain the one simultaneous observation of all three QPOs and that an extrapolation of the model appears to match lower frequency observations where only two of the three components are seen. Thus, this model may be able to unify multiple QPO observations using the properties of a single, simple, geometrical model.

  5. Big game hunting in the andromeda galaxy: identifying And weighing black holes in low mass x-ray binaries

    Directory of Open Access Journals (Sweden)

    R. Barnard

    2004-01-01

    Full Text Available Hemos desarrollado una nueva t ecnica para identi car masas de agujeros negros en binarias de rayos X de baja masa y lo aplicamos a observaciones XMM-Newton de dos fuentes de rayos X en M31. En particular buscamos espectros de potencia de baja tasa de acreci on que son muy similares para todas LXMB, siendo la primaria un agujero negro o una estrella de neutrones. Las estrellas neutr onicas gal acticas, LXMB, presentan estos PDS distintivos a muy bajas luminosidades ( 1036 erg s1; mientras que los LMXB de agujeros negros los pueden presentar a luminosidades > 1038 erg s1. Siguiendo el trabajo de van der Klis (1994 asumimos la m axima tasa de acreci on (como una fracci on del l mite de Eddington para los PDS de baja tasa de acreci on que es constante para todas las LXMB, obteniendo un valor emp rico de 10% de Eddington. Hasta ahora descubrimos dos candidatos a binarias de agujero negro en M31 que presentan PDS de baja tasa de acreci on de hasta 3 1038 y 5 1037 erg s1. Si asumimos que el l mite es 5 1037 erg s1 probablemente tendr a un agujero negro como su primaria.

  6. XMM-Newton Finds That SAX J1750.8-2900 May Harbor the Hottest, Most Luminous Known Neutron Star

    CERN Document Server

    Lowell, Alexander W; Heinke, Craig O; Bodaghee, Arash; Boggs, Steven E; Kaaret, Philip; Chaty, Sylvain; Rodriguez, Jerome; Walter, Roland

    2012-01-01

    We have performed the first sensitive X-ray observation of the low-mass X-ray binary SAX J1750.8-2900 in quiescence with XMM-Newton. The spectrum was fit to both a classical black body model, and a non-magnetized, pure hydrogen neutron star atmosphere model. A power law component was added to these models, but we found that it was not required by the fits. The distance to SAX J1750.8-2900 is known to be D = 6.79 kpc from a previous analysis of photospheric radius expansion bursts. This distance implies a bolometric luminosity (as given by the NS atmosphere model) of (1.05 +/- 0.12) x 10^34 (D/6.79 kpc)^2 erg s^-1, which is the highest known luminosity for a NS LMXB in quiescence. One simple explanation for this surprising result could be that the crust and core of the NS were not in thermal equilibrium during the observation. We argue that this was likely not the case, and that the core temperature of the NS in SAX J1750.8-2900 is unusually high.

  7. Propagation of thermonuclear flames on rapidly rotating neutron stars extreme weather during type I X-ray bursts

    CERN Document Server

    Spitkovsky, A; Ushomirsky, G; Spitkovsky, Anatoly; Levin, Yuri; Ushomirsky, Greg

    2002-01-01

    We analyze the global hydrodynamic flow in the ocean of an accreting, rapidly rotating, non-magnetic neutron star in an LMXB during a type I X-ray burst. Our analysis takes into account the rapid rotation of the star and the lift-up of the burning ocean during the burst. We find a new regime for spreading of a nuclear burning front, where the flame is carried along a coherent shear flow across the front. If turbulent viscosity is weak, the speed of flame propagation is ~20 km/s, while, if turbulent viscosity is dynamically important, the flame speed increases, and reaches the maximum value, ~300 km/s, when the eddy overturn frequency is comparable to the Coriolis parameter. We show that, due to rotationally reduced gravity, the thermonuclear runaway is likely to begin on the equator. The equatorial belt is ignited first, and the flame then propagates from the equator to the poles. Inhomogeneous cooling (equator first, poles second) drives strong zonal currents which may be unstable to formation of Jupiter-typ...

  8. Discovery of disc precession in the M31 dipping X-ray binary Bo 158

    CERN Document Server

    Barnard, R; Haswell, C A; Kolb, U; Osborne, J P; Murray, J R

    2006-01-01

    We present results from three XMM-Newton observations of the M31 low mass X-ray binary XMMU J004314.4+410726.3 (Bo 158), spaced over 3 days in 2004, July. Bo 158 was the first dipping LMXB to be discovered in M31. Periodic intensity dips were previously seen to occur on a 2.78-hr period, due to absorption in material that is raised out of the plane of the accretion disc. The report of these observations stated that the dip depth was anti-correlated with source intensity. However, our new observations do not favour a strict intensity dependance, but rather suggest that the dip variation is due to precession of the accretion disc. This is to be expected in LMXBs with a mass ratio <~ 0.3 (period <~ 4 hr), as the disc reaches the 3:1 resonance with the binary companion, causing elongation and precession of the disc. A 3D smoothed particle hydrodynamics simulation of the disc in this system shows retrograde rotation of a disc warp on a period of ~11 P_orb, and prograde disc precession on a period of ~29 P_or...

  9. Probing the Low-Luminosity XLF in Normal Elliptical Galaxies

    CERN Document Server

    Kim, D W; Kalogera, V; King, A R; Pellegrini, S; Trinchieri, G; Zepf, S E; Zezas, A L; Angelini, L; Davies, R L; Gallagher, J S

    2006-01-01

    We present the first low luminosity (LX > 5 - 10 1036 erg s-1) X-ray luminosity functions (XLFs) of low-mass X-ray binaries (LMXBs) determined for two typical old elliptical galaxies, NGC 3379 and NGC 4278. Because both galaxies contain little diffuse emission from hot ISM and no recent significant star formation (hence no high-mass X-ray binary contamination), they provide two of the best homogeneous sample of LMXBs. With 110 and 140 ks Chandra ACIS S3 exposures, we detect 59 and 112 LMXBs within the D25 ellipse of NGC 3379 and NGC 4278, respectively. The resulting XLFs are well represented by a single power-law with a slope (in a differential form) of 1.9 0.1. In NGC 4278, we can exclude the break at LX ~ 5 x 1037 erg s-1 that was recently suggested to be a general feature of LMXB XLFs. In NGC 3379 instead we find a localized excess over the power law XLF at ~4 x 1037 erg s-1, but with a marginal significance of ~1.6s. Because of the small number of luminous sources, we cannot constrain the high luminosity ...

  10. Formation and Evolution of Galactic Intermediate/Low-Mass X-ray Binaries

    CERN Document Server

    Shao, Yong

    2015-01-01

    We investigate the formation and evolutionary sequences of Galactic intermediate- and low-mass X-ray binaries (I/LMXBs) by combining binary population synthesis (BPS) and detailed stellar evolutionary calculations. Using an updated BPS code we compute the evolution of massive binaries that leads to the formation of incipient I/LMXBs, and present their distribution in the initial donor mass vs. initial orbital period diagram. We then follow the evolution of I/LMXBs until the formation of binary millisecond pulsars (BMSPs). We find that the birthrate of the I/LMXB population is in the range of $ 9\\times10^{-6} - 3.4\\times10^{-5} \\, {\\rm yr^{-1}}$, compatible with that of BMSPs which are thought to descend from I/LMXBs. We show that during the evolution of I/LMXBs they are likely to be observed as relatively compact binaries with orbital periods $ \\lesssim $ 1 day and donor masses $\\lesssim 0.3 M_{\\odot}$. The resultant BMSPs have orbital periods ranging from less than 1 day to a few hundred days. These features...

  11. Comparing GC and Field LMXBs in Elliptical Galaxies with deep Chandra and Hubble data

    CERN Document Server

    Kim, D -W; Brassington, N J; Fragos, T; Kalogera, V; Zezas, A; Jordan, A; Sivakoff, G R; Kundu, A; Zepf, S E; Angelini, L; Davies, R L; Gallagher, J S; Juett, A M; King, A R; Pellegrini, S; Sarazin, C L; Trinchieri, G

    2009-01-01

    (abridged) We present a statistical study of the low-mass X-ray binary (LMXB) populations of three nearby, old elliptical galaxies: NGC 3379, NGC 4278, and NGC 4697. With a cumulative ~1 Ms Chandra ACIS observing time, we detect 90-170 LMXBs within the D25 ellipse of each galaxy. Cross-correlating Chandra X-ray sources and HST optical sources, we identify 75 globular cluster (GC) LMXBs and 112 field LMXBs. In the low luminosity range allowed by our deeper data (LX < 5 x 1037 erg s-1), we find a significant relative lack of GC-LMXBs, when compared with field sources. Using the co-added sample from the three galaxies, we find that the incompleteness-corrected X-ray luminosity functions (XLFs) of GC and field LMXBs differ at ~4# significance at LX < 5 x 1037 erg s-1. As previously reported, these XLFs are consistent at higher luminosities. Our observations may indicate a potential predominance of GC-LMXBs with donors evolved beyond the main sequence, when compared to current models, but their efficient for...

  12. The Megasecond Chandra X-Ray Visionary Project Observation of NGC 3115 (III): luminosity functions of LMXBs and dependence on stellar environments

    CERN Document Server

    Lin, Dacheng; Wong, Ka-wah; Jennings, Zachary G; Homan, Jeroen; Romanowsky, Aaron J; Strader, Jay; Brodie, Jean P; Sivakoff, Gregory R; Remillard, Ronald A

    2015-01-01

    We have studied the X-ray luminosity function (XLF) of low-mass X-ray binaries (LMXBs) in the nearby lenticular galaxy NGC 3115, using the Megasecond Chandra X-Ray Visionary Project Observation. With a total exposure time of ~1.1 Ms, we constructed the XLF down to a limiting luminosity of ~10^36 erg/s, much deeper than typically reached for other early-type galaxies. We found significant flattening of the overall LMXB XLF from dN/dL \\propto L^{-2.2\\pm0.4} above 5.5x10^37 erg/s to dN/dL \\propto L^{-1.0\\pm0.1} below it, though we could not rule out a fit with a higher break at ~1.6x10^38 erg/s. We also found evidence that the XLF of LMXBs in globular clusters (GCs) is overall flatter than that of field LMXBs. Thus our results for this galaxy do not support the idea that all LMXBs are formed in GCs. The XLF of field LMXBs seems to show spatial variation, with the XLF in the inner region of the galaxy being flatter than that in the outer region, probably due to contamination of LMXBs from undetected and/or disrup...

  13. Swift J174540.7-290015: a new accreting binary in the Galactic Center

    CERN Document Server

    Ponti, G; De Marco, B; Rea, N; Rau, A; Haberl, F; Zelati, F Coti; Bozzo, E; Ferrigno, C; Bower, G C; Demorest, P

    2016-01-01

    We report on the identification of the new Galactic Center (GC) transient Swift J174540.7-290015 as a likely low mass X-ray binary (LMXB) located at only 16 arcsec from Sgr A*. This transient was detected on 2016 February 6th during the Swift GC monitoring, and it showed long-term spectral variations compatible with a hard to soft state transition. We observed the field with XMM-Newton on February 26th for 35 ks, detecting the source in the soft state, characterised by a low level of variability and a soft X-ray thermal spectrum with a high energy tail (detected by INTEGRAL up to ~50 keV), typical of either accreting neutron stars or black holes. We observed: i) a high column density of neutral absorbing material, suggesting that Swift J174540.7-290015 is located near or beyond the GC and; ii) a sub-Solar Iron abundance, therefore we argue that Iron is depleted into dust grains. The lack of detection of FeK absorption lines, eclipses or dipping suggests that the accretion disc is observed at a low inclination...

  14. On the Origin of Broad Iron Lines in Neutron Star Low-mass X-ray Binaries

    CERN Document Server

    Chiang, Chia-Ying; Miller, Jon M; Barret, Didier; Fabian, Andy C; D'Ai, Antonino; Parker, Michael L; Bhattacharyya, Sudip; Burderi, Luciano; Di Salvo, Tiziana; Egron, Elise; Homan, Jeroen; Iaria, Rosario; Lin, Dacheng; Miller, M Coleman

    2015-01-01

    Broad Fe K emission lines have been widely observed in the X-ray spectra of black hole systems, and in neutron star systems as well. The intrinsically narrow Fe K fluorescent line is generally believed to be part of the reflection spectrum originating in an illuminated accretion disk, and broadened by strong relativistic effects. However, the nature of the lines in neutron star LMXBs has been under debate. We therefore obtained the longest, high-resolution X-ray spectrum of a neutron star LMXB to date with a 300 ks Chandra HETGS observation of Serpens X-1. The observation was taken under the "continuous clocking" mode and thus free of photon pile-up effects. We carry out a systematic analysis and find that the blurred reflection model fits the Fe line of Serpens X-1 significantly better than a broad Gaussian component does, implying that the relativistic reflection scenario is much preferred. Chandra HETGS also provides highest spectral resolution view of the Fe K region and we find no strong evidence for add...

  15. Effects of variability of X-ray binaries on the X-ray luminosity functions of Milky Way

    CERN Document Server

    Islam, Nazma

    2016-01-01

    The X-ray luminosity functions of galaxies have become a useful tool for population studies of X-ray binaries in them. The availability of long term light-curves of X-ray binaries with the All Sky X-ray Monitors opens up the possibility of constructing X-ray luminosity functions, by also including the intensity variation effects of the galactic X-ray binaries. We have constructed multiple realizations of the X-ray luminosity functions (XLFs) of Milky Way, using the long term light-curves of sources obtained in the 2-10 keV energy band with the RXTE-ASM. The observed spread seen in the value of slope of both HMXB and LMXB XLFs are due to inclusion of variable luminosities of X-ray binaries in construction of these XLFs as well as finite sample effects. XLFs constructed for galactic HMXBs in the luminosity range 10^{36} - 10^{39} erg/sec is described by a power-law model with a mean power-law index of -0.48 and a spread due to variability of HMXBs as 0.19. XLFs constructed for galactic LMXBs in the luminosity r...

  16. Detection of a 1258 Hz high-amplitude kilohertz quasi-periodic oscillation in the ultra-compact X-ray binary 1A 1246-588

    CERN Document Server

    Jonker, P G; Méndez, M; Van der Klis, M

    2007-01-01

    We have observed the ultra-compact low-mass X-ray binary (LMXB) 1A 1246-588 with the Rossi X-ray Timing Explorer (RXTE). In this manuscript we report the discovery of a kilohertz quasi-periodic oscillation (QPO) in 1A 1246-588. The kilohertz QPO was only detected when the source was in a soft high-flux state reminiscent of the lower banana branch in atoll sources. Only one kilohertz QPO peak is detected at a relatively high frequency of 1258+-2 Hz and at a single trial significance of more than 7 sigma. Kilohertz QPOs with a higher frequency have only been found on two occasions in 4U 0614+09. Furthermore, the frequency is higher than that found for the lower kilohertz QPO in any source, strongly suggesting that the QPO is the upper of the kilohertz QPO pair often found in LMXBs. The full-width at half maximum is 25+-4 Hz, making the coherence the highest found for an upper kilohertz QPO. From a distance estimate of ~6 kpc from a radius expansion burst we derive that 1A 1246-588 is at a persistent flux of ~0....

  17. Simultaneous X-ray/optical observations of GX 9+9 (4U 1728-16)

    CERN Document Server

    Kong, A K H; Homer, L; Kuulkers, E; O'Donoghue, D

    2006-01-01

    We report on the results of the first simultaneous X-ray (RXTE) and optical (SAAO) observations of the luminous low mass X-ray binary (LMXB) GX 9+9 in 1999 August. The high-speed optical photometry revealed an orbital period of 4.1958 hr and confirmed previous observations, but with greater precision. No X-ray modulation was found at the orbital period. On shorter timescales, a possible 1.4-hr variability was found in the optical light curves which might be related to the mHz quasi-periodic oscillations seen in other LMXBs. We do not find any significant X-ray/optical correlation in the light curves. In X-rays, the colour-colour diagram and hardness-intensity diagram indicate that the source shows characteristics of an atoll source in the upper banana state, with a correlation between intensity and spectral hardness. Time-resolved X-ray spectroscopy suggests that two-component spectral models give a reasonable fit to the X-ray emission. Such models consist of a blackbody component which can be interpreted as ...

  18. The formation of low-mass helium white dwarfs orbiting pulsars: Evolution of low-mass X-ray binaries below the bifurcation period

    CERN Document Server

    Istrate, Alina; Langer, Norbert

    2014-01-01

    Millisecond pulsars (MSPs) are generally believed to be old neutron stars (NSs) which have been spun up to high rotation rates via accretion of matter from a companion star in a low-mass X-ray binary (LMXB). However, many details of this recycling scenario remain to be understood. Here we investigate binary evolution in close LMXBs to study the formation of radio MSPs with low-mass helium white dwarf companions (He WDs) in tight binaries with orbital periods P_orb = 2-9 hr. In particular, we examine: i) if such observed systems can be reproduced from theoretical modelling using standard prescriptions of orbital angular momentum losses (i.e. with respect to the nature and the strength of magnetic braking), ii) if our computations of the Roche-lobe detachments can match the observed orbital periods, and iii) if the correlation between WD mass and orbital period (M_WD, P_orb) is valid for systems with P_orb < 2 days. Numerical calculations with a detailed stellar evolution code were used to trace the mass-tra...

  19. Evidence for simultaneous jets and disk winds in luminous low-mass X-ray binaries

    CERN Document Server

    Homan, Jeroen; Allen, Jessamyn L; Chakrabarty, Deepto; Fender, Rob; Fridriksson, Joel K; Remillard, Ronald A; Schulz, Norbert

    2016-01-01

    Recent work on jets and disk winds in low-mass X-ray binaries (LMXBs) suggests that they are to a large extent mutually exclusive, with jets observed in spectrally hard states and disk winds in spectrally soft states. In this paper we use existing literature on jets and disk winds in the luminous neutron star LMXB GX 13+1, in combination with archival RXTE data, to show that this source is likely able to produce jets and disk winds simultaneously. We find that jets and disk winds occur in the same location on the source's track in its X-ray color-color diagram. A further study of literature on other luminous LMXBs reveals that this behavior is more common, with indications for simultaneous jets and disk winds in the black hole LMXBs V404 Cyg and GRS 1915+105 and the neutron star LMXBs Sco X-1 and Cir X-1. For the three sources for which we have the necessary spectral information, we find that the simultaneous jets/winds all occur in their spectrally hardest states. Our findings indicate that in LMXBs with lum...

  20. The optical ephemeris and X-ray variability of 4U 1735-44 (V926 Sco)

    CERN Document Server

    Giles, A B

    2012-01-01

    Optical observations of the low mass X-ray binary 4U 1735-44 were obtained during 1997-2007 and combined with earlier published observations from 1984-1993 to refine the ephemeris for the system. The linear fit for the time of maximum optical light has the ephemeris HJD = 2445904.0494(90) + [ N x 0.19383222(29)] with a value of chi^2 = 253.5$ for 16 dof and a scatter about phase zero of sigma = 0.061. The new data reconciles the discrepancy between the previous ephemeris and the more recent spectral ephemeris based on emission from the companion star which defined the systems true dynamical phase zero. The optical maximum for 4U 1735-44 now occurs at spectral phase 0.47 \\pm 0.05 and thus supports the classic model for an LMXB system. Our data further supports the standard model in several ways. The mean optical flux shows a positive correlation with the RXTE ASM X-ray flux, the relative increases suggesting that the non-X-ray induced optical flux from the companion is < 14 percent of the total optical ligh...

  1. Coupling between the 45 Hz Horizontal-Branch Oscillation and the Normal-Branch Oscillation in Scorpius X-1

    Science.gov (United States)

    Yu, Wenfei

    2007-04-01

    The observations of the bright persistent neutron star low-mass X-ray binary (LMXB) Sco X-1 performed with the Rossi X-Ray Timing Explorer (RXTE) show a ~6 Hz normal-branch oscillation (NBO), a ~45 Hz horizontal-branch oscillation (HBO), and twin kilohertz quasi-periodic oscillations (kHz QPOs) on its normal branch simultaneously. We have found that the fractional amplitude of the HBO corresponding to the NBO phase of high flux is 1.1%, while that of the NBO phase of low flux is undetectable, with a 3 σ upper limit of 0.4%, implying that the HBO strength varies with the NBO phase in a manner opposite that of the lower kHz QPO previously found, and suggests that the condition for the generation of the HBO is met when the NBO flux is high. The 6 Hz NBO in Sco X-1 connects the 45 Hz HBO and the twin kHz QPO together, showing a unique picture indicating a coupling between the QPOs, which has never been observed in other neutron star LMXBs. We discuss the implications for current models of the 45 Hz HBO, the 6 Hz NBO, and the twin kHz QPOs.

  2. Coupling between the 45 Hz Horizontal-Branch Oscillation and the Normal Branch Oscillation in Scorpius X-1

    CERN Document Server

    Yu, W

    2007-01-01

    The observations of the bright persistent neutron star low-mass X-ray binary (LMXB) Sco X-1 performed with the {\\it Rossi X-ray Timing Explorer} (RXTE) show a $\\sim$ 6 Hz normal-branch oscillation (NBO), a $\\sim$ 45 Hz horizontal-branch oscillation (HBO), and twin kHz quasi-periodic oscillations (QPOs) on its normal branch simultaneously. We have found that the fractional amplitude of the HBO corresponding to the NBO phase of high flux is 1.1%, while that of the NBO phase of low flux is undetectable, with a 3$\\sigma$ upper limit of 0.4%, implying that the HBO strength varies with the NBO phase in an opposite way to that of the lower kHz QPO previously found, and suggests that the condition for the generation of the HBO is met when the NBO flux is high. The 6 Hz NBO in Sco X-1 connects the 45 Hz HBO and the twin kHz QPO together, showing a unique picture indicating a coupling between the QPOs, which has never been observed in other neutron star LMXBs. We discuss the implications for current models of the 45 Hz...

  3. Black holes in stellar-mass binary systems: expiating original spin?

    CERN Document Server

    King, Andrew

    2016-01-01

    We investigate systematically whether accreting black hole systems are likely to reach global alignment of the black hole spin and its accretion disc with the binary plane. In low-mass X-ray binaries (LMXBs) there is only a modest tendency to reach such global alignment, and it is difficult to achieve fully: except for special initial conditions we expect misalignment of the spin and orbital planes by ~1 radian for most of the LMXB lifetime. The same is expected in high-mass X-ray binaries (HMXBs). A fairly close approach to global alignment is likely in most stellar-mass ultraluminous X-ray binary systems (ULXs) where the companion star fills its Roche lobe and transfers on a thermal timescale to a black hole of lower mass. These systems are unlikely to show orbital eclipses, as their emission cones are close to the hole's spin axis. This offers a potential observational test, as models for ULXs invoking intermediate-mass black holes do predict eclipses for ensembles of > ~10 systems. Recent observational wo...

  4. An Fe XXVI Absorption Line in the Persistent Spectrum of the Dipping Low Mass X-ray Binary 1A 1744-361

    CERN Document Server

    Gavriil, Fotis P; Bhattacharyya, Sudip

    2009-01-01

    We report on Chandra X-ray Observatory (CXO) High-Energy Transmission Grating (HETG) spectra of the dipping Low Mass X-ray Binary (LMXB) 1A 1744-361 during its July 2008 outburst. We find that its persistent emission is well modeled by a blackbody (kT ~ 1.0 keV) plus power-law ($\\Gamma$ ~ 1.7) with an absorption edge at 7.6 keV. In the residuals of the combined spectrum we find a significant absorption line at 6.961+/-0.002 keV, consistent with the Fe XXVI (hydrogen-like Fe) 2 - 1 transition. We place an upper limit on the velocity of a redshifted flow of v 10^3.6 erg cm/s. The properties of this line are consistent with those observed in other dipping LMXBs. Using Rossi X-ray Timing Explorer (RXTE) data accumulated during this latest outburst we present an updated color-color diagram which clearly shows that 1A 1744-361 is an "atoll" source. Finally, using additional dips found in the RXTE and CXO data we provide an updated orbital period estimate of 52+/-5 minutes.

  5. Swift J1357.2-0933: the faintest black hole?

    CERN Document Server

    Padilla, M Armas; Degenaar, N; Muñoz-Darias, T; Casares, J; Fender, R P

    2014-01-01

    Swift J1357.2-0933 is the first confirmed very faint black hole X-ray transient and has a short orbital period of 2.8 hr. We observed Swift J1357.2-0933 for ~50 ks with XMM-Newton in 2013 July during its quiescent state. The source is clearly detected at a 0.5-10 keV flux of ~3x10^-15 erg cm-2 s-1. If the source is located at a distance of 1.5 kpc (as suggested in the literature), this would imply a luminosity of ~8x10^29 erg s-1, making it the faintest detected quiescent black hole LMXB. This would also imply that there is no indication of a reversal in the quiescence X-ray luminosity versus orbital period diagram down to 2.8 hr, as has been predicted theoretically and recently supported by the detection of the 2.4 hr orbital period black hole MAXI J1659-152 at a 0.5-10 keV X-ray luminosity of ~ 1.2 x 10^31 erg s-1. However, there is considerable uncertainty in the distance of Swift J1357.2-0933 and it may be as distant as 6 kpc. In this case, its quiescent luminosity would be Lx ~ 1.3 x 10^31 erg s-1, i.e.,...

  6. The Evolution of Normal Galaxy X-ray Emission Through Cosmic History: Constraints from the 6 Ms Chandra Deep Field-South

    CERN Document Server

    Lehmer, B D; Mineo, S; Brandt, W N; Eufrasio, R T; Fragos, T; Hornschemeier, A E; Luo, B; Xue, Y Q; Bauer, F E; Gilfanov, M; Ranalli, P; Schneider, D P; Shemmer, O; Tozzi, P; Trump, J R; Vignali, C; Wang, J -X; Yukita, M; Zezas, A

    2016-01-01

    We present measurements of the evolution of normal-galaxy X-ray emission from $z \\approx$ 0-7 using local galaxies and galaxy samples in the 6 Ms Chandra Deep Field-South (CDF-S) survey. The majority of the CDF-S galaxies are observed at rest-frame energies above 2 keV, where the emission is expected to be dominated by X-ray binary (XRB) populations; however, hot gas is expected to provide small contributions to the observed- frame < 1 keV emission at $z < 1$. We show that a single scaling relation between X-ray luminosity ($L_{\\rm X}$) and star-formation rate (SFR) is insufficient for characterizing the average X-ray emission at all redshifts. We establish that scaling relations involving not only SFR, but also stellar mass ($M_\\star$) and redshift, provide significantly improved characterizations of the average X-ray emission from normal galaxy populations at $z \\approx$ 0-7. We further provide the first empirical constraints on the redshift evolution of X-ray emission from both low-mass XRB (LMXB) an...

  7. Were most Low Mass X ray Binaries born in Globular Clusters?

    CERN Document Server

    D'Antona, F; Ventura, P; Antona, Francesca D'; Teodorescu, Anamaria; Ventura, Paolo

    2006-01-01

    We summarize the status of art of the secular evolution of low mass X-ray binaries (LMXBs) and take a close look at the orbital period distribution of LMXBs and of binary millisecond pulsars (MSP), in the hypothesis that this latter results from the LMXB evolution. The deficiency of systems below the period gap, which in cataclysmic binaries occurs between ~ 2 and 3 hr, points to a very different secular evolution of LMXBs with respect to their counterparts containing a white dwarf compact object. The presence of several ultrashort period LMXBs (some of which are also X-ray millisecond pulsars), the important fraction of binary MSPs at periods between 0.1 and 1 day, the periods (26 and 32hr) of two ``interacting'' MSPs in Globular Clusters are other pieces of the puzzle in the period distribution. We consider the possible explanations for these peculiarities, and point out that Grindlay's old proposal that all (most of) LMXBs in the field were originally born in globular clusters must be carefully reconsidere...

  8. Broad Band X-ray Spectra of M31 Sources with BeppoSAX

    CERN Document Server

    Trinchieri, G; Chiappetti, L; Belloni, T; Stella, L; Primini, F A; Fabbiano, P; Pietsch, W; Trinchieri, Ginevra; Israel, Gian Luca; Chiappetti, Lucio; Belloni, Tomaso; Stella, Luigi; Primini, Frank; Fabbiano, Pepi; Pietsch, Wolfgang

    1999-01-01

    We present the first spectral study of the X-ray emitting stellar sources in M31 in the energy band from 0.1 to 10 keV. We find that the globular cluster sources have spectral characteristics consistent with those of the Milky Way object, namely that the spectrum can be described by a thermal model with 6-20 keV from 2 to 10 keV. Evidence of high absorption in some of these sources is most likely an indication that they lie in or behind the HI ring in the disk of the galaxy. We also find one peculiar globular cluster source, with spectral characteristics more typically associated with either High Mass X-ray Binaries or black hole candidates. We therefore suggest that either the source has been wrongly identified with a globular cluster or that the system contains a Black Hole. We confirm earlier report that the spectrum of the bulge of M31 is consistent with the superposition of many LMXB spectra. It is likely that a large fraction of the 15-30 keV detection obtained from the PDS instrument is associated with...

  9. A propeller scenario for the gamma-ray emission of low-mass X-ray binaries: The case of XSS J12270-4859

    CERN Document Server

    Papitto, A; Li, J

    2013-01-01

    XSS J12270-4859 is the only low mass X-ray binary (LMXB) with a proposed persistent gamma-ray counterpart in the Fermi-LAT domain, 2FGL 1227.7-4853. Here, we present the results of the analysis of recent INTEGRAL observations, aimed at assessing the long-term variability of the hard X-ray emission, and thus the stability of the accretion state. We confirm that the source behaves as a persistent hard X-ray emitter between 2003 and 2012. We propose that XSS J12270-4859 hosts a neutron star in a propeller state, a state we investigate in detail, developing a theoretical model to reproduce the associated X-ray and gamma-ray properties. This model can be understood as being of a more general nature, representing a viable alternative by which LMXBs can appear as gamma-ray sources. In particular, this may apply to the case of millisecond pulsars performing a transition from a state powered by the rotation of their magnetic field, to a state powered by matter in-fall, such as that recently observed from the transitio...

  10. Hard-tail emission in the soft state of low-mass X-ray binaries and their relation to the neutron star magnetic field

    CERN Document Server

    Asai, Kazumi; Mastuoka, Masaru; Sugizaki, Mutsumi

    2016-01-01

    Average hard-tail X-ray emission in the soft state of nine bright Atoll low-mass X-ray binaries containing a neutron star (NS-LMXBs) are investigated by using the light curves of MAXI/GSC and Swift/BAT. Two sources (4U 1820$-$30 and 4U 1735$-$44) exhibit large hardness ratio (15--50 keV$/$2--10 keV: {\\it HR} $>$ 0.1), while the other sources distribute at {\\it HR} $\\ltsim$ 0.1. In either case, {\\it HR} does not depend on the 2--10 keV luminosity. Therefore the difference of {\\it HR} is due to the 15--50 keV luminosity, which is Comptonized emission. The Compton cloud is assumed to be around the neutron star. The size of the Compton cloud would affect the value of {\\it HR}. Although the magnetic field of NS-LMXB is weak, we could expect a larger Alfv\\'{e}n radius than the innermost stable circular orbit or the neutron star radius in some sources. In such cases, the accretion inflow is stopped at the Alfv\\'{e}n radius and would create relatively large Compton cloud. It would result in the observed larger Compto...

  11. Broad iron emission line and kilohertz quasi-periodic oscillations in the neutron star system 4U 1636-53

    CERN Document Server

    Sanna, Andrea; Altamirano, Diego; Belloni, Tomaso; Hiemstra, Beike; Linares, Manuel

    2014-01-01

    Both the broad iron (Fe) line and the frequency of the kilohertz quasi-periodic oscillations (kHz QPOs) in neutron star low-mass X-ray binaries (LMXBs) can potentially provide independent measures of the inner radius of the accretion disc. We use XMM-Newton and simultaneous Rossi X-ray Timing Explorer observations of the LMXB 4U 1636-53 to test this hypothesis. We study the properties of the Fe-K emission line as a function of the spectral state of the source and the frequency of the kHz QPOs. We find that the inner radius of the accretion disc deduced from the frequency of the upper kHz QPO varies as a function of the position of the source in the colour-colour diagram, in accordance with previous work and with the standard scenario of accretion disc geometry. On the contrary, the inner disc radius deduced from the profile of the Fe line is not correlated with the spectral state of the source. The values of the inner radius inferred from kHz QPOs and Fe lines, in four observations, do not lead to a consisten...

  12. Tuning into Scorpius X-1: adapting a continuous gravitational-wave search for a known binary system

    Science.gov (United States)

    Meadors, Grant David; Goetz, Evan; Riles, Keith

    2016-05-01

    We describe how the TwoSpect data analysis method for continuous gravitational waves (GWs) has been tuned for directed sources such as the low-mass X-ray binary (LMXB), Scorpius X-1 (Sco X-1). A comparison of five search algorithms generated simulations of the orbital and GW parameters of Sco X-1. Whereas that comparison focused on relative performance, here the simulations help quantify the sensitivity enhancement and parameter estimation abilities of this directed method, derived from an all-sky search for unknown sources, using doubly Fourier-transformed data. Sensitivity is shown to be enhanced when the source sky location and period are known, because we can run a fully templated search, bypassing the all-sky hierarchical stage using an incoherent harmonic sum. The GW strain and frequency, as well as the projected semi-major axis of the binary system, are recovered and uncertainty estimated, for simulated signals that are detected. Upper limits for GW strain are set for undetected signals. Applications to future GW observatory data are discussed. Robust against spin-wandering and computationally tractable despite an unknown frequency, this directed search is an important new tool for finding gravitational signals from LMXBs.

  13. SALT observation of X-ray pulse reprocessing in 4U 1626-67

    CERN Document Server

    Raman, Gayathri; Bhattacharya, Dipankar; Mohan, Vijay

    2016-01-01

    We investigate optical reprocessing of X-rays in the LMXB pulsar 4U 1626-67 in its current spin-up phase using observations with Southern African Large Telescope (SALT), near-simultaneous observations with Swift-XRT and non-simultaneous RXTE-PCA observations and present the results of timing analysis. Using SALT observations carried out on 5th and 6th March, 2014, we detect some interesting reprocessing signatures. We detect a weak optical Quasi Periodic Oscillation (QPO) in the power density spectrum on March 5th at 48 mHz with a fractional rms of 3.3% in spite of the fact that source shows no corresponding X-ray QPO in the spin-up phase. In the light curve obtained on March 5th, we detect a coherent pulsation at the spin period of ~7.677 s. A previously known, slightly down-shifted side-band is also detected at 129.92 mHz. The frequency spacing between main pulse and this side-band is different from earlier observations, though the statistical significance of the difference is limited. The light curve of 6t...

  14. Bowen Fluorescence from the Companion Star in X1822-371

    CERN Document Server

    Casares, J; Hynes, R I; Charles, P A; O'Brien, K

    2003-01-01

    We present a clear evidence for the motion of the companion star in the Low Mass X-Ray Binary (LMXB) X1822-371. We detect NIII lambda 4640 emission moving in antiphase with the radial velocity curve of the neutron star and produced on the X-ray heated hemisphere of the donor star. From the motion of this feature we derive a lower limit to the radial velocity semi-amplitude of the companion star K2 > 300 +_ 8 km/s, which, combined with a previous determination of the inclination angle and the pulsar's radial velocity curve, yield M2 > 0.36(2) Msun and M1 > 1.14(6) Msun. The HeI lambda 4471 absorption line moves at lower velocities (~ 225 km/s) and with a -0.05 phase shift, suggests a likely origin on the gas stream near the L1 point. In addition, we detect an S-wave emission of OVI lambda 3811 produced by illumination of the hot-spot bulge by the central source. The Balmer lines are dominated by broad absorptions probably due to obscuration of the accretion disc by vertically extended cool material from the sp...

  15. A Model-Based Cross-Correlation Search for Gravitational Waves from Scorpius X-1

    CERN Document Server

    Whelan, John T; Zhang, Yuanhao; Peiris, Prabath

    2015-01-01

    We consider the cross-correlation search for periodic GWs and its potential application to the LMXB Sco X-1. This method coherently combines data from different detectors at the same time, as well as different times from the same or different detectors. By adjusting the maximum time offset between a pair of data segments to be coherently combined, one can tune the method to trade off sensitivity and computing costs. In particular, the detectable signal amplitude scales as the inverse fourth root of this coherence time. The improvement in amplitude sensitivity for a search with a coherence time of 1hr, compared with a directed stochastic background search with 0.25Hz wide bins is about a factor of 5.4. We show that a search of 1yr of data from Advanced LIGO and Advanced Virgo with a coherence time of 1hr would be able to detect GWs from Sco X-1 at the level predicted by torque balance over a range of signal frequencies from 30-300Hz; if the coherence time could be increased to 10hr, the range would be 20-500Hz...

  16. Long Type I X-ray Bursts and Neutron Star Interior Physics

    CERN Document Server

    Cumming, A; in 't Zand, J J M; Page, D; Cumming, Andrew; Macbeth, Jared; Page, Dany

    2005-01-01

    Superbursts are very energetic Type I X-ray bursts discovered in recent years by long term monitoring of X-ray bursters, believed to be due to unstable ignition of carbon in the deep ocean of the neutron star. A number of "intermediate duration" bursts have also been observed, probably associated with ignition of a thick helium layer. We investigate the sensitivity of these long X-ray bursts to the thermal profile of the neutron star crust and core. We first compare cooling models of superburst lightcurves with observations, and derive constraints on the ignition mass and energy release, and then calculate ignition models for superbursts and pure helium bursts, and compare to observations. The superburst lightcurves and ignition models imply that the carbon mass fraction is approximately 20% or greater in the fuel layer, constraining models of carbon production. However, the most important result is that when Cooper pairing neutrino emission is included in the crust, the temperature is too low to support unst...

  17. A relativistic iron emission line from the neutron star low-mass X-ray binary GX 3+1

    CERN Document Server

    Piraino, S; Kaaret, P; Mück, B; DÁi', A; DI Salvo, T; Iaria, R; Robba, N; Burderi, L; Egron, E

    2012-01-01

    We present the results of a spectroscopic study of the Fe K{\\alpha} emission of the persistent neutron-star atoll low-mass X-ray binary and type I X-ray burster GX 3+1 with the EPIC-PN on board XMM-Newton. The source shows a flux modulation over several years and we observed it during its fainter phase, which corresponds to an X-ray luminosity of Lx~10^37 ergs/s. When fitted with a two-component model, the X-ray spectrum shows broad residuals at \\sim6-7 keV that can be ascribed to an iron K{\\alpha} fluorescence line. In addition, lower energy features are observed at \\sim3.3 keV, \\sim3.9 keV and might originate from Ar XVIII and Ca XIX. The broad iron line feature is well fitted with a relativistically smeared profile. This result is robust against possible systematics caused by instrumental pile-up effects. Assuming that the line is produced by reflection from the inner accretion disk, we infer an inner disk radius of \\sim25 Rg and a disk inclination of 35{\\deg} < i < 44{\\deg}.

  18. Suzaku broad-band spectrum of 4U 1705-44: Probing the Reflection component in the hard state

    CERN Document Server

    Di Salvo, T; Matranga, M; Burderi, L; D'Ai, A; Egron, E; Papitto, A; Riggio, A; Robba, N R; Ueda, Y

    2015-01-01

    Iron emission lines at 6.4-6.97 keV, identified with Kalpha radiative transitions, are among the strongest discrete features in the X-ray band. These are one of the most powerful probes to infer the properties of the plasma in the innermost part of the accretion disk around a compact object. In this paper we present a recent Suzaku observation, 100-ks effective exposure, of the atoll source and X-ray burster 4U 1705-44, where we clearly detect signatures of a reflection component which is distorted by the high-velocity motion in the accretion disk. The reflection component consists of a broad iron line at about 6.4 keV and a Compton bump at high X-ray energies, around 20 keV. All these features are consistently fitted with a reflection model, and we find that in the hard state the smearing parameters are remarkably similar to those found in a previous XMM-Newton observation performed in the soft state. In particular, we find that the inner disk radius is Rin = 17 +/- 5 Rg (where Rg is the Gravitational radius...

  19. Nuclear weapon race does not stop

    International Nuclear Information System (INIS)

    60 years after Hiroshima, the race for nuclear weaponry keeps on. The comprehensive test ban treaty (CTBT), signed in 1996 by the 5 official nuclear-weapon-owning states (Usa, Russia, China, U.K. and France), has not yet been implemented because its implementation requires the ratification of 44 states that harbour on their territories industrial or research nuclear reactors. Till now only 33 such states have ratified CTBT. CTBT aims at prohibiting any nuclear test whatever the amount of energy released in it. Countries like Usa, North-Korea, Russia, soon Iran... are suspected to develop new types of nuclear warfare. For 2005 the American Congress have decided to freeze the funding of programmes dedicated to the development of 'mini-nukes' like the bunker-burster. The international network of monitoring stations will soon cover all the world and will be able to detect and locate, in an almost automated way, any test involving an energy greater than 1 kiloton. 321 stations have been settled and their efficient detection systems are based on seismic or infra-sound or radioactivity or hydro-acoustic analysis. (A.C.)

  20. Frontiers in nuclear astrophysics

    Science.gov (United States)

    Bertulani, C. A.; Kajino, T.

    2016-07-01

    The synthesis of nuclei in diverse cosmic scenarios is reviewed, with a summary of the basic concepts involved before a discussion of the current status in each case is made. We review the physics of the early universe, the proton to neutron ratio influence in the observed helium abundance, reaction networks, the formation of elements up to beryllium, the inhomogeneous Big Bang model, and the Big Bang nucleosynthesis constraints on cosmological models. Attention is paid to element production in stars, together with the details of the pp chain, the pp reaction, 3He formation and destruction, electron capture on 7Be, the importance of 8B formation and its relation to solar neutrinos, and neutrino oscillations. Nucleosynthesis in massive stars is also reviewed, with focus on the CNO cycle and its hot companion cycle, the rp-process, triple- α capture, and red giants and AGB stars. The stellar burning of carbon, neon, oxygen, and silicon is presented in a separate section, as well as the slow and rapid nucleon capture processes and the importance of medium modifications due to electrons also for pycnonuclear reactions. The nucleosynthesis in cataclysmic events such as in novae, X-ray bursters and in core-collapse supernovae, the role of neutrinos, and the supernova radioactivity and light-curve is further discussed, as well as the structure of neutron stars and its equation of state. A brief review of the element composition found in cosmic rays is made in the end.

  1. X-ray spectra and atmospheric structures of bursting neutron stars

    International Nuclear Information System (INIS)

    I discuss atmospheric structures and emitted x-ray spectra of bursting neutron stars. The x-ray spectrum is deformed from the blackbody spectrum by Comptonization and by a strong energy dependence of absorptive opacities. The atmospheric structures deviate from those of the Eddington atmospheres due to the Compton heating-cooling. I construct color temperature vs. luminosity diagrams from the atmospheric models of neutron stars. Comparing these with observational ones, I obtain two relations among mass, radius, and distance of the x-ray bursters MXB 1636 - 536 and MXB 1608 - 522. I derive two possible sets of mass, radius, and distance of the x-ray burst source MXB 1636 - 536 taking into account of the 4.1-keV absorption line, theoretical mass-radius relation of the neutron star, and the distance to the galactic center. If the absorption line is due to Cr 23 M = 1.7 - 2.0 solar mass, R = 11 - 12 km, and d = 6.3 - 6.7 kpc, and if it is due to Fe 25, M = 1.8 - 2.1 solar mass, R = 8 - 10 km, and d = 5.8 - 6.4 kpc. (author)

  2. ANTARES: An Undersea Neutrino telescope

    CERN Multimedia

    2002-01-01

    The ANTARES (Astronomy with a Neutrino Telescope and ${Abyss}$ environmental RESearch) deep-sea neutrino telescope is designed to search for neutrinos of astrophysical origin. Neutrinos are unique probes of the high energy universe; being neutral they are not deflected by magnetic fields and interacting weakly they can readily escape from the densest regions of the universe. Potential sources of neutrino are galactic (e.g supernova remnants, micro-quasars) and extra-galactic (e.g active galactic nuclei, gamma-ray bursters). Annihilation of dark matter particles in the Sun or Galactic Centre is another well motivated potential source of extra terrestrial neutrinos. The ANTARES detector is located 40 km off the coast of Toulon (France) at a depth of 2475m in the Mediterranean Sea. Being located in the Northern hemisphere it studies the Southern sky and in particular has the Galactic Centre in its field of view. Since 2006, the detector has operated continuously in a partial configuration. The detector was compl...

  3. Flares from a new Integral hard X-ray source, IGR J17407-2808, likely associated with the ROSAT source SBM 10

    DEFF Research Database (Denmark)

    Kretschmar, P.; Mereghetti, S.; Hermsen, W.;

    2004-01-01

    detected. The last flare, with peak fluxes of 0.8±0.1 Crab and 0.6±0.1 Crab in the energy ranges 20-40 keV and 40-60 keV respectively, triggered an automatic alert message of the Integral Burst Alert System (IBAS Alert #2010) which led to the discovery of the source (Gotz et al., GCN Circ. #2793). The...... observations of [SBM2001] 10 have been published up to date. The flares were observed with the IBIS instrument in the 20-60 keV energy range, starting at MJD 53287.6310 and over a timespan of 2000 seconds finishing in a strong flare at MJD 53287.6327. Before and after this time period the source was not...... source was outside the FOV of the JEM-X and OMC monitor instruments during this flare. Note that the position of J17407-2808 is inconsistent with that of the X-ray burster SLX 1737-282 [AX J1740.7-2818] (in't Zand et al. 2002, A&A 389, L43), which is just ~11 arcmin away. The correct Integral attitude is...

  4. XXII SLAC summer institute on particle physics: Proceedings. Particle physics, astrophysics and cosmology

    International Nuclear Information System (INIS)

    The seven-day school portion of the Institute revolved around the question of dark matter: where is it and what is it? Reviews were given of microlensing searches for baryonic dark matter, of dark matter candidates in the form of neutrinos and exotic particles, and of low-noise detection techniques used to search for the latter. The history of the universe, from the Big Bang to the role of dark matter in the formation of large-scale structure, was also covered. Other lecture series described the astrophysics that might be done with x-ray timing experiments and through the detection of gravitational radiation. As in past years, the lectures each morning were followed by stimulating afternoon discussion sessions, in which students could pursue with the lecturers the topics that most interested them. The Institute concluded with a three-day topical conference covering recent developments in theory and experiment. Highlights from the astrophysical and cosmological arenas included observations of anisotropy in the cosmic microwave background, and of the mysterious gamma-ray bursters. From terrestrial accelerators came tantalizing hints of the top quark and marked improvements in precision electroweak measurements, among many other results. Selected papers are indexed separately for inclusion in the Energy Science and Technology Database

  5. Globus Pallidus external segment neuron classification in freely moving rats: a comparison to primates.

    Directory of Open Access Journals (Sweden)

    Liora Benhamou

    Full Text Available Globus Pallidus external segment (GPe neurons are well-characterized in behaving primates. Based on their firing properties, these neurons are commonly divided into two distinct groups: high frequency pausers (HFP and low frequency bursters (LFB. However, no such characterization has been made for behaving rats. The current study characterizes and categorizes extracellularly recorded GPe neurons in freely moving rats, and compares these results to those obtained by extracellular recordings in behaving primates using the same analysis methods. Analysis of our data recorded in rats revealed two distinct neuronal populations exhibiting firing-pattern characteristics that are similar to those obtained in primates. These characteristic firing patterns are conserved between species although the firing rate is significantly lower in rats than in primates. Significant differences in waveform duration and shape were insufficient to create a reliable waveform-based classification in either species. The firing pattern analogy may emphasize conserved processing properties over firing rate per-se. Given the similarity in GPe neuronal activity between human and non-human primates in different pathologies, our results encourage information transfer using complementary studies across species in the GPe to acquire a better understanding of the function of this nucleus in health and disease.

  6. The Fermi–GBM Three-year X-Ray Burst Catalog

    Science.gov (United States)

    Jenke, P. A.; Linares, M.; Connaughton, V.; Beklen, E.; Camero-Arranz, A.; Finger, M. H.; Wilson-Hodge, C. A.

    2016-08-01

    The Fermi Gamma-ray Burst Monitor (GBM) is an all-sky gamma-ray monitor well known in the gamma-ray burst (GRB) community. Although GBM excels in detecting the hard, bright extragalactic GRBs, its sensitivity above 8 keV and its all-sky view make it an excellent instrument for the detection of rare, short-lived Galactic transients. In 2010 March, we initiated a systematic search for transients using GBM data. We conclude this phase of the search by presenting a three-year catalog of 1084 X-ray bursts. Using spectral analysis, location, and spatial distributions we classified the 1084 events into 752 thermonuclear X-ray bursts, 267 transient events from accretion flares and X-ray pulses, and 65 untriggered gamma-ray bursts. All thermonuclear bursts have peak blackbody temperatures broadly consistent with photospheric radius expansion (PRE) bursts. We find an average rate of 1.4 PRE bursts per day, integrated over all Galactic bursters within about 10 kpc. These include 33 and 10 bursts from the ultra-compact X-ray binaries 4U 0614+09 and 2S 0918-549, respectively. We discuss these recurrence times and estimate the total mass ejected by PRE bursts in our Galaxy.

  7. INTEGRAL spectral variability study of the atoll 4U 1820-30: first detection of hard X-ray emission

    CERN Document Server

    Tarana, A; Ubertini, P; Zdziarski, A A; Tarana, Antonella; Bazzano, Angela; Ubertini, Pietro; Zdziarski, Andrzej A.

    2006-01-01

    We study the 4-200 keV spectral and temporal behaviour of the low mass X-ray binary 4U 1820-30 with INTEGRAL during 2003-2005. This source as been observed in both the soft (banana) and hard (island) spectral states. A high energy tail, above 50 keV, in the hard state has been observed for the first time. This places the source in the category of X-ray bursters showing high-energy emission. The tail can be modeled as a soft power law component, with the photon index of ~2.4, on top of thermal Comptonization emission from a plasma with the electron temperature of kT_e~6 keV and optical depth of \\tau~4. Alternatively, but at a lower goodness of the fit, the hard-state broad band spectrum can be accounted for by emission from a hybrid, thermal-nonthermal, plasma. During this monitoring the source spent most of the time in the soft state, usual for this source, and the >~4 keV spectra are represented by thermal Comptonization with kT_e~3 keV and \\tau~6-7.

  8. Following the Colour of the Low Mass X-ray Binary 4U 1820-30 with INTEGRAL

    CERN Document Server

    Tarana, A; Ubertini, P; Zdziarski, A A; Federici, M; Tarana, Antonella; Bazzano, Angela; Ubertini, Pietro

    2006-01-01

    The 4-200 keV spectral and temporal behaviour of the low mass X-ray binary 4U 1820-30 has been studied with INTEGRAL during 2003-2005. This source as been observed in both the soft (banana) and hard (island) spectral states. A high energy tail above 50 keV in the hard state has been revealed for the first time. This places the source in the category of X-ray bursters showing high-energy emission. The tail can be modeled as a soft power law component, with the photon index of ~ 2.4, on top of thermal Comptonization emission from a plasma with the electron temperature of kT_e ~ 6 keV and optical depth of $\\tau ~ 4. Alternatively, but at a lower goodness of the fit, the hard-state broad band spectrum can be accounted for by emission from a hybrid, thermal-nonthermal, plasma. During the observations, the source spent most of the time in the soft state, as previously reported and the $\\ge$4 keV spectra can be represented by thermal Comptonization with kT_e ~ 3 keV and $\\tau ~ 6-7.

  9. On the presence and absence of disks around O-type stars

    CERN Document Server

    Vink, Jorick S; Harries, T J; Oudmaijer, R D; Walborn, N R

    2009-01-01

    (abridged) As the favoured progenitors of long-duration gamma-ray bursts, massive stars may represent our best signposts of individual objects in the early Universe, but special conditions seem required to make these bursters, which might originate from the progenitor's rapid rotation and associated asymmetry. To obtain empirical constraints on the interplay between stellar rotation and wind asymmetry, we perform linear Halpha spectropolarimetry on a sample of 18 spectroscopically peculiar massive O stars, including OVz, Of?p, Oe, and Onfp stars, supplemented by an earlier sample of 20 O supergiants. Despite their rapid rotation (with vsin(i) up to 400 km/s) most O-type stars are found to be spherically symmetric, but with notable exceptions amongst specific object classes. We divide the peculiar O stars into four distinct categories: Groups III and IV include the Oe stars and Onfp stars, which are on the high-end tail of the O star rotation distribution and have in the past been claimed to be embedded in dis...

  10. Improved Universal No-Hair Relations for Neutron Stars

    Science.gov (United States)

    Majumder, Barun; Yagi, Kent; Yunes, Nicolas

    2016-03-01

    The exterior gravitational field of an astrophysical body can be characterized by its multipole moments. No-hair theorems for black holes state that the exterior gravitational field can be completely described in terms of their mass and spin angular momentum. Similar no-hair like relations have been recently found for neutron stars which are approximately independent of the internal structure of the star. Missions like NICER and LOFT will observe the pulse profiles of millisecond pulsars and thermonuclear bursters. The equation-of-state (EoS) independent relations may break degeneracies among the relevant observables in the modeling of X-ray pulse and atomic line profiles. The amount of EoS independence of these approximately universal relations depends on how one adimensionalizes the multipole moments of the star with stellar mass, spin and radius. We show that for slowly-rotating neutron stars in both non-relativistic limit and full General Relativity, the optimal normalization of the multipole moments exist that minimizes the EoS dependence in the universal relations. The relations among the moment of inertia and higher order moments can be improved from the original ones approximately by a factor of two. Nicolas Yunes acknowledges support from NSF CAREER Award PHY-1250636. Barun Majumder is supported by the Fulbright-Nehru Postdoctoral Research Fellowship.

  11. Mixed-mode oscillations in a multiple time scale phantom bursting system

    CERN Document Server

    Krupa, Maciej; Desroches, Mathieu; Clément, Frédérique

    2012-01-01

    In this work we study mixed mode oscillations in a model of secretion of GnRH (Gonadotropin Releasing Hormone). The model is a phantom burster consisting of two feedforward coupled FitzHugh-Nagumo systems, with three time scales. The forcing system (Regulator) evolves on the slowest scale and acts by moving the slow nullcline of the forced system (Secretor). There are three modes of dynamics: pulsatility (transient relaxation oscillation), surge (quasi steady state) and small oscillations related to the passage of the slow nullcline through a fold point of the fast nullcline. We derive a variety of reductions, taking advantage of the mentioned features of the system. We obtain two results; one on the local dynamics near the fold in the parameter regime corresponding to the presence of small oscillations and the other on the global dynamics, more specifically on the existence of an attracting limit cycle. Our local result is a rigorous characterization of small canards and sectors of rotation in the case of fo...

  12. SN1998bw/GRB980425 and Radio Supernovae

    CERN Document Server

    Weiler, K W; Montes, M J; Weiler, Kurt W.; Panagia, Nino; Montes, Marcos J.

    2001-01-01

    The unusual supernova SN1998bw, which is thought to be related to the gamma-ray burster GRB980425, is a possible link between the two classes of objects. Analyzing the extensive radio emission data avaliable for SN1998bw, we are able to describe its time evolution within the well established framework available for the analysis of radio emission from supernovae. This then allows description of a number of physical properties of the object. The radio emission can best be explained as interaction of a mildly relativistic (Gamma about 1.6) shock with a dense pre-explosion stellar wind established circumstellar medium (CSM) which is highly structured both azimuthally, in clumps or filaments, and radially, with two observed density enhancements separated by about 3e17 cm. With assumptions as to pre-explosion stellar wind conditions, it is possible to estimate that the progenitor to SN 1998bw had a mass loss rate of about 3.5e-5 solar masses per yr with at least two approximately 30% increases in mass-loss rate; th...

  13. Rotational effects in thermonuclear Type I Bursts: equatorial crossing and directionality of flame spreading

    CERN Document Server

    Cavecchi, Yuri; Levin, Yuri; Braithwaite, Jonathan

    2014-01-01

    In a previous study on thermonuclear (Type I) Bursts on accreting neutron stars we addressed and demonstrated the importance of the effects of rotation, through the Coriolis force, on the propagation of the burning flame. However, that study only analysed cases of longitudinal propagation, where the Coriolis force coefficient $2\\Omega\\cos\\theta$ was constant. In this paper, we study the effects of rotation on propagation in the meridional (latitudinal) direction, where the Coriolis force changes from its maximum at the poles to zero at the equator. We find that the zero Coriolis force at the equator, while affecting the structure of the flame, does not prevent its propagation from one hemisphere to another. We also observe structural differences between the flame propagating towards the equator and that propagating towards the pole, the second being faster. In the light of the recent discovery of the low spin frequency of burster IGR~J17480-2446 rotating at 11 Hz (for which Coriolis effects should be negligib...

  14. A Burst and Simultaneous Short-Term Pulsed Flux Enhancement from the Magnetar Candidate 1E 1048.1-5937

    CERN Document Server

    Gavriil, F P; Woods, P M; Gavriil, Fotis P.; Kaspi, Victoria M.; Woods, Peter M.

    2006-01-01

    We report on the 2004 June 29 burst detected from the direction of the Anomalous X-ray Pulsar (AXP) 1E 1048.1-5937 using the Rossi X-ray Timing Explorer (RXTE). We find a simultaneous increase of ~3.5 times the quiescent value in the 2-10 keV pulsed flux of 1E 1048.1-5937 during the tail of the burst which identifies the AXP as the burst's origin. The burst was overall very similar to the two others reported from the direction of this source in 2001. The unambiguous identification of 1E 1048.1-5937 as the burster here confirms it was the origin of the 2001 bursts as well. The epoch of the burst peak was very close to the arrival time of 1E 1048.1-5937's pulse peak. The burst exhibited significant spectral evolution with the trend going from hard to soft. During the 11 days following the burst, the AXP was observed further with RXTE, XMM-Newton and Chandra. Pre- and post-burst observations revealed no change in the total flux or spectrum of the quiescent emission. Comparing all three bursts detected thus far f...

  15. Inferring network properties of cortical neurons with synaptic coupling and parameter dispersion.

    Science.gov (United States)

    Roy, Dipanjan; Jirsa, Viktor

    2013-01-01

    Computational models at different space-time scales allow us to understand the fundamental mechanisms that govern neural processes and relate uniquely these processes to neuroscience data. In this work, we propose a novel neurocomputational unit (a mesoscopic model which tell us about the interaction between local cortical nodes in a large scale neural mass model) of bursters that qualitatively captures the complex dynamics exhibited by a full network of parabolic bursting neurons. We observe that the temporal dynamics and fluctuation of mean synaptic action term exhibits a high degree of correlation with the spike/burst activity of our population. With heterogeneity in the applied drive and mean synaptic coupling derived from fast excitatory synapse approximations we observe long term behavior in our population dynamics such as partial oscillations, incoherence, and synchrony. In order to understand the origin of multistability at the population level as a function of mean synaptic coupling and heterogeneity in the firing rate threshold we employ a simple generative model for parabolic bursting recently proposed by Ghosh et al. (2009). Further, we use here a mean coupling formulated for fast spiking neurons for our analysis of generic model. Stability analysis of this mean field network allow us to identify all the relevant network states found in the detailed biophysical model. We derive here analytically several boundary solutions, a result which holds for any number of spikes per burst. These findings illustrate the role of oscillations occurring at slow time scales (bursts) on the global behavior of the network. PMID:23533147

  16. Systematic Uncertainties in the Spectroscopic Measurements of Neutron-Star Masses and Radii from Thermonuclear X-ray Bursts. III. Absolute Flux Calibration

    CERN Document Server

    Guver, Tolga; Marshall, Herman; Psaltis, Dimitrios; Guainazzi, Matteo; Diaz-Trigo, Maria

    2015-01-01

    Many techniques for measuring neutron star radii rely on absolute flux measurements in the X-rays. As a result, one of the fundamental uncertainties in these spectroscopic measurements arises from the absolute flux calibrations of the detectors being used. Using the stable X-ray burster, GS 1826-238, and its simultaneous observations by Chandra HETG/ACIS-S and RXTE/PCA as well as by XMM-Newton EPIC-pn and RXTE/PCA, we quantify the degree of uncertainty in the flux calibration by assessing the differences between the measured fluxes during bursts. We find that the RXTE/PCA and the Chandra gratings measurements agree with each other within their formal uncertainties, increasing our confidence in these flux measurements. In contrast, XMM-Newton EPIC-pn measures 14.0$\\pm$0.3% less flux than the RXTE/PCA. This is consistent with the previously reported discrepancy with the flux measurements of EPIC-pn, compared to EPIC-MOS1, MOS2 and ACIS-S detectors. We also address the calibration uncertainty in the RXTE/PCA int...

  17. Surveying the skies how astronomers map the universe

    CERN Document Server

    Wynn-Williams, Gareth

    2016-01-01

    Since the time of Galileo, astronomy has been driven by technological innovation. With each major advance has come the opportunity and enthusiasm to survey the sky in a way that was not possible before. It is these surveys of discovery that are the subject of this book. In the first few chapters the author discusses what astronomers learned from visible-light surveys, first with the naked eye, then using telescopes in the seventeenth century, and photography in the nineteenth century. He then moves to the second half of the twentieth century when the skies started to be swept by radio, infrared, ultraviolet, x-ray and gamma ray telescopes, many of which had to be flown in satellites above the Earth’s atmosphere. These surveys led to the discovery of pulsars, quasars, molecular clouds, protostars, bursters, and black holes. He then returns to Earth to describe several currently active large-scale projects that methodically collect images, photometry and spectra that are then stored in vast publicly-accessibl...

  18. FIR galaxies with compact radio cores

    Science.gov (United States)

    Chini, R.; Biermann, P. L.; Kreysa, E.; Kuhr, H.; Mezger, P. G.; Schmidt, J.; Witzel, A.; Zensus, J. A.

    1987-07-01

    Comparing the IRAS point-source catalog (1985) with sources detected in a VLBI extragalactic radio source survey (Zensus et al., 1984), five FIR sources are found which all show compact radio cores. These objects have been observed with the 30-m MRT at Pico Veleta (Spain) at 1.2-mm wavelength to provide spectral coverage between IRAS and radio bands. The two galaxies among the five sources have luminosities of order 10 to the 12th solar luminosities in the FIR and thus may be super star bursters similar to Arp 220. On the other hand, all five objects have active galactic nuclei, and so the FIR luminosities may be powered by the nuclear activity. Since flat-spectrum radio sources have compact nuclear components, the 1-Jy catalog and its extension to lower flux densities (Kuehr et al., 1979 and 1981) are compared with the IRAS catalog, and a small number of additional active nuclei with strong emission in the FIR are identified. These objects can serve to study the competition between starbursts and nuclear activity to explain high FIR luminosities.

  19. SAXJ1712.6-3739: a persistent hard X-ray source as monitored with INTEGRAL

    CERN Document Server

    Fiocchi, Mariateresa; Ubertini, Pietro; De Cesare, Giovanni

    2007-01-01

    The X-ray source SAXJ1712.6-3739 is a very weak Low Mass X-ray Binary discovered in 1999 with BeppoSAX and located in the Galactic Center. This region has been deeply investigated by the INTEGRAL satellite with an unprecedented exposure time, giving us an unique opportunity to study the hard X-ray behavior also for weak objects. The spectral results are based on the systematic analysis of all INTEGRAL observations covering the source position performed between February 2003 and October 2006. SAXJ1712.6-3739 did not shows any flux variation along this period as well as compared to previous BeppoSAX observation. Hence, to better constrain the physical parameters we combined both instrument data. Long INTEGRAL monitoring reveals, for the first time, that this X-ray burster is a weak persistent source, displaying a X-ray spectrum extended to high energy and spending most of the time in a low luminosity hard state. The broad-band spectrum is well modeled with a simple Comptonized model with a seed photons temperat...

  20. First superburst observed by INTEGRAL/JEM-X

    DEFF Research Database (Denmark)

    Chenevez, Jérôme

    X-ray bursters are neutron stars in low mass X-ray binaries where hydrogen and/or helium accretes on the surface, and explodes in recurrent thermonuclear runaways. Such type I X-ray bursts, characterized by a black-body emission, generally display a fast rise time followed by an exponential cooling...... carbon shell flashes in the layers below the surface of the neutron star, while the intermediately long bursts are generally explained by the unstable burning of a thick atmospheric layer of pure helium. On February 13, 2011, the Danish-built X-ray monitor JEM-X onboard the INTEGRAL satellite observed...... for the first time a superburst, which occurred from the Galactic bulge lowmass X-ray binary SAX J1747.0-2853. This event is also noticeable in light-curves from the MAXI all-sky monitor onboard the International Space Station. Three days earlier, a flare at GeV energy was detected by the Fermi...

  1. Intermittent synchronization in a network of bursting neurons

    Science.gov (United States)

    Park, Choongseok; Rubchinsky, Leonid L.

    2011-09-01

    Synchronized oscillations in networks of inhibitory and excitatory coupled bursting neurons are common in a variety of neural systems from central pattern generators to human brain circuits. One example of the latter is the subcortical network of the basal ganglia, formed by excitatory and inhibitory bursters of the subthalamic nucleus and globus pallidus, involved in motor control and affected in Parkinson's disease. Recent experiments have demonstrated the intermittent nature of the phase-locking of neural activity in this network. Here, we explore one potential mechanism to explain the intermittent phase-locking in a network. We simplify the network to obtain a model of two inhibitory coupled elements and explore its dynamics. We used geometric analysis and singular perturbation methods for dynamical systems to reduce the full model to a simpler set of equations. Mathematical analysis was completed using three slow variables with two different time scales. Intermittently, synchronous oscillations are generated by overlapped spiking which crucially depends on the geometry of the slow phase plane and the interplay between slow variables as well as the strength of synapses. Two slow variables are responsible for the generation of activity patterns with overlapped spiking, and the other slower variable enhances the robustness of an irregular and intermittent activity pattern. While the analyzed network and the explored mechanism of intermittent synchrony appear to be quite generic, the results of this analysis can be used to trace particular values of biophysical parameters (synaptic strength and parameters of calcium dynamics), which are known to be impacted in Parkinson's disease.

  2. Superconductivity in Y-Pd-C-B intermetallics

    International Nuclear Information System (INIS)

    Amongst the family of anti-perovskites, the materials with general formula RM3X (R and M are metals, X=B, C, N) are isostructural with superconducting MgCNi3. From a survey of literature it was found that the Y-Pd-C-B system has one of the highest superconducting transition temperatures (∼ 23 K) amongst the intermetallic compounds. Since YPd3 with AuCu3 structure has good hydrogen storage properties, boron and carbon can also be easily incorporated at its interstitials sites. The electronic properties of borides and carbides of Y-Pd have therefore been investigated by density functional theory based full potential linearized augmented plane wave (FP-LAPW) and projector augmented wave (PAW) methods. The energy bands, Fermi surfaces and density of states as well as the transport and vibrational properties were calculated to study the stability and superconducting properties of these alloys

  3. Bottom-quark fragmentation: Comparing results from tuned event generators and resummed calculations

    International Nuclear Information System (INIS)

    We study bottom-quark fragmentation in e+e- annihilation, top and Higgs decay H->bb-bar , using Monte Carlo event generators, as well as calculations, based on the formalism of perturbative fragmentation functions, which resum soft- and collinear-radiation effects in the next-to-leading logarithmic approximation. We consider the PYTHIA and HERWIG generators, and implement matrix-element corrections to the parton shower simulation of the H->bb-bar process in HERWIG. We tune the Kartvelishvili, string and cluster models to B-hadron data from LEP and SLD, and present results in both xB and moment spaces. The B-hadron spectra yielded by HERWIG, PYTHIA and resummed calculations show small discrepancies, which are due to the different approaches and models employed and to the quality of the fits to the e+e- data

  4. Probing nuclear gluons with heavy quarks at EIC

    CERN Document Server

    Chudakov, E; Hyde, Ch; Furletov, S; Furletova, Yu; Nguyen, D; Stratmann, M; Strikman, M; Weiss, C; Yoshida, R

    2016-01-01

    We explore the feasibility of direct measurements of nuclear gluon densities using heavy-quark production (open charm, beauty) at a future Electron-Ion Collider (EIC). We focus on the regions x > 0.3 (EMC effect) and x ~ 0.05-0.1 (antishadowing), where the nuclear modifications of the gluon density offer insight into non-nucleonic degrees of freedom and the QCD structure of nucleon-nucleon interactions. We describe the charm production rates and momentum distributions in nuclear deep-inelastic scattering (DIS) at large x_B, and comment on the possible methods for charm reconstruction using next-generation detectors at the EIC (pi/K identification, tracking, vertex detection).

  5. Beam-spin Asymmetries from Semi-inclusive Pion Electroproduction

    CERN Document Server

    Gohn, W; Joo, K; Ungaro, M

    2014-01-01

    We have measured the moment $A_{LU}^{\\sin\\phi}$ corresponding to the polarized electron beam-spin asymmetry in SIDIS. $A_{LU}^{\\sin\\phi}$ is a twist-3 quantity providing information about quark-gluon correlations. Data were taken with the CLAS Spectrometer at Jefferson Lab using a 5.498 GeV longitudinally polarized electron beam and an unpolarized liquid hydrogen target. All three pion channels ($\\pi^+$, $\\pi^0$ and $\\pi^-$) were measured simultaneously over a large range of kinematics within the virtuality range $Q^2 \\approx$ 1.0-4.5 GeV$^2$. The observable was measured with good statistical precision over a large range of $z$, $P_T$, $x_B$, and $Q^{2}$, which permits comparison with several reaction models. The discussed measurements provide an upgrade in statistics over previous measurements, and serve as the first evidence for the negative sign of the $\\pi^{-}$ $\\sin\\phi$ moment.

  6. Longitudinal target-spin asymmetries for deeply virtual Compton scattering

    CERN Document Server

    Seder, E; Pisano, S; Niccolai, S

    2014-01-01

    A measurement of the electroproduction of photons off protons in the deeply inelastic regime was performed at Jefferson Lab using a nearly 6-GeV electron beam, a longitudinally polarized proton target and the CEBAF Large Acceptance Spectrometer. Target-spin asymmetries for $ep\\to e'p'\\gamma$ events, which arise from the interference of the deeply virtual Compton scattering and the Bethe-Heitler processes, were extracted over the widest kinematics in $Q^2$, $x_B$, $t$ and $\\phi$, for 166 four-dimensional bins. In the framework of Generalized Parton Distributions (GPDs), at leading twist the $t$ dependence of these asymmetries provides insight on the spatial distribution of the axial charge of the proton, which appears to be concentrated in its center. These results also bring important and necessary constraints for the existing parametrizations of chiral-even GPDs.

  7. Performance of local correlation methods for halogen bonding: The case of Br2–(H2O)n,n = 4,5 clusters and Br2@51262 clathrate cage

    International Nuclear Information System (INIS)

    The performance of local correlation methods is examined for the interactions present in clusters of bromine with water where the combined effect of hydrogen bonding (HB), halogen bonding (XB), and hydrogen-halogen (HX) interactions lead to many interesting properties. Local methods reproduce all the subtleties involved such as many-body effects and dispersion contributions provided that specific methodological steps are followed. Additionally, they predict optimized geometries that are nearly free of basis set superposition error that lead to improved estimates of spectroscopic properties. Taking advantage of the local correlation energy partitioning scheme, we compare the different interaction environments present in small clusters and those inside the 51262 clathrate cage. This analysis allows a clear identification of the reasons supporting the use of local methods for large systems where non-covalent interactions play a key role

  8. Exclusive $\\rho^0$ muoproduction on transversely polarised protons and deuterons

    CERN Document Server

    Adolph, C; Alexakhin, V Yu; Alexandrov, Yu; Alexeev, G D; Amoroso, A; Antonov, A A; Austregesilo, A; Badelek, B; Balestra, F; Barth, J; Baum, G; Bedfer, Y; Bernhard, J; Bertini, R; Bettinelli, M; Bicker, K; Bieling, J; Birsa, R; Bisplinghoff, J; Bordalo, P; Bradamante, F; Braun, C; Bravar, A; Bressan, A; Buechele, M; Burtin, E; Capozza, L; Chiosso, M; Chung, S U; Cicuttin, A; Crespo, M L; Torre, S Dalla; Das, S; Dasgupta, S S; Dasgupta, S; Denisov, O Yu; Dhara, L; Donskov, S V; Doshita, N; Duic, V; Duennweber, W; Dziewiecki, M; Efremov, A; Elia, C; Eversheim, P D; Eyrich, W; Faessler, M; Ferrero, A; Filin, A; Finger, M; Finger, jr, M; Fischer, H; Franco, C; von Hohenesche, N du Fresne; Friedrich, J M; Frolov, V; Garfagnini, R; Gautheron, F; Gavrichtchouk, O P; Gerassimov, S; Geyer, R; Giorgi, M; Gnesi, I; Gobbo, B; Goertz, S; Grabmueller, S; Grasso, A; Grube, B; Gushterski, R; Guskov, A; Guthoerl, T; Haas, F; von Harrach, D; Heinsius, F H; Herrmann, F; Hess, C; Hinterberger, F; Horikawa, N; Hoeppner, Ch; d'Hose, N; Ishimoto, S; Ivanov, O; Ivanshin, Yu; Iwata, T; Jahn, R; Jary, V; Jasinski, P; Joosten, R; Kabuss, E; Kang, D; Ketzer, B; Khaustov, G V; Khokhlov, Yu A; Kisselev, Yu; Klein, F; Klimaszewski, K; Koblitz, S; Koivuniemi, J H; Kolosov, V N; Kondo, K; Koenigsmann, K; Konorov, I; Konstantinov, V F; Korzenev, A; Kotzinian, A M; Kouznetsov, O; Kraemer, M; Kroumchtein, Z V; Kunne, F; Kurek, K; Lauser, L; Lednev, A A; Lehmann, A; Levorato, S; Lichtenstadt, J; Liska, T; Maggiora, A; Magnon, A; Makke, N; Mallot, G K; Mann, A; Marchand, C; Martin, A; Marzec, J; Matsuda, T; Meshcheryakov, G; Meyer, W; Michigami, T; Mikhailov, Yu V; Moinester, M A; Morreale, A; Mutter, A; Nagaytsev, A; Nagel, T; Negrini, T; Nerling, F; Neubert, S; Neyret, D; Nikolaenko, V I; Nowak, W -D; Nunes, A S; Olshevsky, A G; Ostrick, M; Padee, A; Panknin, R; Panzieri, D; Parsamyan, B; Paul, S; Perevalova, E; Pesaro, G; Peshekhonov, D V; Piragino, G; Platchkov, S; Pochodzalla, J; Polak, J; Polyakov, V A; Pretz, J; Quaresma, M; Quintans, C; Rajotte, J -F; Ramos, S; Rapatsky, V; Reicherz, G; Richter, A; Rocco, E; Rondio, E; Rossiyskaya, N S; Ryabchikov, D I; Samoylenko, V D; Sandacz, A; Sapozhnikov, M G; Sarkar, S; Savin, I A; Sbrizzai, G; Schiavon, P; Schill, C; Schlueter, T; Schmidt, K; Schmitt, L; Schoenning, K; Schopferer, S; Schott, M; Schroeder, W; Shevchenko, O Yu; Silva, L; Sinha, L; Sissakian, A N; Slunecka, M; Smirnov, G I; Sosio, S; Sozzi, F; Srnka, A; Steiger, L; Stolarski, M; Sulc, M; Sulej, R; Suzuki, H; Sznajder, P; Takekawa, S; Ter Wolbeek, J; Tessaro, S; Tessarotto, F; Tkatchev, L G; Uhl, S; Uman, I; Vandenbroucke, M; Virius, M; Vlassov, N V; Wang, L; Wilfert, M; Windmolders, R; Wislicki, W; Wollny, H; Zaremba, K; Zavertyaev, M; Zemlyanichkina, E; Ziembicki, M; Zhuravlev, N; Zvyagin, A

    2012-01-01

    The transverse target spin azimuthal asymmetry A_UT in hard exclusive production of rho^0 mesons was measured at COMPASS by scattering 160 GeV/c muons off transversely polarised protons and deuterons. The measured asymmetry is sensitive to the nucleon helicity-flip generalised parton distributions E^q, which are related to the orbital angular momentum of quarks in the nucleon. The Q^2, x_B and p_t^2 dependence of A_UT is presented in a wide kinematic range. Results for deuterons are obtained for the first time. The measured asymmetry is small in the whole kinematic range for both protons and deuterons, which is consistent with the theoretical interpretation that contributions from GPDs E^u and E^d approximately cancel.

  9. Measurement of the second-order Zeeman effect on the sodium clock transition in the weak-magnetic-field region using the scalar Aharonov-Bohm phase

    International Nuclear Information System (INIS)

    The second-order Zeeman effect of the sodium clock transition in a weak magnetic field of less than 50 μT was measured as the scalar Aharonov-Bohm phase by two-photon stimulated Raman atom interferometry. The ac Stark effect of the Raman pulse was canceled out by adopting an appropriate intensity ratio of two photons in the Raman pulse. The Ramsey fringes for the pulse separation of 7 ms were obtained with a phase uncertainty of π/200 rad. The nondispersive feature of the scalar Aharonov-Bohm phase was clearly demonstrated through 18 fringes with constant amplitude. The Breit-Rabi formula of the sodium clock transition was verified to be Δν=(0.222±0.003)x1012xB1.998±0.004 in a magnetic field of less than 50 μT.

  10. Dicty_cDB: Contig-U10165-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available snqfmfnhq*fihklqls*klvttmdiiitmaimvimiitt tvimvttklfk*qkfstktkikkknfvl*liit*nkkiiikktyiyf Frame C: laywn*lf*... DRAFT... 54 0.005 1 ( FK712712 ) pl_002-H8 Ilyanassa (snail) 0-48h Ilyanassa obsol... 54 0.005 1 ( FC607889...76 1 ( FH741568 ) CHO_OF5158xb15f1.ab1 CHO_OF5 Nicotiana tabacum ge... 50 0.076 1 ( ER434337 ) 1092963791167 Global-Ocean...UNKNOWN clone CH250-513... 48 0.18 2 ( EY299335 ) CAWX14410.rev CAWX Helobdella robusta Primary Ear... 34 0.... BD100893 ) Novel genes cloned in humanneuroblastoma and frag... 48 0.30 1 ( BD020955 ) Novel gene and novel

  11. Charged hadron lepto-production off unpolarized protons and deuterons at HERMES

    Science.gov (United States)

    Karyan, Gevorg

    2014-06-01

    The HERMES collaboration has measured charge-separated pion and kaon multiplicities in semi-inclusive deep-inelastic scattering using a 27.6 GeV electron or positron beam scattering off a hydrogen or deuterium target. The results are presented as functions of the Bjorken variable xB, the negative squared four-momentum transfer Q2, a hadron fractional energy z and the hadron's transverse momentum. These data will be very useful to understand the quark-fragmentation process in deep-inelastic hadron electro-production and will serve as crucial input in the understanding of charge and flavour separated fragmentation functions. Furthermore, it provides important information on the transverse-momentum dependence of hadron production.

  12. Charged hadron lepto-production off unpolarized protons and deuterons at HERMES

    Directory of Open Access Journals (Sweden)

    Karyan Gevorg

    2014-06-01

    Full Text Available The HERMES collaboration has measured charge-separated pion and kaon multiplicities in semi-inclusive deep-inelastic scattering using a 27.6 GeV electron or positron beam scattering off a hydrogen or deuterium target. The results are presented as functions of the Bjorken variable xB, the negative squared four-momentum transfer Q2, a hadron fractional energy z and the hadron's transverse momentum. These data will be very useful to understand the quark-fragmentation process in deep-inelastic hadron electro-production and will serve as crucial input in the understanding of charge and flavour separated fragmentation functions. Furthermore, it provides important information on the transverse-momentum dependence of hadron production.

  13. The JLab 12GeV Upgrade and the Initial Science Program

    CERN Document Server

    Burkert, Volker D

    2012-01-01

    An overview is presented of the upgrade of JLab's cw electron accelerator from a maximum beam energy of currently 6 GeV to 12 GeV. Construction of the 12 GeV upgrade project has started in 2008. A broad experimental program has been developed to map the nucleon's intrinsic correlated spin and momentum distribution through measurements of deeply exclusive and semi-inclusive processes, and to probe the quark and gluon confinement by studying the spectrum of mesons with exotic quantum numbers. Other programs include the forward parton distribution function at large xB, the quark and gluon polarized distribution functions, the measurements of electromagnetic form factors of the nucleon ground state and of nucleon resonance transitions at high Q2, and the exploration of physics beyond the Standard Model in high precision parity violating processes. The 12 GeV electron beam is also well suited to explore quark hadronization properties using the nucleus as a laboratory.

  14. Qualitative and Quantitative Analysis of Volatile Components of Zhengtian Pills Using Gas Chromatography Mass Spectrometry and Ultra-High Performance Liquid Chromatography

    Science.gov (United States)

    Liu, Cui-ting; Zhang, Min; Yan, Ping; Liu, Hai-chan; Liu, Xing-yun; Zhan, Ruo-ting

    2016-01-01

    Zhengtian pills (ZTPs) are traditional Chinese medicine (TCM) which have been commonly used to treat headaches. Volatile components of ZTPs extracted by ethyl acetate with an ultrasonic method were analyzed by gas chromatography mass spectrometry (GC-MS). Twenty-two components were identified, accounting for 78.884% of the total components of volatile oil. The three main volatile components including protocatechuic acid, ferulic acid, and ligustilide were simultaneously determined using ultra-high performance liquid chromatography coupled with diode array detection (UHPLC-DAD). Baseline separation was achieved on an XB-C18 column with linear gradient elution of methanol-0.2% acetic acid aqueous solution. The UHPLC-DAD method provided good linearity (R2 ≥ 0.9992), precision (RSD protocatechuic acid, ferulic acid, and ligustilide, in 13 batches of ZTPs, which is suitable for discrimination and quality assessment of ZTPs. PMID:26904360

  15. Glass capable of ionic conduction and method of preparation

    Science.gov (United States)

    Susman, S.; Boehm, L.; Volin, K.J.; Delbecq, C.J.

    1982-05-06

    Sulfide glasses capable of conducting alkali metal ions are prepared from a nonmetal glass former such as GeS/sub 2/, B/sub 2/S/sub 2/ and SiS/sub 2/ in mixture with a glass modifier such as Na/sub 2/S or another alkali metal sulfide. A molten mixture of the constituents is rapidly quenched to below the glass transition temperature by contact with a metal mold. The rapid quench is sufficient to prevent crystallization and permit solidification as an amorphous solid mixture. An oxygen-free atmosphere is maintained over the mixture to prevent oxidation. A new glass system of (1 - X) Na/sub 2/O:XB/sub 2/S/sub 3/ is disclosed.

  16. Performance of local correlation methods for halogen bonding: The case of Br{sub 2}–(H{sub 2}O){sub n},n = 4,5 clusters and Br{sub 2}@5{sup 12}6{sup 2} clathrate cage

    Energy Technology Data Exchange (ETDEWEB)

    Batista-Romero, Fidel A.; Bernal-Uruchurtu, Margarita I.; Hernández-Lamoneda, Ramón, E-mail: ramon@uaem.mx [Centro de Investigaciones Químicas, Universidad Autónoma del Estado de Morelos, Av. Universidad 1001, Cuernavaca, Morelos 62209 (Mexico); Pajón-Suárez, Pedro [Instituto Superior de Tecnologías y Ciencias Aplicadas (InSTEC), Habana 6163 (Cuba)

    2015-09-07

    The performance of local correlation methods is examined for the interactions present in clusters of bromine with water where the combined effect of hydrogen bonding (HB), halogen bonding (XB), and hydrogen-halogen (HX) interactions lead to many interesting properties. Local methods reproduce all the subtleties involved such as many-body effects and dispersion contributions provided that specific methodological steps are followed. Additionally, they predict optimized geometries that are nearly free of basis set superposition error that lead to improved estimates of spectroscopic properties. Taking advantage of the local correlation energy partitioning scheme, we compare the different interaction environments present in small clusters and those inside the 5{sup 12}6{sup 2} clathrate cage. This analysis allows a clear identification of the reasons supporting the use of local methods for large systems where non-covalent interactions play a key role.

  17. The spectrum for overlarge sets of directed triple systems

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    A directed triple system of order v, denoted by DTS(v, λ), is a pair (X,B) where X is a v-set and B is a collection of transitive triples on X such that every ordered pair of X belongs to λ triples of B. An overlarge set of disjoint DTS(v, λ), denoted by OLDTS(v, λ), is a collection {(Y\\{y}, Ai)}i,such that Y is a (v + 1)-set, each (Y\\{y}, Ai) is a DTS(v, λ) and all Ai's form a partition of all transitive triples of Y. In this paper, we shall discuss the existence problem of OLDTS(v, λ) and give the following conclusion: there exists an OLDTS(v, λ) if and only if either λ = 1 and v = 0, 1 (mod 3), or λ = 3 and v≠2.

  18. Singular value and‎ ‎arithmetic-geometric mean inequalities for operators

    OpenAIRE

    Albadawi, Hussien

    2012-01-01

    ‎A singular value inequality for sums and products of Hilbert space operators‎ ‎is given‎. ‎This inequality generalizes several recent singular value‎ ‎inequalities‎, ‎and includes that if $A$‎, ‎$B$‎, ‎and $X$ are positive operators‎ ‎on a complex Hilbert space $H$‎, ‎then ‎\\begin{equation*}‎ ‎s_{j}\\left( A^{^{1/2}}XB^{^{1/2}}\\right) \\leq \\frac{1}{2}\\left\\Vert‎ ‎X\\right\\Vert \\text{ }s_{j}\\left( A+B\\right) \\text{, ‎\\‎ ‎}j=1,2,\\cdots\\text{,}‎ ‎\\end{equation*} ‎which is equ...

  19. Exact distribution of MLE of covariance matrix in a GMANOVA-MANOVA model

    Institute of Scientific and Technical Information of China (English)

    BAI; Peng

    2005-01-01

    For a GMANOVA-MANOVA model with normal error: Y = XB1Z1T + B2Z2T +E, E ~ Nq×n(0, In(×) ∑), the present paper is devoted to the study of distribution of MLE,Σ, of covariance matrix ∑. The main results obtained are stated as follows: (1) When rk(Z) -rk(Z2) ≥ q-rk(X), the exact distribution of (Σ) is derived, where Z = (Z1, Z2), rk(A)denotes the rank of matrix A. (2) The exact distribution of |(Σ)| is gained. (3) It is proved that ntr{[∑-1 - ∑-1XM(MTXT∑-1XM)-1MTXT∑-1]Σ} has x2(q-rk(X))(n-rk(Z2)) distribution, where M is the matrix whose columns are the standardized orthogonal eigenvectors corresponding to the nonzero eigenvalues of XT∑-1X.

  20. A clonal complex 12 methicillin-resistant Staphylococcus aureus strain, West Australian MRSA-59, harbors a novel pseudo-SCCmec element.

    Science.gov (United States)

    Monecke, Stefan; Coombs, Geoffrey W; Pearson, Julie; Hotzel, Helmut; Slickers, Peter; Ehricht, Ralf

    2015-11-01

    A West Australian methicillin-resistant Staphylococcus aureus strain (WA MRSA-59) was characterized by microarray and sequencing. Its pseudo-staphylococcal cassette chromosome mec (SCCmec) element comprised dcs, Q9XB68-dcs, mvaS-SCC, Q5HJW6, dru, ugpQ, ydeM, mecA-mecR-mecI, txbi mecI, tnp IS431, copA2-mco (copper resistance), ydhK, arsC-arsB-arsR (arsenic resistance), open reading frame PT43, and per-2. Recombinase genes, xylR (mecR2), and PSM-mec (phenol-soluble modulin) were absent. We suggest that mec complex A should be split into two subtypes. One harbors PSM-mec and xylR (mecR2). It is found in SCCmec types II, III, and VIII. The second subtype, described herein, is present in WA MRSA-59 and some coagulase-negative staphylococci. PMID:26349822

  1. Dicty_cDB: Contig-U09951-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available tensions: 57003 Number of sequences better than 10.0: 105 Number of HSP's gapped: 56905 Number of HSP's successfull...: 5, Extension: 2 Number of Hits to DB: 12,636 Number of Sequences: 6905 Number of extensions: 12636 Number of succe...6611xb01r1.ab1 CHO_OF6 Nicotiana tabacum ge... 46 1.7 1 ( ET631857 ) lbuc_s_332 Leptotrichia buccalis ATCC 1....2, whole genome... 38 2.1 3 ( EH341788 ) 203907_1559_2880 3' ESTs from HeLa cell Homo sapi... 38 3.3 2 ( AM...umber of Hits to DB: 914,579,870 Number of extensions: 57286262 Number of successful extensions: 4746767 Number of sequence

  2. Theoretical Study of the B(sup 3) Sigma(sup -, sub u) - X(sup3)Sigma(sub g, sup -) and B"(sup 3)Pi(sub u) - X(sup 3)Sigma(sub g, sup -) Band Systems of S(sub 2)

    Science.gov (United States)

    Pradhan, Atul D.; Partridge, Harry; Langhoff, Stephen R. (Technical Monitor)

    1995-01-01

    Multireference configuration-interaction (MRCI) wavefunctions and potential energy curves have been calculated for the X(sup 3)Sigma(sub g,sup -), B(sup 3)Sigma(sub u, Sup -) and B"(sup 3)Pi((sub u) states of S(sub 2) using correlation consistent Gaussian basis sets. These wavefunctions are utilized to compute the the transition dipole moments of the B(sup 3)Sigma(sub g, sup -) - X(sup 3) Sigma(sub g, sup -) and B"(sup 3)Pi(sub u) - X(sup 3)Sigma(sub g, sup -) systems. Oscillator strengths, transition probabilities, and radiative lifetimes are computed for the X-B system and comparison is made with experimental data.

  3. Particle acceleration and plasma energization in substorms: MHD and test particle studies

    Energy Technology Data Exchange (ETDEWEB)

    Birn, Joachim [Los Alamos National Laboratory

    2015-07-16

    The author organizes his slide presentation under the following topics: background, MHD simulation, orbit integration, typical orbits, spatial and temporal features, acceleration mechanisms, source locations, and source energies. Field-­aligned energetic particle fluxes are shown for 45-keV electrons and 80-keV protons. It is concluded that the onset from local thin current sheet is electron tearing. Acceleration is mainly from field collapse, governed by Ey = -vxXBz: importance of localization; betatron acceleration (similar if nonadiabatic); 1st order Fermi, type B (or A; current sheet acceleration). There are two source regions (of comparable importance in magnetotail): - flanks, inner tail - drift entry - early, higher energy - outer plasma sheet - reconnection entry - later, lower energy. Both thermal and suprathermal sources are important, with limited energy range for acceleration

  4. XB的临床应用及其评价

    Institute of Scientific and Technical Information of China (English)

    胡汝南; 邹静娟

    1997-01-01

    目前,以血细胞分析仪逐渐替代血常规的手工操作,测量参数不断增加,其中红细胞的三大平均指数即MCV、MCH、MCHC.它们的每一移动批的均值称之为XB。1974年英国BulI提出,就正常健康成人而言,每一移动批的均值(XB)应稳定在靶值范围内,并具世界性。Bull认为XB:MCV895fI,MCH305Pg,MCHC340g/L;并可作为监测仪器性能及检测

  5. An Approach to Determining the Optimal Cell Number of Manufacturing Cell Formation

    Directory of Open Access Journals (Sweden)

    Jianwei Wang

    2013-04-01

    Full Text Available An approach to determining the optimal cell number of manufacturing cell formation is presented. Firstly, the difference of weighting exponent, cluster center and metrics how to have an impact upon the clustering results and membership function are studied. Secondly, a method to determine the optimal m value is given. Two-order partial derivative of the objective function for FCM is calculated, and the variational weighting exponent m is obtained that can prevent the parameter from being the unique value and play an important role in the process of fuzzy clustering. Moreover, in order to avoid a single validity index can not assess correctly, partition coefficient (PC, classification entropy (CE, Fukuyama and Sugeno (FS and Xie and Beni (XB are considered as multi-performance indexes to evaluate the cluster validity, and then an optimal number c is chosen based on these validity measures. Finally, test exampls are given to illustrate the validity of the proposed approach.

  6. CEPF Western Ghats Special Series: Length-weight and length-length relationship of three species of snakehead fish, Channa diplogramma, C. marulius and C. striata from the riverine reaches of Lake Vembanad, Kerala, India.

    Directory of Open Access Journals (Sweden)

    A. Ali

    2013-09-01

    Full Text Available The length-weight relationship (LWR and length-length relationships (LLR of three snakehead fishes, Channa diplogramma, C. marulius and C. striata, exploited by small-scale fishers in the riverine reaches of Lake Vembanad, Kerala were studied using the allometric growth equation Y = aXb. Our analysis shows that the LWR of C. diplogramma and C. marulius is nonisometric with exponents much smaller than the cubic value (b = 3, while that of C. striata is isometric. Channa marulius showed a definite change in LWR with size, with smaller fish growing with positive allometric exponents (b greater than 3 and larger individuals having negative allometric relationship (b less than 3, indicating a possible age-related change in growth pattern. In the case of LLR, all three snakehead species showed non-isometric growth patterns. The caudal fin did not grow substantially with increasing fish length.

  7. A Modified Newton Method for Absolute Value Equations%修正牛顿法求解绝对值方程

    Institute of Scientific and Technical Information of China (English)

    邓永坤

    2012-01-01

    利用修正牛顿法提出了求解绝对值方程Ax-|x|=b的一种算法,对算法的收敛性进行了分析和证明,并将修正牛顿法与牛顿法进行了比较,比较表明修正牛顿法的计算效率更高,最后通过数值实验表明该算法是有效的.%In this paper, by using the modified Newton method, an algorithm is proposed for solving the absolute value equationAx - |x|=b. Theoretic analysis for the convergence of the algorithm is given and by comparing with Newton indicate that the method is od we get that the Newton method is more effective. Numerical results feasible to the absolute value equation

  8. Complex Heat Capacity of Lithium Borate Glasses Studied by Modulated DSC

    International Nuclear Information System (INIS)

    Complex heat capacity, Cp* = Cp' - iCp'', of lithium borate glasses Li2O·(1-x)B2O3 (x = 0.00 - 0.33) has been investigated by Modulated DSC (MDSC). We have successfully observed the frequency dependent Cp* by MDSC in the frequency range 0.01 to 0.1 Hz, and the average relaxation time of glass transition has been determined as a function of temperature. Moreover, the composition dependence of the thermal properties has been investigated. The calorimetric glass transition temperatures become higher with the increase of concentration of Li2O and show the board maximum around x = 0.26-0.28. The width of glass transition region becomes narrower as Li2O increases. These results relate to the change of the fragility of the system. It has been proven that the complex heat capacity spectroscopy by MDSC is a powerful tool to investigate the glass transition phenomena

  9. Complex Heat Capacity of Lithium Borate Glasses Studied by Modulated DSC

    Science.gov (United States)

    Matsuda, Yu; Matsui, Chihiro; Ike, Yuji; Kodama, Masao; Kojima, Seiji

    2006-05-01

    Complex heat capacity, Cp* = Cp' - iCp″, of lithium borate glasses Li2Oṡ(1-x)B2O3 (x = 0.00 - 0.33) has been investigated by Modulated DSC (MDSC). We have successfully observed the frequency dependent Cp* by MDSC in the frequency range 0.01 to 0.1 Hz, and the average relaxation time of glass transition has been determined as a function of temperature. Moreover, the composition dependence of the thermal properties has been investigated. The calorimetric glass transition temperatures become higher with the increase of concentration of Li2O and show the board maximum around x = 0.26-0.28. The width of glass transition region becomes narrower as Li2O increases. These results relate to the change of the fragility of the system. It has been proven that the complex heat capacity spectroscopy by MDSC is a powerful tool to investigate the glass transition phenomena.

  10. Investigation of Proton-Proton Short-Range Correlations via the 12C(e,e'pp) Reaction

    OpenAIRE

    Shneor, R.; Monaghan, P.; Subedi, R.

    2007-01-01

    We investigated simultaneously the 12C(e,e'p) and 12C(e,e'pp) reactions at Q2 = 2 [GeV/c]2, x_B = 1.2, and in an (e,e'p) missing-momentum range from 300 to 600 MeV/c. At these kinematics, with a missing-momentum greater than the Fermi momentum of nucleons in a nucleus and far from the delta excitation, short-range nucleon-nucleon correlations are predicted to dominate the reaction. For(9.5 +/- 2)% of the 12C(e,e'p) events, a recoiling partner proton was observed back-to-back to the 12C(e,e'p)...

  11. Investigation of Proton-Proton Short-Range Correlations via the 12C(e,e'pp) Reaction

    International Nuclear Information System (INIS)

    We investigated simultaneously the 12C(e,e'p) and 12C(e,e'pp) reactions at Q2=2 (GeV/c)2, xB=1.2, and in an (e, e'p) missing-momentum range from 300 to 600 MeV/c. At these kinematics, with a missing momentum greater than the Fermi momentum of nucleons in a nucleus and far from the delta excitation, short-range nucleon-nucleon correlations are predicted to dominate the reaction. For (9.5±2)% of the 12C(e,e'p) events, a recoiling partner proton was observed back-to-back to the 12C(e,e'p) missing-momentum vector, an experimental signature of correlations

  12. Investigation of Proton-Proton Short-Range Correlations via the 12C(e,e'pp) Reaction

    CERN Document Server

    Shneor, R; Subedi, R; al, et

    2007-01-01

    We investigated simultaneously the 12C(e,e'p) and 12C(e,e'pp) reactions at Q2 = 2 [GeV/c]2, x_B = 1.2, and in an (e,e'p) missing-momentum range from 300 to 600 MeV/c. At these kinematics, with a missing-momentum greater than the Fermi momentum of nucleons in a nucleus and far from the delta excitation, short-range nucleon-nucleon correlations are predicted to dominate the reaction. For(9.5 +/- 2)% of the 12C(e,e'p) events, a recoiling partner proton was observed back-to-back to the 12C(e,e'p) missing momentum vector, an experimental signature of correlations.

  13. Radiative Corrections to Chargino Production in Electron-Positron Collisions

    CERN Document Server

    Díaz, M A; Ross, D A; Diaz, Marco A.; King, Steve F.; Ross, Douglas A.

    1998-01-01

    We discuss the one-loop radiative corrections to the reaction e^+ e^- -> X^+_a X^-_b, for a,b=1,2 where X^+_{1,2} are the charginos of the minimal supersymmetric standard model. We calculate the leading one loop radiative corrections involving loops of top, stop bottom and sbottom quarks, working in the MS-bar scheme. At LEP2 we find positive radiative corrections typically of 10% to 15% and with a maximum value of approximately 30% if the squark mass parameters are of the order of 1 TeV. If \\sqrt{s}=500 GeV we find smaller corrections but they can be also negative, with extreme values of 13% and -4%. For a center of mass given by \\sqrt{s}=2 TeV we find larger corrections, with typical values between 20% and -20%.

  14. यूनिकोड: भाषा प्रोद्योगिकी में हिन्दी का नया औजार

    Digital Repository Service at National Institute of Oceanography (India)

    Sharma, R.

    H${gV Xoem| H$s VwbZm ‘|, Ohm§ B§Q>aZoQ> H$mo 70 à{VeV go A{YH$ bmoJm| Ûmam BñVo‘mb {H$`m OmVm h¡, ~hþV H$‘ h¡& ^maV ‘| A§J«oOr H$mo hr B§Q>aZoQ> H$s ^mfm ‘mZm OmVm h¡, bo{H$Z `h pñW{V `y{ZH$moS> Ho$ ‘mÜ`‘ go ~Xb ahr h¡ & {dœ H$s A{YH$m§e ^mfmAm| H$mo `y...

  15. Cross Sections for the Exclusive Photon Electroproduction on the Proton and Generalized Parton Distributions.

    Science.gov (United States)

    Jo, H S; Girod, F X; Avakian, H; Burkert, V D; Garçon, M; Guidal, M; Kubarovsky, V; Niccolai, S; Stoler, P; Adhikari, K P; Adikaram, D; Amaryan, M J; Anderson, M D; Anefalos Pereira, S; Ball, J; Baltzell, N A; Battaglieri, M; Batourine, V; Bedlinskiy, I; Biselli, A S; Boiarinov, S; Briscoe, W J; Brooks, W K; Carman, D S; Celentano, A; Chandavar, S; Charles, G; Colaneri, L; Cole, P L; Compton, N; Contalbrigo, M; Crede, V; D'Angelo, A; Dashyan, N; De Vita, R; De Sanctis, E; Deur, A; Djalali, C; Dupre, R; Alaoui, A El; Fassi, L El; Elouadrhiri, L; Fedotov, G; Fegan, S; Filippi, A; Fleming, J A; Garillon, B; Gevorgyan, N; Ghandilyan, Y; Gilfoyle, G P; Giovanetti, K L; Goetz, J T; Golovatch, E; Gothe, R W; Griffioen, K A; Guegan, B; Guler, N; Guo, L; Hafidi, K; Hakobyan, H; Harrison, N; Hattawy, M; Hicks, K; Hirlinger Saylor, N; Ho, D; Holtrop, M; Hughes, S M; Ilieva, Y; Ireland, D G; Ishkhanov, B S; Jenkins, D; Joo, K; Joosten, S; Keller, D; Khachatryan, G; Khandaker, M; Kim, A; Kim, W; Klein, A; Klein, F J; Kuhn, S E; Kuleshov, S V; Lenisa, P; Livingston, K; Lu, H Y; MacGregor, I J D; McKinnon, B; Meziani, Z E; Mirazita, M; Mokeev, V; Montgomery, R A; Moutarde, H; Movsisyan, A; Munevar, E; Munoz Camacho, C; Nadel-Turonski, P; Net, L A; Niculescu, G; Osipenko, M; Ostrovidov, A I; Paolone, M; Park, K; Pasyuk, E; Phillips, J J; Pisano, S; Pogorelko, O; Price, J W; Procureur, S; Prok, Y; Puckett, A J R; Raue, B A; Ripani, M; Rizzo, A; Rosner, G; Rossi, P; Roy, P; Sabatié, F; Salgado, C; Schott, D; Schumacher, R A; Seder, E; Simonyan, A; Skorodumina, Iu; Smith, G D; Sokhan, D; Sparveris, N; Stepanyan, S; Strakovsky, I I; Strauch, S; Sytnik, V; Tian, Ye; Tkachenko, S; Ungaro, M; Voskanyan, H; Voutier, E; Walford, N K; Watts, D P; Wei, X; Weinstein, L B; Wood, M H; Zachariou, N; Zana, L; Zhang, J; Zhao, Z W; Zonta, I

    2015-11-20

    Unpolarized and beam-polarized fourfold cross sections (d^{4}σ/dQ^{2}dx_{B}dtdϕ) for the ep→e^{'}p^{'}γ reaction were measured using the CLAS detector and the 5.75-GeV polarized electron beam of the Jefferson Lab accelerator, for 110 (Q^{2},x_{B},t) bins over the widest phase space ever explored in the valence-quark region. Several models of generalized parton distributions (GPDs) describe the data well at most of our kinematics. This increases our confidence that we understand the GPD H, expected to be the dominant contributor to these observables. Through a leading-twist extraction of Compton form factors, these results support the model predictions of a larger nucleon size at lower quark-momentum fraction x_{B}. PMID:26636848

  16. Power Cocentralizing Generalized Derivations on Prime Rings

    Indian Academy of Sciences (India)

    Vincenzo De Filippis

    2010-06-01

    Let be a prime ring, the Utumi quotient ring of $R,C=Z(U)$ the extended centroid of , a non-central Lie ideal of , and non-zero generalized derivations of . Suppose that there exists an integer $n≥ 1$ such that $(H(u)u-uG(u))^n=0$, for all $u\\in L$, then one of the following holds: (1) there exists $c\\in U$ such that $H(x)=xc,G(x)=cx;(2)R$ satisfies the standard identity $s_4$ and char ()=2; (3) satisfies $s4$ and there exist $a, b, c\\in U$, such that $H(x)=ax+xc,G(x)=cx+xb$ and $(a-b)^n=0$.

  17. Absorption and emission properties of Eu3+ ions in Sodium fluoroborate glasses

    International Nuclear Information System (INIS)

    This article presents the optical absorption and emission properties of Eu3+ in sodium fluoroborate glasses of the type XNaF.(89-X)B2O3.10Al2O3.1Eu2O3 (where X=8, 12, 16, 20, and 24). Judd-Ofelt (JO) intensity parameters (Ω2, Ω4, Ω6) are derived from the absorption spectra. These parameters have been used to calculate radiative transition probabilities (A rad), lifetimes (τ R) and branching ratios (β R) for the excited level 5D0. The predicted values of τ R are compared with the measured values for 5D0 level for five glass compositions (Glass (A-E)). The stimulated emission cross section σ(λP) are also evaluated for the 5D0→7FJ (J=0,1,2,3,4) transitions

  18. Hα diagnostic in a recombining plasma

    Science.gov (United States)

    Wenzel, U.; Goto, M.

    2016-05-01

    In fusion devices the hydrogen Balmer lines are used to measure the neutral flux from the walls into the plasma using the atomic physics factor S/XB. This is a standard diagnostic which can be applied in ionizing plasma using {{H}α} , {{H}β} or {{H}γ} without knowledge of the electron density. We will extend this method to a recombining plasma in front of a surface. {{H}α} can be used in an analogous way to measure the plasma flow to this surface which can be e.g. a divertor target. The other Balmer lines are not suitable because the corresponding atomic physics factor R/YB depends on density due to three-body recombination. An application of this diagnostic method is provided.

  19. Pertumbuhan Alometri Dimensi Panjang dan Lingkar Tubuh Sapi Bali Jantan

    Directory of Open Access Journals (Sweden)

    I Putu Sampurna

    2010-03-01

    Full Text Available Research was conducted at Bukit Jimbaran, Badung Bali from September to October 2007 to investigatethe lenght and circular body dimension of Bali cattle. Ten young male bali cattle 0.5-1.5 year old weremeasured for three times at 2 weeks interval. Collected data was analysed with regretion-corelation byallometric growth lines Y = aXb. F test and coeficient-correlation was then used to chek the validity andacurate models. Result showed that the lenght head, neck, body anterior and posterior had medium potentialgrowth. Circular neck anterior grew early with a high potential. The circular neck posterior growth potentialwas medium, where as circular thorax and abdomen was law poitential growth.

  20. Beam-spin asymmetry of pion, kaon, proton and antiproton production in semi-inclusive deep-inelastic scattering

    International Nuclear Information System (INIS)

    Beam-spin asymmetries in the azimuthal distribution of pions, kaons, protons and antiprotons in semi-inclusive deep inelastic scattering (SIDIS) extracted from 2000-2007 HERMES data are presented. The asymmetries were measured in the kinematic region Q2>1 GeV2, W2 > 10 GeV2, 0.1 xB, z and ph perpendicular to dependencies of the sin(φ) modulation of the asymmetries for pions, kaons, protons and antiprotons are shown. Assuming that the SIDIS cross section factorizes to distribution (DF) and fragmentation (FF) functions that dependent on transverse quark momentum (TMD functions), one can obtain novel information about the spin-orbit correlations inside the nucleon and orbital angular momentum of quarks.