WorldWideScience

Sample records for burster gs 1826-238

  1. Swift observations of GS 1826-238

    Science.gov (United States)

    Ji, L.; Santangelo, A.; Zhang, S.; Ducci, L.; Suleimanov, V.

    2018-02-01

    GS 1826-238 is a well-studied low-mass X-ray binary neutron star. This source was in a persistent hard state since its discovery in 1988 and until 2014 June. After that, the source exhibited several softer periods of enhanced intensity in the energy range 2-20 keV. We studied the long-term light curves of MAXI (Monitor of All Sky X-ray Image) and Swift/BAT, and found clearly two branches in the MAXI-BAT and hardness-intensity diagrams, which correspond to the persistent state and softer periods, respectively. We analysed 21 Swift/XRT observations, of which four were located in the persistent state while the others were in softer periods or in a state between them. The XRT spectra could be generally fitted by using an absorbed Comptonization model with no other components required. We found a peculiar relationship between the luminosity and the hardness in the energy range of 0.6-10 keV: when the luminosity is larger (smaller) than 4 per cent-6 per cent Ledd, the hardness is anti-correlated (correlated) with luminosity. We also estimated the variability for each observation by using the fractional rms in the 0.1-10 Hz range. We found that the observations in the persistent state had a large fractional rms of ˜25 per cent, similar to other low-mass X-ray binaries. However, the variability is mainly found in the range of 5 per cent-20 per cent during softer periods. We suggest that GS 1826-238 did not evolve into the soft state of atoll sources, and all the observed XRT observations during the softer periods resemble a peculiar intermediate state of atoll sources.

  2. MAXI/GSC detection of a hard-to-soft transition of NS-LMXB GS 1826-238

    Science.gov (United States)

    Nakahira, S.; Mihara, T.; Sugizaki, M.; Serino, M.; Morii, M.; Sugimoto, J.; Takagi, T.; Yoshikawa, A.; Matsuoka, M.; Kawai, N.; Yoshii, T.; Tachibana, Y.; Ueno, S.; Tomida, H.; Kimura, M.; Ishikawa, M.; Nakagawa, Y. E.; Negoro, H.; Nakajima, M.; Fukushima, K.; Onodera, T.; Suzuki, K.; Fujita, M.; Namba, T.; Honda, F.; Yoshida, A.; Sakamoto, T.; Kawakubo, Y.; Ohtsuki, H.; Tsunemi, H.; Uchida, D.; Ueda, Y.; Shidatsu, M.; Kawamuro, T.; Hori, T.; Kawagoe, A.; Tsuboi, Y.; Yamauchi, M.; Morooka, Y.; Yamaoka, K.

    2014-06-01

    We report on a hard-to-soft spectral transition of an X-ray burster GS 1826-238 detected with MAXI/GSC. This source had been consistently observed in the hard state for more than 25 years since the discovery in 1988 (Tanaka 1989, Barret et al. ...

  3. HARD X-RAY TAIL DISCOVERED IN THE CLOCKED BURSTER GS 1826–238

    Energy Technology Data Exchange (ETDEWEB)

    Rodi, J.; Jourdain, E.; Roques, J. P., E-mail: jrodi@irap.omp.eu [Université de Toulouse, UPS-OMP, IRAP, Toulouse (France)

    2016-02-01

    The low-mass X-ray binary (LMXB) neutron star (NS) GS 1826–238 was discovered by Ginga in 1988 September. Due to the presence of quasi-periodicity in the type I X-ray burst rate, the source has been a frequent target of X-ray observations for almost 30 years. Though the bursts were too soft to be detected by INTEGRAL/SPI, the persistent emission from GS 1826–238 was detected over 150 keV during the ∼10 years of observations. Spectral analysis found a significant high-energy excess above a Comptonization model that is well fit by a power law, indicating an additional spectral component. Most previously reported spectra with hard tails in LMXB NS have had an electron temperature of a few keV and a hard tail dominating above ∼50 keV with an index of Γ ∼ 2–3. GS 1826–238 was found to have a markedly different spectrum with kT{sub e} ∼ 20 keV and a hard tail dominating above ∼150 keV with an index of Γ ∼ 1.8, more similar to black hole X-ray binaries. We report on our search for long-term spectral variability over the 25–370 keV energy range and on a comparison of the GS 1826–238 average spectrum to the spectra of other LMXB NSs with hard tails.

  4. A soft X-ray spectral episode for the Clocked Burster, GS 1826-24 as measured by Swift and NuSTAR

    DEFF Research Database (Denmark)

    Chenevez, J.; Galloway, D.K.; in ’t Zand, J.J.M.

    2016-01-01

    We report on NuSTAR and Swift observations of a soft state of the neutron star low-mass X-ray binary GS 1826–24, commonly known as the "clocked" burster. The transition to the soft state was recorded in 2014 June through an increase of the 2–20 keV source intensity measured by MAXI, simultaneous ...

  5. Experimental signatures of gravitational wave bursters

    International Nuclear Information System (INIS)

    Dubath, Florian; Foffa, Stefano; Gasparini, Maria Alice; Maggiore, Michele; Sturani, Riccardo

    2005-01-01

    Gravitational wave bursters are sources which emit repeatedly bursts of gravitational waves, and have been recently suggested as potentially interesting candidates for gravitational wave (GW) detectors. Mechanisms that could give rise to a GW burster can be found for instance in highly magnetized neutron stars (the 'magnetars' which explain the phenomenon of soft gamma repeaters), in accreting neutron stars and in hybrid stars with a quark core. We point out that these sources have very distinctive experimental signatures. In particular, as already observed in the γ-ray bursts from soft gamma repeaters, the energy spectrum of the events is a power-law, dN∼E -γ dE with γ≅1.6, and they have a distribution of waiting times (the times between one outburst and the next) significantly different from the distribution of uncorrelated events. We discuss possible detection strategies that could be used to search for these events in existing gravitational wave detectors

  6. Infrared and X-ray bursts from the rapid burster

    International Nuclear Information System (INIS)

    Apparao, K.M.V.; Chitre, S.M.

    1979-01-01

    Studies on sudden bursts from the cosmic X-ray sources are reported. The processes occuring from the rise in luminosity of an x-ray source to its collapse are described. Records of the x-ray burst from the globular cluster NGC 6624 and the 'Rapid Burster' are shown. The Infra-red bursts from the Rapid Burster are also explained. (A.K.)

  7. Search for infrared counterparts of gamma-ray bursters

    International Nuclear Information System (INIS)

    Schaefer, B.E.; Cline, T.L.

    1985-01-01

    The result of two searches for infrared counterparts of Gamma-ray Bursters (GRB's) is reported. The first search was made using data from the Infrared Astronomy Satellite and covered 23 positions. The second search was made with the Kitt Peak 1.5 m telescope and covered 3 positions. In neither of these two searches was any infrared candidate detected

  8. Recent activity of the Rapid Burster (MXB 1730-335)

    DEFF Research Database (Denmark)

    Kuulkers, E.; Brandt, Søren Kristian; Markwardt, C.

    2008-01-01

    Observations taken as part of the INTEGRAL Galactic bulge monitoring program (see ATel #1385) on 2008, February 23 13:32-17:13 (UT) showed bursting activity from the X-ray transient, the Rapid Burster (MXB 1730-335). During one of the 1800-sec pointings when the source was in the field- of-view o...

  9. Identification of a Likely Radio Counterpart to the Rapid Burster

    Science.gov (United States)

    Moore, Christopher B.; Rutledge, Robert E.; Fox, Derek W.; Guerriero, Robert A.; Lewin, Walter H. G.; Fender, Robert; van Paradijs, Jan

    2000-04-01

    We have identified a likely radio counterpart to the low-mass X-ray binary MXB 1730-335 (the Rapid Burster). The counterpart has shown 8.4 GHz radio on/off behavior correlated with the X-ray on/off behavior as observed by the RXTE/ASM during six VLA observations. The probability of an unrelated, randomly varying background source duplicating this behavior is 1%-3% depending on the correlation timescale. The location of the radio source is R.A. 17h33m24.61s, decl. -33 deg23'19.8" (J2000), +/-0.1". We do not detect 8.4 GHz radio emission coincident with type II (accretion-driven) X-ray bursts. The ratio of radio to X-ray emission during such bursts is constrained to be below the ratio observed during X-ray-persistent emission at the 2.9 σ level. Synchrotron bubble models of the radio emission can provide a reasonable fit to the full data set, collected over several outbursts, assuming that the radio evolution is the same from outburst to outburst but given the physical constraints the emission is more likely to be due to ~1 hr radio flares such as have been observed from the X-ray binary GRS 1915+105.

  10. A simple satellite system to locate gamma-ray bursters using scintillating fiber technology

    International Nuclear Information System (INIS)

    Colavita, A.; Fratnik, F.

    1993-07-01

    We present a study on the feasibility of using a system of small, light, long-lived and simple satellites in order to locate gamma-ray bursters. Each small satellite possesses only electronics to discriminate gamma-rays out of the large background of cosmic rays and to time the arrival of the front of a gamma-ray burst. The arrival of a γ-ray strikes a plane made out of scintillating fibers. A layered structure of thin lead foils and scintillating fibers is used to obtain a low trigger threshold of approximately 20 MeV. To locate the burster applying triangulation methods, we use the time of arrival of the front of the gamma-ray burst and the position of the satellites at that very moment. We review an elementary version of the triangulation method to study the angular error in the determination of the burster position. We show that for almost all non-pathological distances among satellites we can determine the angular location of the source to better than one arc min. This precision allows us to find the visible counterpart of the burster, if it exists. These simple satellites can be made modular in order to customize their sizes or weights in order to use spare space available during major launches. We also propose a block diagram for the satellite architecture as well as a simple and strong detector using scintillating fiber technology. (author). 13 refs, 5 figs

  11. A group of outbursts with exponential decays in the Rapid Burster

    Czech Academy of Sciences Publication Activity Database

    Šimon, Vojtěch

    2008-01-01

    Roč. 492, č. 1 (2008), s. 135-143 ISSN 0004-6361 R&D Projects: GA ČR GA205/05/2167 Grant - others:ESA(XE) ESA PRODEX INTEGRAL 90108; ESA(XE) ESA-PECS project no. 98023 Institutional research plan: CEZ:AV0Z10030501 Keywords : neutron stars * X-rays binaries * Rapid Burster (MXB 1730-335) Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 4.153, year: 2008

  12. NICER Discovers mHz Oscillations and Marginally Stable Burning in GS 1826-24

    Science.gov (United States)

    Strohmayer, Tod E.; Gendreau, Keith C.; Keek, Laurens; Bult, Peter; Mahmoodifar, Simin; Chakrabarty, Deepto; Arzoumanian, Zaven; NICER Science Team

    2018-01-01

    To date, marginally stable thermonuclear burning, evidenced as mHz X-ray flux oscillations, has been observed in only five accreting neutron star binaries, 4U 1636-536, 4U 1608-52, Aql X-1, 4U 1323-619 and Terzan 5 X-2. Here we report the discovery with NASA's Neutron Star Interior Composition Explorer (NICER) of such oscillations from the well-known X-ray burster GS 1826-24. NICER observed GS 1826-24 on 9 September, 2017 for a total exposure of about 4 ksec. Timing analysis revealed highly significant oscillations at a frequency of 8.2 mHz in two successive pointings. The oscillations have a fractional modulation amplitude of approximately 3% for photon energies less than 6 keV. The observed frequency is consistent with the range observed in the other mHz QPO systems, and indeed is slightly higher than the frequency measured in 4U 1636-536 below which mHz oscillations ceased and unstable burning (X-ray bursts) resumed. We discuss the mass accretion rate dependence of the oscillations as well as the X-ray spectrum as a function of pulsation phase. We place the observations in the context of the current theory of marginally stable burning and briefly discuss the potential for constraining neutron star properties using mHz oscillations.

  13. X-ray bursters and the X-ray sources of the galactic bulge

    Science.gov (United States)

    Lewin, W. H. G.; Joss, P. C.

    An attempt is made to distill from observational and theoretical information on the galactic bulge X-ray sources in general, and on the X-ray burst sources in particular, those aspects which seem to have the greatest relevance to the understanding of these sources. Galactic bulge sources appear to be collapsed objects of roughly solar mass, in most cases neutron stars, which are accreting matter from low-mass stellar companions. Type I bursts seem to result from thermonuclear flashes in the surface layers of some of these neutron stars, while the type II bursts from the Rapid Burster are almost certainly due to an instability in the accretion flow onto a neutron star. It is concluded that the studies cited offer a new and powerful observational handle on the fundamental properties of neutron stars and of the interacting binary systems in which they are often contained.

  14. Spike-adding in parabolic bursters: The role of folded-saddle canards

    Science.gov (United States)

    Desroches, Mathieu; Krupa, Martin; Rodrigues, Serafim

    2016-09-01

    The present work develops a new approach to studying parabolic bursting, and also proposes a novel four-dimensional canonical and polynomial-based parabolic burster. In addition to this new polynomial system, we also consider the conductance-based model of the Aplysia R15 neuron known as the Plant model, and a reduction of this prototypical biophysical parabolic burster to three variables, including one phase variable, namely the Baer-Rinzel-Carillo (BRC) phase model. Revisiting these models from the perspective of slow-fast dynamics reveals that the number of spikes per burst may vary upon parameter changes, however the spike-adding process occurs in an explosive fashion that involves special solutions called canards. This spike-adding canard explosion phenomenon is analysed by using tools from geometric singular perturbation theory in tandem with numerical bifurcation techniques. We find that the bifurcation structure persists across all considered systems, that is, spikes within the burst are incremented via the crossing of an excitability threshold given by a particular type of canard orbit, namely the true canard of a folded-saddle singularity. However there can be a difference in the spike-adding transitions in parameter space from one case to another, according to whether the process is continuous or discontinuous, which depends upon the geometry of the folded-saddle canard. Using these findings, we construct a new polynomial approximation of the Plant model, which retains all the key elements for parabolic bursting, including the spike-adding transitions mediated by folded-saddle canards. Finally, we briefly investigate the presence of spike-adding via canards in planar phase models of parabolic bursting, namely the theta model by Ermentrout and Kopell.

  15. The INTEGRAL long monitoring of persistent ultra compact X-ray bursters

    Science.gov (United States)

    Fiocchi, M.; Bazzano, A.; Ubertini, P.; Bird, A. J.; Natalucci, L.; Sguera, V.

    2008-12-01

    Context: The combination of compact objects, short period variability and peculiar chemical composition of the ultra compact X-ray binaries make up a very interesting laboratory to study accretion processes and thermonuclear burning on the neutron star surface. Improved large optical telescopes and more sensitive X-ray satellites have increased the number of known ultra compact X-ray binaries allowing their study with unprecedented detail. Aims: We analyze the average properties common to all ultra compact bursters observed by INTEGRAL from 0.2 keV to 150 keV. Methods: We have performed a systematic analysis of the INTEGRAL public data and Key-Program proprietary observations of a sample of the ultra compact X-ray binaries. In order to study their average properties in a very broad energy band, we combined INTEGRAL with BeppoSAX and SWIFT data whenever possible. For sources not showing any significant flux variations along the INTEGRAL monitoring, we build the average spectrum by combining all available data; in the case of variable fluxes, we use simultaneous INTEGRAL and SWIFT observations when available. Otherwise we compared IBIS and PDS data to check the variability and combine BeppoSAX with INTEGRAL /IBIS data. Results: All spectra are well represented by a two component model consisting of a disk-blackbody and Comptonised emission. The majority of these compact sources spend most of the time in a canonical low/hard state, with a dominating Comptonised component and accretion rate dot {M} lower than 10-9 {M⊙}/yr, not depending on the model used to fit the data. INTEGRAL is an ESA project with instruments and Science Data Center funded by ESA member states (especially the PI countries: Denmark, France, Germany, Italy, Switzerland, Spain), Czech Republic and Poland, and with the participation of Russia and the USA.

  16. Object Tracking withIphone 3Gs

    OpenAIRE

    Alin, Lars

    2010-01-01

    In June of 2007 Apple Inc. released the smartphone Iphone. It was a groundbreaking success that set a new standard for what a smartphone should be able to do. Apple has improved the Iphone every year since then and the 3Gs is the newest Iphone model. As the phones have improved, both when looking at hardware and software, the applications have improved as well. The Iphone 3Gs provides the possibility to use the camera as an application background and with that the possibility to analyze the s...

  17. Behind the scenes of GS: preventing and curing - the GS-SE group

    CERN Document Server

    CERN, GS-SE

    2013-01-01

    With over 3,000 CERN personnel and more than 300 visitors on the site, CERN’s infrastructure takes a real hammering every day of the year. Fortunately, the GS-SE Group is on the watch… Here, like everywhere else, nothing stays shiny and new for very long. That’s why it’s important to carry out regular, even daily, maintenance of buildings, equipment, pipes and roads which every single day see thousands of CERN personnel and visitors passing by. The team responsible for this weighty task is part of the GS-SE Group.

  18. Behind the scenes of GS: shared mobility

    CERN Multimedia

    Corinne Pralavorio

    2014-01-01

    The GS-IS team responsible for mobility is working on the problematic equation of improving transport with a growing number of people on site.   Congested car parks and sites that are far apart mean that going from one place to another at CERN often requires patience. Transport is major a concern not only for people working at the Organization, but also those in charge of the road infrastructure. The 120-hectare Meyrin site and the distance between the various sites mean that efficient modes of transport are essential. The growing number of people on site and the increasingly congested car parks have made the problem even trickier. Over the past five years, the GS-IS group has launched several initiatives to facilitate mobility on site without proportionately increasing CERN’s fleet of vehicles. Sharing is the only solution! The shuttle service has been reinforced:  since 2010, four regular routes have been set up as well as a service for operators working shifts during t...

  19. Behind the scenes of GS: preventing and curing - the GS-SE group (VERSION FR)

    CERN Multimedia

    CERN, GS-SE

    2013-01-01

    Avec, chaque jour, plus de 3000 Cernois sur le site et plus de 300 visiteurs, le CERN et ses infrastructures en voient des vertes et des pas mûres. Heureusement, le groupe GS-SE veille au grain… Ici comme partout ailleurs, rien ne reste jamais neuf bien longtemps. D’où l’importance d’entretenir régulièrement, pour ne pas dire « quotidiennement », les bâtiments, équipements, canalisations, routes, qui voient passer, jour après jour, des milliers de Cernois et de visiteurs. Au CERN, l’équipe en charge de cette lourde tâche fait partie du groupe GS-SE.

  20. Behind the scenes of GS: Sweet dreams!

    CERN Multimedia

    Anaïs Schaeffer

    2014-01-01

    The CERN Hostel is located in the heart of the Meyrin site and provides the Organization’s many users with a comfortable and peaceful place to stay. The services offered by the Hostel, which is managed by the GS-IS Group, have seen many changes over the years.   The first CERN Hostel (Building 38) was built in 1982 in response to an increasing demand for accommodation, which until then had been met by a handful of converted bedrooms in Building 5 and, since 1974, by 81 additional bedrooms made available to CERN through an agreement with the Foyer Schumann in Saint-Genis-Pouilly. Let’s not even mention the fact that the barracks now occupied by the CERN clubs used to be dormitories… The Hostel was gradually extended, particularly in 1995 with the construction of Building 39, and then in 2007, when Building 41 was added, resulting in a total of 413 rooms (495 beds) today. In addition, a new agreement now gives users access to 151 low-cost rooms at the Foyer Schuma...

  1. Behind the scenes of GS: Open Sesame!

    CERN Multimedia

    Anaïs Schaeffer

    2014-01-01

    The section in the GS-IS Group responsible for running the CERN Stores processes hundreds of orders per day, checks the quality of each and every product and is responsible for warehousing thousands of items available in a richly-stocked catalogue.   Sprawling across several buildings (73, 128 and 129), a total surface area of 3640 m2, and providing 28,300 cubic metres of storage space, the equivalent of 330 semi-trailers, the CERN stores are a veritable treasure trove! The products on offer range from office stationery and computer hardware to fire extinguishers, cables, steel and chemicals. The new (above) and old storage system for the CERN stores. The CERN Stores catalogue contains nearly 48,000 referenced items, 12,000 of which are available on site. Goods arrive at either Building 194 (Meyrin) or Building 904 (Prévessin) and are then forwarded to the central stores in Building 73. “Every item that arrives here undergoes a strict quality control,” says M...

  2. Behind the scenes of GS: precious stones

    CERN Multimedia

    Anaïs Schaeffer

    2014-01-01

    Since the laying of the foundation stone for the Synchrocyclotron in June 1954, CERN has been expanding constantly to reach a current constructed surface area of 580,000 m2 covered by some 650 buildings (just 125 of which account for 70% of this area).   This year, while CERN’s 60th anniversary is an important milestone in the Laboratory’s history, it also highlights another reality: CERN is a collection of ageing buildings, no less than 60% of which are more than 40 years old. “Of the 580,000 m2 of buildings, around 52,000 m2 are nearing the end of their useful life and 140,000 m2 are in need of extensive renovations,” says Natacha Lopez, GS-SE-PO Section Leader. “Of course, we’ve already started several renovation projects, but it's a huge challenge as we have to renovate buildings constructed in the 1960s and 70s while complying with modern standards, which are very different from those that were in force when they were bu...

  3. Evaluation of Two Guralp Preamplifiers for GS13 Seismometer Application.

    Energy Technology Data Exchange (ETDEWEB)

    Merchant, Bion J. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)

    2017-09-01

    Sandia National Laboratories has tested and evaluated a new preamplifier, the Guralp Preamplifier for GS13, manufactured by Guralp. These preamplifiers are used to interface between Guralp digitizers and Geotech GS13 Seismometers. The purpose of the preamplifier evaluation was to measure the performance characteristics in such areas as power consumption, input impedance, sensitivity, full scale, self-noise, dynamic range, system noise, response, passband, and timing. The Guralp GS13 Preamplifiers are being evaluated for potential use in the International Monitoring System (IMS) of the Comprehensive Nuclear Test-Ban-Treaty Organization (CTBTO).

  4. Affine Fullerene C60 in a GS-Quasigroup

    Directory of Open Access Journals (Sweden)

    Vladimir Volenec

    2014-01-01

    Full Text Available It will be shown that the affine fullerene C60, which is defined as an affine image of buckminsterfullerene C60, can be obtained only by means of the golden section. The concept of the affine fullerene C60 will be constructed in a general GS-quasigroup using the statements about the relationships between affine regular pentagons and affine regular hexagons. The geometrical interpretation of all discovered relations in a general GS-quasigroup will be given in the GS-quasigroup C(1/2(1+5.

  5. Cardiac Effects of Attenuating Gsα - Dependent Signaling.

    Directory of Open Access Journals (Sweden)

    Marcus R Streit

    Full Text Available Inhibition of β-adrenergic signalling plays a key role in treatment of heart failure. Gsα is essential for β-adrenergic signal transduction. In order to reduce side-effects of beta-adrenergic inhibition diminishing β-adrenergic signalling in the heart at the level of Gsα is a promising option.We analyzed the influence of Gsα on regulation of myocardial function and development of cardiac hypertrophy, using a transgenic mouse model (C57BL6/J mice overexpressing a dominant negative Gsα-mutant under control of the α-MHC-promotor. Cardiac phenotype was characterized in vivo and in vitro and under acute and chronic β-adrenergic stimulation. At rest, Gsα-DN-mice showed bradycardia (602 ± 13 vs. 660 ± 17 bpm, p<0.05 and decreased dp/dtmax (5037 ± 546- vs. 6835 ± 505 mmHg/s, p = 0.02. No significant differences were found regarding ejection fraction, heart weight and cardiomyocyte size. β-blockade by propranolol revealed no baseline differences of hemodynamic parameters between wildtype and Gsα-DN-mice. Acute adrenergic stimulation resulted in decreased β-adrenergic responsiveness in Gsα-DN-mice. Under chronic adrenergic stimulation, wildtype mice developed myocardial hypertrophy associated with increase of LV/BW-ratio by 23% (4.4 ± 0.2 vs. 3.5 ± 0.1 mg/g, p<0.01 and cardiac myocyte size by 24% (14927 ± 442 px vs. 12013 ± 583 px, p<0.001. In contrast, both parameters were unchanged in Gsα-DN-mice after chronic isoproterenol stimulation.Overexpression of a dominant negative mutant of Gsα leads to decreased β-adrenergic responsiveness and is protective against isoproterenol-induced hypertrophy. Thus, Gsα-DN-mice provide novel insights into β-adrenergic signal transduction and its modulation in myocardial overload and failure.

  6. Behinds the scenes of GS: a DSO like no other

    CERN Multimedia

    Antonella Del Rosso

    2014-01-01

    At CERN, Departmental Safety Officers (DSOs) are responsible for making the members of their department aware of safety issues. They’re our first point of call every time a problem arises relating to environmental matters or the safety of people and installations. In GS, this role is even more crucial as the Department’s activities are scattered across the Laboratory and affect everyone.   As we have pointed out in our article series "Behind the scenes of GS”, the GS Department is responsible for the construction, renovation and maintenance of buildings and related technical infrastructures. The latter include heating and toilet facilities; detection and alarm systems; the management of the hotels, stores, stocks, shuttle services and mail; and the development of technical and administrative databases. The activities of the Medical Service and the Fire and Rescue Service also come under the umbrella of GS, as do the many other daily activities that are pa...

  7. Clenbuterol-Stimulated Glucose Uptake Activates both GS and GI ...

    African Journals Online (AJOL)

    β2-adrenoceptors activated by adrenaline can also couple to both Gs and Gi proteins. The former is associated with an increase in cAMP to illicit the effect of the catecholamine. In the later, β2-AR induces PKA-catalysed phosphorylation of the receptor, which intends couples to Gi, at high concentration. We proposed that ...

  8. MDM Redshift of the Host of ASASSN-17gs

    Science.gov (United States)

    Chornock, R.; Margutti, R.

    2017-06-01

    The optical transient ASASSN-17gs = AT2017egv (http://www.astronomy.ohio-state.edu/ assassin/transients.html, https://wis-tns.weizmann.ac.il/object/2017egv) was associated with the new Fermi LAT source J1544-0649 and a new, bright X-ray source Swift 154419.7-064915 by Ciprini et al. (ATel #10482).

  9. Regulation of PDH, GS and insulin signalling in skeletal muscle

    DEFF Research Database (Denmark)

    Biensø, Rasmus Sjørup

    of inflammation on resting and exercise-induced PDH regulation in human skeletal muscle and 4) The effect of IL-6 on PDH regulation in mouse skeletal muscle. Study I demonstrated that bed rest–induced insulin resistance was associated with reduced insulinstimulated GS activity and Akt signaling as well...

  10. Measurement of the inelastic branch of the $^{14}$O(α,p)$^{17}$F reaction Implications for explosive burning in novae and x-ray bursters

    CERN Document Server

    He, J J; Davinson, T; Aliotta, M; Büscher, J; Clement, E; Delahaye, P; Hass, M; Jenkins, D G; Kumar, V; Murphy, A St J; Neyskens, P; Raabe, R; Robinson, A P; Voulot, D; van der Walle, J; Warr, N; Wenander, F

    2009-01-01

    A measurement of the inelastic component of the key astrophysical resonance in the 14O(α,p)17F reaction for burning and breakout from hot carbon-nitrogen-oxygen (CNO) cycles is reported. The inelastic component is found to be comparable to the ground-state branch and will enhance the 14O(α,p)17F reaction rate. The current results for the reaction rate confirm that the 14O(α,p)17F reaction is unlikely to contribute substantially to burning and breakout from the CNO cycles under novae conditions. The reaction can, however, contribute strongly to the breakout from the hot CNO cycles under the more extreme conditions found in x-ray bursters.

  11. Behind the scenes of GS: an eye for accuracy

    CERN Multimedia

    Anaïs Schaeffer

    2014-01-01

    The CERN sites are constantly evolving… with new buildings, extensions, redevelopment and renovation. The team in charge of geographical information in the GS Department measures and records even the smallest changes so that it can provide everyone at CERN with the most up-to-date plans possible.   The “Patrimony” team in the GS-SE-DOP Section is responsible for geographical information and has the job of updating all of the information relating to CERN's property, including the land made available to the Organization by Switzerland (110 hectares) and France (516 hectares), green spaces, buildings, underground structures, underground networks (gas, water, electricity, etc. – for which the "Patrimony” team works closely with numerous other groups and departments), car parks, roads… and much more. “Our team consists of seven surveyors and GIS specialists, who identify, define, measure, catalogue and pinpoi...

  12. Test Report : GS Battery, EPC power HES RESCU

    Energy Technology Data Exchange (ETDEWEB)

    Rose, David Martin [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Schenkman, Benjamin L. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Borneo, Daniel R. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)

    2013-10-01

    The Department of Energy Office of Electricity (DOE/OE), Sandia National Laboratories (SNL) and the Base Camp Integration Lab (BCIL) partnered together to incorporate an energy storage system into a microgrid configured Forward Operating Base to reduce the fossil fuel consumption and to ultimately save lives. Energy storage vendors will be sending their systems to SNL Energy Storage Test Pad (ESTP) for functional testing and then to the BCIL for performance evaluation. The technologies that will be tested are electro-chemical energy storage systems comprising of lead acid, lithium-ion or zinc-bromide. GS Battery and EPC Power have developed an energy storage system that utilizes zinc-bromide flow batteries to save fuel on a military microgrid. This report contains the testing results and some limited analysis of performance of the GS Battery, EPC Power HES RESCU.

  13. Behind the scenes of GS: the impact of IMPACT

    CERN Multimedia

    Katarina Anthony

    2014-01-01

    Carrying out a job at CERN can be a complicated task, with coordinators reaching across departments to manage personnel, ensure safety and minimise the impact of their activities on the rest of the Laboratory.  To help coordinators with this tough task, the GS Department developed IMPACT, the platform that, since 2011, has unified CERN's major experiment, accelerator and injector coordination tools.   When planning interventions both large and small, IMPACT (the Intervention Management Planning and Coordination Tool) is the go-to gizmo on every CERN coordinator's tool belt. "IMPACT is a central repository of activity requests that standardises the way work is declared at CERN," says Benoit Daudin, GS-AIS-PM Section Leader. "If you need to intervene in any of CERN's major facilities, you need to declare this work on IMPACT. The tool will analyse the job and see whose approval is required. This could simply b...

  14. Behind the scenes of GS: preventing and curing

    CERN Document Server

    Anaïs Schaeffer

    2014-01-01

    With about 10,000 persons on the site every day, CERN’s infrastructure takes a real hammering every day of the year. Fortunately, the GS-SE Group is on the watch…   Here, like everywhere else, nothing stays shiny and new for very long. That’s why it’s important to carry out regular, even daily, maintenance of buildings, equipment, pipes and roads which every single day see thousands of CERN personnel and visitors passing by. The team responsible for this weighty task is part of the GS-SE Group. Suspicious steam All CERN’s buildings are heated by two heating plants (see the article in Bulletin 13-14/2011) via the underground hot-water network. Seen from below the ground, this is a labyrinth of pipes stretching over 30 km (including both the Meyrin and Prévessin sites). And with some of these pipes now over 40 years old, it goes without saying that leaks are a common hazard. “At the end of 2013, we had to deal with a big l...

  15. Behind the scenes of GS: nothing left to chance

    CERN Multimedia

    Anaïs Schaeffer

    2014-01-01

    The AS (Alarm Systems) Section in the GS-ASE Group is, as its name suggests, in charge of the various alarm systems spread across CERN’s many sites. Its mission? To install, manage and maintain more than 26,000 alarms of all types located both above ground and in the tunnels.   Detection Among these systems, the best known are of course the heat and/or smoke detectors, which quickly raise the alarm in the event of a fire. CERN has 8500 of these devices in total. In combination with these, evacuation alarms are also found all over the Laboratory, including some 1800 break glass call points for 2000 sirens. In the LHC tunnel, the evacuation alarms are connected to 200 Oxygen Deficiency Hazard (ODH) sensors, but this is not the only way of triggering an alarm. “The Fire Brigade permanently monitors the evolution of safety conditions in the LHC tunnels,” says Henrik Nissen, who is responsible for “Alarm Transmission” in the GS-ASE-AS Section. &...

  16. Operational reliability of the Point Lepreau GS standby generators

    Energy Technology Data Exchange (ETDEWEB)

    Loughead, D. A.; McGregor, A. T. [Safety and Compllance Group, New Brunswick Electric Power Commission, Point Lepreau Generating Station, P.O.Box 10 Lepreau, New Brunswick E0G 2H0 (Canada)

    1986-02-15

    Performance of the two Point Lepreau GS standby generators during the first three years of licensed station operation is reviewed. It is shown that the mandated reliability/availability requirements have been met. The nature of starting and running failures has been examined and the consequences, in terms of design and procedural changes, discussed. A brief review of standby generator outages is included to permit estimates of standby generator availability and total Class III standby power unavailability. A pair of simple equations is introduced as a means of estimating the probable economic penalty, both cumulative and incremental, associated with the running failure of one standby generator while the other is on a maintenance outage. (authors)

  17. Operational reliability of the Point Lepreau GS standby generators

    International Nuclear Information System (INIS)

    Loughead, D.A.; McGregor, A.T.

    1986-01-01

    Performance of the two Point Lepreau GS standby generators during the first three years of licensed station operation is reviewed. It is shown that the mandated reliability/availability requirements have been met. The nature of starting and running failures has been examined and the consequences, in terms of design and procedural changes, discussed. A brief review of standby generator outages is included to permit estimates of standby generator availability and total Class III standby power unavailability. A pair of simple equations is introduced as a means of estimating the probable economic penalty, both cumulative and incremental, associated with the running failure of one standby generator while the other is on a maintenance outage. (authors)

  18. Ground Source Integrated Heat Pump (GS-IHP) Development

    Energy Technology Data Exchange (ETDEWEB)

    Baxter, V. D. [ORNL; Rice, K. [ORNL; Murphy, R. [ORNL; Munk, J. [ORNL; Ally, Moonis [ORNL; Shen, Bo [ORNL; Craddick, William [ORNL; Hearn, Shawn A. [ClimateMaster, Inc.

    2013-05-24

    Between October 2008 and May 2013 ORNL and ClimateMaster, Inc. (CM) engaged in a Cooperative Research and Development Agreement (CRADA) to develop a groundsource integrated heat pump (GS-IHP) system for the US residential market. A initial prototype was designed and fabricated, lab-tested, and modeled in TRNSYS (SOLAR Energy Laboratory, et al, 2010) to predict annual performance relative to 1) a baseline suite of equipment meeting minimum efficiency standards in effect in 2006 (combination of air-source heat pump (ASHP) and resistance water heater) and 2) a state-of-the-art (SOA) two-capacity ground-source heat pump with desuperheater water heater (WH) option (GSHPwDS). Predicted total annual energy savings, while providing space conditioning and water heating for a 2600 ft{sup 2} (242 m{sup 2}) house at 5 U.S. locations, ranged from 52 to 59%, averaging 55%, relative to the minimum efficiency suite. Predicted energy use for water heating was reduced 68 to 78% relative to resistance WH. Predicted total annual savings for the GSHPwDS relative to the same baseline averaged 22.6% with water heating energy use reduced by 10 to 30% from desuperheater contributions. The 1st generation (or alpha) prototype design for the GS-IHP was finalized in 2010 and field test samples were fabricated for testing by CM and by ORNL. Two of the alpha units were installed in 3700 ft{sup 2} (345 m{sup 2}) houses at the ZEBRAlliance site in Oak Ridge and field tested during 2011. Based on the steady-state performance demonstrated by the GS-IHPs it was projected that it would achieve >52% energy savings relative to the minimum efficiency suite at this specific site. A number of operational issues with the alpha units were identified indicating design changes needed to the system before market introduction could be accomplished. These were communicated to CM throughout the field test period. Based on the alpha unit test results and the diagnostic information coming from the field test

  19. Chimeric microbial rhodopsins for optical activation of Gs-proteins

    Science.gov (United States)

    Yoshida, Kazuho; Yamashita, Takahiro; Sasaki, Kengo; Inoue, Keiichi; Shichida, Yoshinori; Kandori, Hideki

    2017-01-01

    We previously showed that the chimeric proteins of microbial rhodopsins, such as light-driven proton pump bacteriorhodopsin (BR) and Gloeobacter rhodopsin (GR) that contain cytoplasmic loops of bovine rhodopsin, are able to activate Gt protein upon light absorption. These facts suggest similar protein structural changes in both the light-driven proton pump and animal rhodopsin. Here we report two trials to engineer chimeric rhodopsins, one for the inserted loop, and another for the microbial rhodopsin template. For the former, we successfully activated Gs protein by light through the incorporation of the cytoplasmic loop of β2-adrenergic receptor (β2AR). For the latter, we did not observe any G-protein activation for the light-driven sodium pump from Indibacter alkaliphilus (IndiR2) or a light-driven chloride pump halorhodopsin from Natronomonas pharaonis (NpHR), whereas the light-driven proton pump GR showed light-dependent G-protein activation. This fact suggests that a helix opening motion is common to G protein coupled receptor (GPCR) and GR, but not to IndiR2 and NpHR. Light-induced difference FTIR spectroscopy revealed similar structural changes between WT and the third loop chimera for each light-driven pump. A helical structural perturbation, which was largest for GR, was further enhanced in the chimera. We conclude that similar structural dynamics that occur on the cytoplasmic side of GPCR are needed to design chimeric microbial rhodopsins. PMID:29362703

  20. Behind the scenes of GS: security affects us all

    CERN Multimedia

    Antonella Del Rosso

    2014-01-01

    A CERN manager, supported by two outside companies, manages the three entities in the GS Department that are in charge of various aspects of security. In total, about 80 people, 300 cameras, a surveillance centre (CSA) and 22 kilometres of fences are responsible for ensuring that the Organization is secure. But in spite of these significant resources, the best strategy for maintaining a good level of security at CERN is the active support of its users.   CERN’s security service covers three main areas: access control, comprising the security guards and a patrol service that ensures the site is secure and monitors compliance with traffic and parking rules; registration; and locks and keys. The 22 guards on the day shift and the seven on the night shift, who constantly monitor access, are spread across the two main sites and the four experiment sites. “The guards’ main job is to check that only those who are authorised to do so enter the site,” explains...

  1. Behind the scenes of GS: Service orientation CERN-wide

    CERN Multimedia

    Corinne Pralavorio

    2014-01-01

    A far-reaching project to improve the management of services was initiated in 2010, through the implementation of standard methods and tools to improve the efficiency of CERN services continuously.   Everyone at CERN now knows the telephone number 77777, the e-mail address service-desk@cern.ch and the CERN Service Portal. Behind all this lies a one-stop-shop where a team of operators is ready to answer your call as swiftly as possible and help you send that over-sized parcel to Patagonia or repair those faulty blinds (see Bulletin article 44-45/2013). But that’s not all, as Reinoud Martens, head of the Service Management Support Group in the GS Department, explains: “As far as the service management project is concerned, receiving and assigning incoming calls is just the tip of the iceberg! More generally, the aim of this massive project, launched in 2010 in close collaboration with the IT Department, is to enhance service management and implement standardised met...

  2. Behind the scenes of GS: keeping CERN clean

    CERN Document Server

    Antonella Del Rosso

    2014-01-01

    More than 350,000 square metres to be maintained, two different cleaning companies due to CERN’s sites being in two different countries, underground installations where cleanliness is a question of safety… the CERN team in charge of supervising cleaning services overcomes all these challenges to ensure that our workplace remains clean and pleasant every day.   Ensuring the cleanliness of sites containing a huge variety of buildings is an enormous challenge for the two experts in the GS Department in charge of cleaning services. Alain Bertrand has been at CERN for 29 years and knows all there is to know about the Organization’s buildings and what they are used for, the condition of their toilet facilities and, of course, the location of the border between France and Switzerland which, in terms of cleaning services, denotes the transition point between the two companies used. David Chameaux has been doing the same job as Alain for two years, working with him to ensu...

  3. G-Protein α-Subunit Gsα Is Required for Craniofacial Morphogenesis.

    Directory of Open Access Journals (Sweden)

    Run Lei

    Full Text Available The heterotrimeric G protein subunit Gsα couples receptors to activate adenylyl cyclase and is required for the intracellular cAMP response and protein kinase A (PKA activation. Gsα is ubiquitously expressed in many cell types; however, the role of Gsα in neural crest cells (NCCs remains unclear. Here we report that NCCs-specific Gsα knockout mice die within hours after birth and exhibit dramatic craniofacial malformations, including hypoplastic maxilla and mandible, cleft palate and craniofacial skeleton defects. Histological and anatomical analysis reveal that the cleft palate in Gsα knockout mice is a secondary defect resulting from craniofacial skeleton deficiencies. In Gsα knockout mice, the morphologies of NCCs-derived cranial nerves are normal, but the development of dorsal root and sympathetic ganglia are impaired. Furthermore, loss of Gsα in NCCs does not affect cranial NCCs migration or cell proliferation, but significantly accelerate osteochondrogenic differentiation. Taken together, our study suggests that Gsα is required for neural crest cells-derived craniofacial development.

  4. Crystal structure of the β2 adrenergic receptor-Gs protein complex

    DEFF Research Database (Denmark)

    Rasmussen, Søren Gøgsig Faarup; DeVree, Brian T; Zou, Yaozhong

    2011-01-01

    -occupied receptor. The β(2) adrenergic receptor (β(2)AR) activation of Gs, the stimulatory G protein for adenylyl cyclase, has long been a model system for GPCR signalling. Here we present the crystal structure of the active state ternary complex composed of agonist-occupied monomeric β(2)AR and nucleotide-free Gs...

  5. Gq and Gs signaling acting in synergy to control GLP-1 secretion

    DEFF Research Database (Denmark)

    Pedersen, Maria Hauge; Ekberg, Jeppe Hvidtfeldt; Engelstoft, Maja Storm

    2017-01-01

    GPR40 is generally known to signal through Gq. However, in transfected cells, certain synthetic agonists can make the receptor signal also through Gs and cAMP (Hauge et al., 2015). Here we find that, in colonic crypt cultures, the GLP-1 secretion induced by such Gq + Gs GPR40 agonists is indeed i...

  6. French language: A basic G.S course for Nnamdi Azikiwe University ...

    African Journals Online (AJOL)

    Descriptive method was adopted for the study and data were collected from articles, internet sources and interview. The finding indicated that some universities have adopted French as one of the GS courses. It suggested that French language be taught in UNIZIK as a GS course. The work was based on NUC benchmark ...

  7. Gs protein peptidomimetics as allosteric modulators of the β2-adrenergic receptor

    DEFF Research Database (Denmark)

    Boyhus, Lotte Emilie; Danielsen, Mia; Bengtson, Nina Smidt

    2018-01-01

    A series of Gs protein peptidomimetics were designed and synthesised based on the published X-ray crystal structure of the active state β2-Adrenergic receptor (β2AR) in complex with the Gs protein (PDB 3SN6). We hypothesised that such peptidomimetics may function as allosteric modulators...... that target the intracellular Gs protein binding site of the β2AR. Peptidomimetics were designed to mimic the 15 residue C-Terminal α-helix of the Gs protein and were pre-organised in a helical conformation by (i, i + 4)-stapling using copper catalysed azide alkyne cycloaddition. Linear and stapled...... be able to compete with the native Gs protein for the intracellular binding site to block ISO-induced cAMP formation, but are unable to stabilise an active-like receptor conformation....

  8. Summoning earth and fire: The energy development implications of Grameen Shakti (GS) in Bangladesh

    International Nuclear Information System (INIS)

    Sovacool, Benjamin K.; Drupady, Ira Martina

    2011-01-01

    Since its establishment in 1996, the nonprofit company Grameen Shakti (GS) has installed almost half a million solar home systems (SHS), 132,000 cookstoves, and 13,300 biogas plants among 3.1 million beneficiaries. They plan to ramp up their expansion so that by 2015, more than 1.5 million SHS are in place along with 100,000 biogas units and 5 million improved cookstoves. This article describes GS's current activities, the contours of its programs, and likely reasons for its success. It also explores the remaining challenges facing GS and distils common lessons for other energy development assistance projects and programs around the world. After detailing research methods consisting primarily of research interviews and site visits, the article briefly explores the history of GS and summarizes its three most prominent programs. The article then identifies six distinct benefits to their programs-expansion of energy access, less deforestation and fewer greenhouse gas emissions, price savings, direct employment and income generation, improved public health, and better technology-before discussing challenges related to staff retention and organizational growth, living standards, technical obstacles, affordability, tension with other energy programs, political constraints, and awareness and cultural values. -- Highlights: → Grameen Shakti (GS) has installed a large number of solar home systems (SHS), cookstoves, and biogas plants. → GS programs have brought a wide array of social and economic benefits. → GS programs face internal and external challenges if they are to remain successful.

  9. GS6, a member of the GRAS gene family, negatively regulates grain size in rice.

    Science.gov (United States)

    Sun, Lianjun; Li, Xiaojiao; Fu, Yongcai; Zhu, Zuofeng; Tan, Lubin; Liu, Fengxia; Sun, Xianyou; Sun, Xuewen; Sun, Chuanqing

    2013-10-01

    Grain size is an important yield-related trait in rice. Intensive artificial selection for grain size during domestication is evidenced by the larger grains of most of today's cultivars compared with their wild relatives. However, the molecular genetic control of rice grain size is still not well characterized. Here, we report the identification and cloning of Grain Size 6 (GS6), which plays an important role in reducing grain size in rice. A premature stop at the +348 position in the coding sequence (CDS) of GS6 increased grain width and weight significantly. Alignment of the CDS regions of GS6 in 90 rice materials revealed three GS6 alleles. Most japonica varieties (95%) harbor the Type I haplotype, and 62.9% of indica varieties harbor the Type II haplotype. Association analysis revealed that the Type I haplotype tends to increase the width and weight of grains more than either of the Type II or Type III haplotypes. Further investigation of genetic diversity and the evolutionary mechanisms of GS6 showed that the GS6 gene was strongly selected in japonica cultivars. In addition, a "ggc" repeat region identified in the region that encodes the GRAS domain of GS6 played an important historic role in the domestication of grain size in rice. Knowledge of the function of GS6 might aid efforts to elucidate the molecular mechanisms that control grain development and evolution in rice plants, and could facilitate the genetic improvement of rice yield. © 2013 Institute of Botany, Chinese Academy of Sciences.

  10. Docosahexaenoic acid alters Gsα localization in lipid raft and potentiates adenylate cyclase.

    Science.gov (United States)

    Zhu, Zhuoran; Tan, Zhoubin; Li, Yan; Luo, Hongyan; Hu, Xinwu; Tang, Ming; Hescheler, Jürgen; Mu, Yangling; Zhang, Lanqiu

    2015-01-01

    Supplementation with docosahexaenoic acid (DHA), an ω-3 polyunsaturated fatty acid (PUFA), recently has become popular for the amelioration of depression; however the molecular mechanism of DHA action remains unclear. The aim of this study was to investigate the mechanism underlying the antidepressant effect of DHA by evaluating Gsα localization in lipid raft and the activity of adenylate cyclase in an in vitro glioma cell model. Lipid raft fractions from C6 glioma cells treated chronically with DHA were isolated by sucrose gradient ultracentrifugation. The content of Gsα in lipid raft was analyzed by immunoblotting and colocalization of Gsα with lipid raft was subjected to confocal microscopic analysis. The intracellular cyclic adenosine monophosphate (cAMP) level was determined by cAMP immunoassay kit. DHA decreased the amount of Gsα in lipid raft, whereas whole cell lysate Gsα was not changed. Confocal microscopic analysis demonstrated that colocalization of Gsα with lipid raft was decreased, whereas DHA increased intracellular cAMP accumulation in a dose-dependent manner. Interestingly, we found that DHA increased the lipid raft level, instead of disrupting it. The results of this study suggest that DHA may exert its antidepressant effect by translocating Gsα from lipid raft and potentiating the activity of adenylate cyclase. Importantly, the reduced Gsα in lipid raft by DHA is independent of disruption of lipid raft. Overall, the study provides partial preclinical evidence supporting a safe and effective therapy using DHA for depression. Copyright © 2015 Elsevier Inc. All rights reserved.

  11. A Rare Allele of GS2 Enhances Grain Size and Grain Yield in Rice.

    Science.gov (United States)

    Hu, Jiang; Wang, Yuexing; Fang, Yunxia; Zeng, Longjun; Xu, Jie; Yu, Haiping; Shi, Zhenyuan; Pan, Jiangjie; Zhang, Dong; Kang, Shujing; Zhu, Li; Dong, Guojun; Guo, Longbiao; Zeng, Dali; Zhang, Guangheng; Xie, Lihong; Xiong, Guosheng; Li, Jiayang; Qian, Qian

    2015-10-05

    Grain size determines grain weight and affects grain quality. Several major quantitative trait loci (QTLs) regulating grain size have been cloned; however, our understanding of the underlying mechanism that regulates the size of rice grains remains fragmentary. Here, we report the cloning and characterization of a dominant QTL, grain size on chromosome 2 (GS2), which encodes Growth-Regulating Factor 4 (OsGRF4), a transcriptional regulator. GS2 localizes to the nucleus and may act as a transcription activator. A rare mutation of GS2 affecting the binding site of a microRNA, OsmiR396c, causes elevated expression of GS2/OsGRF4. The increase in GS2 expression leads to larger cells and increased numbers of cells, which thus enhances grain weight and yield. The introduction of this rare allele of GS2/OsGRF4 into rice cultivars could significantly enhance grain weight and increase grain yield, with possible applications in breeding high-yield rice varieties. Copyright © 2015 The Author. Published by Elsevier Inc. All rights reserved.

  12. Methionine sulfoximine supplementation enhances productivity in GS-CHOK1SV cell lines through glutathione biosynthesis.

    Science.gov (United States)

    Feary, Marc; Racher, Andrew J; Young, Robert J; Smales, C Mark

    2017-01-01

    In Lonza Biologics' GS Gene Expression System™, recombinant protein-producing GS-CHOK1SV cell lines are generated by transfection with an expression vector encoding both GS and the protein product genes followed by selection in MSX and glutamine-free medium. MSX is required to inhibit endogenous CHOK1SV GS, and in effect create a glutamine auxotrophy in the host that can be complemented by the expression vector encoded GS in selected cell lines. However, MSX is not a specific inhibitor of GS as it also inhibits the activity of GCL (a key enzyme in the glutathione biosynthesis pathway) to a similar extent. Glutathione species (GSH and GSSG) have been shown to provide both oxidizing and reducing equivalents to ER-resident oxidoreductases, raising the possibility that selection for transfectants with increased GCL expression could result in the isolation of GS-CHOKISV cell lines with improved capacity for recombinant protein production. In this study we have begun to address the relationship between MSX supplementation, the amount of intracellular GCL subunit and mAb production from a panel of GS-CHOK1SV cell lines. We then evaluated the influence of reduced GCL activity on batch culture of an industrially relevant mAb-producing GS-CHOK1SV cell line. To the best of our knowledge, this paper describes for the first time the change in expression of GCL subunits and recombinant mAb production in these cell lines with the degree of MSX supplementation in routine subculture. Our data also shows that partial inhibition of GCL activity in medium containing 75 µM MSX increases mAb productivity, and its more specific inhibitor BSO used at a concentration of 80 µM in medium increases the specific rate of mAb production eight-fold and the concentration in harvest medium by two-fold. These findings support a link between the inhibition of glutathione biosynthesis and recombinant protein production in industrially relevant systems and provide a process-driven method for

  13. Therapeutic efficacy of the small molecule GS-5734 against Ebola virus in rhesus monkeys.

    Science.gov (United States)

    Warren, Travis K; Jordan, Robert; Lo, Michael K; Ray, Adrian S; Mackman, Richard L; Soloveva, Veronica; Siegel, Dustin; Perron, Michel; Bannister, Roy; Hui, Hon C; Larson, Nate; Strickley, Robert; Wells, Jay; Stuthman, Kelly S; Van Tongeren, Sean A; Garza, Nicole L; Donnelly, Ginger; Shurtleff, Amy C; Retterer, Cary J; Gharaibeh, Dima; Zamani, Rouzbeh; Kenny, Tara; Eaton, Brett P; Grimes, Elizabeth; Welch, Lisa S; Gomba, Laura; Wilhelmsen, Catherine L; Nichols, Donald K; Nuss, Jonathan E; Nagle, Elyse R; Kugelman, Jeffrey R; Palacios, Gustavo; Doerffler, Edward; Neville, Sean; Carra, Ernest; Clarke, Michael O; Zhang, Lijun; Lew, Willard; Ross, Bruce; Wang, Queenie; Chun, Kwon; Wolfe, Lydia; Babusis, Darius; Park, Yeojin; Stray, Kirsten M; Trancheva, Iva; Feng, Joy Y; Barauskas, Ona; Xu, Yili; Wong, Pamela; Braun, Molly R; Flint, Mike; McMullan, Laura K; Chen, Shan-Shan; Fearns, Rachel; Swaminathan, Swami; Mayers, Douglas L; Spiropoulou, Christina F; Lee, William A; Nichol, Stuart T; Cihlar, Tomas; Bavari, Sina

    2016-03-17

    The most recent Ebola virus outbreak in West Africa, which was unprecedented in the number of cases and fatalities, geographic distribution, and number of nations affected, highlights the need for safe, effective, and readily available antiviral agents for treatment and prevention of acute Ebola virus (EBOV) disease (EVD) or sequelae. No antiviral therapeutics have yet received regulatory approval or demonstrated clinical efficacy. Here we report the discovery of a novel small molecule GS-5734, a monophosphoramidate prodrug of an adenosine analogue, with antiviral activity against EBOV. GS-5734 exhibits antiviral activity against multiple variants of EBOV and other filoviruses in cell-based assays. The pharmacologically active nucleoside triphosphate (NTP) is efficiently formed in multiple human cell types incubated with GS-5734 in vitro, and the NTP acts as an alternative substrate and RNA-chain terminator in primer-extension assays using a surrogate respiratory syncytial virus RNA polymerase. Intravenous administration of GS-5734 to nonhuman primates resulted in persistent NTP levels in peripheral blood mononuclear cells (half-life, 14 h) and distribution to sanctuary sites for viral replication including testes, eyes, and brain. In a rhesus monkey model of EVD, once-daily intravenous administration of 10 mg kg(-1) GS-5734 for 12 days resulted in profound suppression of EBOV replication and protected 100% of EBOV-infected animals against lethal disease, ameliorating clinical disease signs and pathophysiological markers, even when treatments were initiated three days after virus exposure when systemic viral RNA was detected in two out of six treated animals. These results show the first substantive post-exposure protection by a small-molecule antiviral compound against EBOV in nonhuman primates. The broad-spectrum antiviral activity of GS-5734 in vitro against other pathogenic RNA viruses, including filoviruses, arenaviruses, and coronaviruses, suggests the

  14. FiGS: a filter-based gene selection workbench for microarray data

    Directory of Open Access Journals (Sweden)

    Yun Taegyun

    2010-01-01

    Full Text Available Abstract Background The selection of genes that discriminate disease classes from microarray data is widely used for the identification of diagnostic biomarkers. Although various gene selection methods are currently available and some of them have shown excellent performance, no single method can retain the best performance for all types of microarray datasets. It is desirable to use a comparative approach to find the best gene selection result after rigorous test of different methodological strategies for a given microarray dataset. Results FiGS is a web-based workbench that automatically compares various gene selection procedures and provides the optimal gene selection result for an input microarray dataset. FiGS builds up diverse gene selection procedures by aligning different feature selection techniques and classifiers. In addition to the highly reputed techniques, FiGS diversifies the gene selection procedures by incorporating gene clustering options in the feature selection step and different data pre-processing options in classifier training step. All candidate gene selection procedures are evaluated by the .632+ bootstrap errors and listed with their classification accuracies and selected gene sets. FiGS runs on parallelized computing nodes that capacitate heavy computations. FiGS is freely accessible at http://gexp.kaist.ac.kr/figs. Conclusion FiGS is an web-based application that automates an extensive search for the optimized gene selection analysis for a microarray dataset in a parallel computing environment. FiGS will provide both an efficient and comprehensive means of acquiring optimal gene sets that discriminate disease states from microarray datasets.

  15. Investigation of structure and function of mitochondrial alcohol dehydrogenase isozyme III from Komagataella phaffii GS115.

    Science.gov (United States)

    Zhang, Huaidong; Li, Qin; Wang, Lina; Chen, Yan

    2018-05-01

    Alcohol dehydrogenases (ADHs) catalyze the reversible oxidation of alcohol using NAD + or NADP + as cofactor. Three ADH homologues have been identified in Komagataella phaffii GS115 (also named Pichia pastoris GS115), ADH1, ADH2 and ADH3, among which adh3 is the only gene responsible for consumption of ethanol in Komagataella phaffii GS115. However, the relationship between structure and function of mitochondrial alcohol dehydrogenase isozyme III from Komagataella phaffii GS115 (KpADH3) is still not clear yet. KpADH3 was purified, identified and characterized by multiple biophysical techniques (Nano LC-MS/MS, Enzymatic activity assay, X-ray crystallography). The crystal structure of KpADH3, which was the first ADH structure from Komagataella phaffii GS115, was solved at 1.745 Å resolution. Structural analysis indicated that KpADH3 was the sole dimeric ADH structure with face-to-face orientation quaternary structure from yeast. The major structural different conformations located on residues 100-114 (the structural zinc binding loop) and residues 337-344 (the loop between α12 and β15 which covered the catalytic domain). In addition, three channels were observed in KpADH3 crystal structure, channel 2 and channel 3 may be essential for substrate specific recognition, ingress and egress, channel 1 may be the pass-through for cofactor. KpADH3 plays an important role in the metabolism of alcohols in Komagataella phaffii GS115, and its crystal structure is the only dimeric medium-chain ADH from yeast described so far. Knowledge of the relationship between structure and function of KpADH3 is crucial for understanding the role of KpADH3 in Komagataella phaffii GS115 mitochondrial metabolism. Copyright © 2018 Elsevier B.V. All rights reserved.

  16. Ectopic Expression of GsSRK in Medicago sativa Reveals Its Involvement in Plant Architecture and Salt Stress Responses.

    Science.gov (United States)

    Sun, Mingzhe; Qian, Xue; Chen, Chao; Cheng, Shufei; Jia, Bowei; Zhu, Yanming; Sun, Xiaoli

    2018-01-01

    Receptor-like kinases (RLK) play fundamental roles in plant growth and stress responses. Compared with other RLKs, little information is provided concerning the S-locus LecRLK subfamily, which is characterized by an extracellular G-type lectin domain and an S-locus-glycop domain. Until now, the function of the G-type lectin domain is still unknown. In a previous research, we identified a Glycine soja S-locus LecRLK gene GsSRK , which conferred increased salt stress tolerance in transgenic Arabidopsis . In this study, to investigate the role of the G-type lectin domain and to breed transgenic alfalfa with superior salt stress tolerance, we transformed the full-length GsSRK ( GsSRK-f ) and a truncated version of GsSRK ( GsSRK-t ) deleting the G-type lectin domain into alfalfa. Our results showed that overexpression of GsSRK-t , but not GsSRK-f , resulted in changes of plant architecture, as evidenced by more branches but shorter shoots of GsSRK-t transgenic alfalfa, indicating a potential role of the extracellular G-type lectin domain in regulating plant architecture. Furthermore, we also found that transgenic alfalfa overexpressing either GsSRK-f or GsSRK-t showed increased salt stress tolerance, and GsSRK-t transgenic alfalfa displayed better growth (more branches and higher fresh weight) than GsSRK-f lines under salt stress. In addition, our results suggested that both GsSRK-f and GsSRK-t were involved in ion homeostasis, ROS scavenging, and osmotic regulation. Under salt stress, the Na + content in the transgenic lines was significantly lower, while the K + content was slightly higher than that in WT. Moreover, the transgenic lines displayed reduced ion leakage and MDA content, but increased SOD activity and proline content than WT. Notably, no obvious difference in these physiological indices was observed between GsSRK-f and GsSRK-t transgenic lines, implying that deletion of the GsSRK G-type lectin domain does not affect its physiological function in salt

  17. Specific requirements of GS-R3 related to process implementation

    International Nuclear Information System (INIS)

    Florescu, N.

    2009-01-01

    The PowerPoint presentation gives: an overview of IAEA management system requirements or topics; - the requirements specific to processes and process implementation; - the key practical challenge of using the process approach specified in IAEA SG GS-G3.1 and GS-G3.5. The following items are thoroughly discussed: - Requirements related to specific process implementation and developing processes; - Process management; Generic management; - System processes: - Control of documents; Control of products; Control of records; - Purchasing; - Communication; - Managing organizational change; - Other requirements concerning the process management system; - General management system; - Grading; - Documentation; - Fulfilling the requirements of interested parties; - Management responsibility; - Planning responsibility and authority for the management system monitoring and measurement; - Independent assessment; - Management system review; - Non-conformances, corrective and preventive actions; - Improvement key practical challenge of using the process approach specified in IAEA SG GS-G3.1 and GS-G3.5; - Key challenge: - Process common to all stages; - Phases of process development proposed by IAEA. The following conclusions complete the presentation: GS-R-3 sets basic requirements for process-based integrated management system; - Some key generic processes required, no specific process model favoured namely, no reference to management, core and support processes; - Up to organization to determine appropriate process model; - Easily applicable to a wide range of facilities and activities, including those of a regulatory body; - Specific requirements are found in specific Safety Guide. (author)

  18. TaGS5-3A, a grain size gene selected during wheat improvement for larger kernel and yield.

    Science.gov (United States)

    Ma, Lin; Li, Tian; Hao, Chenyang; Wang, Yuquan; Chen, Xinhong; Zhang, Xueyong

    2016-05-01

    Grain size is a dominant component of grain weight in cereals. Earlier studies have shown that OsGS5 plays a major role in regulating both grain size and weight in rice via promotion of cell division. In this study, we isolated TaGS5 homoeologues in wheat and mapped them on chromosomes 3A, 3B and 3D. Temporal and spatial expression analysis showed that TaGS5 homoeologues were preferentially expressed in young spikes and developing grains. Two alleles of TaGS5-3A, TaGS5-3A-T and TaGS5-3A-G were identified in wheat accessions, and a functional marker was developed to discriminate them. Association analysis revealed that TaGS5-3A-T was significantly correlated with larger grain size and higher thousand kernel weight. Biochemical assays showed that TaGS5-3A-T possesses a higher enzymatic activity than TaGS5-3A-G. Transgenic rice lines overexpressing TaGS5-3A-T also exhibited larger grain size and higher thousand kernel weight than TaGS5-3A-G lines, and the transcript levels of cell cycle-related genes in TaGS5-3A-T lines were higher than those in TaGS5-3A-G lines. Furthermore, systematic evolution analysis in diploid, tetraploid and hexaploid wheat showed that TaGS5-3A underwent strong artificial selection during wheat polyploidization events and the frequency changes of two alleles demonstrated that TaGS5-3A-T was favoured in global modern wheat cultivars. These results suggest that TaGS5-3A is a positive regulator of grain size and its favoured allele TaGS5-3A-T exhibits a larger potential application in wheat high-yield breeding. © 2015 Society for Experimental Biology, Association of Applied Biologists and John Wiley & Sons Ltd.

  19. A 2-GS/s 6-bit self-calibrated flash ADC

    Energy Technology Data Exchange (ETDEWEB)

    Zhang Youtao; Chen Chen [National Key Laboratory of Monolithic Integrated Circuits and Modules, Nanjing Electronic Devices Institute, Nanjing 210016 (China); Li Xiaopeng; Zhang Min; Liu Ao, E-mail: zhangyt@nedc-ic.co [Nanjing Electronic Devices Institute, Nanjing 210016 (China)

    2010-09-15

    A single channel 2-GS/s 6-bit ADC with cascade resistive averaging and self foreground calibration is demonstrated in 0.18-{mu}m CMOS. The calibration method based on DAC trimming improves the linearity and dynamic performance further. The peak DNL and INL are measured as 0.34 and 0.22 LSB, respectively. The SNDR and SFDR have achieved 36.5 and 45.9 dB, respectively, with 1.22 MHz input signal and 2 GS/s. The proposed ADC, including on-chip track-and-hold amplifiers and clock buffers, consumes 570 mW from a single 1.8 V supply while operating at 2 GS/s. (semiconductor integrated circuits)

  20. Correspondence of ISO 9001:2008 with IAEA GS-R-3

    International Nuclear Information System (INIS)

    Kibrit, Eduardo

    2009-01-01

    This article identifies, characterises and analyses International Organisation for Standardisation (ISO) and International Atomic Energy Agency (IAEA) normative requirements for the development and implementation of quality management systems in nuclear organisations. The structures of the applicable standards, ISO 9001:2008 and IAEA GS-R-3, are characterised. The differences and similarities of objective, focus, scope, level of application, structure, vocabulary, management system, management responsibility, resource management, process implementation, measurement, assessment and improvement verified in the applicable standards are deeply reviewed. A correspondence of the applicable standards' requirements is presented topic by topic. A correlation of the applicable standards' requirements is made, showing IAEA GS-R-3 topics that have no correlation with ISO 9001:2008 and ISO 9001:2008 topics that have no correlation with IAEA GS-R-3. Conclusive remarks advise the pros and cons of using one of the applicable standards or the other. (author)

  1. 0(gs)+ -->2(1)+ transition strengths in 106Sn and 108Sn.

    Science.gov (United States)

    Ekström, A; Cederkäll, J; Fahlander, C; Hjorth-Jensen, M; Ames, F; Butler, P A; Davinson, T; Eberth, J; Fincke, F; Görgen, A; Górska, M; Habs, D; Hurst, A M; Huyse, M; Ivanov, O; Iwanicki, J; Kester, O; Köster, U; Marsh, B A; Mierzejewski, J; Reiter, P; Scheit, H; Schwalm, D; Siem, S; Sletten, G; Stefanescu, I; Tveten, G M; Van de Walle, J; Van Duppen, P; Voulot, D; Warr, N; Weisshaar, D; Wenander, F; Zielińska, M

    2008-07-04

    The reduced transition probabilities, B(E2; 0(gs)+ -->2(1)+), have been measured in the radioactive isotopes (108,106)Sn using subbarrier Coulomb excitation at the REX-ISOLDE facility at CERN. Deexcitation gamma rays were detected by the highly segmented MINIBALL Ge-detector array. The results, B(E2;0(gs)+ -->2(1)+)=0.222(19)e2b2 for 108Sn and B(E2; 0(gs)+-->2(1)+)=0.195(39)e2b2 for 106Sn were determined relative to a stable 58Ni target. The resulting B(E2) values are approximately 30% larger than shell-model predictions and deviate from the generalized seniority model. This experimental result may point towards a weakening of the N=Z=50 shell closure.

  2. Propiedades psicométricas del Maslach Burnout Inventory-GS en una muestra multiocupacional venezolana

    Directory of Open Access Journals (Sweden)

    Anthony Constant Millán de Lange

    2012-06-01

    Full Text Available Psychometric properties of the Maslach Burnout Inventory-GS in a Venezuelan sampleThe assessment of work stress is one of the most important aspects in the current scope of occupational psychological health, especially when it comes to chronic levels of involvement.Here are the results of the Venezuelan psychometric validation of the Cuban version of the Maslach Burnout Inventory-General Survey (MBI-GS. Results show adequate reliability of the instrument and suggest the need to remove item 1 to ensure its construct validity.Some indicators reveal the divergent criterion validity of the MBI-GS on the degree of the participant’s psychological well-being.

  3. 5 CFR 531.217 - Special conversion rules for certain non-GS employees.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Special conversion rules for certain non... SERVICE REGULATIONS PAY UNDER THE GENERAL SCHEDULE Determining Rate of Basic Pay Setting Pay When Appointment Or Position Changes § 531.217 Special conversion rules for certain non-GS employees. When an...

  4. Crystal structure of the β2 adrenergic receptor-Gs protein complex

    Energy Technology Data Exchange (ETDEWEB)

    Rasmussen, Søren G.F.; DeVree, Brian T; Zou, Yaozhong; Kruse, Andrew C; Chung, Ka Young; Kobilka, Tong Sun; Thian, Foon Sun; Chae, Pil Seok; Pardon, Els; Calinski, Diane; Mathiesen, Jesper M; Shah, Syed T.A.; Lyons, Joseph A; Caffrey, Martin; Gellman, Samuel H; Steyaert, Jan; Skiniotis, Georgios; Weis, William I; Sunahara, Roger K; Kobilka, Brian K [Brussels; (Trinity); (Michigan); (Stanford-MED); (Michigan-Med); (UW)

    2011-12-07

    G protein-coupled receptors (GPCRs) are responsible for the majority of cellular responses to hormones and neurotransmitters as well as the senses of sight, olfaction and taste. The paradigm of GPCR signalling is the activation of a heterotrimeric GTP binding protein (G protein) by an agonist-occupied receptor. The β2 adrenergic receptor (β2AR) activation of Gs, the stimulatory G protein for adenylyl cyclase, has long been a model system for GPCR signalling. Here we present the crystal structure of the active state ternary complex composed of agonist-occupied monomeric β2AR and nucleotide-free Gs heterotrimer. The principal interactions between the β2AR and Gs involve the amino- and carboxy-terminal α-helices of Gs, with conformational changes propagating to the nucleotide-binding pocket. The largest conformational changes in the β2AR include a 14Å outward movement at the cytoplasmic end of transmembrane segment 6 (TM6) and an α-helical extension of the cytoplasmic end of TM5. The most surprising observation is a major displacement of the α-helical domain of Gαs relative to the Ras-like GTPase domain. This crystal structure represents the first high-resolution view of transmembrane signalling by a GPCR.

  5. Foam generation during G.S. [Girdler sulphide] process and its prevention

    International Nuclear Information System (INIS)

    Lammirato, Alberto; Rojo, Enrique.

    1989-01-01

    Available literature, from both foreign and local sources, regarding foam generation during Girdler Sulphide (G.S.) process operation, was compiled. Assembly and operation of a loop for hydraulic process conditions simulation, of which further tests are to be expected, is reported. (Author) [es

  6. HMW-GS affect the properties of glutenin particles in GMP and thus flour quality

    NARCIS (Netherlands)

    Don, C.; Mann, G.; Bekes, F.; Hamer, R.J.

    2006-01-01

    Using a unique set of deletion lines, (Olympic×Gabo, varying in high molecular weight glutenin subunit (HMW-GS) composition, but with the same genetic background) it was shown that the presence of glutenin particles in glutenin macropolymer (GMP) is directly related to the presence of certain

  7. 78 FR 10001 - Proposed Collection; Comment Request for Form 706-GS(D)

    Science.gov (United States)

    2013-02-12

    ... Form 706-GS(D), Generation-Skipping Transfer Tax Return for Distributions. DATES: Written comments should be received on or before April 15, 2013 to be assured of consideration. ADDRESSES: Direct all... [email protected] . SUPPLEMENTARY INFORMATION: Title: Generation-Skipping Transfer Tax Return for...

  8. GS143, an IκB ubiquitination inhibitor, inhibits allergic airway inflammation in mice

    International Nuclear Information System (INIS)

    Hirose, Koichi; Wakashin, Hidefumi; Oki, Mie; Kagami, Shin-ichiro; Suto, Akira; Ikeda, Kei; Watanabe, Norihiko; Iwamoto, Itsuo; Furuichi, Yasuhiro; Nakajima, Hiroshi

    2008-01-01

    Asthma is characterized by airway inflammation with intense eosinophil infiltration and mucus hyper-production, in which antigen-specific Th2 cells play critical roles. Nuclear factor-κB (NF-κB) pathway has been demonstrated to be essential for the production of Th2 cytokines and chemokines in the airways in murine asthma models. In the present study, we examined the effect of GS143, a novel small-molecule inhibitor of IκB ubiquitination, on antigen-induced airway inflammation and Th2 cytokine production in mice. Intranasal administration of GS143 prior to antigen challenge suppressed antigen-induced NF-κB activation in the lung of sensitized mice. Intranasal administration of GS143 also inhibited antigen-induced eosinophil and lymphocyte recruitment into the airways as well as the expression of Th2 cytokines and eotaxin in the airways. Moreover, GS143 inhibited antigen-induced differentiation of Th2 cells but not of Th1 cells in vitro. Taken together, these results suggest that IκB ubiquitination inhibitor may have therapeutic potential against asthma

  9. Improved method for reliable HMW-GS identification by RP-HPLC and SDS-PAGE in common wheat cultivars

    Science.gov (United States)

    The accurate identification of alleles for high-molecular weight glutenins (HMW-GS) is critical for wheat breeding programs targeting end-use quality. RP-HPLC methods were optimized for separation of HMW-GS, resulting in enhanced resolution of 1By and 1Dx subunits. Statistically significant differe...

  10. Haplotypes of the TaGS5-A1 gene are associated with thousand-kernel weight in Chinese bread wheat

    Directory of Open Access Journals (Sweden)

    Wang Sha Sha

    2016-06-01

    Full Text Available In previous work, we cloned TaGS5 gene and found the association of TaGS5-A1 alleles with agronomic traits. In this study, the promoter sequence of the TaGS5-A1 gene was isolated from bread wheat. Sequencing results revealed that a G insertion was found in position -1925 bp of the TaGS5-A1 gene (Reference to ATG, which occurred in the Sp1 domain of the promoter sequence. Combined with previous single nucleotide polymorphism (SNP in the TaGS5-A1 exon sequence, four genotypes were formed at the TaGS5-A1 locus and were designated as TaGS5-A1a-a, TaGS5-A1a-b, TaGS5-A1b-a, and TaGS5-A1b-b, respectively. Analysis of the association of TaGS5-A1 alleles with agronomic traits indicated that cultivars with the TaGS5-A1a-b allele possessed significantly higher thousand-kernel weight (TKW and lower plant height than cultivars with the TaGS5-A1a-a allele, and cultivars with the TaGS5-A1b-b allele showed higher TKW than cultivars with the TaGS5-A1b-a allele. The differences of these traits between the TaGS5-A1a-a and TaGS5-A1a-b alleles were larger than those of the TaGS5-A1b-a and TaGS5-A1b-b alleles, suggesting that the -1925G insertion plays the more important role in TaGS5-A1a genotypes than in TaGS5-A1b genotypes. qRT-PCR indicated that TaGS5-A1b-b possessed the significantly highest expression level among four TaGS5-A1 haplotypes in mature seeds and further showed a significantly higher expression level than TaGS5-A1b-a at five different developmental stages of the seeds, suggesting that high expression of TaGS5-A1 was positively associated with high TKW in bread wheat. This study could provide a relatively superior genotype in view of TKW in wheat breeding programs and could also provide important information for dissection of the regulatory mechanism of the yield-related traits.

  11. Antifoaming materials in G.S. (Girlder sulfide) heavy water plants. Thermical stability. Pt. 2

    International Nuclear Information System (INIS)

    Delfino, C.A.

    1986-01-01

    In Girlder sulfide (G.S.) heavy water plants hydrogen sulfide-water systems are inherentely foaming, so the adding of antifoaming materials is of great importance. These may be of high volatility, pyrolizable or chemically unstable in plant operation conditions (water and hydrogen sulfide at 2 MPa, up to 230 deg C). About twenty commercial surfactants were studied from the point of view of their thermical stability. (Author) [es

  12. Therapeutic Efficacy of the Small Molecule GS-5734 against Ebola virus in Rhesus Monkeys

    Science.gov (United States)

    2016-03-02

    culture. The diastereomeric mixture at phosphorous 858 containing GS-5734 was incubated continuously for 72 h at 1 µM and levels of intracellular NTP...constants (J) in Hertz. Analytical thin–layer chromatography was performed using Merck KGaA Silica gel 60 F254 glassplates with UV visualization. Preparative...trifluoroacetic acid in water and 0.1% trifluoroacetic acid in acetonitrile; flow rate, 2 mL/min; acquisition time, 6 min; wavelength, UV 214 and 254 nm

  13. Glutathione Preservation during Storage of Rat Lenses in Optisol-GS and Castor Oil

    DEFF Research Database (Denmark)

    Holm, Thomas; Brøgger-Jensen, Martin Rocho; Johnson, Leif

    2013-01-01

    Glutathione concentration in the lens decreases in aging and cataractous lenses, providing a marker for tissue condition. Experimental procedures requiring unfrozen lenses from donor banks rely on transportation in storage medium, affecting lens homeostasis and alterations in glutathione levels. ....... The aim of the study was to examine the effects of Optisol-GS and castor oil on lens condition, determined from their ability to maintain glutathione concentrations....

  14. Gs-coupled GPCR signalling in AgRP neurons triggers sustained increase in food intake.

    Science.gov (United States)

    Nakajima, Ken-ichiro; Cui, Zhenzhong; Li, Chia; Meister, Jaroslawna; Cui, Yinghong; Fu, Ou; Smith, Adam S; Jain, Shalini; Lowell, Bradford B; Krashes, Michael J; Wess, Jürgen

    2016-01-08

    Agouti-related peptide (AgRP) neurons of the hypothalamus play a key role in regulating food intake and body weight, by releasing three different orexigenic molecules: AgRP; GABA; and neuropeptide Y. AgRP neurons express various G protein-coupled receptors (GPCRs) with different coupling properties, including Gs-linked GPCRs. At present, the potential role of Gs-coupled GPCRs in regulating the activity of AgRP neurons remains unknown. Here we show that the activation of Gs-coupled receptors expressed by AgRP neurons leads to a robust and sustained increase in food intake. We also provide detailed mechanistic data linking the stimulation of this class of receptors to the observed feeding phenotype. Moreover, we show that this pathway is clearly distinct from other GPCR signalling cascades that are operative in AgRP neurons. Our data suggest that drugs able to inhibit this signalling pathway may become useful for the treatment of obesity.

  15. Proteolytic activity of IgGs from blood serum of wistar rats at experimental rheumatoid arthritis

    Directory of Open Access Journals (Sweden)

    Yu. Ya. Kit

    2014-10-01

    Full Text Available The aim of this work was to study the proteolytic activity of IgGs purified from blood serum of Wistar rats at experimental rheumatoid arthritis (ERA induced by an injection of bovine collagen of type II. Twenty rats were immunized with a preparation of bovine collagen II (Sigma-Aldrich, USA in the presence of complete Freund’s adjuvant. ERA development was determined by inflammation in limbs of treated animals. IgG preparations were isolated from blood serum of immunized and non-immunized animals by precipitation of antibodies with 33% ammonium sulfate followed by chromatography on the Protein G-Sepharose column. Human histone H1, bovine collagen II, calf thymus histones, myelin basic protein (MBP, bovine serum albumin (BSA, and bovine casein were used as substrates of the proteolytic activity of IgGs. It was found that IgG preparations from blood serum of rats with ERA were capable of cleaving histone H1 and MBP, however, they were catalytically inactive towards collagen II, casein, BSA, and core histones. IgGs from blood serum of non-immunized rats were proteolytically inactive towards all used protein substrates. Thus, we demonstrated that immunization of rats with bovine collagen II induced IgG-antibodies possessing the proteolytic activity towards histone H1 and MBP. This activity might be associated with the development of inflammatory processes in the immunized rats.

  16. Behind the scenes of GS: each to his own lock and key

    CERN Multimedia

    Anaïs Schaeffer

    2014-01-01

    The GS-ASE team in charge of access control has an access solution for every type of premises, from radiation-controlled areas to simple administrative offices.   Although CERN is unquestionably open to the world, some of its doors must remain closed for a simple reason: as an industrial site, it must put safety and security at the top of its priorities and control access to certain areas in order to protect people and property from hazards. The AC (Access Control) section of the GS-ASE group uses a range of access control tools as the type of restrictions varies considerably according to the type of premises or area concerned: the requirements at the entrances to the different CERN sites may be quite different, for example, to those at the entrances to a specific building, a storage area, a workshop or an experiment hall within the fenced part of the CERN site. “We use different types of access systems at CERN”, explains Rui Nunes, head of the GS-ASE-AC section. &ldq...

  17. A novel Fe(III) dependent bioflocculant from Klebsiella oxytoca GS-4-08: culture conditions optimization and flocculation mechanism.

    Science.gov (United States)

    Yu, Lei; Tang, Qing-Wen; Zhang, Yu-Jia; Chen, Rong-Ping; Liu, Xin; Qiao, Wei-Chuan; Li, Wen-Wei; Ruan, Hong-Hua; Song, Xin

    2016-10-07

    In this work, the effect of cultivation factors on the flocculation efficiency (FE) of bioflocculant P-GS408 from Klebsiella oxytoca was optimized by the response surface methodology. The most significant factor, i.e. culture time, was determined by gray relational analysis. A total of 240 mg of purified P-GS408 was prepared from 1 liter of culture solution under the optimal conditions. GC-MS analysis results indicated that the polysaccharide of P-GS408 mainly contains Rhamnose and Galactose, and the existence of abundant hydroxyl, carboxyl and amino groups was evidenced by FTIR and XPS analyses. With the aid of Fe 3+ , the FE of kaolin solution by P-GS408 could achieve 99.48% in ten minutes. Functional groups of polysaccharide were involved in the first adsorption step and the zeta potential of kaolin solution changed from -39.0 mV to 43.4 mV in the presence of Fe 3+ and P-GS408. Three-dimensional excitation-emission (EEM) fluorescence spectra demonstrates that the trivalent Fe 3+ and Al 3+ can bind efficiently with P-GS408, while those univalent and divalent cations cannot. With the help of SEM images, FTIR, zeta potential and EEM spectra, we proposed the P-GS408 flocculation mechanism, which consists of coordination bond combination, charge neutrality, adsorption and bridging, and net catching.

  18. Mechanistic Characterization of GS-9190 (Tegobuvir), a Novel Nonnucleoside Inhibitor of Hepatitis C Virus NS5B Polymerase▿

    Science.gov (United States)

    Shih, I-hung; Vliegen, Inge; Peng, Betty; Yang, Huiling; Hebner, Christy; Paeshuyse, Jan; Pürstinger, Gerhard; Fenaux, Martijn; Tian, Yang; Mabery, Eric; Qi, Xiaoping; Bahador, Gina; Paulson, Matthew; Lehman, Laura S.; Bondy, Steven; Tse, Winston; Reiser, Hans; Lee, William A.; Schmitz, Uli; Neyts, Johan; Zhong, Weidong

    2011-01-01

    GS-9190 (Tegobuvir) is a novel imidazopyridine inhibitor of hepatitis C virus (HCV) RNA replication in vitro and has demonstrated potent antiviral activity in patients chronically infected with genotype 1 (GT1) HCV. GS-9190 exhibits reduced activity against GT2a (JFH1) subgenomic replicons and GT2a (J6/JFH1) infectious virus, suggesting that the compound's mechanism of action involves a genotype-specific viral component. To further investigate the GS-9190 mechanism of action, we utilized the susceptibility differences between GT1b and GT2a by constructing a series of replicon chimeras where combinations of 1b and 2a nonstructural proteins were encoded within the same replicon. The antiviral activities of GS-9190 against the chimeric replicons were reduced to levels comparable to that of the wild-type GT2a replicon in chimeras expressing GT2a NS5B. GT1b replicons in which the β-hairpin region (amino acids 435 to 455) was replaced by the corresponding sequence of GT2a were markedly less susceptible to GS-9190, indicating the importance of the thumb subdomain of the polymerase in this effect. Resistance selection in GT1b replicon cells identified several mutations in NS5B (C316Y, Y448H, Y452H, and C445F) that contributed to the drug resistance phenotype. Reintroduction of these mutations into wild-type replicons conferred resistance to GS-9190, with the number of NS5B mutations correlating with the degree of resistance. Analysis of GS-9190 cross-resistance against previously reported NS5B drug-selected mutations showed that the resistance pattern of GS-9190 is different from other nonnucleoside inhibitors. Collectively, these data demonstrate that GS-9190 represents a novel class of nonnucleoside polymerase inhibitors that interact with NS5B likely through involvement of the β-hairpin in the thumb subdomain. PMID:21746939

  19. Analysis of the Second Law of Thermodynamics applied to GS process in the primary production of heavy water

    International Nuclear Information System (INIS)

    Chavez, Rosa Hilda

    1991-01-01

    An evaluation of the entropic change, through the analysis of the Second Law of Thermodynamic of GS process, with the aim of determine the sections where the majors irreversibilities of the process are located, is presented in this work. This process consist in the first enrichment stage of GS, which operates bithermally at 305 D and 403 Kelvin degree and a pressure of 2 MPa, participating four chemical compounds: H 2 O, HDO, H 2 S and HDS (Author)

  20. A high-yielding, generic fed-batch process for recombinant antibody production of GS-engineered cell lines

    DEFF Research Database (Denmark)

    Fan, Li; Zhao, Liang; Sun, Yating

    2009-01-01

    An animal component-free and chemically defined fed-batch process for GS-engineered cell lines producing recombinant antibodies has been developed. The fed-batch process relied on supplying sufficient nutrients to match their consumption, simultaneously minimizing the accumulation of byproducts....... This generic and high-yielding fed-batch process would shorten development time, and ensure process stability, thereby facilitating the manufacture of therapeutic antibodies by GS-engineered cell lines....

  1. Glutathione preservation during storage of rat lenses in optisol-GS and castor oil.

    Science.gov (United States)

    Holm, Thomas; Brøgger-Jensen, Martin Rocho; Johnson, Leif; Kessel, Line

    2013-01-01

    Glutathione concentration in the lens decreases in aging and cataractous lenses, providing a marker for tissue condition. Experimental procedures requiring unfrozen lenses from donor banks rely on transportation in storage medium, affecting lens homeostasis and alterations in glutathione levels. The aim of the study was to examine the effects of Optisol-GS and castor oil on lens condition, determined from their ability to maintain glutathione concentrations. Rat lenses were stored in the two types of storage media at varying time intervals up to 3 days. Glutathione concentration was afterwards determined in an enzymatic detection assay, specific for both reduced and oxidized forms. Lenses removed immediately after death exhibited a glutathione concentration of 4.70±0.29 mM. In vitro stored lenses in Optisol-GS lost glutathione quickly, ending with a concentration of 0.60±0.34 mM after 3 days while castor oil stored lenses exhibited a slower decline and ended at 3 times the concentration. A group of lenses were additionally stored under post mortem conditions within the host for 6 hours before its removal. Total glutathione after 6 hours was similar to that of lenses removed immediately after death, but with altered GSH and GSSG concentrations. Subsequent storage of these lenses in media showed changes similar to those in the first series of experiments, albeit to a lesser degree. It was determined that storage in Optisol-GS resulted in a higher loss of glutathione than lenses stored in castor oil. Storage for more than 12 hours reduced glutathione to half its original concentration, and was considered unusable after 24 hours.

  2. Glutathione preservation during storage of rat lenses in optisol-GS and castor oil.

    Directory of Open Access Journals (Sweden)

    Thomas Holm

    Full Text Available BACKGROUND: Glutathione concentration in the lens decreases in aging and cataractous lenses, providing a marker for tissue condition. Experimental procedures requiring unfrozen lenses from donor banks rely on transportation in storage medium, affecting lens homeostasis and alterations in glutathione levels. The aim of the study was to examine the effects of Optisol-GS and castor oil on lens condition, determined from their ability to maintain glutathione concentrations. METHODOLOGY/PRINCIPAL FINDINGS: Rat lenses were stored in the two types of storage media at varying time intervals up to 3 days. Glutathione concentration was afterwards determined in an enzymatic detection assay, specific for both reduced and oxidized forms. Lenses removed immediately after death exhibited a glutathione concentration of 4.70±0.29 mM. In vitro stored lenses in Optisol-GS lost glutathione quickly, ending with a concentration of 0.60±0.34 mM after 3 days while castor oil stored lenses exhibited a slower decline and ended at 3 times the concentration. A group of lenses were additionally stored under post mortem conditions within the host for 6 hours before its removal. Total glutathione after 6 hours was similar to that of lenses removed immediately after death, but with altered GSH and GSSG concentrations. Subsequent storage of these lenses in media showed changes similar to those in the first series of experiments, albeit to a lesser degree. CONCLUSIONS/SIGNIFICANCE: It was determined that storage in Optisol-GS resulted in a higher loss of glutathione than lenses stored in castor oil. Storage for more than 12 hours reduced glutathione to half its original concentration, and was considered unusable after 24 hours.

  3. Influence of induction hardening parameters on the GS30Mn5 weld properties

    Directory of Open Access Journals (Sweden)

    V. Marušić

    2016-10-01

    Full Text Available This study examines parameters of post-weld heat treatment on the test specimens made of cast steel GS30Mn5. The welding is performed with shielded metal arc welding (SMAW process. The aim is to obtain the surface without illicit cracks, with hardness ranging from 320 up to 400 HB. After induction heating, the specimens are cooled alternately with air and water. Decreased speed of quenching results in avoiding the occurrence of illicit splashes, while the hardness is maintained within the prescribed limits.

  4. Use of plant trait data in the ISBA-A-gs model

    Science.gov (United States)

    Calvet, Jean-Christophe

    2014-05-01

    ISBA-A-gs is a CO2-responsive LSM (Calvet et al., 1998; Gibelin et al., 2006), able to simulate the diurnal cycle of carbon and water vapour fluxes, together with LAI and soil moisture evolution. The various components of ISBA-A-gs are based to a large extent on meta-analyses of trait data. (1) Photosynthesis: ISBA-A-gs uses the model of Goudriaan et al. (1985) modified by Jacobs (1994) and Jacobs et al. (1996). The main parameter is mesophyll conductance (gm). Leaf-level photosynthesis observations were used together with canopy level flux observations to derive gm together with other key parameters of the Jacobs model, including in drought conditions. This permitted implementing detailed representations of the soil moisture stress. Two different types of drought responses are distinguished for both herbaceous vegetation (Calvet, 2000) and forests (Calvet et al., 2004), depending on the evolution of the water use efficiency (WUE) under moderate stress: WUE increases in the early soil water stress stages in the case of the drought-avoiding response, whereas WUE decreases or remains stable in the case of the drought-tolerant response. (2) Plant growth: the leaf biomass is provided by a growth model (Calvet et al., 1998; Calvet and Soussana, 2001) driven by photosynthesis. In contrast to other land surface models, no GDD-based phenology model is used in ISBA-A-gs, as the vegetation growth and senescence are entirely driven by photosynthesis. The leaf biomass is supplied with the carbon assimilated by photosynthesis, and decreased by a turnover and a respiration term. Turnover is increased by a deficit in photosynthesis. The leaf onset is triggered by sufficient photosynthesis levels and a minimum LAI value is prescribed. The maximum annual value of LAI is prognostic, i.e. it can be predicted by the model. LAI is derived from leaf biomass using SLA values. The latter are derived from the leaf nitrogen concentration using plasticity parameters. (3) CO2 effect: the

  5. Comparisons of 'Identical' Simulations by the Eulerian Gyrokinetic Codes GS2 and GYRO

    Science.gov (United States)

    Bravenec, R. V.; Ross, D. W.; Candy, J.; Dorland, W.; McKee, G. R.

    2003-10-01

    A major goal of the fusion program is to be able to predict tokamak transport from first-principles theory. To this end, the Eulerian gyrokinetic code GS2 was developed years ago and continues to be improved [1]. Recently, the Eulerian code GYRO was developed [2]. These codes are not subject to the statistical noise inherent to particle-in-cell (PIC) codes, and have been very successful in treating electromagnetic fluctuations. GS2 is fully spectral in the radial coordinate while GYRO uses finite-differences and ``banded" spectral schemes. To gain confidence in nonlinear simulations of experiment with these codes, ``apples-to-apples" comparisons (identical profile inputs, flux-tube geometry, two species, etc.) are first performed. We report on a series of linear and nonlinear comparisons (with overall agreement) including kinetic electrons, collisions, and shaped flux surfaces. We also compare nonlinear simulations of a DIII-D discharge to measurements of not only the fluxes but also the turbulence parameters. [1] F. Jenko, et al., Phys. Plasmas 7, 1904 (2000) and refs. therein. [2] J. Candy, J. Comput. Phys. 186, 545 (2003).

  6. Behind the scenes of GS: a long-term urban planning vision

    CERN Multimedia

    Corinne Pralavorio

    2014-01-01

    The GS Department is working on a long-term plan for the urban planning of the CERN sites, ensuring that their development takes place using a coherent approach and keeping in mind the need for harmonious integration in the surrounding area.   Visitors are often bemused by CERN’s buildings, with their 1950s style and a layout that seems to defy all logic. Up until the 90s, buildings were erected as accelerators were built, with no apparent concern for harmony. But now, with a much larger number of users and installations, space is at a premium, getting around the site is difficult and urban planners are needed more than ever. "Over 9,000 people enter the CERN sites every day and we have 7,500 workstations," says Frédéric Magnin, Civil Engineering and Buildings Section Leader in the GS Department. For this reason, specialists in the department have been working on the development of the sites for five years. It is especially important that the...

  7. Necessary and sufficient liveness condition of GS3PR Petri nets

    Science.gov (United States)

    Liu, GaiYun; Barkaoui, Kamel

    2015-05-01

    Structural analysis is one of the most important and efficient methods to investigate the behaviour of Petri nets. Liveness is a significant behavioural property of Petri nets. Siphons, as structural objects of a Petri net, are closely related to its liveness. Many deadlock control policies for flexible manufacturing systems (FMS) modelled by Petri nets are implemented via siphon control. Most of the existing methods design liveness-enforcing supervisors by adding control places for siphons based on their controllability conditions. To compute a liveness-enforcing supervisor with as much as permissive behaviour, it is both theoretically and practically significant to find an exact controllability condition for siphons. However, the existing conditions, max, max‧, and max″-controllability of siphons are all overly restrictive and generally sufficient only. This paper develops a new condition called max*-controllability of the siphons in generalised systems of simple sequential processes with resources (GS3PR), which are a net subclass that can model many real-world automated manufacturing systems. We show that a GS3PR is live if all its strict minimal siphons (SMS) are max*-controlled. Compared with the existing conditions, i.e., max-, max‧-, and max″-controllability of siphons, max*-controllability of the SMS is not only sufficient but also necessary. An example is used to illustrate the proposed method.

  8. Glycation of polyclonal IgGs: Effect of sugar excipients during stability studies.

    Science.gov (United States)

    Leblanc, Y; Bihoreau, N; Jube, M; Andre, M-H; Tellier, Z; Chevreux, G

    2016-05-01

    A number of intravenous immunoglobulin preparations are stabilized with sugar additives that may lead over time to undesirable glycation reactions especially in liquid formulation. This study aimed to evaluate the reactivity of sugar excipients on such preparations in condition of temperature, formulation and concentration commonly used for pharmaceutical products. Through an innovative LC-MS method reported to characterize post-translational modifications of IgGs Fc/2 fragments, a stability study of IVIg formulated with reducing and non-reducing sugars has been undertaken. The rate of polyclonal IgGs glycation was investigated during 6months at 5, 25, 30 and 40°C. High levels of glycation were observed with reducing sugars such as glucose and maltose in the first months of the stability study from 25°C. Non-reducing sugars presented a low reactivity even at the highest tested temperature (40°C). Furthermore, a site by site analysis was performed by MS/MS to determine the glycation sites which were mainly identified at Lys246, Lys248 and Lys324. This work points out the high probability of glycation reactions in some commercialized products and describes a useful method to characterize IVIg glycated products issued from reducing sugar excipients. Copyright © 2016 The Authors. Published by Elsevier B.V. All rights reserved.

  9. Management Systems and Safety Culture in the Nuclear Energy Sector (ISO 9001 & GS-R-3)

    International Nuclear Information System (INIS)

    Smetnik, A.; Murlis, D.

    2016-01-01

    Nowadays, the enterprises of the Rosatom State Nuclear Energy Corporation that provides products and services to foreign customers should rely on the requirements to the management systems established by the IAEA Standard GS-R-3 “The management system for facilities and activities”. This results from the fact that in order to enter foreign markets, Russian suppliers have to meet foreign requirements related to quality assurance, protection of the environment, nuclear and radiation safety, etc. For instance, the Finnish customer “Fennovoima” requires full compliance of the management systems of the Russian companies involved in the construction of the Hanhikivi-1 NPP with the GS-R-3 Standard. ISO 9001 quality management systems were widely implemented in the nuclear industry enterprises in Russia. The assessment of compliance of the quality management systems with the established requirements is carried out by the certification bodies. The same relates to the environmental management systems that are implemented at the majority of nuclear industry facilities in Russia. But due to their uniqueness and associated significant risks, the nuclear industry enterprises have to meet current safety requirements and principles established in the IAEA Safety Standards, such as safety culture and risk management.

  10. Overexpression of GsZFP1 enhances salt and drought tolerance in transgenic alfalfa (Medicago sativa L.).

    Science.gov (United States)

    Tang, Lili; Cai, Hua; Ji, Wei; Luo, Xiao; Wang, Zhenyu; Wu, Jing; Wang, Xuedong; Cui, Lin; Wang, Yang; Zhu, Yanming; Bai, Xi

    2013-10-01

    GsZFP1 encodes a Cys2/His2-type zinc-finger protein. In our previous study, when GsZFP1 was heterologously expressed in Arabidopsis, the transgenic Arabidopsis plants exhibited enhanced drought and cold tolerance. However, it is still unknown whether GsZFP1 is also involved in salt stress. GsZFP1 is from the wild legume Glycine soja. Therefore, the aims of this study were to further elucidate the functions of the GsZFP1 gene under salt and drought stress in the forage legume alfalfa and to investigate its biochemical and physiological functions under these stress conditions. Our data showed that overexpression of GsZFP1 in alfalfa resulted in enhanced salt tolerance. Under high salinity stress, greater relative membrane permeability and malondialdehyde (MDA) content were observed and more free proline and soluble sugars accumulated in transgenic alfalfa than in the wild-type (WT) plants; in addition, the transgenic lines accumulated less Na(+) and more K(+) in both the shoots and roots. Overexpression of GsZFP1 also enhanced the drought tolerance of alfalfa. The fold-inductions of stress-responsive marker gene expression, including MtCOR47, MtRAB18, MtP5CS, and MtRD2, were greater in transgenic alfalfa than those of WT under drought stress conditions. In conclusion, the transgenic alfalfa plants generated in this study could be used for farming in salt-affected as well as arid and semi-arid areas. Copyright © 2013 Elsevier Masson SAS. All rights reserved.

  11. Toll-like receptor 7 agonist GS-9620 induces prolonged inhibition of HBV via a type I interferon-dependent mechanism.

    Science.gov (United States)

    Niu, Congrong; Li, Li; Daffis, Stephane; Lucifora, Julie; Bonnin, Marc; Maadadi, Sarah; Salas, Eduardo; Chu, Ruth; Ramos, Hilario; Livingston, Christine M; Beran, Rudolf K; Garg, Abhishek V; Balsitis, Scott; Durantel, David; Zoulim, Fabien; Delaney, William E; Fletcher, Simon P

    2018-05-01

    GS-9620, an oral agonist of toll-like receptor 7 (TLR7), is in clinical development for the treatment of chronic hepatitis B (CHB). GS-9620 was previously shown to induce prolonged suppression of serum viral DNA and antigens in the woodchuck and chimpanzee models of CHB. Herein, we investigated the molecular mechanisms that contribute to the antiviral response to GS-9620 using in vitro models of hepatitis B virus (HBV) infection. Cryopreserved primary human hepatocytes (PHH) and differentiated HepaRG (dHepaRG) cells were infected with HBV and treated with GS-9620, conditioned media from human peripheral blood mononuclear cells treated with GS-9620 (GS-9620 conditioned media [GS-9620-CM]), or other innate immune stimuli. The antiviral and transcriptional response to these agents was determined. GS-9620 had no antiviral activity in HBV-infected PHH, consistent with low level TLR7 mRNA expression in human hepatocytes. In contrast, GS-9620-CM induced prolonged reduction of HBV DNA, RNA, and antigen levels in PHH and dHepaRG cells via a type I interferon (IFN)-dependent mechanism. GS-9620-CM did not reduce covalently closed circular DNA (cccDNA) levels in either cell type. Transcriptional profiling demonstrated that GS-9620-CM strongly induced various HBV restriction factors - although not APOBEC3A or the Smc5/6 complex - and indicated that established HBV infection does not modulate innate immune sensing or signaling in cryopreserved PHH. GS-9620-CM also induced expression of immunoproteasome subunits and enhanced presentation of an immunodominant viral peptide in HBV-infected PHH. Type I IFN induced by GS-9620 durably suppressed HBV in human hepatocytes without reducing cccDNA levels. Moreover, HBV antigen presentation was enhanced, suggesting additional components of the TLR7-induced immune response played a role in the antiviral response to GS-9620 in animal models of CHB. GS-9620 is a drug currently being tested in clinical trials for the treatment of chronic

  12. Draft genome sequencing of giardia intestinalis assemblage B isolate GS: is human giardiasis caused by two different species?

    Directory of Open Access Journals (Sweden)

    Oscar Franzén

    2009-08-01

    Full Text Available Giardia intestinalis is a major cause of diarrheal disease worldwide and two major Giardia genotypes, assemblages A and B, infect humans. The genome of assemblage A parasite WB was recently sequenced, and the structurally compact 11.7 Mbp genome contains simplified basic cellular machineries and metabolism. We here performed 454 sequencing to 16x coverage of the assemblage B isolate GS, the only Giardia isolate successfully used to experimentally infect animals and humans. The two genomes show 77% nucleotide and 78% amino-acid identity in protein coding regions. Comparative analysis identified 28 unique GS and 3 unique WB protein coding genes, and the variable surface protein (VSP repertoires of the two isolates are completely different. The promoters of several enzymes involved in the synthesis of the cyst-wall lack binding sites for encystation-specific transcription factors in GS. Several synteny-breaks were detected and verified. The tetraploid GS genome shows higher levels of overall allelic sequence polymorphism (0.5 versus <0.01% in WB. The genomic differences between WB and GS may explain some of the observed biological and clinical differences between the two isolates, and it suggests that assemblage A and B Giardia can be two different species.

  13. Synthesis and optimization of cholesterol-based diquaternary ammonium Gemini Surfactant (Chol-GS) as a new gene delivery vector.

    Science.gov (United States)

    Kim, Bieong-Kil; Doh, Kyung-Oh; Bae, Yun-Ui; Seu, Young-Bae

    2011-01-01

    Amongst a number of potential nonviral vectors, cationic liposomes have been actively researched, with both gemini surfactants and bola amphiphiles reported as being in possession of good structures in terms of cell viability and in vitro transfection. In this study, a cholesterol-based diquaternary ammonium gemini surfactant (Chol-GS) was synthesized and assessed as a novel nonviral gene vector. Chol-GS was synthesized from cholesterol by way of four reaction steps. The optimal efficiency was found to be at a weight ratio of 1:4 of lipid:DOPE (1,2-dioleoyl-L-alpha- glycero-3-phosphatidylethanolamine), and at a ratio of between 10:1~15:1 of liposome:DNA. The transfection efficiency was compared with commercial liposomes and with Lipofectamine, 1,2-dimyristyloxypropyl-3-dimethylhydroxyethylammonium bromide (DMRIE-C), and N-[1-(2,3-dioleoyloxy)propyl]- N,N,N-trimethylammonium chloride (DOTAP). The results indicate that the efficiency of Chol-GS is greater than that of all the tested commercial liposomes in COS7 and Huh7 cells, and higher than DOTAP and Lipofectamine in A549 cells. Confirmation of these findings was observed through the use of green fluorescent protein expression. Chol-GS exhibited a moderate level of cytotoxicity, at optimum concentrations for efficient transfection, indicating cell viability. Hence, the newly synthesized Chol-GS liposome has the potential of being an excellent nonviral vector for gene delivery.

  14. Comparison between IAEA GS-R-3 and ISO 9001:2000

    International Nuclear Information System (INIS)

    Biscan, R.

    2008-01-01

    International Atomic Energy Agency (IAEA) developed Safety Standard 'The Management System for Facilities and Activities' (GS-R-3) to define the requirements for establishing, implementing, assessing, and continually improving an integrated management system to integrate: safety, health, environmental, security, quality and economic elements. Standard requirements must be met to ensure the protection of people and the environment and they are governed by the objectives, concepts and IAEA Safety Fundamentals principles. The GS-R-3 requirements may be used as the basis for the: Management System of organizations directly responsible for operating facilities and activities and providing services; Regulation of these facilities and activities by the regulatory body: Management System of the relevant regulatory bodies; Operator, to specify to the supplier, via contractual documentation, any specific requirements that must be included in the supplier's management system for the supply and delivery of products. International Organization for Standardization (ISO) developed International Standard 'Quality Management Systems - Requirements' (ISO 9001:2000) to specify requirements for a quality management system where an organization: Needs to demonstrate its ability to consistently provide product that meets customer and applicable regulatory requirements, and Aims to enhance customer satisfaction through the effective application of the system, including processes for continual improvement of the system and the assurance of conformity to customer and applicable regulatory requirements. IAEA GS-R-3 is focused on meeting the overall safety requirements for the plant, personnel and society in general, and grading the application of the management system. Any State wishing to enter into an agreement with the IAEA concerning any form of Agency assistance is required to comply with the requirements of this safety standard that pertain to the activities covered by the agreement

  15. Carbon steel protection in G.S. [Girldler sulphide] plants: Pt. 8

    International Nuclear Information System (INIS)

    Lires, Osvaldo; Delfino, Cristina; Rojo, Enrique.

    1990-01-01

    In order to protect carbon steel of towers and piping of a GS experimental heavy water plant against corrosion produced by the action of aqueous solutions of hydrogen sulphide, a method, elsewhere published, was developed. Carbon steel exposed to saturated aqueous solutions of hydrogen sulphide forms iron sulphide scales. In oxygen free solutions, evolution of corrosion follows the sequence mackinawate → cubic ferrous sulphide → troilite → pyrrotite → pyrite. Scales formed by pyrrotite and pyrite are the most protective layers (these are obtained at 130 deg C, 2 MPa for a period of 14 days). Pyrite formation is favoured by an oxidizing agent presence that allows the oxidation of sulphur ions to disulphur ions. Elemental sulphur or oxygen were used as oxidating agents. Variation and operational parameters such as concentration, temperature, pH, aggregate time, etc. were studied. Though little improvement on protective scales quality was observed, results do not justify operational troubles and the additional costs and effort involved. (Author)

  16. Replacement of a cracked pressure tube in Bruce GS unit 2

    International Nuclear Information System (INIS)

    Dunn, J.T.

    1982-06-01

    In 1982 February, a primary heat transport system leak was detected in the annulus gas system by on-line instrumentation. The source of the leak was found to be a small axial crack in the pressure tube of fuel channel X-14. This fuel channel was removed and replaced by station maintenance staff, and the unit was returned to service five weeks after it had been shut down. The cracked pressure tube was sent to Chalk River Nuclear Laboratories for examination, and the crack was found to be very similar to those found in Pickering GS units 3 and 4 in 1974-75. It was caused by delayed hydride cracking during the period of high residual stress between the time of rolling and the pre-service stress relief

  17. Carbon steel protection in G.S. (Girlder sulfide) plants. CITROSOLV process influence. Pt. 6

    International Nuclear Information System (INIS)

    Lires, O.A.; Burkart, A.L.; Delfino, C.A.; Rojo, E.A.

    1988-01-01

    In order to protect carbon steel towers and piping of Girlder sulfide (G.S.) experimental heavy water plants against corrosion produced by the action of aqueous solutions of hydrogen sulfides, a method, previously published, was developed. Carbon steel, exposed to saturated aqueous solutions of hydrogen sulfide, forms iron sulfide scales. In oxygen free solutions evolution of corrosion follows the sequence: mackinawite → cubic ferrous sulfide → troilite → pyrrotite → pyrite. Scales formed by pyrrotite-pyrite or pyrite are the most protective layers (these are obtained at 130 deg C, 2 MPa, for periods of 14 days). CITROSOLV Process (Pfizer) is used to descaling and passivating stainless steel plant's components. This process must be used in mixed (carbon steel - stainless steel) circuits and may cause the formation of magnetite scales over the carbon steel. The influence of magnetite in the pyrrotite-pyrite scales formation is studied in this work. (Author) [es

  18. Carbon steel protection in G.S. [Girldler sulphide] plants: Pt. 7

    International Nuclear Information System (INIS)

    Lires, Osvaldo; Delfino, Cristina; Rojo, Enrique.

    1989-01-01

    In order to protect carbon steel towers and piping of a GS experimental heavy water plant against corrosion produced by the action of aqueous solutions of hydrogen sulphide, a method, elsewhere published, was developed. Carbon steel exposed to saturated aqueous solutions of hydrogen sulphide forms iron sulphide scales. In oxygen free solutions, evolution of corrosion follows the sequence mackinawite → cubic ferrous sulphide → troilite → pyrrotite → pyrite. Scales formed by pyrrotite and pyrite are the most protective layers (these are obtained at 130 deg C, 2 MPa for a period of 14 days). During a plant shutdown procedures, the carbon steel protected with those scales is exposed to water and highly humid air; under such conditions oxidation is unavoidable. Later, treatment in plant conditions does not regenerate scales because the composition of regenerated scales involves more soluble iron sulphides such as mackinawite and troilite. Therefore, it is not recommendable to expose the protective scales to atmospherical conditions. (Author)

  19. A 2 GS/s 8-bit folding and interpolating ADC in 90 nm CMOS

    International Nuclear Information System (INIS)

    He Wenwei; Meng Qiao; Zhang Yi; Tang Kai

    2014-01-01

    A single-channel 2 GS/s 8-bit analog-to-digital converter in 90 nm CMOS process technology is presented. It utilizes cascade folding architecture, which incorporates an additional inter-stage sample-and-hold amplifier between the folding circuits to enhance the quantization time. It also uses the foreground on-chip digital-assisted calibration circuit to improve the linearity of the circuit. The post simulation results demonstrate that it has a differential nonlinearity < ±0.3 LSB and an integral nonlinearity < ±0.25 LSB at the Nyquist frequency. Moreover, 7.338 effective numbers of bits can be achieved at 2 GSPS. The whole chip area is 0.88 × 0.88 mm 2 with the pad. It consumes 210 mW from a 1.2 V single supply. (semiconductor integrated circuits)

  20. Potent Inhibitory Effects of D-tagatose on the Acid Production and Water-insoluble Glucan Synthesis of Streptococcus mutans GS5 in the Presence of Sucrose

    OpenAIRE

    Sawada, Daijo; Ogawa, Takaaki; Miyake, Minoru; Hasui, Yoshinori; Yamaguchi, Fuminori; Izumori, Ken; Tokuda, Masaaki

    2015-01-01

    We examined and compared the inhibitory effects of D-tagatose on the growth, acid production, and water-insoluble glucan synthesis of GS5, a bacterial strain of Streptococcus mutans, with those of xylitol, D-psicose, L-psicose and L-tagatose. GS5 was cultured for 12h in a medium containing 10オ (w/v) of xylitol, D-psicose, L-psicose, D-tagatose or L-tagatose, and the inhibitory effect of GS5 growth was assessed. Each sugar showed different inhibitory effects on GS5. Both D-tagatose and xylitol...

  1. The better growth phenotype of DvGS1-transgenic arabidopsis thaliana is attributed to the improved efficiency of nitrogen assimilation

    Directory of Open Access Journals (Sweden)

    Zhu Chenguang

    2015-01-01

    Full Text Available The overexpression of the algal glutamine synthetase (GS gene DvGS1 in Arabidopsis thaliana resulted in higher plant biomass and better growth phenotype. The purpose of this study was to recognize the biological mechanism for the growth improvement of DvGS1-transgenic Arabidopsis. A series of molecular and biochemical investigations related to nitrogen and carbon metabolism in the DvGS1-transgenic line was conducted. Analysis of nitrogen use efficiency (NUE-related gene transcription and enzymatic activity revealed that the transcriptional level and enzymatic activity of the genes encoding GS, glutamate synthase, glutamate dehydrogenase, alanine aminotransferase and aspartate aminotransferase, were significantly upregulated, especially from leaf tissues of the DvGS1-transgenic line under two nitrate conditions. The DvGS1-transgenic line showed increased total nitrogen content and decreased carbon: nitrogen ratio compared to wild-type plants. Significant reduced concentrations of free nitrate, ammonium, sucrose, glucose and starch, together with higher concentrations of total amino acids, individual amino acids (glutamate, aspartate, asparagine, methionine, soluble proteins and fructose in leaf tissues confirmed that the DvGS1-transgenic line demonstrated a higher efficiency of nitrogen assimilation, which subsequently affected carbon metabolism. These improved metabolisms of nitrogen and carbon conferred the DvGS1-transgenic Arabidopsis higher NUE, more biomass and better growth phenotype compared with the wild-type plants.

  2. Molecular characterization of a novel algal glutamine synthetase (GS) and an algal glutamate synthase (GOGAT) from the colorful outer mantle of the giant clam, Tridacna squamosa, and the putative GS-GOGAT cycle in its symbiotic zooxanthellae.

    Science.gov (United States)

    Fam, Rachel R S; Hiong, Kum C; Choo, Celine Y L; Wong, Wai P; Chew, Shit F; Ip, Yuen K

    2018-05-20

    Giant clams harbor symbiotic zooxanthellae (Symbiodinium), which are nitrogen-deficient, mainly in the fleshy and colorful outer mantle. This study aimed to sequence and characterize the algal Glutamine Synthetase (GS) and Glutamate Synthase (GLT), which constitute the glutamate synthase cycle (or GS-GOGAT cycle, whereby GOGAT is the protein acronym of GLT) of nitrogen assimilation, from the outer mantle of the fluted giant clam, Tridacna squamosa. We had identified a novel GS-like cDNA coding sequence of 2325 bp, and named it as T. squamosa Symbiodinium GS1 (TSSGS1). The deduced TSSGS1 sequence had 774 amino acids with a molecular mass of 85 kDa, and displayed the characteristics of GS1 and Nucleotide Diphosphate Kinase. The cDNA coding sequence of the algal GLT, named as T. squamosa Symbiodinium GLT (TSSGLT), comprised 6399 bp, encoding a protein of 2133 amino acids and 232.4 kDa. The zooxanthellal origin of TSSGS1 and TSSGOGAT was confirmed by sequence comparison and phylogenetic analyses. Indeed, TSSGS1 and TSSGOGAT were expressed predominately in the outer mantle, which contained the majority of the zooxanthellae. Immunofluorescence microscopy confirmed the expression of TSSGS1 and TSSGOGAT in the cytoplasm and the plastids, respectively, of the zooxanthellae in the outer mantle. It can be concluded that the symbiotic zooxanthellae of T. squamosa possesses a glutamate synthase (TSSGS1-TSSGOGAT) cycle that can assimilate endogenous ammonia produced by the host clam into glutamate, which can act as a substrate for amino acid syntheses. Thus, our results provide insights into why intact giant clam-zooxanthellae associations do not excrete ammonia under normal circumstances. Copyright © 2018 Elsevier B.V. All rights reserved.

  3. Photometry of the three eclipsing novalike variables EC 21178-5417, GS Pav and V345 Pav

    Science.gov (United States)

    Bruch, Albert

    2017-10-01

    As part of a project to better characterize comparatively bright, yet little studied cataclysmic variables time resolved photometry of the three eclipsing novalike variables EC 21178-5417, GS Pav und V345 Pav is presented. Previously known orbital periods are significantly improved and long-term ephemeris are derived. Variations of eclipse profiles, occurring on time scales of days to weeks, are analyzed. Out of eclipse the light curves are characterized by low scale flickering superposed on more gradual variations with amplitudes limited to a few tenths of a magnitude and profiles which at least in EC 21178-5417 and GS Pav roughly follow the same pattern in all observed cycles. Additionally, signs for variations on the time scale of some tens of minutes are seen in GS Pav, most clearly in two subsequent nights when in the first of these a signal with a period of 15.7 min was observed over several hours. In the second night variations with twice this period were seen. While no additional insight could be gained on quasi periodic oscillations (QPOs) and dwarf nova oscillations in EC 21178-5417, previously detected by Warner et al. (2003), and while such oscillations could not be found in V345 Pav, stacked power spectra of GS Pav clearly reveal the presence of QPOs over time intervals of several hours with periods varying between 200 s and 500 s in that system.

  4. An 11b 3.6GS/s time-Iiterleaved SAR ADC in 65nm CMOS

    NARCIS (Netherlands)

    Janssen, E.J.G.; Doris, K.; Zanikopoulos, A.; Murroni, A.; Weide, van der G.; Lin, Y.; Alvado, L.; Darthenay, F.; Fregeais, Y.

    2013-01-01

    Over the last years several low-power time-interleaved (TI) ADC designs in the 2.5-to-3.0GS/s range have been published [1-3], intended for integration in applications like radar, software-defined radio, full-spectrum cable modems, and multi-channel satellite reception. It is to be expected that

  5. Genome Sequence of Aeribacillus pallidus Strain GS3372, an Endospore-Forming Bacterium Isolated in a Deep Geothermal Reservoir

    OpenAIRE

    Sevasti Filippidou; Marion Jaussi; Thomas Junier; Tina Wunderlin; Nicole Jeanneret; Simona Regenspurg; Po-E Li; Chien-Chi Lo; Shannon Johnson; Kim McMurry; Cheryl D. Gleasner; Momchilo Vuyisich; Patrick S. Chain; Pilar Junier

    2015-01-01

    The genome of strain GS3372 is the first publicly available strain of Aeribacillus pallidus. This endospore-forming thermophilic strain was isolated from a deep geothermal reservoir. The availability of this genome can contribute to the clarification of the taxonomy of the closely related Anoxybacillus, Geobacillus, and Aeribacillus genera.

  6. Genome Sequence of Aeribacillus pallidus Strain GS3372, an Endospore-Forming Bacterium Isolated in a Deep Geothermal Reservoir.

    Science.gov (United States)

    Filippidou, Sevasti; Jaussi, Marion; Junier, Thomas; Wunderlin, Tina; Jeanneret, Nicole; Regenspurg, Simona; Li, Po-E; Lo, Chien-Chi; Johnson, Shannon; McMurry, Kim; Gleasner, Cheryl D; Vuyisich, Momchilo; Chain, Patrick S; Junier, Pilar

    2015-08-27

    The genome of strain GS3372 is the first publicly available strain of Aeribacillus pallidus. This endospore-forming thermophilic strain was isolated from a deep geothermal reservoir. The availability of this genome can contribute to the clarification of the taxonomy of the closely related Anoxybacillus, Geobacillus, and Aeribacillus genera. Copyright © 2015 Filippidou et al.

  7. Interference with Gsα-Coupled Receptor Signaling in Renin-Producing Cells Leads to Renal Endothelial Damage

    DEFF Research Database (Denmark)

    Lachmann, Peter; Hickmann, Linda; Steglich, Anne

    2017-01-01

    Intracellular cAMP, the production of which is catalyzed by the α-subunit of the stimulatory G protein (Gsα), controls renin synthesis and release by juxtaglomerular (JG) cells of the kidney, but may also have relevance for the physiologic integrity of the kidney. To investigate this possibility...... in the maintenance and protection of the renal microvascular endothelium....

  8. Nustar Detection of Hard X-Ray Phase Lags from the Accreting Pulsar GS 0834-430

    DEFF Research Database (Denmark)

    Miyasaka, Hiromasa; Bachetti, Matteo; Harrison, Fiona A.

    2013-01-01

    The Nuclear Spectroscopic Telescope Array hard X-ray telescope observed the transient Be/X-ray binary GS 0834-430 during its 2012 outburst-the first active state of this system observed in the past 19 yr. We performed timing and spectral analysis and measured the X-ray spectrum between 3-79 keV w...

  9. DNA sequence polymorphisms within the bovine guanine nucleotide-binding protein Gs subunit alpha (Gsα-encoding (GNAS genomic imprinting domain are associated with performance traits

    Directory of Open Access Journals (Sweden)

    Mullen Michael P

    2011-01-01

    Full Text Available Abstract Background Genes which are epigenetically regulated via genomic imprinting can be potential targets for artificial selection during animal breeding. Indeed, imprinted loci have been shown to underlie some important quantitative traits in domestic mammals, most notably muscle mass and fat deposition. In this candidate gene study, we have identified novel associations between six validated single nucleotide polymorphisms (SNPs spanning a 97.6 kb region within the bovine guanine nucleotide-binding protein Gs subunit alpha gene (GNAS domain on bovine chromosome 13 and genetic merit for a range of performance traits in 848 progeny-tested Holstein-Friesian sires. The mammalian GNAS domain consists of a number of reciprocally-imprinted, alternatively-spliced genes which can play a major role in growth, development and disease in mice and humans. Based on the current annotation of the bovine GNAS domain, four of the SNPs analysed (rs43101491, rs43101493, rs43101485 and rs43101486 were located upstream of the GNAS gene, while one SNP (rs41694646 was located in the second intron of the GNAS gene. The final SNP (rs41694656 was located in the first exon of transcripts encoding the putative bovine neuroendocrine-specific protein NESP55, resulting in an aspartic acid-to-asparagine amino acid substitution at amino acid position 192. Results SNP genotype-phenotype association analyses indicate that the single intronic GNAS SNP (rs41694646 is associated (P ≤ 0.05 with a range of performance traits including milk yield, milk protein yield, the content of fat and protein in milk, culled cow carcass weight and progeny carcass conformation, measures of animal body size, direct calving difficulty (i.e. difficulty in calving due to the size of the calf and gestation length. Association (P ≤ 0.01 with direct calving difficulty (i.e. due to calf size and maternal calving difficulty (i.e. due to the maternal pelvic width size was also observed at the rs

  10. Complex phase dynamics in coupled bursters

    DEFF Research Database (Denmark)

    Postnov, D E; Sosnovtseva, Olga; Malova, S Y

    2003-01-01

    The phenomenon of phase multistability in the synchronization of two coupled oscillatory systems typically arises when the systems individually display complex wave forms associated, for instance, with the presence of subharmonic components. Alternatively, phase multistability can be caused...... the number of spikes per train and the proximity of a neighboring equilibrium point can influence the formation of coexisting regimes....

  11. The mechano-gated channel inhibitor GsMTx4 reduces the exercise pressor reflex in decerebrate rats.

    Science.gov (United States)

    Copp, Steven W; Kim, Joyce S; Ruiz-Velasco, Victor; Kaufman, Marc P

    2016-02-01

    Mechanical and metabolic stimuli from contracting muscles evoke reflex increases in blood pressure, heart rate and sympathetic nerve activity. Little is known, however, about the nature of the mechano-gated channels on the thin fibre muscle afferents that contribute to evoke this reflex, termed the exercise pressor reflex. We determined the effect of GsMTx4, an inhibitor of mechano-gated Piezo channels, on the exercise pressor reflex evoked by intermittent contraction of the triceps surae muscles in decerebrated, unanaesthetized rats. GsMTx4 reduced the pressor, cardioaccelerator and renal sympathetic nerve responses to intermittent contraction but did not reduce the pressor responses to femoral arterial injection of compounds that stimulate the metabolically-sensitive thin fibre muscle afferents. Expression levels of Piezo2 channels were greater than Piezo1 channels in rat dorsal root ganglia. Our findings suggest that mechanically-sensitive Piezo proteins contribute to the generation of the mechanical component of the exercise pressor reflex in rats. Mechanical and metabolic stimuli within contracting skeletal muscles evoke reflex autonomic and cardiovascular adjustments. In cats and rats, gadolinium has been used to investigate the role played by the mechanical component of this reflex, termed the exercise pressor reflex. Gadolinium, however, has poor selectivity for mechano-gated channels and exerts multiple off-target effects. We tested the hypothesis that GsMTX4, a more selective mechano-gated channel inhibitor than gadolinium and a particularly potent inhibitor of mechano-gated Piezo channels, reduced the exercise pressor reflex in decerebrate rats. Injection of 10 μg of GsMTx4 into the arterial supply of the hindlimb reduced the peak pressor (control: 24 ± 5, GsMTx4: 12 ± 5 mmHg, P acid. Moreover, injection of 10 μg of GsMTx4 into the arterial supply of the hindlimb reduced the peak pressor (control: 24 ± 2, GsMTx4: 14 ± 3 mmHg, P reflex in

  12. Behind the scenes of GS: a professional fire and rescue service like no other

    CERN Multimedia

    Anaïs Schaeffer

    2014-01-01

    Meet the professionals at the top of their game working hard for the well-being of the CERN community. Meet the CERN Fire Brigade.   Highly-qualified professional firefighters CERN’s Fire and Rescue Service (FRS, GS-FB Group) currently consists of 58 professionals. These are highly sought-after positions: for just a handful of vacancies, hundreds of applications are submitted from all over Europe. And bear in mind that only professional firefighters with at least five years’ experience at a centre with high levels of operational activity may apply… and they must also have a good command of at least one of the Organization's two official languages. Once the pre-selection process is over, around twenty candidates progress to the next stage, where they are really put through their paces with language tests, theory exams and exercises on real fires. “For the practical part, all candidates are evaluated on their responses to a real fire," ...

  13. Behind the scenes of GS: there’s only one way to go

    CERN Multimedia

    Anaïs Schaeffer

    2014-01-01

    At CERN, all of the Laboratory’s imports and exports are routed in the same way: through the Logistics Service. This GS-IS Group service is responsible for receiving, inspecting and distributing all goods sent to the Organization.   Whether products for the CERN Stores, components for the experiments, tools, machinery and materials for the workshops or equipment for users and members of the personnel, nothing escapes the attention of CERN’s Logistics Service, which every year processes nearly 70,000 incoming deliveries, 7,500 shipments and 160,000 distributed items. “The vast majority of our imports come from CERN Member States,” says imports and customs procedures manager Laurence Planque, “but we are receiving more and more goods for collaborators working at CERN from non-Member States such as China, India and Pakistan. All these imports are entitled to diplomatic exemption, so every day we have to manage the customs clearance procedures wit...

  14. Development of a 1 GS/s high-resolution transient recorder

    CERN Document Server

    Bartknecht, S; Herrmann, F; Königsmann, K; Lauser, L; Schill, C; Schopferer, S; Wollny, H

    2009-01-01

    With present-day detectors in high energy physics one is often faced with short analog pulses of a few nanoseconds length which may cover large dynamic ranges. In many experiments both amplitude and timing information have to be measured with high accuracy. Additionally, the data rate per readout channel can reach several MHz, which makes high demands on the separation of pile-up pulses. For such applications we have built the GANDALF transient recorder with a resolution of 12bit@1GS/s and an analog bandwidth of 500 MHz. Signals are digitized and processed by fast algorithms to extract pulse arrival times and amplitudes in real-time and to generate experiment trigger signals. With up to 16 analog channels, deep memories and a high data rate interface, this 6U-VME64x/VXS module is not only a dead-time free digitization unit but also has huge numerical capabilities provided by the implementation of a Virtex5-SXT FPGA. Fast algorithms implemented in the FPGA may be used to disentangle possible pile-up pulses and...

  15. Behind the scenes of GS: Did you say “grey”?

    CERN Multimedia

    Antonella Del Rosso

    2014-01-01

    Walking around the CERN site, what we tend to notice are the buildings, roads, and car parks. At first glance, any “green” seems to be in the minority. The reality is quite different, as developed land takes up only 40 of the almost 650 hectares made available to the Organization by its Host States.   1,300 trees in CERN's enclosed areas, 250 hectares of cultivated fields and meadows, 140 hectares of woodland, and three wetlands: CERN clearly deserves its “green” certification from the Swiss conservation foundation Nature et économie that it has held since 2009. "We maintain every site, but each site is different and has its own conservation criteria," says Mathieu Fontaine, head of Green Spaces in the Civil Engineering and Buildings section of the GS Department. At CERN, an external company takes care of the day-to-day upkeep, but more complex operations are often necessary. The various projects to fell diseased or ...

  16. Detection of high GS risk group prostate tumors by diffusion tensor imaging and logistic regression modelling.

    Science.gov (United States)

    Ertas, Gokhan

    2018-07-01

    To assess the value of joint evaluation of diffusion tensor imaging (DTI) measures by using logistic regression modelling to detect high GS risk group prostate tumors. Fifty tumors imaged using DTI on a 3 T MRI device were analyzed. Regions of interests focusing on the center of tumor foci and noncancerous tissue on the maps of mean diffusivity (MD) and fractional anisotropy (FA) were used to extract the minimum, the maximum and the mean measures. Measure ratio was computed by dividing tumor measure by noncancerous tissue measure. Logistic regression models were fitted for all possible pair combinations of the measures using 5-fold cross validation. Systematic differences are present for all MD measures and also for all FA measures in distinguishing the high risk tumors [GS ≥ 7(4 + 3)] from the low risk tumors [GS ≤ 7(3 + 4)] (P Logistic regression modelling provides a favorable solution for the joint evaluations easily adoptable in clinical practice. Copyright © 2018 Elsevier Inc. All rights reserved.

  17. A 6-bit 4 GS/s pseudo-thermometer segmented CMOS DAC

    Science.gov (United States)

    Yijun, Song; Wenyuan, Li

    2014-06-01

    A 6-bit 4 GS/s, high-speed and power-efficient DAC for ultra-high-speed transceivers in 60 GHz band millimeter wave technology is presented. A novel pseudo-thermometer architecture is proposed to realize a good compromise between the fast conversion speed and the chip area. Symmetrical and compact floor planning and layout techniques including tree-like routing, cross-quading and common-centroid method are adopted to guarantee the chip is fully functional up to near-Nyquist frequency in a standard 0.18 μm CMOS process. Post simulation results corroborate the feasibility of the designed DAC, which canperform good static and dynamic linearity without calibration. DNL errors and INL errors can be controlled within ±0.28 LSB and ±0.26 LSB, respectively. SFDR at 4 GHz clock frequency for a 1.9 GHz near-Nyquist sinusoidal output signal is 40.83 dB and the power dissipation is less than 37 mW.

  18. A 6-bit 4 GS/s pseudo-thermometer segmented CMOS DAC

    International Nuclear Information System (INIS)

    Song Yijun; Li Wenyuan

    2014-01-01

    A 6-bit 4 GS/s, high-speed and power-efficient DAC for ultra-high-speed transceivers in 60 GHz band millimeter wave technology is presented. A novel pseudo-thermometer architecture is proposed to realize a good compromise between the fast conversion speed and the chip area. Symmetrical and compact floor planning and layout techniques including tree-like routing, cross-quading and common-centroid method are adopted to guarantee the chip is fully functional up to near-Nyquist frequency in a standard 0.18 μm CMOS process. Post simulation results corroborate the feasibility of the designed DAC, which canperform good static and dynamic linearity without calibration. DNL errors and INL errors can be controlled within ±0.28 LSB and ±0.26 LSB, respectively. SFDR at 4 GHz clock frequency for a 1.9 GHz near-Nyquist sinusoidal output signal is 40.83 dB and the power dissipation is less than 37 mW. (semiconductor integrated circuits)

  19. Measurement of isotope abundance variations in nature by gravimetric spiking isotope dilution analysis (GS-IDA).

    Science.gov (United States)

    Chew, Gina; Walczyk, Thomas

    2013-04-02

    Subtle variations in the isotopic composition of elements carry unique information about physical and chemical processes in nature and are now exploited widely in diverse areas of research. Reliable measurement of natural isotope abundance variations is among the biggest challenges in inorganic mass spectrometry as they are highly sensitive to methodological bias. For decades, double spiking of the sample with a mix of two stable isotopes has been considered the reference technique for measuring such variations both by multicollector-inductively coupled plasma mass spectrometry (MC-ICPMS) and multicollector-thermal ionization mass spectrometry (MC-TIMS). However, this technique can only be applied to elements having at least four stable isotopes. Here we present a novel approach that requires measurement of three isotope signals only and which is more robust than the conventional double spiking technique. This became possible by gravimetric mixing of the sample with an isotopic spike in different proportions and by applying principles of isotope dilution for data analysis (GS-IDA). The potential and principle use of the technique is demonstrated for Mg in human urine using MC-TIMS for isotopic analysis. Mg is an element inaccessible to double spiking methods as it consists of three stable isotopes only and shows great potential for metabolically induced isotope effects waiting to be explored.

  20. Quaternary structure of a G-protein-coupled receptor heterotetramer in complex with Gi and Gs.

    Science.gov (United States)

    Navarro, Gemma; Cordomí, Arnau; Zelman-Femiak, Monika; Brugarolas, Marc; Moreno, Estefania; Aguinaga, David; Perez-Benito, Laura; Cortés, Antoni; Casadó, Vicent; Mallol, Josefa; Canela, Enric I; Lluís, Carme; Pardo, Leonardo; García-Sáez, Ana J; McCormick, Peter J; Franco, Rafael

    2016-04-05

    G-protein-coupled receptors (GPCRs), in the form of monomers or homodimers that bind heterotrimeric G proteins, are fundamental in the transfer of extracellular stimuli to intracellular signaling pathways. Different GPCRs may also interact to form heteromers that are novel signaling units. Despite the exponential growth in the number of solved GPCR crystal structures, the structural properties of heteromers remain unknown. We used single-particle tracking experiments in cells expressing functional adenosine A1-A2A receptors fused to fluorescent proteins to show the loss of Brownian movement of the A1 receptor in the presence of the A2A receptor, and a preponderance of cell surface 2:2 receptor heteromers (dimer of dimers). Using computer modeling, aided by bioluminescence resonance energy transfer assays to monitor receptor homomerization and heteromerization and G-protein coupling, we predict the interacting interfaces and propose a quaternary structure of the GPCR tetramer in complex with two G proteins. The combination of results points to a molecular architecture formed by a rhombus-shaped heterotetramer, which is bound to two different interacting heterotrimeric G proteins (Gi and Gs). These novel results constitute an important advance in understanding the molecular intricacies involved in GPCR function.

  1. The NASA competitive placement plan for positions GS-15 and below (including trades and labor positions)

    Science.gov (United States)

    1993-01-01

    This plan provides the framework for selection based on merit from among the best qualified candidates available. Selections will be made without regard to political, religious, or labor organization affiliation or nonaffiliation, marital status, race, color, sex, national origin, nondisqualifying disability, or age. This plan does not guarantee promotion but rather ensures that all qualified available candidates receive fair and equitable consideration for positions filled under these competitive procedures. Announcing a vacancy under this plan is only one method of locating applicants for a position and can be used in conjunction with other methods. Subject to applicable law and regulation, selection of an individual to fill a position is the decision of management, as is the decision as to the method(s) to be used in identifying candidates. This plan is applicable to all NASA Installations. It covers all positions in the competitive service at (and below) the GS/GM-15 level (including all trades and labor positions), except positions in the Office of the Inspector General. The requirements herein are not intended to, nor should they be construed to limit in any way, the independent personnel authority of the Inspector General under the Inspector General Act, as Amended.

  2. S08: investigation and repair of a cracked feeder at Point Lepreau GS

    International Nuclear Information System (INIS)

    A Celovsky, A.; Wright, M.D.; Gendron, T.S.

    1997-01-01

    Early in 1997 investigation of a low level leak in the Point Lepreau GS (PLGS) PHTS revealed that an outlet feeder, S08, was leaking. Ultrasonic inspection, and subsequent failure analysis, revealed that the leak was a consequence of a crack. Given the unusual nature of this event, and current concerns over feeder thinning, a detailed and careful removal and examination procedure was developed. The S08 outlet feeder was removed and shipped to Chalk River Laboratories for examination. The examination confirmed that the failure was a through-wall crack, most likely the consequence of stress corrosion cracking. A critical point of the analysis was to determine how the crack initiated, and subsequently propagated. High residual stresses and possible abnormal loading in conjunction with chemistry environments resulted in the Stress Corrosion Cracking (SCC) of the S08 outlet feeder bend. It is recognized that some of the causative factors implicated in the S08 failure apply to other outlet feeders. In particular, residual stresses in the non-stress-relieved, short-radius cold bent pipes will remain relatively high over the future life of the feeders. However, the risk of CANDU feeder failure by SCC is judged to be extremely low based on the evidence of the inspections carried out to date and the good performance record of feeder pipe in the CANDU industry. The channel was restored to its locked configuration, and the failed section of feeder replaced. (author)

  3. Análisis estructural e invarianza de medición del MBI-GS en trabajadores peruanos (Structural Analysis and Measurement Invariance of MBI-GS in Peruvian Workers

    Directory of Open Access Journals (Sweden)

    Manuel Fernández-Arata

    2015-06-01

    Full Text Available Resumen La medición del burnout ha evolucionado con la creación de varios instrumentos y modelos. El Maslach Burnout Inventory - General Survey (MBI-GS es uno de estos instrumentos para medir tres constructos definicionales del burnout: (1 agotamiento emocional, (2 eficacia profesional y (3 indiferencia. Fue creado para un amplio rango de ocupaciones, pero pocas veces se ha verificado su estructura latente e invarianza de medición en Latinoamérica. El presente estudio analiza esta estructura latente y la invarianza de medición del MBI-GS en una muestra de 940 trabajadores peruanos de varias ocupaciones. Se aplicó la metodología de ecuaciones estructurales mediante el análisis factorial confirmatorio, así como la invarianza de medición entre varones y mujeres, imponiendo restricciones sucesivamente más estrictas. Los resultados verificaron satisfactoriamente la estructura de tres dimensiones latentes del MBI-GS, y la invarianza de sus parámetros entre hombres y mujeres. Se discute las implicaciones de los resultados. Abstract The measurement of burnout has evolved into the creation of various tools and models. The Maslach Burnout Inventory - General Survey (MBI-GS is one of these instruments used to measure three definitional constructs of burnout: (1 emotional exhaustion, (2 professional efficiency, and (3 indifference. It was created for a wide range of occupations, but its latent structure and invariance of measurement in Latin America has rarely been verified. The present study analyzes the latent structure and the invariance of measurement of MBI-GS in a sample of 940 Peruvian workers in various occupations. The methodology of structural equations was applied through the confirmatory factor analysis, as well as the invariance of measurement between men and women, imposing restrictions successively more strict. The results satisfactorily verified the structure of three-dimensional latent MBI-GS, and the invariance of its

  4. Potent inhibitory effects of D-tagatose on the acid production and water-insoluble glucan synthesis of Streptococcus mutans GS5 in the presence of sucrose.

    Science.gov (United States)

    Sawada, Daijo; Ogawa, Takaaki; Miyake, Minoru; Hasui, Yoshinori; Yamaguchi, Fuminori; Izumori, Ken; Tokuda, Masaaki

    2015-01-01

    We examined and compared the inhibitory effects of D-tagatose on the growth, acid production, and water-insoluble glucan synthesis of GS5, a bacterial strain of Streptococcus mutans, with those of xylitol, D-psicose, L-psicose and L-tagatose. GS5 was cultured for 12h in a medium containing 10% (w/v) of xylitol, D-psicose, L-psicose, D-tagatose or L-tagatose, and the inhibitory effect of GS5 growth was assessed. Each sugar showed different inhibitory effects on GS5. Both D-tagatose and xylitol significantly inhibited the acid production and water-insoluble glucan synthesis of GS5 in the presence of 1% (w/v) sucrose. However, the inhibitory effect of acid production by D-tagatose was significantly stronger than that of xylitol in presence of sucrose.

  5. GsLRPK, a novel cold-activated leucine-rich repeat receptor-like protein kinase from Glycine soja, is a positive regulator to cold stress tolerance.

    Science.gov (United States)

    Yang, Liang; Wu, Kangcheng; Gao, Peng; Liu, Xiaojuan; Li, Guangpu; Wu, Zujian

    2014-02-01

    Plant LRR-RLKs serve as protein interaction platforms, and as regulatory modules of protein activation. Here, we report the isolation of a novel plant-specific LRR-RLK from Glycine soja (termed GsLRPK) by differential screening. GsLRPK expression was cold-inducible and shows Ser/Thr protein kinase activity. Subcellular localization studies using GFP fusion protein indicated that GsLRPK is localized in the plasma membrane. Real-time PCR analysis indicated that temperature, salt, drought, and ABA treatment can alter GsLRPK gene transcription in G. soja. However, just protein induced by cold stress not by salinity and ABA treatment in tobacco was found to possess kinase activity. Furthermore, we found that overexpression of GsLRPK in yeast and Arabidopsis can enhance resistance to cold stress and increase the expression of a number of cold responsive gene markers. Copyright © 2013 Elsevier Ireland Ltd. All rights reserved.

  6. RBiomirGS: an all-in-one miRNA gene set analysis solution featuring target mRNA mapping and expression profile integration

    Directory of Open Access Journals (Sweden)

    Jing Zhang

    2018-01-01

    Full Text Available Background With the continuous discovery of microRNA’s (miRNA association with a wide range of biological and cellular processes, expression profile-based functional characterization of such post-transcriptional regulation is crucial for revealing its significance behind particular phenotypes. Profound advancement in bioinformatics has been made to enable in depth investigation of miRNA’s role in regulating cellular and molecular events, resulting in a huge quantity of software packages covering different aspects of miRNA functional analysis. Therefore, an all-in-one software solution is in demand for a comprehensive yet highly efficient workflow. Here we present RBiomirGS, an R package for a miRNA gene set (GS analysis. Methods The package utilizes multiple databases for target mRNA mapping, estimates miRNA effect on the target mRNAs through miRNA expression profile and conducts a logistic regression-based GS enrichment. Additionally, human ortholog Entrez ID conversion functionality is included for target mRNAs. Results By incorporating all the core steps into one package, RBiomirGS eliminates the need for switching between different software packages. The modular structure of RBiomirGS enables various access points to the analysis, with which users can choose the most relevant functionalities for their workflow. Conclusions With RBiomirGS, users are able to assess the functional significance of the miRNA expression profile under the corresponding experimental condition by minimal input and intervention. Accordingly, RBiomirGS encompasses an all-in-one solution for miRNA GS analysis. RBiomirGS is available on GitHub (http://github.com/jzhangc/RBiomirGS. More information including instruction and examples can be found on website (http://kenstoreylab.com/?page_id=2865.

  7. Exploring bacterial diversity in hospital environments by GS-FLX Titanium pyrosequencing.

    Directory of Open Access Journals (Sweden)

    Margarita Poza

    Full Text Available Understanding microbial populations in hospital environments is crucial for improving human health. Hospital-acquired infections are an increasing problem in intensive care units (ICU. In this work we present an exploration of bacterial diversity at inanimate surfaces of the ICU wards of the University Hospital A Coruña (Spain, as an example of confined hospital environment subjected to selective pressure, taking the entrance hall of the hospital, an open and crowded environment, as reference. Surface swab samples were collected from both locations and recovered DNA used as template to amplify a hypervariable region of the bacterial 16S rRNA gene. Sequencing of the amplicons was performed at the Roche 454 Sequencing Center using GS-FLX Titanium procedures. Reads were pre-processed and clustered into OTUs (operational taxonomic units, which were further classified. A total of 16 canonical bacterial phyla were detected in both locations. Members of the phyla Firmicutes (mainly Staphylococcus and Streptococcus and Actinobacteria (mainly Micrococcaceae, Corynebacteriaceae and Brevibacteriaceae were over-represented in the ICU with respect to the Hall. The phyllum Proteobacteria was also well represented in the ICU, mainly by members of the families Enterobacteriaceae, Methylobacteriaceae and Sphingomonadaceae. In the Hall sample, the phyla Proteobacteria, Bacteroidetes, Deinococcus-Thermus and Cyanobacteria were over-represented with respect to the ICU. Over-representation of Proteobacteria was mainly due to the high abundance of Enterobacteriaceae members. The presented results demonstrate that bacterial diversity differs at the ICU and entrance hall locations. Reduced diversity detected at ICU, relative to the entrance hall, can be explained by its confined character and by the existence of antimicrobial selective pressure. This is the first study using deep sequencing techniques made in hospital wards showing substantial hospital microbial

  8. Exploring bacterial diversity in hospital environments by GS-FLX Titanium pyrosequencing.

    Science.gov (United States)

    Poza, Margarita; Gayoso, Carmen; Gómez, Manuel J; Rumbo-Feal, Soraya; Tomás, María; Aranda, Jesús; Fernández, Ana; Bou, Germán

    2012-01-01

    Understanding microbial populations in hospital environments is crucial for improving human health. Hospital-acquired infections are an increasing problem in intensive care units (ICU). In this work we present an exploration of bacterial diversity at inanimate surfaces of the ICU wards of the University Hospital A Coruña (Spain), as an example of confined hospital environment subjected to selective pressure, taking the entrance hall of the hospital, an open and crowded environment, as reference. Surface swab samples were collected from both locations and recovered DNA used as template to amplify a hypervariable region of the bacterial 16S rRNA gene. Sequencing of the amplicons was performed at the Roche 454 Sequencing Center using GS-FLX Titanium procedures. Reads were pre-processed and clustered into OTUs (operational taxonomic units), which were further classified. A total of 16 canonical bacterial phyla were detected in both locations. Members of the phyla Firmicutes (mainly Staphylococcus and Streptococcus) and Actinobacteria (mainly Micrococcaceae, Corynebacteriaceae and Brevibacteriaceae) were over-represented in the ICU with respect to the Hall. The phyllum Proteobacteria was also well represented in the ICU, mainly by members of the families Enterobacteriaceae, Methylobacteriaceae and Sphingomonadaceae. In the Hall sample, the phyla Proteobacteria, Bacteroidetes, Deinococcus-Thermus and Cyanobacteria were over-represented with respect to the ICU. Over-representation of Proteobacteria was mainly due to the high abundance of Enterobacteriaceae members. The presented results demonstrate that bacterial diversity differs at the ICU and entrance hall locations. Reduced diversity detected at ICU, relative to the entrance hall, can be explained by its confined character and by the existence of antimicrobial selective pressure. This is the first study using deep sequencing techniques made in hospital wards showing substantial hospital microbial diversity.

  9. Resonant cell of a double nuclear electron resonance spectrometer for performance in a 120-350 Gs magnetic field

    International Nuclear Information System (INIS)

    Baldin, V.I.; Stepanov, A.P.

    1976-01-01

    Spectrometer double-frequency resonance cell construction of a double nuclear electron resonance for operation in 120-350 Gs magnetic fields is described. The cell has been developed from a special decimeter resonator with a concentrated capacitance. The electric and magnetic components of a high frequency field are efficiently divided in the separator. Therefore, the insertion of a measuring coil and a sample in the maximum of the magnetic component of the field does not practically affect the distribution and parameters of the high-frequency field. The double-frequency resonance cell proposed provides for a higher accuracy of measuring amplifications of the nuclear magnetic resonance signals when there is the overhauzer effect for 120-350 Gs magnetic fields

  10. Studies on silicone based antifoaming agents to be used in G.S. (Girlder sulfide) heavy water plants

    International Nuclear Information System (INIS)

    Delfino, C.A.

    1986-01-01

    In Girlder sulfide (G.S.) heavy water plants hydrogen sulfide-water systems are inherentely foaming, so the adding of antifoaming materials is of great importance. These may be of high volatility, pyrolizable or chemically unstable in plant operation conditions (water and hydrogen sulfide at 2MPa, up to 230 deg C). Six commercial silicone based antifoaming agents were studied from the point of view of their chemical and thermical stability in order to select the most suitable. (Author) [es

  11. Antifoaming materials studies in G.S. (Girlder sulfide) heavy water plants. Chemical and thermical stability. Pt. 3

    International Nuclear Information System (INIS)

    Delfino, C.A.; Rojo, E.A.

    1988-01-01

    In Girlder sulfide (G.S.) heavy water plants hydrogen sulfide-water systems are inherentely foaming, so the adding of antifoaming materials is of great importance. These may be of high volatility, pyrolizable or chemically unstable in plant operation conditions (water and hydrogen sulfide at 2 MPa, up to 230 deg C). Five commercial surfactants were studied from the point of view of their chemical and thermical stability in order to select the most suitable. (Author) [es

  12. Effect of transfer of donor corneal tissue from McCarey–Kaufmann medium to Optisol-GS on corneal endothelium

    Directory of Open Access Journals (Sweden)

    Neha Kapur

    2018-01-01

    Full Text Available Purpose: The purpose of this study is to evaluate the effect of transfer of donor corneal tissue from McCarey–Kaufmann (MK medium to Optisol-GS on corneal endothelium. Methods: This was a prospective, randomized comparative study. Twenty paired human donor corneal tissues of optical quality were retrieved. One tissue of the pair was preserved in Optisol-GS preservative medium (Group A and other tissue of the pair in MK medium (Group B at the time of corneoscleral disc excision. Within 12 h of retrieval, each cornea was evaluated using slit-lamp biomicroscopic examination and specular microscopic analysis. Group B corneas were transferred to Optisol-GS medium within 48–53 h of retrieval. Specular analysis of the paired corneas was repeated 3 h after transferring to Optisol-GS. On day 7 of storage, specular analysis of both the tissues was repeated. Results: The average age of the donor at the time of death was 29 years (16–68 years. The reduction in endothelial cell count, from baseline, in Groups A and B was 5.5% and 5.8% (P = 0.938 on the 3rd day and 8.2% and 12.6% (P = 0.025 on the 7th day, respectively, postretrieval. The coefficient of variation (CV increased by 36% (P = 0.021 and hexagonality reduced by 19% (P = 0.007 on day 7. All tissues retained an endothelial cell density higher than the accepted critical level for penetrating keratoplasty. Conclusion: Significant endothelial cell loss was noted while transferring tissues from one medium to another, necessitating the need for reevaluation of transferred tissues before utilization.

  13. A minimal set of tissue-specific hypomethylated CpGs constitute epigenetic signatures of developmental programming.

    Directory of Open Access Journals (Sweden)

    Alejandro Colaneri

    Full Text Available Cell specific states of the chromatin are programmed during mammalian development. Dynamic DNA methylation across the developing embryo guides a program of repression, switching off genes in most cell types. Thus, the majority of the tissue specific differentially methylated sites (TS-DMS must be un-methylated CpGs.Comparison of expanded Methyl Sensitive Cut Counting data (eMSCC among four tissues (liver, testes, brain and kidney from three C57BL/6J mice, identified 138,052 differentially methylated sites of which 23,270 contain CpGs un-methylated in only one tissue (TS-DMS. Most of these CpGs were located in intergenic regions, outside of promoters, CpG islands or their shores, and up to 20% of them overlapped reported active enhancers. Indeed, tissue-specific enhancers were up to 30 fold enriched in TS-DMS. Testis showed the highest number of TS-DMS, but paradoxically their associated genes do not appear to be specific to the germ cell functions, but rather are involved in organism development. In the other tissues the differentially methylated genes are associated with tissue-specific physiological or anatomical functions. The identified sets of TS-DMS quantify epigenetic distances between tissues, generated during development. We applied this concept to measure the extent of reprogramming in the liver of mice exposed to in utero or early postnatal nutritional stress. Different protocols of food restriction reprogrammed the liver methylome in different but reproducible ways.Thus, each identified set of differentially methylated sites constituted an epigenetic signature that traced the developmental programing or the early nutritional reprogramming of each exposed mouse. We propose that our approach has the potential to outline a number of disease-associated epigenetic states. The composition of differentially methylated CpGs may vary with each situation, behaving as a composite variable, which can be used as a pre-symptomatic marker for

  14. Amperometric Immunosensor for Carbofuran Detection Based on MWCNTs/GS-PEI-Au and AuNPs-Antibody Conjugate

    Directory of Open Access Journals (Sweden)

    Xiangyou Wang

    2013-04-01

    Full Text Available In this paper, an amperometric immunosensor for the detection of carbofuran was developed. Firstly, multiwall carbon nanotubes (MWCNTs and graphene sheets-ethyleneimine polymer-Au (GS-PEI-Au nanocomposites were modified onto the surface of a glass carbon electrode (GCE via self-assembly. The nanocomposites can increase the surface area of the GCE to capture a large amount of antibody, as well as produce a synergistic effect in the electrochemical performance. Then the modified electrode was coated with gold nanoparticles-antibody conjugate (AuNPs-Ab and blocked with BSA. The monoclonal antibody against carbofuran was covalently immobilized on the AuNPs with glutathione as a spacer arm. The morphologies of the GS-PEI-Au nanocomposites and the fabrication process of the immunosensor were characterized by X-ray diffraction (XRD, ultraviolet and visible absorption spectroscopy (UV-vis and scanning electron microscopy (SEM, respectively. Under optimal conditions, the immunosensor showed a wide linear range, from 0.5 to 500 ng/mL, with a detection limit of 0.03 ng/mL (S/N = 3. The as-constructed immunosensor exhibited notable performance features such as high specificity, good reproducibility, acceptable stability and regeneration performance. The results are mainly due to the excellent properties of MWCNTs, GS-PEI-Au nanocomposites and the covalent immobilization of Ab with free hapten binding sites for further immunoreaction. It provides a new avenue for amperometric immunosensor fabrication.

  15. Implementation of a management system in accordance with IAEA GS-R-3 Standard. A gap analysis

    International Nuclear Information System (INIS)

    Dicianu, I.; Oprea, M.

    2009-01-01

    Full text: The design and implementation of an Integrated Management System at SNN SA Headquarters become necessary as the CNCAN norms are already under revision to comply with the IAEA GS-R-3 standard. The purpose of this analysis is to draft a project for the transition from a Quality Management System (QMS) to an Integrated Management System (IMS) complying with GS-R-3 requirements. Four steps were identified for developing this project: STEP1 - To justify the necessity of the IMS implementation to meet the SNN SA Headquarters Top Management commitments. The requirements for implementing an IMS are analyzed and a comprehensive document is issued to (and maybe discussed with) SNN General Director in order to obtain the top management adherence/commitment to the project implementation. The document will show the strong and the weak points which should be considered in developing the project. The references for the project are: - IAEA Safety Standard GS-R-3 'The Management System for Facilities and Activities'; - ISO - 1400/2004 Standard 'Environmental Management System Requirements'; - OHSAS 18001/2007 Standard 'Occupational Health and Safety Management Systems. Requirements'; There are also considered: - IAEA Safety Guide GS-G-3.1 'Application of the Management System for Facilities and Activities'; - IAEA Draft Safety Guide DS-349 'Application of the Management System for Nuclear Facilities; There will be considered: Workshop 2 Bookmarks (F5) 2 - CNCAN Norms (as they will be revised); STEP2 - The performance of a comparative analysis of the requirements of GS-R-3, ISO 14001 and OHSAS 18001 versus the provisions of the QMS already implemented in SNN. This analysis is shown as a comparative table; STEP3 - Identification of the IMS processes. An overall analysis of the current processes described in the SNN QMS Manual is performed and based on this. There are identified the additional processes that have to be documented for the proper implementation of an IMS

  16. A 12b 2.9GS/s DAC with IM3>60dB beyond 1 GHz in 65nm CMOS

    NARCIS (Netherlands)

    Lin, C.H.; Goes, F.; Westra, J.; Mulder, J.; Lin, Y.; Arslan, E.; Ayranci, E.; Liu, X.; Bult, K.

    2009-01-01

    A 12b 2.9GS/s current-steering DAC implemented in 65nm CMOS is presented, with an IM3 «-60dBc beyond 1GHz while driving a 50¿ load with an output swing of 2.5Vpp-diff and dissipating a power of 188mW. The SFDR measured at 2.9GS/s is better than 60dB beyond 340MHz.

  17. The kinetics of oocyst shedding and sporulation in two immunologically distinct strains of Eimeria maxima, GS and M6.

    Science.gov (United States)

    Al-Badri, Riadh; Barta, John Robert

    2012-11-01

    The kinetics of oocyst shedding and sporulation of two immunologically distinct strains of Eimeria maxima (GS and M6) were compared. Both strains had a prepatent period of approximately 120 h followed by peak oocyst shedding at 144-150 h post inoculation. Mean total oocyst output determined for each strain demonstrated that the fecundity of the M6 strain (12.8 × 10(3) ± 1.95) of E. maxima was roughly twice that of the GS strain (6.9 × 10(3) ± 3.33) when inoculated at the rate of 1,000 infective oocysts per bird. The process of oocyst sporulation was followed by repetitive sampling of sporulating oocysts at 26 °C with aeration over a 138 hour period. Sporulation was divided into five morphologically distinguishable stages whose abundance peaked at the following times during sporulation: unsporulated oocysts at 0 h; sporoblast anlagen at 18 h; sporoblasts without sporocyst walls at 22 h; and sporocysts without mature sporozoites at 38 h. The time to 50 % sporulation of E. maxima oocysts observed in the present study was approximately 53 h for both strains and all viable oocysts had completed sporulation by 60 h. In the present study, the prepatent periods, duration of oocyst shedding, and the relative kinetics of sporulation of the GS and M6 strains of E. maxima were found to be virtually identical despite the immunological distinctiveness of these two parasite strains.

  18. Structural flexibility of the G alpha s alpha-helical domain in the beta2-adrenoceptor Gs complex

    DEFF Research Database (Denmark)

    Westfield, Gerwin H; Rasmussen, Søren Gøgsig Faarup; Su, Min

    2011-01-01

    The active-state complex between an agonist-bound receptor and a guanine nucleotide-free G protein represents the fundamental signaling assembly for the majority of hormone and neurotransmitter signaling. We applied single-particle electron microscopy (EM) analysis to examine the architecture...... of agonist-occupied β(2)-adrenoceptor (β(2)AR) in complex with the heterotrimeric G protein Gs (Gαsβγ). EM 2D averages and 3D reconstructions of the detergent-solubilized complex reveal an overall architecture that is in very good agreement with the crystal structure of the active-state ternary complex...

  19. Encryption and display of multiple-image information using computer-generated holography with modified GS iterative algorithm

    Science.gov (United States)

    Xiao, Dan; Li, Xiaowei; Liu, Su-Juan; Wang, Qiong-Hua

    2018-03-01

    In this paper, a new scheme of multiple-image encryption and display based on computer-generated holography (CGH) and maximum length cellular automata (MLCA) is presented. With the scheme, the computer-generated hologram, which has the information of the three primitive images, is generated by modified Gerchberg-Saxton (GS) iterative algorithm using three different fractional orders in fractional Fourier domain firstly. Then the hologram is encrypted using MLCA mask. The ciphertext can be decrypted combined with the fractional orders and the rules of MLCA. Numerical simulations and experimental display results have been carried out to verify the validity and feasibility of the proposed scheme.

  20. MBI-GS: APLICAÇÃO E VERIFICAÇÃO PSICOMÉTRICA NA REALIDADE BRASILEIRA

    Directory of Open Access Journals (Sweden)

    Marcelo da Silva Schuster

    2015-03-01

    Full Text Available O presente estudo tem por objetivo verificar a aplicação da escala MBI-GS (Maslach Burnout Inventory e suas três dimensões (exaustão, cinismo e eficácia no trabalho em um hospital público brasileiro com uma população de servidores da área médica e administrativa, caracterizando assim o uso da versão General Survey. A amostra considerada para efeito das análises realizadas foi de 173 profissionais, através da aplicação de questionário estruturado. Os dados foram submetidos a análises quantitativas (análise fatorial exploratória, confiabilidade, teste de correlação e regressão. Os resultados apontam para a aplicabilidade da escala, após procedimentos fatoriais, a escala ficou com 15 variáveis permanecendo com três fatores, apresentando uma confiabilidade de 0,87. A síndrome Burnout correlacionou-se a percepção de Saúde dos trabalhadores, confirmando relação causal na saúde dos trabalhadores. O estudo contribui para o estudo de Burnout no Brasil com a aplicação da MBI-GS de forma inédita em um Hospital Público.

  1. A combined coalescence gene-dropping tool for evaluating genomic selection in complex scenarios (ms2gs).

    Science.gov (United States)

    Pérez-Enciso, M; Legarra, A

    2016-04-01

    We present ms2gs, a combined coalescence - gene dropping (i.e. backward-forward) simulator for complex traits. It therefore aims at combining the advantages of both approaches. It is primarily conceived for very short term, recent scenarios such as those that are of interest in animal and plant breeding. It is very flexible in terms of defining QTL architecture and SNP ascertainment bias, and it allows for easy modelling of alternative markers such as RADs. It can use real sequence or chip data or generate molecular polymorphisms via the coalescence. It can generate QTL conditional on extant molecular information, such as low-density genotyping. It models (simplistically) sequence, imputation or genotyping errors. It requires as input both genotypic data in plink or ms formats, and a pedigree that is used to perform the gene dropping. By default, it compares accuracy for BLUP, SNP ascertained data, sequence, and causal SNPs. It employs VanRaden's linear (GBLUP) and nonlinear method for incorporating molecular information. To illustrate the program, we present a small application in a half-sib population and a multiparental (MAGIC) cross. The program, manual and examples are available at https://github.com/mperezenciso/ms2gs. © 2016 Blackwell Verlag GmbH.

  2. The Populus superoxide dismutase gene family and its responses to drought stress in transgenic poplar overexpressing a pine cytosolic glutamine synthetase (GS1a.

    Directory of Open Access Journals (Sweden)

    Juan Jesús Molina-Rueda

    Full Text Available BACKGROUND: Glutamine synthetase (GS plays a central role in plant nitrogen assimilation, a process intimately linked to soil water availability. We previously showed that hybrid poplar (Populus tremula X alba, INRA 717-1B4 expressing ectopically a pine cytosolic glutamine synthetase gene (GS1a display enhanced tolerance to drought. Preliminary transcriptome profiling revealed that during drought, members of the superoxide dismutase (SOD family were reciprocally regulated in GS poplar when compared with the wild-type control, in all tissues examined. SOD was the only gene family found to exhibit such patterns. RESULTS: In silico analysis of the Populus genome identified 12 SOD genes and two genes encoding copper chaperones for SOD (CCSs. The poplar SODs form three phylogenetic clusters in accordance with their distinct metal co-factor requirements and gene structure. Nearly all poplar SODs and CCSs are present in duplicate derived from whole genome duplication, in sharp contrast to their predominantly single-copy Arabidopsis orthologs. Drought stress triggered plant-wide down-regulation of the plastidic copper SODs (CSDs, with concomitant up-regulation of plastidic iron SODs (FSDs in GS poplar relative to the wild type; this was confirmed at the activity level. We also found evidence for coordinated down-regulation of other copper proteins, including plastidic CCSs and polyphenol oxidases, in GS poplar under drought conditions. CONCLUSIONS: Both gene duplication and expression divergence have contributed to the expansion and transcriptional diversity of the Populus SOD/CCS families. Coordinated down-regulation of major copper proteins in drought-tolerant GS poplars supports the copper cofactor economy model where copper supply is preferentially allocated for plastocyanins to sustain photosynthesis during drought. Our results also extend previous findings on the compensatory regulation between chloroplastic CSDs and FSDs, and suggest that this

  3. A Mutational Analysis of Residues in Cholera Toxin A1 Necessary for Interaction with Its Substrate, the Stimulatory G Protein Gsα

    Directory of Open Access Journals (Sweden)

    Michael G. Jobling

    2015-03-01

    Full Text Available Pathogenesis of cholera diarrhea requires cholera toxin (CT-mediated adenosine diphosphate (ADP-ribosylation of stimulatory G protein (Gsα in enterocytes. CT is an AB5 toxin with an inactive CTA1 domain linked via CTA2 to a pentameric receptor-binding B subunit. Allosterically activated CTA1 fragment in complex with NAD+ and GTP-bound ADP-ribosylation factor 6 (ARF6-GTP differs conformationally from the CTA1 domain in holotoxin. A surface-exposed knob and a short α-helix (formed, respectively, by rearranging “active-site” and “activation” loops in inactive CTA1 and an ADP ribosylating turn-turn (ARTT motif, all located near the CTA1 catalytic site, were evaluated for possible roles in recognizing Gsα. CT variants with one, two or three alanine substitutions at surface-exposed residues within these CTA1 motifs were tested for assembly into holotoxin and ADP-ribosylating activity against Gsα and diethylamino-(benzylidineamino-guanidine (DEABAG, a small substrate predicted to fit into the CTA1 active site. Variants with single alanine substitutions at H55, R67, L71, S78, or D109 had nearly wild-type activity with DEABAG but significantly decreased activity with Gsα, suggesting that the corresponding residues in native CTA1 participate in recognizing Gsα. As several variants with multiple substitutions at these positions retained partial activity against Gsα, other residues in CTA1 likely also participate in recognizing Gsα.

  4. Piezo channels and GsMTx4: Two milestones in our understanding of excitatory mechanosensitive channels and their role in pathology.

    Science.gov (United States)

    Suchyna, Thomas M

    2017-11-01

    Discovery of Piezo channels and the reporting of their sensitivity to the inhibitor GsMTx4 were important milestones in the study of non-selective cationic mechanosensitive channels (MSCs) in normal physiology and pathogenesis. GsMTx4 had been used for years to investigate the functional role of cationic MSCs, especially in muscle tissue, but with little understanding of its target or inhibitory mechanism. The sensitivity of Piezo channels to bilayer stress and its robust mechanosensitivity when expressed in heterologous systems were keys to determining GsMTx4's mechanism of action. However, questions remain regarding Piezo's role in muscle function due to the non-selective nature of GsMTx4 inhibition toward membrane mechanoenzymes and the implication of MCS channel types by genetic knockdown. Evidence supporting Piezo like activity, at least in the developmental stages of muscle, is presented. While the MSC targets of GsMTx4 in muscle pathology are unclear, its muscle protective effects are clearly demonstrated in two recent in situ studies on normal cardiomyocytes and dystrophic skeletal muscle. The muscle protective function may be due to the combined effect of GsMTx4's inhibitory action on cationic MSCs like Piezo and TRP, and its potentiation of repolarizing K + selective MSCs like K2P and SAKCa. Paradoxically, the potent in vitro action of GsMTx4 on many physiological functions seems to conflict with its lack of in situ side-effects on normal animal physiology. Future investigations into cytoskeletal control of sarcolemma mechanics and the suspected inclusion of MSCs in membrane micro/nano sized domains with distinct mechanical properties will aide our understanding of this dichotomy. Published by Elsevier Ltd.

  5. RELACION DE LA EXPRESION DEL RECEPTOR DE INSULINA CON LA EXPRESION DE LAS ENZIMAS GLICOGENICAS (GS1 Y GS2) Y GLUCONEOGENICAS EN LAS CELULAS DE TUBULO PROXIMAL DE RATAS NORMALES Y DIABETICAS

    OpenAIRE

    GATICA GUTIERREZ, RODRIGO ORLANDO; GATICA GUTIERREZ, RODRIGO ORLANDO

    2012-01-01

    En el presente estudio se determinó los efectos sobre la expresión y localización del receptor de insulina (InsR), de glicógeno sin tasa (GS) y de las enzimas glicolíticas y gluconeogénicas en diabetes de largo plazo. Insulina es esencial para el manejo energético del cuerpo, sin embargo, su rol a nivel renal es poco conocido. Su unión al receptor de insulina provoca una cascada de señalización intracelular, que regula múltiples procesos biológicos, tales corno el metabolismo lipídico y pr...

  6. THE FAST DECLINING TYPE Ia SUPERNOVA 2003gs, AND EVIDENCE FOR A SIGNIFICANT DISPERSION IN NEAR-INFRARED ABSOLUTE MAGNITUDES OF FAST DECLINERS AT MAXIMUM LIGHT

    International Nuclear Information System (INIS)

    Krisciunas, Kevin; Marion, G. H.; Suntzeff, Nicholas B.

    2009-01-01

    We obtained optical photometry of SN 2003gs on 49 nights, from 2 to 494 days after T(B max ). We also obtained near-IR photometry on 21 nights. SN 2003gs was the first fast declining Type Ia SN that has been well observed since SN 1999by. While it was subluminous in optical bands compared to more slowly declining Type Ia SNe, it was not subluminous at maximum light in the near-IR bands. There appears to be a bimodal distribution in the near-IR absolute magnitudes of Type Ia SNe at maximum light. Those that peak in the near-IR after T(B max ) are subluminous in the all bands. Those that peak in the near-IR prior to T(B max ), such as SN 2003gs, have effectively the same near-IR absolute magnitudes at maximum light regardless of the decline rate Δm 15 (B). Near-IR spectral evidence suggests that opacities in the outer layers of SN 2003gs are reduced much earlier than for normal Type Ia SNe. That may allow γ rays that power the luminosity to escape more rapidly and accelerate the decline rate. This conclusion is consistent with the photometric behavior of SN 2003gs in the IR, which indicates a faster than normal decline from approximately normal peak brightness.

  7. Enhancement of humoral immunity in mice by coupling pUCpGs10 and aluminium to the HCV recombinant immunogen

    Directory of Open Access Journals (Sweden)

    Zhan Na

    2011-11-01

    Full Text Available Abstract Aim To investigate the enhancement of humoral immunity when CpG ODN (cytidine phosphate guanosine oligodeoxynucleotides and aluminium adjuvants are complexed with the HCV (Hepatitis C virus recombinant immunogen in mice. Methods After immunizing Balb/c mice with the recombination HCV antigen adjuvanted with pUCpGs10 and/or aluminium(antigen+CpG+alum, antigen+CpG, antigen+alum, antigen+PBS, enzyme-linked immunosorbent assay (ELISA was used to measure the specific serum antibody titers of IgG, to determine the neutralization response to various peptide genotypes, and to determine the concentration of IL-6 and IL-10 in supernatants of in vitro cultured splenic lymphocytes. Enzyme-linked immunospot assay (ELISPOT was used to quantify the non-specific and specific splenic antibody-secreting cells (ASCs, and flow cytometry (FCM determined the ratio of different splenic lymphocytes. The serum of rabbits immunized with the recombinant pBVGST/HVR1 antigen immunoprecipitated the HCV isolated from 12 patients' serum. Results The sera antibody titers were 1:51200, 1:9051, 1:18102, 1:6400 respectively after the final immunization and demonstrated good neutralization responses to the six gene peptide containing 1a, 1b, 2a, 3a, 4a and 6a. The aluminum adjuvant increased the population of both specific ASCs (P +CD27+ (P +CD38+ splenic lymphocytes with the aluminum and pUCpGs10 adjuvant present compared to the control group(P Conclusions 1. The aluminum adjuvant induces a potent Th2-biased immune response by increasing both the populations of specific and total ASCs and the ratio of CD19+CD27+ cells. 2. The pUCpGs10 complexed with the aluminum adjuvant boosts the population of plasma cells and increase the efficiency of the immune response. 3. The two adjuvants have synergistic effects on humoral immunity. 4. The recombinant HVR1 protein has the possibility of generating broadly reactive anti-HVR1 antibody.

  8. The SERTS-97 Rocket Experiment on Study Activity on the Sun: Flight 36.167-GS on 1997 November 18

    Science.gov (United States)

    Swartz, Marvin; Condor, Charles E.; Davila, Joseph M.; Haas, J. Patrick; Jordan, Stuart D.; Linard, David L.; Miko, Joseph J.; Nash, I. Carol; Novello, Joseph; Payne, Leslie J.; hide

    1999-01-01

    This paper describes mainly the 1997 version of the Solar EUV Rocket Telescope and Spectrograph (SERTS-97), a scientific experiment that operated on NASA's suborbital rocket flight 36.167-GS. Its function was to study activity on the Sun and to provide a cross calibration for the CDS instrument on the SOHO satellite. The experiment was designed, built, and tested by the Solar Physics Branch of the Laboratory for Astronomy and Solar Physics at the Goddard Space Flight Center (GSFC). Other essential sections of the rocket were built under the management of the Sounding Rockets Program Office. These sections include the electronics, timers, IGN despin, the SPARCS pointing controls, the S-19 flight course correction section, the rocket motors, the telemetry, ORSA, and OGIVE.

  9. Carbon steel protection in G.S. (Girlder sulfide) plants. Pressure influence on iron sulfide scales formation. Pt. 5

    International Nuclear Information System (INIS)

    Delfino, C.A.; Lires, O.A.; Rojo, E.A.

    1987-01-01

    In order to protect carbon steel towers and piping of Girlder sulfide (G.S.) experimental heavy water plants against corrosion produced by the action of aqueous solutions of hydrogen sulfide, a method, previously published, was developed. Carbon steel, exposed to saturated aqueous solutions of hydrogen sulfide, forms iron sulfide scales. In oxygen free solutions evolution of corrosion follows the sequence: mackinawite → cubic ferrous sulfide → troilite → pyrrotite → pyrite. Scales formed by pyrrotite-pyrite or pyrite are the most protective layers (these are obtained at 130 deg C, 2MPa, for periods of 14 days). Experiments, at 125 deg C and periods of 10-25 days, were performed in two different ways: 1- constant pressure operations at 0.5 and 1.1 MPa. 2- variable pressure operation between 0.3-1 MPa. In all cases pyrrotite-pyrite scales were obtained. (Author) [es

  10. NuSTAR observations of the black holes GS 1354-645: Evidence of rapid black hole spin

    DEFF Research Database (Denmark)

    El-Batal, A. M.; Miller, J. M.; Reynolds, M. T.

    2016-01-01

    We present the results of a NuSTAR study of the dynamically confirmed stellar-mass black hole GS 1354-645. The source was observed during its 2015 "hard" state outburst; we concentrate on spectra from two relatively bright phases. In the higher-flux observation, the broadband NuSTAR spectra reveal...... a clear, strong disk reflection spectrum, blurred by a degree that requires a black hole spin of a = cf/GM(2) >= 0.98 (1 sigma statistical limits only). The fits also require a high inclination: 0 similar or equal to 75 (2)degrees. Strong "dips" are sometimes observed in the X-ray light curves of sources...... in stellar-mass black holes, and inner accretion flow geometries at moderate accretion rates....

  11. Error de medición alrededor de los puntos de corte en el MBI-GS

    Directory of Open Access Journals (Sweden)

    Manuel Fernández Arata

    2014-12-01

    Full Text Available Resumen En la calificación de los resultados del MBI-GS (Maslach Burnout Inventory - General Survey como de sus antecesores, se usan interpretaciones dimensionales, pero también puntos de corte para clasificar a los sujetos y diferenciarlos con respecto a la presencia del síndrome de burnout. Sin embargo, este uso está orientado al tipo de tests referidos a criterios, por lo que la estimación de la confiabilidad debe converger con este tipo de uso. El objetivo del presente estudio fue estimar la confiabilidad alrededor de varios puntos de corte en el MBI-GS (agotamiento emocional, eficacia profesional y cinismo, mediante el coeficiente K2 de Livingston. Los participantes fueron 741 sujetos de varias ocupaciones, provenientes de instituciones públicas y privadas de Lima y de otras ciudades. Previo a la obtención de la confiabilidad criterial, se verificó la unidimensionalidad, el modelo equivalente tau, la distribución y la bimodalidad de los puntajes. Se halló que los puntos de corte más extremos muestran mayor confiabilidad; que la confiabilidad se incrementa en relación al grado de extremidad de los puntajes; que el puntaje de agotamiento emocional obtiene mayor confiabilidad criterial y que cinismo obtiene la menor, pero todos los puntajes generalmente muestran buenas confiabilidades. Se discute el uso de los puntos de corte en relación a su validez y confiabilidad. Abstract In the rating of the MBI-GS results (Maslach Burnout Inventory - General Survey as its predecessors, we used dimensional interpretations, but also cut-off points for classifying and differentiating the subjects with respect to the presence of the burnout syndrome. However, this use is oriented to the type of tests relating to criteria so that the estimate of the reliability must converge with this type of use. The objective of this study was to estimate the reliability around various cutting points in the MBI-GS (emotional exhaustion, professional

  12. Radiographic findings and Gs-alpha bioactivity studies and mutation screening in acrodysostosis indicate a different etiology from pseudohypoparathyroidism

    International Nuclear Information System (INIS)

    Graham, J.M. Jr.; Krakow, D.; Smith, A.K.; Lachman, R.S.

    2001-01-01

    Acrodysostosis is an uncommon skeletal dysplasia associated with nasal hypoplasia, midface deficiency, severe brachydactyly, and varying degrees of hearing loss and mental retardation. Previous publications have suggested that it may be difficult to distinguish acrodystostosis from pseudohypoparathyroidism on clinical grounds, but acrodysostosis does appear to have distinct clinical and radiologic findings. Spinal stenosis is an underappreciated risk in acrodysostosis, despite the reported loss of normal caudal widening of the lumbar interpediculate distance on AP spine radiographs in the original report of this disorder by Robinow et al., with confirmation of these radiographic findings by Butler et al. We report two sporadic cases of acrodysostosis, one of which required decompressive laminectomy for symptomatic spinal stenosis, and review 11 cases of acrodysostosis from 9 families that were submitted to the International Skeletal Dysplasia Registry. The objective of this report is to determine the frequency and severity of spinal stenosis in patients with acrodysostosis and to summarize the clinical and radiographic findings of acrodysostosis in an effort to distinguish acrodysostosis clearly from pseudohypoparathyroidism. The pattern of brachydactyly differs between these two conditions, and varying degrees of spinal stenosis are characteristic of acrodysostosis. Both our index patients with acrodysostosis had normal bioactivity of the alpha subunit of the Gs protein, therefore indicating that acrodysostosis has a different pathogenesis from pseudohypoparathyroidism. Furthermore, single-strand confirmational polymorphism (SSCP) analysis failed to demonstrate any confirmational alterations in the coding exons of the Gs alpha gene. These radiographic and laboratory findings substantiate that acrodysostosis is clinically different from pseudohypoparathyroidism and that it is necessary to follow patients with acrodysostosis for signs of spinal stenosis. (orig.)

  13. A cAMP Biosensor-Based High-Throughput Screening Assay for Identification of Gs-Coupled GPCR Ligands and Phosphodiesterase Inhibitors

    DEFF Research Database (Denmark)

    Vedel, Line; Bräuner-Osborne, Hans; Mathiesen, Jesper Mosolff

    2015-01-01

    Cyclic adenosine 3',5'-monophosphate (cAMP) is an important second messenger, and quantification of intracellular cAMP levels is essential in studies of G protein-coupled receptors (GPCRs). The intracellular cAMP levels are regulated by the adenylate cyclase (AC) upon activation of either Gs- or ...... also observed for the other representative Gs-coupled GPCRs tested, GLP-1R and GlucagonR. The FRET-based cAMP biosensor assay is robust, reproducible, and inexpensive with good Z factors and is highly applicable for HTS....

  14. Lysine conjugation properties in human IgGs studied by integrating high-resolution native mass spectrometry and bottom-up proteomics

    NARCIS (Netherlands)

    Gautier, Violette|info:eu-repo/dai/nl/372660851; Boumeester, Anja J.; Lössl, Philip|info:eu-repo/dai/nl/371559693; Heck, Albert J R|info:eu-repo/dai/nl/105189332

    2015-01-01

    Antibody-drug conjugates (ADCs) are a novel class of biopharmaceuticals several of which are now being investigated in clinical studies. In ADCs, potent cytotoxic drugs are coupled via a linker to reactive residues in IgG monoclonal antibodies. Linkage to lysine residues in the IgGs, using

  15. NON DESTRUCTIVE APPLICATION OF RADIOACTIVE TRACER TECHNIQUE FOR CHARACTERIZATION OF INDUSTRIAL GRADE ANION EXCHANGE RESINS INDION GS-300 AND INDION-860

    Directory of Open Access Journals (Sweden)

    P.U. SINGARE

    2014-02-01

    Full Text Available The paper deals with the application of radio isotopic non-destructive technique in the characterization of two industrial grade anion exchange resins Indion GS-300 and Indion-860. For the characterization of the two resins, 131I and 82Br were used as tracer isotopes to trace the kinetics of iodide and bromide ion-isotopic exchange reactions. It was observed that the values of specific reaction rate (min−1, amount of iodide ion exchanged (mmol, initial rate of iodide ion exchange (mmol/min and log Kd were calculated as 0.328, 0.577, 0.189 and 19.7 respectively for Indion GS-300 resin, which was higher than the respective values of 0.180, 0.386, 0.070 and 17.0 calculated for Indion-860 resins when measured under identical experimental conditions. Also at a constant temperature of 40.0 °C, as the concentration of labeled iodide ion solution increases 0.001 M to 0.004 M, the percentage of iodide ions exchanged increases from 75.16 % to 78.36 % for Indion GS-300 resins, which was higher than the increases from 49.65 % to 52.36 % compared to that obtained for Indion-860 resins. The overall results indicate that under identical experimental conditions, Indion GS-300 resins show superior performance over Indion-860 resins.

  16. A method for determining the branching ratio for the superallowed decay: 10C(0+, gs)→10B(0+, 1.74 MeV)+e++ν

    International Nuclear Information System (INIS)

    Kroupa, M.A.; Freedman, S.J.; Barker, P.H.; Ferguson, S.M.

    1991-01-01

    We describe a new way of determining the strength of the superallowed branch of the β-decay of 10 C, 10 C(0 + , gs) → 10 B(0 + , 1.74 MeV) + e + + ν. Precise knowledge of the branching ratio is needed to compute the experimental ft-value and the weak vector coupling constant. (orig.)

  17. Improved stress tolerance and productivity in transgenic rice plants constitutively expressing the Oryza sativa glutathione synthetase OsGS under paddy field conditions.

    Science.gov (United States)

    Park, Seong-Im; Kim, Young-Saeng; Kim, Jin-Ju; Mok, Ji-Eun; Kim, Yul-Ho; Park, Hyang-Mi; Kim, Il-Sup; Yoon, Ho-Sung

    2017-08-01

    Reactive oxygen species, which increase under various environmental stresses, have deleterious effects on plants. An important antioxidant, glutathione, is used to detoxify reactive oxygen species in plant cells and is mainly produced by two enzymes: gamma-glutamylcysteine synthetase (γ-ECS) and glutathione synthetase (GS). To evaluate the functional roles of the glutathione synthetase gene (OsGS) in rice, we generated four independent transgenic rice plants (TG1-TG4) that overexpressed OsGS under the control of the constitutively expressed OsCc1 promoter. When grown under natural paddy field conditions, the TG rice plants exhibited greater growth development, higher chlorophyll content, and higher GSH/GSSH ratios than control wild-type (WT) rice plants. Subsequently, the TG rice plants enhanced redox homeostasis by preventing hydroperoxide-mediated membrane damage, which improved their adaptation to environmental stresses. As a result, TG rice plants improved rice grain yield and total biomass following increases in panicle number and number of spikelets per panicle, despite differences in climate during the cultivation periods of 2014 and 2015. Overall, our results indicate that OsGS overexpression improved redox homeostasis by enhancing the glutathione pool, which resulted in greater tolerance to environmental stresses in the paddy fields. Copyright © 2017. Published by Elsevier GmbH.

  18. Genetic divergence for high-molecular weight glutenin subunits (HMW-GS) in indigenous landraces and commercial cultivars of bread wheat of Pakistan.

    Science.gov (United States)

    Yasmeen, F; Khurshid, H; Ghafoor, A

    2015-05-11

    Wheat flour quality is an important consideration in the breeding and development of new cultivars. A strong association between high-molecular weight glutenin subunits (HMW-GS) and bread making quality has resulted in the widespread utilization of HMW-GS in wheat breeding. In this study, we analyzed 242 lines of wheat, including landraces from the provinces of Punjab and Baluchistan, as well as the commercial varieties of Pakistan, to determine allelic variation in the Glu-A1, Glu-B1, and Glu-D1 loci encoding HMW-GS. Higher genetic diversity was observed for HMW-GS in landraces from Baluchistan, followed by landraces collected from Punjab and then commercial varieties. Rare and uncommon subunits were observed in Glu-B1, whereas Glu-A1 was less polymorphic. However, Glu-B1 was the highest contributor to overall diversity (78%), with a total of 31 rare alleles, followed by Glu-D1 (20%) with the high quality 5+10 allele and other variants. Commercial cultivars possessed favorable alleles, potentially from indirect selection for wheat flour quality by the breeders; however, this indirect selection has decreased the pedigree base of commercial cultivars. The allelic combinations, including 2*, 5+10, and 17+18, showing high quality scores were frequent among landraces, indicating their usefulness in future crop improvement and breeding programs.

  19. The positive impact of simultaneous implementation of the BD FocalPoint GS Imaging System and lean principles on the operation of gynecologic cytology.

    Science.gov (United States)

    Wong, Rebecca; Levi, Angelique W; Harigopal, Malini; Schofield, Kevin; Chhieng, David C

    2012-02-01

    Our cytology laboratory, like many others, is under pressure to improve quality and provide test results faster while decreasing costs. We sought to address these issues by introducing new technology and lean principles. To determine the combined impact of the FocalPoint Guided Screener (GS) Imaging System (BD Diagnostics-TriPath, Burlington, North Carolina) and lean manufacturing principles on the turnaround time (TAT) and productivity of the gynecologic cytology operation. We established a baseline measure of the TAT for Papanicolaou tests. We then compared that to the performance after implementing the FocalPoint GS Imaging System and lean principles. The latter included value-stream mapping, workflow modification, and a first in-first out policy. The mean (SD) TAT for Papanicolaou tests before and after the implementation of FocalPoint GS Imaging System and lean principles was 4.38 (1.28) days and 3.20 (1.32) days, respectively. This represented a 27% improvement in the average TAT, which was statistically significant (P implementation of FocalPoint GS Imaging System in conjunction with lean principles resulted in a significant decrease in the average TAT for Papanicolaou tests and a substantial increase in the productivity of cytotechnologists while maintaining the diagnostic quality of gynecologic cytology.

  20. Rhipicephalus microplus dataset of nonredundant raw sequence reads from 454 GS FLX sequencing of Cot-selected (Cot = 660) genomic DNA

    Science.gov (United States)

    A reassociation kinetics-based approach was used to reduce the complexity of genomic DNA from the Deutsch laboratory strain of the cattle tick, Rhipicephalus microplus, to facilitate genome sequencing. Selected genomic DNA (Cot value = 660) was sequenced using 454 GS FLX technology, resulting in 356...

  1. Non Destructive Application of Radioactive Tracer Technique for Characterization of Industrial Grade Anion Exchange Resins Indio GS-300 and Indion-860

    International Nuclear Information System (INIS)

    Singare, P. U.

    2014-01-01

    The paper deals with the application of radio isotopic non-destructive technique in the characterization of two industrial grade anion exchange resins Indion GS-300 and Indion-860. For the characterization of the two resins, 131 I and 82 Br were used as tracer isotopes to trace the kinetics of iodide and bromide ion-isotopic exchange reactions. It was observed that the values of specific reaction rate (min -1 ), amount of iodide ion exchanged (mmol), initial rate of iodide ion exchange (mmol/min) and log K d were calculated as 0.328, 0.577, 0.189 and 19.7 respectively for Indion GS-300 resin, which was higher than the respective values of 0.180, 0.386, 0.070 and 17.0 calculated for Indion-860 resins when measured under identical experimental conditions. Also at a constant temperature of 40.0 .deg. C, as the concentration of labeled iodide ion solution increases 0.001 M to 0.004 M, the percentage of iodide ions exchanged increases from 75.16 % to 78.36 % for Indion GS-300 resins, which was higher than the increases from 49.65 % to 52.36 % compared to that obtained for Indion-860 resins. The overall results indicate that under identical experimental conditions, Indion GS-300 resins show superior performance over Indion-860 resins

  2. The mechano-gated channel inhibitor GsMTx4 reduces the exercise pressor reflex in rats with ligated femoral arteries.

    Science.gov (United States)

    Copp, Steven W; Kim, Joyce S; Ruiz-Velasco, Victor; Kaufman, Marc P

    2016-05-01

    Mechanical and metabolic stimuli arising from contracting muscles evoke the exercise pressor reflex. This reflex is greater in a rat model of simulated peripheral arterial disease in which a femoral artery is chronically ligated than it is in rats with freely perfused femoral arteries. The role played by the mechanically sensitive component of the exaggerated exercise pressor reflex in ligated rats is unknown. We tested the hypothesis that the mechano-gated channel inhibitor GsMTx4, a relatively selective inhibitor of mechano-gated Piezo channels, reduces the exercise pressor reflex in decerebrate rats with ligated femoral arteries. Injection of 10 μg of GsMTx4 into the arterial supply of the hindlimb reduced the pressor response to Achilles tendon stretch (a purely mechanical stimulus) but had no effect on the pressor responses to intra-arterial injection of α,β-methylene ATP or lactic acid (purely metabolic stimuli). Moreover, injection of 10 μg of GsMTx4 into the arterial supply of the hindlimb reduced both the integrated pressor area (control 535 ± 21, GsMTx4 218 ± 24 mmHg·s; P reflex contributes to the exaggerated exercise pressor reflex during intermittent hindlimb muscle contractions in rats with ligated femoral arteries. Copyright © 2016 the American Physiological Society.

  3. Intraesophageal administratio (JP4-039) and p53/MDM2/MDM4 Inhibitor (BEB55) ameliorates radiation esophagitisn of GS-Nitroxide

    NARCIS (Netherlands)

    Kim, H.; Bernard, M.; Epperly, M.W.; Shen, H.; Dixon, T.M.; Amoscato, A.A.; Doemling, A.S.; Li, S.; Gao, X.; Wipf, P.

    2011-01-01

    Purpose/Objective(s): To evaluate the esophageal radiation dose modification properties of the GS-nitroxide (JP4-039) and the p53/MDM2/MDM4 inhibitor (BEB55). Materials/Methods: Esophagitis is a significant toxicity of radiation therapy of thoracic cancers. We evaluated radiation dose modification

  4. NuSTAR Observations of the Black Hole GS 1354-645: Evidence of Rapid Black Hole Spin

    Science.gov (United States)

    El-Batal, A. M.; Miller, J. M.; Reynolds, M. T.; Boggs, S. E.; Christensen, F. E.; Craig, W. W.; Fuerst, F.; Hailey, C. J.; Harrison, F. A.; Stern, D. K.; hide

    2016-01-01

    We present the results of a NuSTAR study of the dynamically confirmed stellar-mass black hole GS 1354-645. The source was observed during its 2015 "hard" state outburst; we concentrate on spectra from two relatively bright phases. In the higher-flux observation, the broadband NuSTAR spectra reveal a clear, strong disk reflection spectrum, blurred by a degree that requires a black hole spin of a = cJ/ GM(sup 2) > or = 0.98 (1(sigma) statistical limits only). The fits also require a high inclination: theta approx. = 75(2)deg. Strong "dips" are sometimes observed in the X-ray light curves of sources viewed at such an angle; these are absent, perhaps indicating that dips correspond to flared disk structures that only manifest at higher accretion rates. In the lower flux observation, there is evidence of radial truncation of the thin accretion disk. We discuss these results in the context of spin in stellar-mass black holes, and inner accretion flow geometries at moderate accretion rates.

  5. Supplementation of Nucleosides During Selection can Reduce Sequence Variant Levels in CHO Cells Using GS/MSX Selection System.

    Science.gov (United States)

    Tang, Danming; Lam, Cynthia; Louie, Salina; Hoi, Kam Hon; Shaw, David; Yim, Mandy; Snedecor, Brad; Misaghi, Shahram

    2018-01-01

    In the process of generating stable monoclonal antibody (mAb) producing cell lines, reagents such as methotrexate (MTX) or methionine sulfoximine (MSX) are often used. However, using such selection reagent(s) increases the possibility of having higher occurrence of sequence variants in the expressed antibody molecules due to the effects of MTX or MSX on de novo nucleotide synthesis. Since MSX inhibits glutamine synthase (GS) and results in both amino acid and nucleoside starvation, it is questioned whether supplementing nucleosides into the media could lower sequence variant levels without affecting titer. The results show that the supplementation of nucleosides to the media during MSX selection decreased genomic DNA mutagenesis rates in the selected cells, probably by reducing nucleotide mis-incorporation into the DNA. Furthermore, addition of nucleosides enhance clone recovery post selection and does not affect antibody expression. It is further observed that nucleoside supplements lowered DNA mutagenesis rates only at the initial stage of the clone selection and do not have any effect on DNA mutagenesis rates after stable cell lines are established. Therefore, the data suggests that addition of nucleosides during early stages of MSX selection can lower sequence variant levels without affecting titer or clone stability in antibody expression. © 2017 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  6. Exploring salivary microbiota in AIDS patients with different periodontal statuses using 454 GS-FLX Titanium pyrosequencing

    Directory of Open Access Journals (Sweden)

    Fang eZhang

    2015-07-01

    Full Text Available Patients with acquired immunodeficiency syndrome (AIDS are at high risk of opportunistic infections. Oral manifestations have been associated with the level of immunosuppression, these include periodontal diseases, and understanding the microbial populations in the oral cavity is crucial for clinical management. The aim of this study was to examine the salivary bacterial diversity in patients newly admitted to the AIDS ward of the Public Health Clinical Center (China. Saliva samples were collected from fifteen patients with AIDS who were randomly recruited between December 2013 and March 2014. Extracted DNA was used as template to amplify bacterial 16S rRNA. Sequencing of the amplicon library was performed using a 454 GS-FLX Titanium sequencing platform. Reads were optimized and clustered into operational taxonomic units for further analysis. A total of 10 bacterial phyla (106 genera were detected. Firmicutes, Bacteroidetes and Proteobacteria were preponderant in the salivary microbiota in AIDS patients. The pathogen, Capnocytophaga sp., and others not considered pathogenic such as Neisseria elongata, Streptococcus mitis and Mycoplasma salivarium but which may be opportunistic infective agents were detected. Dialister pneumosintes, Eubacterium infirmum, Rothia mucilaginosa and Treponema parvum were preponderant in AIDS patients with periodontitis. Patients with necrotic periodontitis had a distinct salivary bacterial profile from those with chronic periodontitis. This is the first study using advanced sequencing techniques focused on hospitalized AIDS patients showing the diversity of their salivary microbiota.

  7. NuSTAR DETECTION OF HARD X-RAY PHASE LAGS FROM THE ACCRETING PULSAR GS 0834–430

    Energy Technology Data Exchange (ETDEWEB)

    Miyasaka, Hiromasa; Harrison, Fiona A.; Fürst, Felix; Bellm, Eric C.; Grefenstette, Brian W.; Madsen, Kristin K.; Walton, Dominic J. [Cahill Center for Astronomy and Astrophysics, California Institute of Technology, Pasadena, CA 91125 (United States); Bachetti, Matteo; Barret, Didier [Université de Toulouse, UPS-OMP, IRAP, F-31400 Toulouse (France); Boggs, Steven E.; Craig, William W.; Tomsick, John A. [Space Sciences Laboratory, University of California, Berkeley, CA 94720 (United States); Chakrabarty, Deepto [Kavli Institute for Astrophysics and Space Research, Massachusetts Institute of Technology, Cambridge, MA 02139 (United States); Chenevez, Jerome; Christensen, Finn E. [DTU Space, National Space Institute, Technical University of Denmark, Elektrovej 327, DK-2800 Lyngby (Denmark); Hailey, Charles J. [Columbia Astrophysics Laboratory, Columbia University, New York, NY 10027 (United States); Natalucci, Lorenzo [Istituto di Astrofisica e Planetologia Spaziali, INAF, Via Fosso del Cavaliere 100, Roma I-00133 (Italy); Pottschmidt, Katja [CRESST, UMBC, and NASA GSFC, Code 661, Greenbelt, MD 20771 (United States); Stern, Daniel [Jet Propulsion Laboratory, California Institute of Technology, Pasadena, CA 91109 (United States); Wilms, Jörn, E-mail: miyasaka@srl.caltech.edu [Dr. Karl-Remeis-Sternwarte and ECAP, Sternwartstr. 7, D-96049 Bamberg (Germany); and others

    2013-09-20

    The Nuclear Spectroscopic Telescope Array hard X-ray telescope observed the transient Be/X-ray binary GS 0834–430 during its 2012 outburst—the first active state of this system observed in the past 19 yr. We performed timing and spectral analysis and measured the X-ray spectrum between 3-79 keV with high statistical significance. We find the phase-averaged spectrum to be consistent with that observed in many other magnetized, accreting pulsars. We fail to detect cyclotron resonance scattering features that would allow us to constrain the pulsar's magnetic field in either phase-averaged or phase-resolved spectra. Timing analysis shows a clearly detected pulse period of ∼12.29 s in all energy bands. The pulse profiles show a strong, energy-dependent hard phase lag of up to 0.3 cycles in phase, or about 4 s. Such dramatic energy-dependent lags in the pulse profile have never before been reported in high-mass X-ray binary pulsars. Previously reported lags have been significantly smaller in phase and restricted to low energies (E < 10 keV). We investigate the possible mechanisms that might produce this energy-dependent pulse phase shift. We find the most likely explanation for this effect is a complex beam geometry.

  8. NuSTAR detection of 4s Hard X-ray Lags from the Accreting Pulsar GS 0834-430

    Directory of Open Access Journals (Sweden)

    Bachetti Matteo

    2014-01-01

    Full Text Available The NuSTAR hard X-ray telescope observed the transient Be/X-ray binary GS 0834–430 during its 2012 outburst. The source is detected between 3 – 79 keV with high statistical significance, and we were able to perform very accurate spectral and timing analysis. The phase-averaged spectrum is consistent with that observed in many other magnetized accreting pulsars. We fail to detect cyclotron resonance scattering features in either phase-averaged nor phase-resolved spectra that would allow us to constrain the pulsar’s magnetic field. We detect a pulse period of ~ 12:29 s in all energy bands. The pulse profile can be modeled with a double Gaussian and shows a strong and smooth hard lag of up to 0.3 cycles in phase, or about 4s between the pulse at ~ 3 and ≳ 30 keV. This is the first report of such a strong lag in high-mass X-ray binary (HMXB pulsars. Previously reported lags have been significantly smaller in phase and restricted to low-energies (E<10 keV. We investigate the possible mechanisms that might produce such lags. We find the most likely explanation for this effect to be a complex beam geometry.

  9. Sociālie mediji kā ilgtspējīgs mārketinga instruments.

    OpenAIRE

    Kudlāne, Maija

    2012-01-01

    Ietekme, kādu sociālie mediji atstāj uz patērētāja ikdienas dzīvi ir neiedomājami liela. Tāpēc sociālo mediju mārketings ir attīstījies kā atsevišķa nozare. Pastāv dažādi viedokļi par to vai sociālo mediju mārketings ir ilgtspējīgs vai tā ir tikai mirkļa tendence. Darba mērķis ir izpētīt sociālo mediju mārketinga īpatnības un pielietojumu atkarībā no mārketinga mērķa, mērķa auditorijas iezīmēm, ekonomiskiem un kultūras faktoriem, kā arī izprast tā nākotnes potenciālu. Darba izpētes pro...

  10. Design, fabrication, commissioning, and testing of a 250 g/s, 2-K helium cold compressor system

    International Nuclear Information System (INIS)

    V. Ganni; D. M. Arenius; B. S. Bevins; W. C. Chronis; J. D. Creel; J. D. Wilson Jr.

    2002-01-01

    In June 1999 the Thomas Jefferson National Accelerator Facility (TJNAF) Cryogenic Systems Group had completed the design, fabrication, and commissioning of a cold compressor system capable of pumping 250 g/s of 2-K helium vapor to a pressure above 1 bar. The 2-K cold box consists of five stages of centrifugal variable speed compressors with LN2 cooled drive motors and magnetic bearings, a plate fin heat exchanger, and an LN2 shield system. The new 2-K cold box (referred to as the SCN) was built as a redundant system to an existing four stage cold compressor SCM cold box that was commissioned in May 1994. The SCN has been in continuous service supporting the facility experiments since commissioning. This system has achieved a significant improvement in the total 2-K refrigeration system capacity and stability and has substantially increased the operating envelope both in cold compressor flow and operating pressure range. This paper describes the cold box configuration and the experience s in the design, fabrication, commissioning and performance evaluation. The capacity of the system for various operating pressures (0.040 to 0.025 bar at the load corresponding to a total compressor pressure ratio of 28 to 54) is presented. An effort is made to characterize the components and their operating data over the tested range. This includes the return side pressure drop in the distribution system, the heat exchanger, and the cold compressor characteristics. The system design parameters and their effects on performance are outlined

  11. CANGS: a user-friendly utility for processing and analyzing 454 GS-FLX data in biodiversity studies

    Directory of Open Access Journals (Sweden)

    Schlötterer Christian

    2010-01-01

    Full Text Available Abstract Background Next generation sequencing (NGS technologies have substantially increased the sequence output while the costs were dramatically reduced. In addition to the use in whole genome sequencing, the 454 GS-FLX platform is becoming a widely used tool for biodiversity surveys based on amplicon sequencing. In order to use NGS for biodiversity surveys, software tools are required, which perform quality control, trimming of the sequence reads, removal of PCR primers, and generation of input files for downstream analyses. A user-friendly software utility that carries out these steps is still lacking. Findings We developed CANGS (Cleaning and Analyzing Next Generation Sequences a flexible and user-friendly integrated software utility: CANGS is designed for amplicon based biodiversity surveys using the 454 sequencing platform. CANGS filters low quality sequences, removes PCR primers, filters singletons, identifies barcodes, and generates input files for downstream analyses. The downstream analyses rely either on third party software (e.g.: rarefaction analyses or CANGS-specific scripts. The latter include modules linking 454 sequences with the name of the closest taxonomic reference retrieved from the NCBI database and the sequence divergence between them. Our software can be easily adapted to handle sequencing projects with different amplicon sizes, primer sequences, and quality thresholds, which makes this software especially useful for non-bioinformaticians. Conclusion CANGS performs PCR primer clipping, filtering of low quality sequences, links sequences to NCBI taxonomy and provides input files for common rarefaction analysis software programs. CANGS is written in Perl and runs on Mac OS X/Linux and is available at http://i122server.vu-wien.ac.at/pop/software.html

  12. Transcriptional regulation of host NH₄⁺ transporters and GS/GOGAT pathway in arbuscular mycorrhizal rice roots.

    Science.gov (United States)

    Pérez-Tienda, Jacob; Corrêa, Ana; Azcón-Aguilar, Concepción; Ferrol, Nuria

    2014-02-01

    Arbuscular mycorrhizal (AM) fungi play a key role in the nutrition of many land plants. AM roots have two pathways for nutrient uptake, directly through the root epidermis and root hairs and via AM fungal hyphae into root cortical cells, where arbuscules or hyphal coils provide symbiotic interfaces. Recent studies demonstrated that the AM symbiosis modifies the expression of plant transporter genes and that NH₄⁺ is the main form of N transported in the symbiosis. The aim of the present work was to get insights into the mycorrhizal N uptake pathway in Oryza sativa by analysing the expression of genes encoding ammonium transporters (AMTs), glutamine synthase (GS) and glutamate synthase (GOGAT) in roots colonized by the AM fungus Rhizophagus irregularis and grown under two N regimes. We found that the AM symbiosis down-regulated OsAMT1;1 and OsAMT1;3 expression at low-N, but not at high-N conditions, and induced, independently of the N status of the plant, a strong up-regulation of OsAMT3;1 expression. The AM-inducible NH₄⁺ transporter OsAMT3;1 belongs to the family 2 of plant AMTs and is phylogenetically related to the AM-inducible AMTs of other plant species. Moreover, for the first time we provide evidence of the specific induction of a GOGAT gene upon colonization with an AM fungus. These data suggest that OsAMT3;1 is likely involved in the mycorrhizal N uptake pathway in rice roots and that OsGOGAT2 plays a role in the assimilation of the NH₄⁺ supplied via the OsAMT3;1 AM-inducible transporter. Copyright © 2013 Elsevier Masson SAS. All rights reserved.

  13. Statistical method evaluation for differentially methylated CpGs in base resolution next-generation DNA sequencing data.

    Science.gov (United States)

    Zhang, Yun; Baheti, Saurabh; Sun, Zhifu

    2018-05-01

    High-throughput bisulfite methylation sequencing such as reduced representation bisulfite sequencing (RRBS), Agilent SureSelect Human Methyl-Seq (Methyl-seq) or whole-genome bisulfite sequencing is commonly used for base resolution methylome research. These data are represented either by the ratio of methylated cytosine versus total coverage at a CpG site or numbers of methylated and unmethylated cytosines. Multiple statistical methods can be used to detect differentially methylated CpGs (DMCs) between conditions, and these methods are often the base for the next step of differentially methylated region identification. The ratio data have a flexibility of fitting to many linear models, but the raw count data take consideration of coverage information. There is an array of options in each datatype for DMC detection; however, it is not clear which is an optimal statistical method. In this study, we systematically evaluated four statistic methods on methylation ratio data and four methods on count-based data and compared their performances with regard to type I error control, sensitivity and specificity of DMC detection and computational resource demands using real RRBS data along with simulation. Our results show that the ratio-based tests are generally more conservative (less sensitive) than the count-based tests. However, some count-based methods have high false-positive rates and should be avoided. The beta-binomial model gives a good balance between sensitivity and specificity and is preferred method. Selection of methods in different settings, signal versus noise and sample size estimation are also discussed.

  14. B(IS4;0GS+→4γ+) systematics in rare-earth nuclei: SU sdg (3) description

    International Nuclear Information System (INIS)

    Devi, Y.D.; Kota, V.K.B.

    1993-01-01

    The observed variation of B(IS4; 0 GS + →4 γ + ) with mass number A, that gives information about hexadecupole component in γ-vibration, in rare-earth nuclei is studied in the SU sdg (3) limit of sdg interacting boson model empoloying IBM-2 to IBM-1 projected hexadecupole transition operator with effective charges determined using a multi-j shell mapping procedure. The SU sdg (3) limit provides a reasonably good description of the data. (orig.)

  15. GsCa2+-ATPase基因大豆主要农艺性状调查与分析%Investigation and Analysis of Main Agronomic Traits of Transgenic Soybean with GsCa2+-ATPase Gene

    Institute of Scientific and Technical Information of China (English)

    赵超越; 柏锡; 樊超; 林凡敏; 才华; 纪巍; 朱延明

    2012-01-01

    In order to evaluate the variation of the main agronomic traits between transgenic soybean and the control, the seed germination, seed shattering, yield traits, morphological and quality traits of three T3 transgenic soybean lines HF50-CA-1, HF55-CA-1 and HF55-CA-2 were investigated and analyzed. No obvious differences in seed germination,seed shattering,yield traits,morphological traits and protein content were found for transgenic soybeans. The oil content of HF50-CA-1 ,HF55-CA-1 were decreased by 1.01% and 0.56% compared with the control, while HF55-CA-2 had no obvious differences. This study provides an important genetic resource for the industrialization of alkali tolerant transgenic soybeans.%为对转基因大豆新株系的主要农艺性状进行科学评价,对已获得耐盐碱性状显著的转GsCa2 +-A TPase基因大豆的3个株系HF50-CA-1、HF55-CA-1、HF55-CA-2的T3植株进行种子萌发率、种子落粒性、产量性状、品质性状和形态性状的调查与分析.结果表明:在种子萌发率、种子落粒性、形态性状和产量性状上,3个转基因大豆株系与对照相比无显著差异.在品质性状上,3个转基因株系的蛋白含量与对照差异不显著.表明没有因导入耐盐碱基因而导致上述性状产生不良变化.油分含量与对照相比,株系HF50-CA-1和HF55-CA-1分别显著下降1.01%和0.56%,而HF55-CA-2株系则差异不显著.

  16. Development of feed supplement Urea Molasses Multi nutrient Block (UMMB) using protein source from soy bean flour and gliricidia sepium (Gs) for ruminant animal

    International Nuclear Information System (INIS)

    Suharyono

    2014-01-01

    The aim of this activities is to develop formula of feed supplement UMMB-Gs for ruminant animal. The development of feed supplement was carried out on a laboratory and field scale. The activities on laboratory scale include biological evaluation of feed supplement used isotope technique P-32 in order to measure ratio bacteria and protozoa and growth rate of microbial cell in rumen liquid by in vitro studies. Two feed supplement were developed, these were UMMB-TK and UMMB-Gs. Two UMMB-TK were produced at pesantren Al Hikmah and Famor Satwa. Gliricidia sepium meal combined with UMMB-BK were tested on Goat of PE, buffaloes and beef cattle by in vitro studies in order to measure growth rate of microbial cell in rumen liquid using P-32. On the next activity the effect of UMMB-Gs on production and fat concentration of milk from dairy cattle was done. Statistical analysis used were test, 3x3 latin square design and randomize block design respectively. Quality control of UMMB indicated that ratio of bacteria and protozoa was 14 : 1 on UMMB-BK formulas, whereas on UMMB-TK1 it was found 19 : 1 and UMMB-TK2 was 17 : 1 respectively. These results were better then control (grass only). The value of feed control was 1 : 4. The result of UMMB-BK combinated with Gs on laboratory scale was capable of increasing growth rate of microbial cell on rumen liquid of Goat PE, buffaloes and beef cattle. The values were 102.01%; 205.7% and 73.7% respectively compared to control. Field trial of UMMB-Gs increased milk production and fat concentration on dairy cattle. It mean that nuclear technique has a potential role on the finding of a new feed supplement formulas and capable of giving positive impact, when UMMB feed supplement was able to create job field for small business of UMMB product based on local feed resources. (author)

  17. INTERACCIÓN DE LA GLUTAMINA SINTETASA (GS Y EL PÉPTIDO β -AMILOIDE COMO UNA ESTRATEGIA DE PURIFICACIÓN

    Directory of Open Access Journals (Sweden)

    Sonia Luz Albarracín

    2013-08-01

    Full Text Available La enfermedad de Alzheimer (EA esla forma de demencia más común en laedad adulta. Se manifiesta con la pérdidaprogresiva de la memoria a medida quelas neuronas en la corteza cerebral y elhipocampo mueren. En todas las formasde EA se evidencia aumento de la expresiónde diferentes proteínas, así comola presencia de agregados insolubles depéptido-β-amiloide (PBA. La glutaminasintetasa (GS es una enzima clave en elmetabolismo del glutamato y en la detoxificaciónde amonio (NH4+. Previamentese ha reportado una posible interacciónGS-PBA que puede estar asociada conEA. En este trabajo se realizó la purificaciónde la enzima cerebral de rata a partirde un extracto sometido a precipitaciónfraccionada con (NH42SO4 del 20-60 %de saturación y posteriormente a travésde cromatografías sucesivas de filtraciónen gel, intercambio iónico y afinidad. Elpeso molecular del complejo fue calculadoen 137 kDa por el orden de eluciónen la columna de filtración. Se identificóinteracción de la enzima con PBA1-40, lográndose la purificación de unasola banda de 45 kDa, correspondiente ala forma monomérica de la GS. En estetrabajo se presenta un nuevo método depurificación de la enzima y se demuestrala interacción de GS con el PBA. Se proponeque esta interacción GS-PBA puedeser uno de los procesos que se presentanen la enfermedad al explicar la reducciónde la actividad de la enzima en pacientes con EA, ya que podría alterar el cicloglutamato-glutamina y generar cambiosen el entorno celular que favorecen excitotoxicidadpor glutamato típica de losprocesos de neurodegeneración.

  18. Evaluation of root water uptake in the ISBA-A-gs land surface model using agricultural yield statistics over France

    Science.gov (United States)

    Canal, N.; Calvet, J.-C.; Decharme, B.; Carrer, D.; Lafont, S.; Pigeon, G.

    2014-12-01

    The simulation of root water uptake in land surface models is affected by large uncertainties. The difficulty in mapping soil depth and in describing the capacity of plants to develop a rooting system is a major obstacle to the simulation of the terrestrial water cycle and to the representation of the impacts of drought. In this study, long time series of agricultural statistics are used to evaluate and constrain root water uptake models. The inter-annual variability of cereal grain yield and permanent grassland dry matter yield is simulated over France by the Interactions between Soil, Biosphere and Atmosphere, CO2-reactive (ISBA-A-gs) generic land surface model (LSM). The two soil profile schemes available in the model are used to simulate the above-ground biomass (Bag) of cereals and grasslands: a two-layer force-restore (FR-2L) bulk reservoir model and a multi-layer diffusion (DIF) model. The DIF model is implemented with or without deep soil layers below the root zone. The evaluation of the various root water uptake models is achieved by using the French agricultural statistics of Agreste over the 1994-2010 period at 45 cropland and 48 grassland départements, for a range of rooting depths. The number of départements where the simulated annual maximum Bag presents a significant correlation with the yield observations is used as a metric to benchmark the root water uptake models. Significant correlations (p value neutral impact of the most refined versions of the model is found with respect to the simplified soil hydrology scheme. This shows that efforts should be made in future studies to reduce other sources of uncertainty, e.g. by using a more detailed soil and root density profile description together with satellite vegetation products. It is found that modelling additional subroot-zone base flow soil layers does not improve (and may even degrade) the representation of the inter-annual variability of the vegetation above-ground biomass. These results are

  19. Assimilation of Leaf Area Index and Soil Wetness Index into the ISBA-A-gs land surface model over France

    Science.gov (United States)

    Barbu, A. L.; Calvet, J.-C.; Lafont, S.

    2012-04-01

    The development of a Land Data Assimilation System (LDAS) dedicated to carbon and water cycles is considered as a key aspect for monitoring activities of terrestrial carbon fluxes. It allows the assimilation of biophysical products in order to reduce the bias between the model simulations and the observations and have a positive impact on carbon and water fluxes. This work shows the benefits of data assimilation of Earth observations for the monitoring of vegetation status and carbon fluxes, in the framework of the GEOLAND2 project, co-funded by the European Commission within the GMES initiative in FP7. In this study, the SURFEX modelling platform developed at Meteo-France is used for describing the continental vegetation state, surface fluxes and soil moisture. It consists of the land surface model ISBA-A-gs that simulates photosynthesis and plant growth. The vegetation biomass and Leaf Area Index (LAI) evolve dynamically in response to weather and climate conditions. The ECOCLIMAP database provides detailed information about the land cover at a resolution of 1 km. Over the France domain, the most present ecosystem types are grasslands (32%), C3 crop lands (24%), deciduous forest (20%), bare soil (11%), and C4 crop lands (8%).The model also includes a representation of the soil moisture stress with two different types of drought responses for herbaceous vegetation and forests. A version of the Extended Kalman Filter (EKF) scheme is developed for the joint assimilation of satellite-derived surface soil moisture from ASCAT-25 km product, namely Soil Wetness Index (SWI-01) developed by TU-Wien, and remote sensing LAI product provided by GEOLAND2. The GEOLAND2 LAI product is derived from CYCLOPES V3.1 and MODIS collection 5 data. It is more consistent with an effective LAI for low LAI and close to the actual LAI for high values. The assimilation experiment was conducted across France at a spatial resolution of 8 km. The study period ranges from July 2007 to December

  20. Anti-EBOV GP IgGs Lacking α1-3-Galactose and Neu5Gc Prolong Survival and Decrease Blood Viral Load in EBOV-Infected Guinea Pigs.

    Directory of Open Access Journals (Sweden)

    Olivier Reynard

    Full Text Available Polyclonal xenogenic IgGs, although having been used in the prevention and cure of severe infectious diseases, are highly immunogenic, which may restrict their usage in new applications such as Ebola hemorrhagic fever. IgG glycans display powerful xenogeneic antigens in humans, for example α1-3 Galactose and the glycolyl form of neuraminic acid Neu5Gc, and IgGs deprived of these key sugar epitopes may represent an advantage for passive immunotherapy. In this paper, we explored whether low immunogenicity IgGs had a protective effect on a guinea pig model of Ebola virus (EBOV infection. For this purpose, a double knock-out pig lacking α1-3 Galactose and Neu5Gc was immunized against virus-like particles displaying surface EBOV glycoprotein GP. Following purification from serum, hyper-immune polyclonal IgGs were obtained, exhibiting an anti-EBOV GP titer of 1:100,000 and a virus neutralizing titer of 1:100. Guinea pigs were injected intramuscularly with purified IgGs on day 0 and day 3 post-EBOV infection. Compared to control animals treated with IgGs from non-immunized double KO pigs, the anti-EBOV IgGs-treated animals exhibited a significantly prolonged survival and a decreased virus load in blood on day 3. The data obtained indicated that IgGs lacking α1-3 Galactose and Neu5Gc, two highly immunogenic epitopes in humans, have a protective effect upon EBOV infection.

  1. Anti-EBOV GP IgGs Lacking α1-3-Galactose and Neu5Gc Prolong Survival and Decrease Blood Viral Load in EBOV-Infected Guinea Pigs

    Science.gov (United States)

    Reynard, Olivier; Jacquot, Frédéric; Evanno, Gwénaëlle; Mai, Hoa Le; Martinet, Bernard; Duvaux, Odile; Bach, Jean-Marie; Conchon, Sophie; Judor, Jean-Paul; Perota, Andrea; Lagutina, Irina; Duchi, Roberto; Lazzari, Giovanna; Le Berre, Ludmilla; Perreault, Hélène; Lheriteau, Elsa; Raoul, Hervé; Volchkov, Viktor; Galli, Cesare; Soulillou, Jean-Paul

    2016-01-01

    Polyclonal xenogenic IgGs, although having been used in the prevention and cure of severe infectious diseases, are highly immunogenic, which may restrict their usage in new applications such as Ebola hemorrhagic fever. IgG glycans display powerful xenogeneic antigens in humans, for example α1–3 Galactose and the glycolyl form of neuraminic acid Neu5Gc, and IgGs deprived of these key sugar epitopes may represent an advantage for passive immunotherapy. In this paper, we explored whether low immunogenicity IgGs had a protective effect on a guinea pig model of Ebola virus (EBOV) infection. For this purpose, a double knock-out pig lacking α1–3 Galactose and Neu5Gc was immunized against virus-like particles displaying surface EBOV glycoprotein GP. Following purification from serum, hyper-immune polyclonal IgGs were obtained, exhibiting an anti-EBOV GP titer of 1:100,000 and a virus neutralizing titer of 1:100. Guinea pigs were injected intramuscularly with purified IgGs on day 0 and day 3 post-EBOV infection. Compared to control animals treated with IgGs from non-immunized double KO pigs, the anti-EBOV IgGs-treated animals exhibited a significantly prolonged survival and a decreased virus load in blood on day 3. The data obtained indicated that IgGs lacking α1–3 Galactose and Neu5Gc, two highly immunogenic epitopes in humans, have a protective effect upon EBOV infection. PMID:27280712

  2. Glutamine synthetase and alanine transaminase expression are decreased in livers of aged vs. young beef cows and GS can be upregulated by 17β-estradiol implants.

    Science.gov (United States)

    Miles, E D; McBride, B W; Jia, Y; Liao, S F; Boling, J A; Bridges, P J; Matthews, J C

    2015-09-01

    Aged beef cows (≥ 8 yr of age) produce calves with lower birth and weaning weights. In mammals, aging is associated with reduced hepatic expression of glutamine synthetase (GS) and alanine transaminase (ALT), thus impaired hepatic Gln-Glu cycle function. To determine if the relative protein content of GS, ALT, aspartate transaminase (AST), glutamate transporters (EAAC1, GLT-1), and their regulating protein (GTRAP3-18) differed in biopsied liver tissue of (a) aged vs. young (3 to 4 yr old) nonlactating, nongestating Angus cows (Exp. 1 and 2) and (b) aged mixed-breed cows with and without COMPUDOSE (17β-estradiol) ear implants (Exp. 3), Western blot analyses were performed. In Exp. 1, 12 young (3.62 ± 0.01 yr) and 13 aged (10.08 ± 0.42 yr) cows grazed the same mixed forage for 42 d (August-October). In Exp. 2, 12 young (3.36 ± 0.01 yr) and 12 aged (10.38 ± 0.47 yr) cows were individually fed (1.03% of BW) a corn-silage-based diet to maintain BW for 20 d. For both Exp. 1 and 2, the effect of cow age was assessed by ANOVA using the MIXED procedure of SAS. Cow BW did not change ( ≥ 0.17). Hepatic ALT (78% and 61%) and GS (52% and 71%) protein content (Exp. 1 and 2, respectively) was decreased ( ≤ 0.01), whereas GTRAP3-18 (an inhibitor of EAAC1 activity) increased ( ≤ 0.01; 170% and 136%) and AST, GLT-1, and EAAC1 contents did not differ ( ≥ 0.17) in aged vs. young cows. In Exp. 2, free concentrations (nmol/g) of Glu, Ala, Gln, Arg, and Orn in liver homogenates were determined. Aged cows tended to have less ( = 0.10) free Gln (15.0%) than young cows, whereas other AA concentrations did not differ ( 0.26). In Exp. 3, 14 aged (> 10 yr) cows were randomly allotted ( = 7) to sham or COMPUDOSE (25.7 mg of 17β-estradiol) implant treatment (TRT), and had ad libitum access to alfalfa hay for 28 d. Blood and liver biopsies were collected 14 and 28 d after implant treatment. Treatment, time after implant (DAY), and TRT × DAY effects were assessed by ANOVA using

  3. Follicular variant of papillary thyroid carcinoma presenting as toxic nodule in an adolescent: coexistent polymorphism of the TSHR and Gsα genes.

    Science.gov (United States)

    Ruggeri, Rosaria Maddalena; Campennì, Alfredo; Giovinazzo, Salvatore; Saraceno, Giovanna; Vicchio, Teresa Manuela; Carlotta, Dario; Cucinotta, Maria Paola; Micali, Carmelo; Trimarchi, Francesco; Tuccari, Giovanni; Baldari, Sergio; Benvenga, Salvatore

    2013-02-01

    Autonomously functioning, "hot", thyroid nodules are not common in children and adolescents. Such nodules are not considered alarming because they are assumed to be benign adenomas. Herein, we present a 15-year-old girl with a papillary thyroid carcinoma of 3.5 cm in diameter, which was functionally autonomous and scintigraphically hot. The patient, initially referred to our Endocrine Unit because of a thyroid nodule, returned 6 months later for symptoms of hyperthyroidism. Hyperthyroidism was confirmed biochemically. Radioactive iodine ((131)I) thyroid scintigraphy was consistent with an autonomous thyroid nodule. As per guidelines, the patient underwent surgery and a pathological examination revealed papillary carcinoma, follicular variant. The excised nodule was examined for activating mutations of the thyrotropin receptor (TSHR), Gsα (GNAS1), H-RAS, N-RAS, K-RAS, and BRAF genes by direct sequencing. No mutations were found. Nevertheless, two combined nonfunctioning mutations were detected: a single-nucleotide polymorphism (SNP) of the TSHR gene, in exon 7, at codon 187 (AAT→AAC, both encoding asparagine), and a SNP within exon 8 of the Gsα gene at codon 185 (ATC→ATT, both encoding isoleucine). Both SNPs were also identified in the germline DNA of the patient. The same SNPs were sought in the parents and brother of our patient. Her father was heterozygous for the TSHR SNP, her mother heterozygous for the Gsα SNP, and her brother was wild type. This case demonstrates that the presence of hyperfunctioning thyroid nodule(s) does not rule out cancer and warrants careful evaluation, especially in childhood and adolescence to overlook malignancy.

  4. Physical constraints on models of gamma-ray bursters

    International Nuclear Information System (INIS)

    Epstein, R.I.

    1985-01-01

    This report deals with the constraints that can be placed on models of gamma-ray burst sources based on only the well-established observational facts and physical principles. The premise is developed that the very hard x-ray and gamma-ray continua spectra are well-established aspects of gamma-ray bursts. Recent theoretical work on gamma-ray bursts are summarized with emphasis on the geometrical properties of the models. Constraints on the source models which are implied by the x-ray and gamma-ray spectra are described. The allowed ranges for the luminosity and characteristic dimension for gamma-ray burst sources are shown. Some of the deductions and inferences about the nature of the gamma-ray burst sources are summarized. 67 refs., 3 figs

  5. “Inclonals”: IgGs and IgG-enzyme fusion proteins produced in an E. coli expression-refolding system

    OpenAIRE

    Hakim, Rahely; Benhar, Itai

    2009-01-01

    Full-length antibodies and antibodies that ferry a cargo to target cells are desired biopharmaceuticals. We describe the production of full-length IgGs and IgG-toxin fusion proteins in E. coli. In the presented examples of anti CD30 and anti EGF-receptor antibodies, the antibody heavy and light chains or toxin fusions thereof were expressed in separate bacterial cultures, where they accumulated as insoluble inclusion bodies. Following refolding and purification, high yields (up to 50 mg/L of ...

  6. Study on characteristic differences of wheat 1Ax1 and 1Ax2* NILS obtained by transgenic HMW-GS 1Dx5 + 1Dy10 gene

    International Nuclear Information System (INIS)

    Sun Yan; Zhang Hongji; Liu Dongjun; Qi Qianqian; Yang Shuping; Guo Yipan; Ma Shumei; Liu Wenlin; Wang Guangjin; Zhao Wei

    2012-01-01

    Use wheat 1Ax1 and 1Ax2* NILS obtained by transgenic HMW-GS 1Dx5 + 1Dy10 gene, characteristics differences have been studied. The two-year results showed that the statistical differences in seed quality parameters, farinogram parameters, extensigram parameters, botany characters and main agricultural characters between 1Ax1 and 1Ax2* were not significant. We considered that 08K860 and 08K871 are similar in hereditary background, 1Ax1 and 1Ax2* have identical contribute on quality. Breeder should attach to 1Ax1 and 1Ax2* identically on wheat breeding. (authors)

  7. Study on characteristic differences of wheat 1Ax1 and 1Ax2* NILS obtained by transgenic HMW-GS 1Dx5+1Dy10 gene

    International Nuclear Information System (INIS)

    Sun Yan; Zhang Hongji; Liu Dongjun; Qi Qianqian; Yang Shuping; Guo Yifan; Ma Shumei; Liu Wenlin; Wang Guangjin; Zhao Wei

    2011-01-01

    Use wheat 1Ax1 and 1Ax2 * NILS obtained by transgenic HMW-GS 1Dx5+1Dy10 gene, characteristics differences have been studied. The two-year results showed that the statistical differences in seed quality parameters, farinogram parameters, extensigram parameters, botany characters and main agricultural characters between 1Ax1 and 1Ax2 * were not significant. We considered that 08K860 and 08K871 are similar in hereditary background, 1Ax1 and 1Ax2 * have identical contribute on quality. Breeder should atlach to 1Ax1 and 1Ax2 * identically on wheat breeding. (authors)

  8. Epidemiology and Heritability of Major Depressive Disorder, Stratified by Age of Onset, Sex, and Illness Course in Generation Scotland: Scottish Family Health Study (GS:SFHS.

    Directory of Open Access Journals (Sweden)

    Ana Maria Fernandez-Pujals

    Full Text Available The heritability of Major Depressive Disorder (MDD has been estimated at 37% based largely on twin studies that rely on contested assumptions. More recently, the heritability of MDD has been estimated on large populations from registries such as the Swedish, Finnish, and Chinese cohorts. Family-based designs utilise a number of different relationships and provide an alternative means of estimating heritability. Generation Scotland: Scottish Family Health Study (GS:SFHS is a large (n = 20,198, family-based population study designed to identify the genetic determinants of common diseases, including Major Depressive Disorder. Two thousand seven hundred and six individuals were SCID diagnosed with MDD, 13.5% of the cohort, from which we inferred a population prevalence of 12.2% (95% credible interval: 11.4% to 13.1%. Increased risk of MDD was associated with being female, unemployed due to a disability, current smokers, former drinkers, and living in areas of greater social deprivation. The heritability of MDD in GS:SFHS was between 28% and 44%, estimated from a pedigree model. The genetic correlation of MDD between sexes, age of onset, and illness course were examined and showed strong genetic correlations. The genetic correlation between males and females with MDD was 0.75 (0.43 to 0.99; between earlier (≤ age 40 and later (> age 40 onset was 0.85 (0.66 to 0.98; and between single and recurrent episodic illness course was 0.87 (0.72 to 0.98. We found that the heritability of recurrent MDD illness course was significantly greater than the heritability of single MDD illness course. The study confirms a moderate genetic contribution to depression, with a small contribution of the common family environment (variance proportion = 0.07, CI: 0.01 to 0.15, and supports the relationship of MDD with previously identified risk factors. This study did not find robust support for genetic differences in MDD due to sex, age of onset, or illness course. However

  9. Epidemiology and Heritability of Major Depressive Disorder, Stratified by Age of Onset, Sex, and Illness Course in Generation Scotland: Scottish Family Health Study (GS:SFHS).

    Science.gov (United States)

    Fernandez-Pujals, Ana Maria; Adams, Mark James; Thomson, Pippa; McKechanie, Andrew G; Blackwood, Douglas H R; Smith, Blair H; Dominiczak, Anna F; Morris, Andrew D; Matthews, Keith; Campbell, Archie; Linksted, Pamela; Haley, Chris S; Deary, Ian J; Porteous, David J; MacIntyre, Donald J; McIntosh, Andrew M

    2015-01-01

    The heritability of Major Depressive Disorder (MDD) has been estimated at 37% based largely on twin studies that rely on contested assumptions. More recently, the heritability of MDD has been estimated on large populations from registries such as the Swedish, Finnish, and Chinese cohorts. Family-based designs utilise a number of different relationships and provide an alternative means of estimating heritability. Generation Scotland: Scottish Family Health Study (GS:SFHS) is a large (n = 20,198), family-based population study designed to identify the genetic determinants of common diseases, including Major Depressive Disorder. Two thousand seven hundred and six individuals were SCID diagnosed with MDD, 13.5% of the cohort, from which we inferred a population prevalence of 12.2% (95% credible interval: 11.4% to 13.1%). Increased risk of MDD was associated with being female, unemployed due to a disability, current smokers, former drinkers, and living in areas of greater social deprivation. The heritability of MDD in GS:SFHS was between 28% and 44%, estimated from a pedigree model. The genetic correlation of MDD between sexes, age of onset, and illness course were examined and showed strong genetic correlations. The genetic correlation between males and females with MDD was 0.75 (0.43 to 0.99); between earlier (≤ age 40) and later (> age 40) onset was 0.85 (0.66 to 0.98); and between single and recurrent episodic illness course was 0.87 (0.72 to 0.98). We found that the heritability of recurrent MDD illness course was significantly greater than the heritability of single MDD illness course. The study confirms a moderate genetic contribution to depression, with a small contribution of the common family environment (variance proportion = 0.07, CI: 0.01 to 0.15), and supports the relationship of MDD with previously identified risk factors. This study did not find robust support for genetic differences in MDD due to sex, age of onset, or illness course. However, we found

  10. Effects of HMW-GS Ax1 or Dx2 absence on the glutenin polymerization and gluten micro structure of wheat (Triticum aestivum L.).

    Science.gov (United States)

    Gao, Xin; Liu, Tianhong; Ding, Mengyun; Wang, Jun; Li, Chunlian; Wang, Zhonghua; Li, Xuejun

    2018-02-01

    Wheat (Triticum aestivum L.) dough strength and extensibility are mainly determined by the polymerization of glutenin. The number of high-molecular-weight glutenin subunits (HMW-GS) differs in various wheat varieties due to the silencing of some genes. The effects of Ax1 or Dx2 subunit absence on glutenin polymerization, dough mixing properties and gluten micro structure were investigated with two groups of near-isogenic lines. The results showed that Ax1 or Dx2 absence decreased the accumulation rate of glutenin polymers and thus delayed the rapid increase period for glutenin polymerization by at least ten days, which led to lower percentage of polymeric protein in mature grain. Ax1 or Dx2 absence significantly decreased the dough development time and dough stability, but increased the uniformity of micro structure. Lacunarity, derived from quantitative analysis of gluten network, is suggested as a new indicator for wheat quality. Copyright © 2017 Elsevier Ltd. All rights reserved.

  11. Carbon steel protection in G.S. (Girlder sulfide) heavy water fabrication plants. Control of iron content at the final stage of passivation. Pt. 10

    International Nuclear Information System (INIS)

    Rojo, E.A.

    1991-01-01

    This paper is part of a series which corresponds to the carbon steel behaviour as construction material for Girlder sulfide (G.S.) heavy water plants. The present work analyses the iron concentration study during passivation in the passivating fluid. At the beginning, during the formation of the most soluble sulfide -that is the mackinawite-, the iron concentration reaches more than 10 ppm. After some days, this iron concentration begins to decrease up to its stabilization under 0.1 ppm. This process, which occurs in the 9th. and 11th days, indicates that passivation is over, and that a pyrite and pyrrhotite-pyrite layer exists on the iron. Some differences exist between the results obtained and those previsible for the iron sulfides solubilities. In spite of these difficulties, the procedure is perfectly adequate to judge the passivation final stage. (Author) [es

  12. Effects of Lys to Glu mutations in GsMTx4 on membrane binding, peptide orientation, and self-association propensity, as analyzed by molecular dynamics simulations.

    Science.gov (United States)

    Nishizawa, Kazuhisa; Nishizawa, Manami; Gnanasambandam, Radhakrishnan; Sachs, Frederick; Sukharev, Sergei I; Suchyna, Thomas M

    2015-11-01

    GsMTx4, a gating modifier peptide acting on cationic mechanosensitive channels, has a positive charge (+5e) due to six Lys residues. The peptide does not have a stereospecific binding site on the channel but acts from the boundary lipids within a Debye length of the pore probably by changing local stress. To gain insight into how these Lys residues interact with membranes, we performed molecular dynamics simulations of Lys to Glu mutants in parallel with our experimental work. In silico, K15E had higher affinity for 1-palmitoyl-2-oleoyl-glycero-3-phosphocholine bilayers than wild-type (WT) peptide or any other mutant tested, and showed deeper penetration than WT, a finding consistent with the experimental data. Experimentally, the inhibitory activities of K15E and K25E were most compromised, whereas K8E and K28E inhibitory activities remained similar to WT peptide. Binding of WT in an interfacial mode did not influence membrane thickness. With interfacial binding, the direction of the dipole moments of K15E and K25E was predicted to differ from WT, whereas those of K8E and K28E oriented similarly to that of WT. These results support a model in which binding of GsMTx4 to the membrane acts like an immersible wedge that serves as a membrane expansion buffer reducing local stress and thus inhibiting channel activity. In simulations, membrane-bound WT attracted other WT peptides to form aggregates. This may account for the positive cooperativity observed in the ion channel experiments. The Lys residues seem to fine-tune the depth of membrane binding, the tilt angle, and the dipole moments. Copyright © 2015 Elsevier B.V. All rights reserved.

  13. Hypoxia activates a Ca2+-permeable cation conductance sensitive to carbon monoxide and to GsMTx-4 in human and mouse sickle erythrocytes.

    Science.gov (United States)

    Vandorpe, David H; Xu, Chang; Shmukler, Boris E; Otterbein, Leo E; Trudel, Marie; Sachs, Frederick; Gottlieb, Philip A; Brugnara, Carlo; Alper, Seth L

    2010-01-15

    Deoxygenation of sickle erythrocytes activates a cation permeability of unknown molecular identity (Psickle), leading to elevated intracellular [Ca(2+)] ([Ca(2+)](i)) and subsequent activation of K(Ca) 3.1. The resulting erythrocyte volume decrease elevates intracellular hemoglobin S (HbSS) concentration, accelerates deoxygenation-induced HbSS polymerization, and increases the likelihood of cell sickling. Deoxygenation-induced currents sharing some properties of Psickle have been recorded from sickle erythrocytes in whole cell configuration. We now show by cell-attached and nystatin-permeabilized patch clamp recording from sickle erythrocytes of mouse and human that deoxygenation reversibly activates a Ca(2+)- and cation-permeable conductance sensitive to inhibition by Grammastola spatulata mechanotoxin-4 (GsMTx-4; 1 microM), dipyridamole (100 microM), DIDS (100 microM), and carbon monoxide (25 ppm pretreatment). Deoxygenation also elevates sickle erythrocyte [Ca(2+)](i), in a manner similarly inhibited by GsMTx-4 and by carbon monoxide. Normal human and mouse erythrocytes do not exhibit these responses to deoxygenation. Deoxygenation-induced elevation of [Ca(2+)](i) in mouse sickle erythrocytes did not require KCa3.1 activity. The electrophysiological and fluorimetric data provide compelling evidence in sickle erythrocytes of mouse and human for a deoxygenation-induced, reversible, Ca(2+)-permeable cation conductance blocked by inhibition of HbSS polymerization and by an inhibitor of strctch-activated cation channels. This cation permeability pathway is likely an important source of intracellular Ca(2+) for pathologic activation of KCa3.1 in sickle erythrocytes. Blockade of this pathway represents a novel therapeutic approach for treatment of sickle disease.

  14. Hypoxia activates a Ca2+-permeable cation conductance sensitive to carbon monoxide and to GsMTx-4 in human and mouse sickle erythrocytes.

    Directory of Open Access Journals (Sweden)

    David H Vandorpe

    2010-01-01

    Full Text Available Deoxygenation of sickle erythrocytes activates a cation permeability of unknown molecular identity (Psickle, leading to elevated intracellular [Ca(2+] ([Ca(2+](i and subsequent activation of K(Ca 3.1. The resulting erythrocyte volume decrease elevates intracellular hemoglobin S (HbSS concentration, accelerates deoxygenation-induced HbSS polymerization, and increases the likelihood of cell sickling. Deoxygenation-induced currents sharing some properties of Psickle have been recorded from sickle erythrocytes in whole cell configuration.We now show by cell-attached and nystatin-permeabilized patch clamp recording from sickle erythrocytes of mouse and human that deoxygenation reversibly activates a Ca(2+- and cation-permeable conductance sensitive to inhibition by Grammastola spatulata mechanotoxin-4 (GsMTx-4; 1 microM, dipyridamole (100 microM, DIDS (100 microM, and carbon monoxide (25 ppm pretreatment. Deoxygenation also elevates sickle erythrocyte [Ca(2+](i, in a manner similarly inhibited by GsMTx-4 and by carbon monoxide. Normal human and mouse erythrocytes do not exhibit these responses to deoxygenation. Deoxygenation-induced elevation of [Ca(2+](i in mouse sickle erythrocytes did not require KCa3.1 activity.The electrophysiological and fluorimetric data provide compelling evidence in sickle erythrocytes of mouse and human for a deoxygenation-induced, reversible, Ca(2+-permeable cation conductance blocked by inhibition of HbSS polymerization and by an inhibitor of strctch-activated cation channels. This cation permeability pathway is likely an important source of intracellular Ca(2+ for pathologic activation of KCa3.1 in sickle erythrocytes. Blockade of this pathway represents a novel therapeutic approach for treatment of sickle disease.

  15. Wind Speed and Sea State Dependencies of Air-Sea Gas Transfer: Results From the High Wind Speed Gas Exchange Study (HiWinGS)

    Science.gov (United States)

    Blomquist, B. W.; Brumer, S. E.; Fairall, C. W.; Huebert, B. J.; Zappa, C. J.; Brooks, I. M.; Yang, M.; Bariteau, L.; Prytherch, J.; Hare, J. E.; Czerski, H.; Matei, A.; Pascal, R. W.

    2017-10-01

    A variety of physical mechanisms are jointly responsible for facilitating air-sea gas transfer through turbulent processes at the atmosphere-ocean interface. The nature and relative importance of these mechanisms evolves with increasing wind speed. Theoretical and modeling approaches are advancing, but the limited quantity of observational data at high wind speeds hinders the assessment of these efforts. The HiWinGS project successfully measured gas transfer coefficients (k660) with coincident wave statistics under conditions with hourly mean wind speeds up to 24 m s-1 and significant wave heights to 8 m. Measurements of k660 for carbon dioxide (CO2) and dimethylsulfide (DMS) show an increasing trend with respect to 10 m neutral wind speed (U10N), following a power law relationship of the form: k660 CO2˜U10N1.68 and k660 dms˜U10N1.33. Among seven high wind speed events, CO2 transfer responded to the intensity of wave breaking, which depended on both wind speed and sea state in a complex manner, with k660 CO2 increasing as the wind sea approaches full development. A similar response is not observed for DMS. These results confirm the importance of breaking waves and bubble injection mechanisms in facilitating CO2 transfer. A modified version of the Coupled Ocean-Atmosphere Response Experiment Gas transfer algorithm (COAREG ver. 3.5), incorporating a sea state-dependent calculation of bubble-mediated transfer, successfully reproduces the mean trend in observed k660 with wind speed for both gases. Significant suppression of gas transfer by large waves was not observed during HiWinGS, in contrast to results from two prior field programs.

  16. Spearfishing regulation benefits artisanal fisheries: the ReGS indicator and its application to a multiple-use Mediterranean marine protected area.

    Science.gov (United States)

    Rocklin, Delphine; Tomasini, Jean-Antoine; Culioli, Jean-Michel; Pelletier, Dominique; Mouillot, David

    2011-01-01

    The development of fishing efficiency coupled with an increase of fishing effort led to the overexploitation of numerous natural marine resources. In addition to this commercial pressure, the impact of recreational activities on fish assemblages remains barely known. Here we examined the impact of spearfishing limitation on resources in a marine protected area (MPA) and the benefit it provides for the local artisanal fishery through the use of a novel indicator. We analysed trends in the fish assemblage composition using artisanal fisheries data collected in the Bonifacio Strait Natural Reserve (BSNR), a Mediterranean MPA where the spearfishing activity has been forbidden over 15% of its area. Fish species were pooled into three response groups according to their target level by spearfishing. We developed the new flexible ReGS indicator reflecting shifts in species assemblages according to the relative abundance of each response group facing external pressure. The catch per unit effort (CPUE) increased by ca. 60% in the BSNR between 2000 and 2007, while the MPA was established in 1999. The gain of CPUE strongly depended on the considered response group: for the highly targeted group, the CPUE doubled while the CPUE of the untargeted group increased by only 15.5%. The ReGS value significantly increased from 0.31 to 0.45 (on a scale between 0 and 1) in the general perimeter of this MPA while it has reached a threshold of 0.43, considered as a reference point, in the area protected from spearfishing since 1982. Our results demonstrated that limiting recreational fishing by appropriate zoning in multiple-use MPAs represents a real benefit for artisanal fisheries. More generally we showed how our new indicator may reveal a wide range of impacts on coastal ecosystems such as global change or habitat degradation.

  17. Spearfishing regulation benefits artisanal fisheries: the ReGS indicator and its application to a multiple-use Mediterranean marine protected area.

    Directory of Open Access Journals (Sweden)

    Delphine Rocklin

    Full Text Available The development of fishing efficiency coupled with an increase of fishing effort led to the overexploitation of numerous natural marine resources. In addition to this commercial pressure, the impact of recreational activities on fish assemblages remains barely known. Here we examined the impact of spearfishing limitation on resources in a marine protected area (MPA and the benefit it provides for the local artisanal fishery through the use of a novel indicator. We analysed trends in the fish assemblage composition using artisanal fisheries data collected in the Bonifacio Strait Natural Reserve (BSNR, a Mediterranean MPA where the spearfishing activity has been forbidden over 15% of its area. Fish species were pooled into three response groups according to their target level by spearfishing. We developed the new flexible ReGS indicator reflecting shifts in species assemblages according to the relative abundance of each response group facing external pressure. The catch per unit effort (CPUE increased by ca. 60% in the BSNR between 2000 and 2007, while the MPA was established in 1999. The gain of CPUE strongly depended on the considered response group: for the highly targeted group, the CPUE doubled while the CPUE of the untargeted group increased by only 15.5%. The ReGS value significantly increased from 0.31 to 0.45 (on a scale between 0 and 1 in the general perimeter of this MPA while it has reached a threshold of 0.43, considered as a reference point, in the area protected from spearfishing since 1982. Our results demonstrated that limiting recreational fishing by appropriate zoning in multiple-use MPAs represents a real benefit for artisanal fisheries. More generally we showed how our new indicator may reveal a wide range of impacts on coastal ecosystems such as global change or habitat degradation.

  18. Optimization of cell line development in the GS-CHO expression system using a high-throughput, single cell-based clone selection system.

    Science.gov (United States)

    Nakamura, Tsuyoshi; Omasa, Takeshi

    2015-09-01

    Therapeutic antibodies are commonly produced by high-expressing, clonal and recombinant Chinese hamster ovary (CHO) cell lines. Currently, CHO cells dominate as a commercial production host because of their ease of use, established regulatory track record, and safety profile. CHO-K1SV is a suspension, protein-free-adapted CHO-K1-derived cell line employing the glutamine synthetase (GS) gene expression system (GS-CHO expression system). The selection of high-producing mammalian cell lines is a crucial step in process development for the production of therapeutic antibodies. In general, cloning by the limiting dilution method is used to isolate high-producing monoclonal CHO cells. However, the limiting dilution method is time consuming and has a low probability of monoclonality. To minimize the duration and increase the probability of obtaining high-producing clones with high monoclonality, an automated single cell-based clone selector, the ClonePix FL system, is available. In this study, we applied the high-throughput ClonePix FL system for cell line development using CHO-K1SV cells and investigated efficient conditions for single cell-based clone selection. CHO-K1SV cell growth at the pre-picking stage was improved by optimizing the formulation of semi-solid medium. The efficiency of picking and cell growth at the post-picking stage was improved by optimization of the plating time without decreasing the diversity of clones. The conditions for selection, including the medium formulation, were the most important factors for the single cell-based clone selection system to construct a high-producing CHO cell line. Copyright © 2015 The Society for Biotechnology, Japan. Published by Elsevier B.V. All rights reserved.

  19. Reseña: Abal Oliú, Alejandro: C.G.P. y conciliación previa en materia laboral, Editorial Universidad Ltda. Montevideo, 1992, 64 págs.

    Directory of Open Access Journals (Sweden)

    o. C. R.

    2015-10-01

    Full Text Available Abal Oliú, Alejandro: C.G.P. y conciliación previa en materia laboral, Editorial Universidad Ltda. Montevideo, 1992, 64 págs. Editorial Universidad Ltda. Montevideo, 1992, 64 págs.El autor, profesor de Derecho Procesal y de Técnica Forense en nuestra Facultad, analiza en la presente obra las distintas fórmulas que es posible estab~ecer en cuanto a la tentativa de conciliación previa a la iniciación de los procesos laborales, luego de la entrada en vigencia del Código General del Proceso. (...

  20. A 5bit 1GS/s 2.7mW 0.05mm^2 asynchronous digital slope ADC in 90nm CMOS for IR UWB radio

    NARCIS (Netherlands)

    Ding, M.; Harpe, P.J.A.; Hegt, J.A.; Philips, K.J.P.; Groot, de H.W.H.; Roermund, van A.H.M.

    2012-01-01

    A 5bit 1GS/s 0.05mm2 4× time-interleaved asynchronous digital slope ADC in 90nm CMOS for IR UWB radio is presented. New delay cells are introduced to double the speed over prior art, yielding the 250MS/s single-channel slope converter. A self-disabled comparator eliminates static leakage and

  1. The Vigna Genome Server, 'VigGS': A Genomic Knowledge Base of the Genus Vigna Based on High-Quality, Annotated Genome Sequence of the Azuki Bean, Vigna angularis (Willd.) Ohwi & Ohashi.

    Science.gov (United States)

    Sakai, Hiroaki; Naito, Ken; Takahashi, Yu; Sato, Toshiyuki; Yamamoto, Toshiya; Muto, Isamu; Itoh, Takeshi; Tomooka, Norihiko

    2016-01-01

    The genus Vigna includes legume crops such as cowpea, mungbean and azuki bean, as well as >100 wild species. A number of the wild species are highly tolerant to severe environmental conditions including high-salinity, acid or alkaline soil; drought; flooding; and pests and diseases. These features of the genus Vigna make it a good target for investigation of genetic diversity in adaptation to stressful environments; however, a lack of genomic information has hindered such research in this genus. Here, we present a genome database of the genus Vigna, Vigna Genome Server ('VigGS', http://viggs.dna.affrc.go.jp), based on the recently sequenced azuki bean genome, which incorporates annotated exon-intron structures, along with evidence for transcripts and proteins, visualized in GBrowse. VigGS also facilitates user construction of multiple alignments between azuki bean genes and those of six related dicot species. In addition, the database displays sequence polymorphisms between azuki bean and its wild relatives and enables users to design primer sequences targeting any variant site. VigGS offers a simple keyword search in addition to sequence similarity searches using BLAST and BLAT. To incorporate up to date genomic information, VigGS automatically receives newly deposited mRNA sequences of pre-set species from the public database once a week. Users can refer to not only gene structures mapped on the azuki bean genome on GBrowse but also relevant literature of the genes. VigGS will contribute to genomic research into plant biotic and abiotic stresses and to the future development of new stress-tolerant crops. © The Author 2015. Published by Oxford University Press on behalf of Japanese Society of Plant Physiologists. All rights reserved. For permissions, please email: journals.permissions@oup.com.

  2. Use of agricultural statistics to verify the interannual variability in land surface models: a case study over France with ISBA-A-gs

    Directory of Open Access Journals (Sweden)

    J.-C. Calvet

    2012-01-01

    Full Text Available In order to verify the interannual variability of the above-ground biomass of herbaceous vegetation simulated by the ISBA-A-gs land surface model, within the SURFEX modelling platform, French agricultural statistics for C3 crops and grasslands were compared with the simulations for the 1994–2008 period. While excellent correlations are obtained for grasslands, representing the interannual variability of crops is more difficult. It is shown that, the Maximum Available soil Water Capacity (MaxAWC has a large influence on the correlation between the model and the agricultural statistics. In particular, high values of MaxAWC tend to reduce the impact of the climate interannual variability on the simulated biomass. Also, high values of MaxAWC allow the simulation of a negative trend in biomass production, in relation to a marked warming trend, of about 0.12 Kyr−1 on average, affecting the daily maximum air temperature during the growing period (April–June. This trend is particularly acute in Northern France. The estimates of MaxAWC for C3 crops and grasslands, currently used in SURFEX, are about 129 mm and do not vary much. Therefore, more accurate grid-cell values of this parameter are needed.

  3. Differential cross section measurement of the {sup 12}C(e,e{sup '}pp){sup 10}Be{sub g.s.} reaction

    Energy Technology Data Exchange (ETDEWEB)

    Makek, M.; Bosnar, D.; Friscic, I. [University of Zagreb, Department of Physics, Faculty of Science, Zagreb (Croatia); Achenbach, P.; Ayerbe Gayoso, C.; Bernauer, J.C.; Boehm, R.; Denig, A.; Distler, M.O.; Merkel, H.; Mueller, U.; Nungesser, L.; Pochodzalla, J.; Sanches Majos, S.; Schlimme, B.S.; Schwamb, M.; Walcher, T. [Johannes Gutenberg-Universitaet, Institut fuer Kernphysik, Mainz (Germany); Barbieri, C. [University of Surrey, Department of Physics, Guildford (United Kingdom); Giusti, C. [Universita degli Studi di Pavia, Dipartimento di Fisica, Pavia (Italy); INFN, Sezione di Pavia (Italy); Collaboration: A1 Collaboration

    2016-09-15

    The differential cross section was measured for the {sup 12}C(e,e{sup '}pp){sup 10}Be{sub g.s.} reaction at energy and momentum transfers of 163 MeV and 198 MeV/c, respectively. The measurement was performed at the Mainz Microtron by using two high-resolution magnetic spectrometers of the A1 Collaboration and a newly developed silicon detector telescope. The overall resolution of the detector system was sufficient to distinguish the ground state from the first excited state in {sup 10}Be. We chose a super-parallel geometry that minimizes the effect of two-body currents and emphasizes the effect of nucleon-nucleon correlations. The obtained differential cross section is compared to the theoretical results of the Pavia reaction code in which different processes leading to two-nucleon knockout are accounted for microscopically. The comparison shows a strong sensitivity to nuclear-structure input and the measured cross section is seen to be dominated by the interplay between long- and short-range nucleon-nucleon correlations. Microscopic calculations based on the ab initio self-consistent Green's function method give a reasonable description of the experimental cross section. (orig.)

  4. Solvarmeanlægs energibesparelser

    DEFF Research Database (Denmark)

    Furbo, Simon; Fan, Jianhua

    Energy savings for a number of new solar heating systems in one family houses have been determined by means of information on the energy consumption of the houses before and after installation of the solar heating systems. The investigated solar heating systems are marketed by Velux Danmark A...... of the houses used as the auxiliary energy systems for the solar heating systems. The yearly energy savings for the houses where the only change is the installation of the solar heating system vary from 300 kWh per m² solar collector to 1300 kWh per m² solar collector. The average yearly energy savings is about....../S, Sonnnenkraft Scandinavia A/S and Batec Solvarme A/S. Solar domestic hot water systems as well as solar combi systems are included in the investigations The houses have different auxiliary energy supply systems: Natural gas boilers, oil fired burners, electrical heating and district heating. Some of the houses...

  5. Til vægs

    DEFF Research Database (Denmark)

    Egemose, Ellen

    abstraktion og mellem rumlighed og flade, og som i varierende grad strider mod at underordne sig motivernes figurer og handling. Med afsæt fra Wolfgang Iser og Wolfgang Kemps receptionsæstetik – og i et indledende forsøg på at kaste et kritisk blik på projektets geografiske empiriafgrænsning – spørger jeg: Er...

  6. PI3Kδ inhibitor idelalisib in combination with BTK inhibitor ONO/GS-4059 in diffuse large B cell lymphoma with acquired resistance to PI3Kδ and BTK inhibitors.

    Directory of Open Access Journals (Sweden)

    Anella Yahiaoui

    Full Text Available Activated B-cell-like diffuse large B-cell lymphoma relies on B-cell receptor signaling to drive proliferation and survival. Downstream of the B-cell receptor, the key signaling kinases Bruton's tyrosine kinase and phosphoinositide 3-kinase δ offer opportunities for therapeutic intervention by agents such as ibrutinib, ONO/GS-4059, and idelalisib. Combination therapy with such targeted agents could provide enhanced efficacy due to complimentary mechanisms of action. In this study, we describe both the additive interaction of and resistance mechanisms to idelalisib and ONO/GS-4059 in a model of activated B-cell-like diffuse large B-cell lymphoma. Significant tumor regression was observed with a combination of PI3Kδ and Bruton's tyrosine kinase inhibitors in the mouse TMD8 xenograft. Acquired resistance to idelalisib in the TMD8 cell line occurred by loss of phosphatase and tensin homolog and phosphoinositide 3-kinase pathway upregulation, but not by mutation of PIK3CD. Sensitivity to idelalisib could be restored by combining idelalisib and ONO/GS-4059. Further evaluation of targeted inhibitors revealed that the combination of idelalisib and the phosphoinositide-dependent kinase-1 inhibitor GSK2334470 or the AKT inhibitor MK-2206 could partially overcome resistance. Characterization of acquired Bruton's tyrosine kinase inhibitor resistance revealed a novel tumor necrosis factor alpha induced protein 3 mutation (TNFAIP3 Q143*, which led to a loss of A20 protein, and increased p-IκBα. The combination of idelalisib and ONO/GS-4059 partially restored sensitivity in this resistant line. Additionally, a mutation in Bruton's tyrosine kinase at C481F was identified as a mechanism of resistance. The combination activity observed with idelalisib and ONO/GS-4059, taken together with the ability to overcome resistance, could lead to a new therapeutic option in activated B-cell-like diffuse large B-cell lymphoma. A clinical trial is currently underway to

  7. Assimilation of Soil Wetness Index and Leaf Area Index into the ISBA-A-gs land surface model: grassland case study

    Directory of Open Access Journals (Sweden)

    A. L. Barbu

    2011-07-01

    Full Text Available The performance of the joint assimilation in a land surface model of a Soil Wetness Index (SWI product provided by an exponential filter together with Leaf Area Index (LAI is investigated. The data assimilation is evaluated with different setups using the SURFEX modeling platform, for a period of seven years (2001–2007, at the SMOSREX grassland site in southwestern France. The results obtained with a Simplified Extended Kalman Filter demonstrate the effectiveness of a joint data assimilation scheme when both SWI and Leaf Area Index are merged into the ISBA-A-gs land surface model. The assimilation of a retrieved Soil Wetness Index product presents several challenges that are investigated in this study. A significant improvement of around 13 % of the root-zone soil water content is obtained by assimilating dimensionless root-zone SWI data. For comparison, the assimilation of in situ surface soil moisture is considered as well. A lower impact on the root zone is noticed. Under specific conditions, the transfer of the information from the surface to the root zone was found not accurate. Also, our results indicate that the assimilation of in situ LAI data may correct a number of deficiencies in the model, such as low LAI values in the senescence phase by using a seasonal-dependent error definition for background and observations. In order to verify the specification of the errors for SWI and LAI products, a posteriori diagnostics are employed. This approach highlights the importance of the assimilation design on the quality of the analysis. The impact of data assimilation scheme on CO2 fluxes is also quantified by using measurements of net CO2 fluxes gathered at the SMOSREX site from 2005 to 2007. An improvement of about 5 % in terms of rms error is obtained.

  8. An optimally tuned ensemble of the "eb_go_gs" configuration of GENIE: parameter sensitivity and bifurcations in the Atlantic overturning circulation

    Directory of Open Access Journals (Sweden)

    R. Marsh

    2013-10-01

    Full Text Available The key physical parameters for the "eb_go_gs" configuration of version 2.7.4 of GENIE, an Earth system model of intermediate complexity (EMIC, are tuned using a multi-objective genetic algorithm. An ensemble of 90 parameter sets is tuned using two ocean and two atmospheric state variables as targets. These are "Pareto-optimal", representing a range of trade-offs between the four tuning targets. For the leading five parameter sets, simulations are evaluated alongside a simulation with untuned "default" parameters, comparing selected variables and diagnostics that describe the state of the atmosphere, ocean and sea ice. Further experiments are undertaken with these selected parameter sets to compare equilibrium climate sensitivities and transient climate responses. The pattern of warming under doubled CO2 is strongly shaped by changes in the Atlantic meridional overturning circulation (AMOC, while the pattern and rate of warming under rising CO2 is closely linked to changing sea ice extent. One of the five tuned parameter sets is identified as marginally optimal, and the objective function (error landscape is further analysed in the vicinity of the tuned values of this parameter set. "Cliffs" along some dimensions motivate closer inspection of corresponding variations in the AMOC. This reveals that bifurcations in the AMOC are highly sensitive to parameters that are not typically associated with MOC stability. Specifically, the state of the AMOC is sensitive to parameters governing the wind-driven circulation and atmospheric heat transport. For the GENIE configuration presented here, the marginally optimal parameter set is recommended for single simulations, although the leading five parameter sets may be used in ensemble mode to admit a constrained degree of parametric uncertainty in climate prediction.

  9. Glycyrrhetic acid synergistically enhances β₂-adrenergic receptor-Gs signaling by changing the location of Gαs in lipid rafts.

    Directory of Open Access Journals (Sweden)

    Qian Shi

    Full Text Available Glycyrrhetic acid (GA exerts synergistic anti-asthmatic effects via a β₂-adrenergic receptor (β₂AR-mediated pathway. Cholesterol is an important component of the structure and function of lipid rafts, which play critical roles in the β₂AR-Gs-adenylate cyclase (AC-mediated signaling pathway. Owing to the structural similarities between GA and cholesterol, we investigated the possibility that GA enhances β₂AR signaling by altering cholesterol distribution. Azide-terminal GA (ATGA was synthesized and applied to human embryonic kidney 293 (HEK293 cells expressing fusion β₂AR, and the electron spin resonance (ESR technique was utilized. GA was determined to be localized predominantly on membrane and decreased their cholesterol contents. Thus, the fluidity of the hydrophobic region increased but not the polar surface of the cell membrane. The conformations of membrane proteins were also changed. GA further changed the localization of Gαs from lipid rafts to non-raft regions, resulting the binding of β₂AR and Gαs, as well as in reduced β₂AR internalization. Co-localization of β₂AR, Gαs, and AC increased isoproterenol-induced cAMP production and cholesterol reloading attenuated this effect. A speculation wherein GA enhances beta-adrenergic activity by increasing the functional linkage between the subcomponents of the membrane β₂AR-protein kinase A (PKA signaling pathway was proposed. The enhanced efficacy of β₂AR agonists by this novel mechanism could prevent tachyphylaxis.

  10. Adaptive Activation of a Stress Response Pathway Improves Learning and Memory Through Gs and β-Arrestin-1-Regulated Lactate Metabolism.

    Science.gov (United States)

    Dong, Jun-Hong; Wang, Yi-Jing; Cui, Min; Wang, Xiao-Jing; Zheng, Wen-Shuai; Ma, Ming-Liang; Yang, Fan; He, Dong-Fang; Hu, Qiao-Xia; Zhang, Dao-Lai; Ning, Shang-Lei; Liu, Chun-Hua; Wang, Chuan; Wang, Yue; Li, Xiang-Yao; Yi, Fan; Lin, Amy; Kahsai, Alem W; Cahill, Thomas Joseph; Chen, Zhe-Yu; Yu, Xiao; Sun, Jin-Peng

    2017-04-15

    Stress is a conserved physiological response in mammals. Whereas moderate stress strengthens memory to improve reactions to previously experienced difficult situations, too much stress is harmful. We used specific β-adrenergic agonists, as well as β 2 -adrenergic receptor (β2AR) and arrestin knockout models, to study the effects of adaptive β2AR activation on cognitive function using Morris water maze and object recognition experiments. We used molecular and cell biological approaches to elucidate the signaling subnetworks. We observed that the duration of the adaptive β2AR activation determines its consequences on learning and memory. Short-term formoterol treatment, for 3 to 5 days, improved cognitive function; however, prolonged β2AR activation, for more than 6 days, produced harmful effects. We identified the activation of several signaling networks downstream of β2AR, as well as an essential role for arrestin and lactate metabolism in promoting cognitive ability. Whereas Gs-protein kinase A-cyclic adenosine monophosphate response element binding protein signaling modulated monocarboxylate transporter 1 expression, β-arrestin-1 controlled expression levels of monocarboxylate transporter 4 and lactate dehydrogenase A through the formation of a β-arrestin-1/phospho-mitogen-activated protein kinase/hypoxia-inducible factor-1α ternary complex to upregulate lactate metabolism in astrocyte-derived U251 cells. Conversely, long-term treatment with formoterol led to the desensitization of β2ARs, which was responsible for its decreased beneficial effects. Our results not only revealed that β-arrestin-1 regulated lactate metabolism to contribute to β2AR functions in improved memory formation, but also indicated that the appropriate management of one specific stress pathway, such as through the clinical drug formoterol, may exert beneficial effects on cognitive abilities. Copyright © 2016 Society of Biological Psychiatry. All rights reserved.

  11. Reduction by the Positive Allosteric Modulator of the GABAB Receptor, GS39783, of Alcohol Self-Administration in Sardinian Alcohol-Preferring Rats Exposed to the “Sipper” Procedure

    Science.gov (United States)

    Maccioni, Paola; Flore, Paolo; Carai, Mauro A. M.; Mugnaini, Claudia; Pasquini, Serena; Corelli, Federico; Gessa, Gian Luigi; Colombo, Giancarlo

    2010-01-01

    The present study was designed to evaluate (a) alcohol self-administration behavior of selectively bred, Sardinian alcohol-preferring (sP) rats exposed to the so-called “sipper” procedure (characterized by the temporal separation between alcohol-seeking and -taking phases), and (b) the effect of the positive allosteric modulator of the GABAB receptor, GS39783, on alcohol self-administration in sP rats exposed to this procedure. To this end, sP rats were initially trained to lever-respond under a reinforcement requirement (RR) 55 (RR55) for alcohol. Achievement of RR55 resulted in the 20-min presentation of the alcohol (15%, v/v)-containing sipper bottle. Once stable levels of lever-responding and alcohol consumption were reached, rats were treated with 0, 25, 50, and 100 mg/kg GS39783 (i.g.) 60 min before the self-administration session. Rats displayed robust alcohol-seeking (as suggested by relatively short latencies to the first lever-response and high frequencies of lever-responding) and -taking (as suggested by alcohol intakes averaging approximately 1.5 g/kg) behaviors. Pretreatment with GS39783 inhibited both alcohol-seeking (the number of rats achieving RR55 and the mean RR value were virtually halved) and -taking (the amount of self-administered alcohol was reduced by approximately 60%). The results of the present study suggest the power of the “sipper” procedure in triggering high levels of alcohol-seeking and -taking behavior in sP rats. Further, these results extend to this additional procedure of alcohol self-administration the capacity of GS39783 to reduce the motivational properties of alcohol and alcohol consumption in sP rats. PMID:21423431

  12. Reduction by the positive allosteric modulator of the GABAB receptor, GS39783, of alcohol self-administration in Sardinian alcohol-preferring rats exposed to the “sipper” procedure

    Directory of Open Access Journals (Sweden)

    Paola Maccioni

    2010-07-01

    Full Text Available The present study was designed to evaluate (a alcohol self-administration behavior of selectively bred, Sardinian alcohol-preferring (sP rats exposed to the so-called “sipper” procedure (characterized by the temporal separation between alcohol-seeking and -taking phases, and (b the effect of the positive allosteric modulator of the GABAB receptor, GS39783, on alcohol self-administration in sP rats exposed to this procedure. To this end, sP rats were initially trained to lever-respond under a reinforcement requirement (RR 55 (RR55 for alcohol. Achievement of RR55 resulted in the 20-min presentation of the alcohol (15%, v/v-containing sipper bottle. Once stable levels of lever-responding and alcohol consumption were reached, rats were treated with 0, 25, 50, and 100 mg/kg GS39783 (i.g. 60 min before the self-administration session. Rats displayed robust alcohol-seeking (as suggested by relatively short latencies to the first lever-response and high frequencies of lever-responding and -taking (as suggested by alcohol intakes averaging approximately 1.5 g/kg behaviors. Pretreatment with GS39783 inhibited both alcohol-seeking (the number of rats achieving RR55 and the mean RR value were virtually halved and -taking (the amount of self-administered alcohol was reduced by approximately 60%. The results of the present study suggest the power of the “sipper” procedure in triggering high levels of alcohol-seeking and -taking behavior in sP rats. Further, these results extend to this additional procedure of alcohol self-administration the capacity of GS39783 to reduce the motivational properties of alcohol and alcohol consumption in sP rats.

  13. Simultaneous Decolorization and Biohydrogen Production from Xylose by Klebsiella oxytoca GS-4-08 in the Presence of Azo Dyes with Sulfonate and Carboxyl Groups

    Science.gov (United States)

    Cao, Ming-yue; Wang, Peng-tao; Wang, Shi; Yue, Ying-rong; Yuan, Wen-duo; Qiao, Wei-chuan; Wang, Fei

    2017-01-01

    ABSTRACT Biohydrogen production from the pulp and paper effluent containing rich lignocellulosic material could be achieved by the fermentation process. Xylose, an important hemicellulose hydrolysis product, is used less efficiently as a substrate for biohydrogen production. Moreover, azo dyes are usually added to fabricate anticounterfeiting paper, which further increases the complexity of wastewater. This study reports that xylose could serve as the sole carbon source for a pure culture of Klebsiella oxytoca GS-4-08 to achieve simultaneous decolorization and biohydrogen production. With 2 g liter−1 of xylose as the substrate, a maximum xylose utilization rate (URxyl) and a hydrogen molar yield (HMY) of 93.99% and 0.259 mol of H2 mol of xylose−1, respectively, were obtained. Biohydrogen kinetics and electron equivalent (e− equiv) balance calculations indicated that methyl red (MR) penetrates and intracellularly inhibits both the pentose phosphate pathway and pyruvate fermentation pathway, while methyl orange (MO) acted independently of the glycolysis and biohydrogen pathway. The data demonstrate that biohydrogen pathways in the presence of azo dyes with sulfonate and carboxyl groups were different, but the azo dyes could be completely reduced during the biohydrogen production period in the presence of MO or MR. The feasibility of hydrogen production from industrial pulp and paper effluent by the strain if the xylose is sufficient was also proved and was not affected by toxic substances which usually exist in such wastewater, except for chlorophenol. This study offers a promising energy-recycling strategy for treating pulp and paper wastewaters, especially for those containing azo dyes. IMPORTANCE The pulp and paper industry is a major industry in many developing countries, and the global market of pulp and paper wastewater treatment is expected to increase by 60% between 2012 and 2020. Such wastewater contains large amounts of refractory contaminants, such

  14. Impact of climate, vegetation, soil and crop management variables on multi-year ISBA-A-gs simulations of evapotranspiration over a Mediterranean crop site

    Science.gov (United States)

    Garrigues, S.; Olioso, A.; Carrer, D.; Decharme, B.; Calvet, J.-C.; Martin, E.; Moulin, S.; Marloie, O.

    2015-10-01

    Generic land surface models are generally driven by large-scale data sets to describe the climate, the soil properties, the vegetation dynamic and the cropland management (irrigation). This paper investigates the uncertainties in these drivers and their impacts on the evapotranspiration (ET) simulated from the Interactions between Soil, Biosphere, and Atmosphere (ISBA-A-gs) land surface model over a 12-year Mediterranean crop succession. We evaluate the forcing data sets used in the standard implementation of ISBA over France where the model is driven by the SAFRAN (Système d'Analyse Fournissant des Renseignements Adaptés à la Nivologie) high spatial resolution atmospheric reanalysis, the leaf area index (LAI) time courses derived from the ECOCLIMAP-II land surface parameter database and the soil texture derived from the French soil database. For climate, we focus on the radiations and rainfall variables and we test additional data sets which include the ERA-Interim (ERA-I) low spatial resolution reanalysis, the Global Precipitation Climatology Centre data set (GPCC) and the MeteoSat Second Generation (MSG) satellite estimate of downwelling shortwave radiations. The evaluation of the drivers indicates very low bias in daily downwelling shortwave radiation for ERA-I (2.5 W m-2) compared to the negative biases found for SAFRAN (-10 W m-2) and the MSG satellite (-12 W m-2). Both SAFRAN and ERA-I underestimate downwelling longwave radiations by -12 and -16 W m-2, respectively. The SAFRAN and ERA-I/GPCC rainfall are slightly biased at daily and longer timescales (1 and 0.5 % of the mean rainfall measurement). The SAFRAN rainfall is more precise than the ERA-I/GPCC estimate which shows larger inter-annual variability in yearly rainfall error (up to 100 mm). The ECOCLIMAP-II LAI climatology does not properly resolve Mediterranean crop phenology and underestimates the bare soil period which leads to an overall overestimation of LAI over the crop succession. The

  15. Physiological response of Pichia pastoris GS115 to methanol-induced high level production of the Hepatitis B surface antigen: catabolic adaptation, stress responses, and autophagic processes

    Science.gov (United States)

    2012-01-01

    Background Pichia pastoris is an established eukaryotic host for the production of recombinant proteins. Most often, protein production is under the control of the strong methanol-inducible aox1 promoter. However, detailed information about the physiological alterations in P. pastoris accompanying the shift from growth on glycerol to methanol-induced protein production under industrial relevant conditions is missing. Here, we provide an analysis of the physiological response of P. pastoris GS115 to methanol-induced high-level production of the Hepatitis B virus surface antigen (HBsAg). High product titers and the retention of the protein in the endoplasmic reticulum (ER) are supposedly of major impact on the host physiology. For a more detailed understanding of the cellular response to methanol-induced HBsAg production, the time-dependent changes in the yeast proteome and ultrastructural cell morphology were analyzed during the production process. Results The shift from growth on glycerol to growth and HBsAg production on methanol was accompanied by a drastic change in the yeast proteome. In particular, enzymes from the methanol dissimilation pathway started to dominate the proteome while enzymes from the methanol assimilation pathway, e.g. the transketolase DAS1, increased only moderately. The majority of methanol was metabolized via the energy generating dissimilatory pathway leading to a corresponding increase in mitochondrial size and numbers. The methanol-metabolism related generation of reactive oxygen species induced a pronounced oxidative stress response (e.g. strong increase of the peroxiredoxin PMP20). Moreover, the accumulation of HBsAg in the ER resulted in the induction of the unfolded protein response (e.g. strong increase of the ER-resident disulfide isomerase, PDI) and the ER associated degradation (ERAD) pathway (e.g. increase of two cytosolic chaperones and members of the AAA ATPase superfamily) indicating that potential degradation of HBsAg could

  16. GPR40 (FFAR1) – Combined Gs and Gq signaling in vitro is associated with robust incretin secretagogue action ex vivo and in vivo

    DEFF Research Database (Denmark)

    Pedersen, Maria Hauge; Bentsen, Marie Aare; Husted, Anna S

    2015-01-01

    OBJECTIVES: GPR40 (FFAR1), a clinically proven anti-diabetes target, is a Gq-coupled receptor for long chain fatty acids (LCFA) stimulating insulin secretion directly and mediating a major part of the dietary triglyceride-induced secretion of the incretins GLP-1 and GIP. In phase-II studies the GPR....... Nevertheless, both the Gq-only and the Gq + Gs agonists all docked surprisingly well into the binding site for TAK-875 in the X-ray structure of GPR40. In murine intestinal primary cell-cultures the endogenous LCFAs and the Gq-only agonists stimulated GLP-1 secretion with rather poor efficacy as compared...

  17. Carbon steel protection in G.S. (Girlder sulfide) plants. A protective layer formation in saturated solution of sulfohydric acid in water at pH = 4.43. Pt. 3

    International Nuclear Information System (INIS)

    Bruzzoni, P.; Burkart, A.L.; Garavaglia, R.N.

    1985-04-01

    As complement to the experiences on carbon steel passivation for its use in G.S. (Girlder sulfide) heavy water production plants, the results herein obtained are given, processing the material with a saturated solution at 2.3 MPa of full pressure and 125 temperature degree of H 2 S in NaOH 5 x 10 -3 M, which, at an equilibrium point, the pH is 4.43. The characteristics, the composition and adherence to the layer formed and the corrosion velocity data are analyzed. (Author) [es

  18. Ressenya a Grifoll, Isabel, Julián Acebrón, Flocel Sabaté (eds. (2014: Cartografies de l’ànima. Identitat, memòria i escriptura, Lleida, Pagès Editors, 2014, 248 pàgs. ISBN:978-84-9975-517-5; i Acebrón, Julián, Isabel Grifoll, Flocel Sabaté (eds. (2015: La Construcció d’identitats imaginades. Literatura medieval i ideologia, Lleida, Pagès Editors, 2015, 320 pàgs. ISBN:978-84-9975-704-9

    Directory of Open Access Journals (Sweden)

    Vicent Martines

    2016-12-01

    Full Text Available Review to Grifoll, Isabel, Julián Acebrón, Flocel Sabaté (eds. (2014: Cartografies de l’ànima. Identitat, memòria i escriptura, Lleida, Pagès Editors, 2014, 248 pàgs. ISBN:978-84-9975-517-5; and Acebrón, Julián, Isabel Grifoll, Flocel Sabaté (eds. (2015: La Construcció d’identitats imaginades. Literatura medieval i ideologia, Lleida, Pagès Editors, 2015, 320 pàgs. ISBN:978-84-9975-704-9

  19. Direct observations of Biogenic Volatile Organic Compound (BVOC) Air-Sea Exchange in the remote North Atlantic from the High-Wind Gas-Exchange Study (HiWinGS)

    Science.gov (United States)

    Kim, M.; Yang, M. X.; Blomquist, B.; Huebert, B. J.; Bertram, T. H.

    2014-12-01

    Biogenic Volatile Organic Compounds (BVOCs) are reactive trace gases that impact both chemistry and climate by regulating oxidant loadings, determining secondary organic aerosol production rates as well as altering particle hygroscopicity. While continental BVOC exchange rates are well studied, global marine flux estimates are poorly constrained. In Fall 2013, a chemical-ionization time-of-flight mass spectrometer (CI-ToF-MS) utilizing benzene cations was deployed as part of the High Wind Gas Exchange Study (HiWinGs) to quantify monoterpenes, isoprene and dimethylsulfide fluxes in the remote North Atlantic. Dimethylsulfide measurements are in strong agreement with those determined by the University of Hawaii's atmospheric pressure ionization mass-spectrometer. In the remote marine boundary layer, positive monoterpene fluxes (i.e. emissions) were observed while isoprene levels rarely exceeded the detection limit.

  20. K-SHELL PHOTOABSORPTION OF MAGNESIUM IONS

    Energy Technology Data Exchange (ETDEWEB)

    Hasoğlu, M. F. [Department of Computer Engineering, Hasan Kalyoncu University, 27100 Sahinbey, Gaziantep (Turkey); Abdel-Naby, Sh. A. [Department of Physics, Auburn University, Auburn, AL 36849 (United States); Gatuzz, E.; Mendoza, C. [Centro de Física, Instituto Venezolano de Investigaciones Científicas, Caracas 1020 (Venezuela, Bolivarian Republic of); García, J. [Harvard-Smithsonian Center for Astrophysics, MS-6, 60 Garden Street, Cambridge, MA 02138 (United States); Kallman, T. R. [NASA Goddard Space Flight Center, Greenbelt, MD 20771 (United States); Gorczyca, T. W. [Department of Physics, Western Michigan University, Kalamazoo, MI 49008-5252 (United States)

    2014-09-01

    X-ray photoabsorption cross sections have been computed for all magnesium ions with three or more electrons using the R-matrix method. A comparison with other available data for Mg II-Mg X shows good qualitative agreement in the resultant resonance shapes. However, for the lower ionization stages, and for singly ionized Mg II in particular, the previous R-matrix results overestimate the K-edge position due to the neglect of important orbital relaxation effects, and a global shift downward in photon energy of those cross sections is therefore warranted. We have found that the cross sections for Mg I and Mg II are further complicated by the M-shell (n = 3) occupancy. As a result, the treatment of spectator Auger decay of 1s → np resonances using a method based on multichannel quantum defect theory and an optical potential becomes problematic, making it necessary to implement an alternative, approximate treatment of Auger decay for neutral Mg I. The new cross sections are used to fit the Mg K edge in XMM-Newton spectra of the low-mass X-ray binary GS 1826-238, where most of the interstellar Mg is found to be in ionized form.

  1. Lab-scale preparations of Candida albicans and dual Candida albicans-Candida glabrata biofilms on the surface of medical-grade polyvinyl chloride (PVC) perfusion tube using a modified gravity-supported free-flow biofilm incubator (GS-FFBI).

    Science.gov (United States)

    Shao, Jing; Lu, KeQiao; Tian, Ge; Cui, YanYan; Yan, YuanYuan; Wang, TianMing; Zhang, XinLong; Wang, ChangZhong

    2015-02-01

    The assembly of a man-made gravity-supported free-flow biofilm incubator (GS-FFBI) was described, which was composed of a gas cushion injector and four incubators. The GS-FFBI had the characteristics of (i) a bottom-up flow direction, and (ii) lab-scale biofilm preparation without the use of a multichannel pump. Two opportunistic fungal strains, namely Candida albicans and Candida glabrata, were employed to incubate C. albicans and dual C. albicans-C. glabrata biofilms on the surface of medical-grade polyvinyl chloride perfusion tube. In terms of the results from {2, 3-bis (2-methoxy-4-nitro-5-sulfo-phenyl)-2H-tetrazolium-5-carboxanilide} (XTT) assay, dry weight measurement, colony-forming unit counting, susceptibility test, and scanning electron microscopy, it was demonstrated that GS-FFBI could form both stable single and dual Candida biofilms with no significant variations among the four incubators or the three daily incubations within 21h, and could operate for at least 96h smoothly with no contamination of stock medium. The results also indicated, for the first time, that C. albicans and C. glabrata might be co-existent competitively and symbiotically in the dual biofilms with flowing media. GS-FFBI would be a useful device to study in vitro morphological and physiological features of microbial biofilms in the medical settings. Copyright © 2014 Elsevier B.V. All rights reserved.

  2. [Smoļenskas-Rīgas aktis 13. gs.-14. gs. pirmā puse : kompleksa "Moscowitica-Ruthenica" dokumenti par Smoļenskas un Rīgas attiecībām = Смоленско-рижские акты XIII в.-первая половина XIV в. : документ�

    Index Scriptorium Estoniae

    Levans, Andris, 1968-

    2011-01-01

    Arvustus: Smoļenskas-Rīgas aktis 13. gs.-14. gs. pirmā puse : kompleksa "Moscowitica-Ruthenica" dokumenti par Smoļenskas un Rīgas attiecībām = Смоленско-рижские акты XIII в.-первая половина XIV в. : документы комплекса Moscowitica-Ruthenica об отношениях Смоленска и Риги /koostajad Leksanders Ivanovs, Anatolijs Kuzņcovs. Vēstures avoti ; 6 (Riga: Latvijas Valsts vēstures arcīva izdevniecība, 2009)

  3. X-ray bursters and the X-ray sources of the galactic bulge

    International Nuclear Information System (INIS)

    Lewin, W.H.G.; Joss, P.C.; Massachusetts Inst. of Tech., Cambridge; Massachusetts Inst. of Tech., Cambridge

    1981-01-01

    In this article we shall discuss the observed X-ray, optical, infrared and radio properties of the galactic bulge sources, with an emphasis on those that produce type I X-ray bursts. There is persuasive evidence that these burst sources and many other galactic bulge sources are neutron stars in low-mass, close-binary stellar systems. (orig./WL)

  4. Numerical simulation of the magnetospheric gate model for X-ray bursters

    Science.gov (United States)

    Starrfield, S. G.; Kenyon, S.; Truran, J. W.; Sparks, W. M.

    1981-01-01

    A Lagrangian, fully implicit, one dimensional hydrodynamic computer code was used to investigate the evolution of a gas cloud impacting the surface of a 20 km, 1 Msub solar neutron star. This gas is initially at rest with respect to the surface of the neutron star, extends to 185 km above the surface, and is optically thick. The infall results in a burst which lasts about 0.1 seconds and reached a peak luminosity and effective temperature of 240,000 Lsub solar and 9 million; respectively. The burst was followed by a phase of oscillations with a period 0.2 seconds.

  5. Canards in a minimal piecewise-linear square-wave burster

    Energy Technology Data Exchange (ETDEWEB)

    Desroches, M.; Krupa, M. [Inria Sophia-Antipolis Méditerranée Research Centre, MathNeuro Project-Team 2004 route des Lucioles BP 93, 06902 Valbonne Cedex (France); Fernández-García, S., E-mail: soledad@us.es [Departamento EDAN, University of Seville, Facultad de Matemáticas C/ Tarfia, s/n., 41012 Sevilla (Spain)

    2016-07-15

    We construct a piecewise-linear (PWL) approximation of the Hindmarsh-Rose (HR) neuron model that is minimal, in the sense that the vector field has the least number of linearity zones, in order to reproduce all the dynamics present in the original HR model with classical parameter values. This includes square-wave bursting and also special trajectories called canards, which possess long repelling segments and organise the transitions between stable bursting patterns with n and n + 1 spikes, also referred to as spike-adding canard explosions. We propose a first approximation of the smooth HR model, using a continuous PWL system, and show that its fast subsystem cannot possess a homoclinic bifurcation, which is necessary to obtain proper square-wave bursting. We then relax the assumption of continuity of the vector field across all zones, and we show that we can obtain a homoclinic bifurcation in the fast subsystem. We use the recently developed canard theory for PWL systems in order to reproduce the spike-adding canard explosion feature of the HR model as studied, e.g., in Desroches et al., Chaos 23(4), 046106 (2013).

  6. Numerical simulation of the magnetospheric gate model for the x-ray bursters

    International Nuclear Information System (INIS)

    Starrfield, S.G.; Kenyon, S.; Truran, J.W.; Sparks, W.M.

    1981-01-01

    A Lagrangian, fully implicit, one-dimensional hydrodynamic computer code was used to investigate the evolution of a gas cloud impacting the surface of a 20 km, 1 Msub solar neutron star. This gas is initially at rest with respect to the surface of the neutron star, extends to 185 km above the surface, and is optically thick. The infall results in a burst which lasts about 0.1 seconds and reaches a peak luminosity and effective temperature of 2.4 x 10 5 Lsub solar and 9 x 10 6 ; respectively. The burst was followed by a phase of oscillations with a period 0.2 seconds

  7. Swift follow-up of the newly discovered burster millisecond pulsar IGR J17511-3057

    DEFF Research Database (Denmark)

    Bozzo, E.; Ferrigno, C.; Kuulkers, E.

    2009-01-01

    Following the discovery of the new hard X-ray transient IGR J17511-3057 by INTEGRAL (Atel #2196) and its classification as a millisecond pulsar by RXTE (Atel #2197), a Swift ToO was performed. Swift/XRT observed IGR J17511-3057 on 2009-09-13 at 19:53:31 for a total exposure time of 4 ks. The first...

  8. Discovery and Synthesis of a Phosphoramidate Prodrug of a Pyrrolo[2,1-f][triazin-4-amino] Adenine C-Nucleoside (GS-5734) for the Treatment of Ebola and Emerging Viruses.

    Science.gov (United States)

    Siegel, Dustin; Hui, Hon C; Doerffler, Edward; Clarke, Michael O; Chun, Kwon; Zhang, Lijun; Neville, Sean; Carra, Ernest; Lew, Willard; Ross, Bruce; Wang, Queenie; Wolfe, Lydia; Jordan, Robert; Soloveva, Veronica; Knox, John; Perry, Jason; Perron, Michel; Stray, Kirsten M; Barauskas, Ona; Feng, Joy Y; Xu, Yili; Lee, Gary; Rheingold, Arnold L; Ray, Adrian S; Bannister, Roy; Strickley, Robert; Swaminathan, Swami; Lee, William A; Bavari, Sina; Cihlar, Tomas; Lo, Michael K; Warren, Travis K; Mackman, Richard L

    2017-03-09

    The recent Ebola virus (EBOV) outbreak in West Africa was the largest recorded in history with over 28,000 cases, resulting in >11,000 deaths including >500 healthcare workers. A focused screening and lead optimization effort identified 4b (GS-5734) with anti-EBOV EC 50 = 86 nM in macrophages as the clinical candidate. Structure activity relationships established that the 1'-CN group and C-linked nucleobase were critical for optimal anti-EBOV potency and selectivity against host polymerases. A robust diastereoselective synthesis provided sufficient quantities of 4b to enable preclinical efficacy in a non-human-primate EBOV challenge model. Once-daily 10 mg/kg iv treatment on days 3-14 postinfection had a significant effect on viremia and mortality, resulting in 100% survival of infected treated animals [ Nature 2016 , 531 , 381 - 385 ]. A phase 2 study (PREVAIL IV) is currently enrolling and will evaluate the effect of 4b on viral shedding from sanctuary sites in EBOV survivors.

  9. Saka, MG, Zarto, ST and Gawaisa, GS

    African Journals Online (AJOL)

    ALBARKA

    called Friends of the Earth has identified. Nigeria as one of the areas where tropical rain forest is being lost at the ... maintenance and utilization of the earth resources is no more than the combination of these two ancient ... are carried on hollow bases or pedicles and show considerable variation (45-83cm) from individual to ...

  10. Darlington GS vacuum building - containment shell

    International Nuclear Information System (INIS)

    Huterer, J.; Ha, E.C.; Brown, D.G.; Cheng, P.C.

    1985-01-01

    The paper describes the consequences of new design requirements for the Darlington vacuum building on its structural configuration, analytical and reinforcing steel layout. Attention focuses on the ring girder where the juncture of dome and perimeter wall produces a complex post-tensioning layout, and attendant difficulties in design and construction. At the wall base, full fixity imposes large local stresses. Long-term, shrinkage and creep, and temperature effects become significant. A research program and in-house analytical procedure established time-dependent concrete behaviour and corresponding wall-sectional stresses. The outcome is examined in terms of reinforcement, temperature controls, and wall liner requirements. (orig.)

  11. Performance evaluation of the Bio-Rad Laboratories GS HIV Combo Ag/Ab EIA, a 4th generation HIV assay for the simultaneous detection of HIV p24 antigen and antibodies to HIV-1 (groups M and O) and HIV-2 in human serum or plasma.

    Science.gov (United States)

    Bentsen, Christopher; McLaughlin, Lisa; Mitchell, Elizabeth; Ferrera, Carol; Liska, Sally; Myers, Robert; Peel, Sheila; Swenson, Paul; Gadelle, Stephane; Shriver, M Kathleen

    2011-12-01

    A multi-center study was conducted to evaluate the Bio-Rad GS HIV Combo Ag/Ab EIA, a 4th generation HIV-1/HIV-2 assay for the simultaneous detection of HIV p24 antigen and antibodies to HIV-1 (groups M and O) and HIV-2 in human serum or plasma in adult and pediatric populations. The objectives of the study were to assess assay performance for the detection of acute HIV infections; sensitivity in known HIV positive samples; percent agreement with HIV status; specificity in low and high risk individuals of unknown HIV status; and to compare assay performance to a 3rd generation HIV assay. The evaluation included testing 9150 samples at four U.S. clinical trial sites, using three kit lots. Unlinked samples were from routine testing, repositories or purchased from vendors. GS HIV Combo Ag/Ab EIA detection in samples from individuals in two separate populations with acute HIV infection was 95.2% (20/21) and 86.4% (38/44). Sensitivity was 100% (1603/1603) in known antibody positive [HIV-1 Groups M and O, and HIV-2] samples. HIV p24 antigen detection was 100% (53/53) in HIV-1 culture supernatants. HIV-1 seroconversion panel detection improved by a range of 0-20 days compared to a 3rd generation HIV test. Specificity was 99.9% (5989/5996) in low risk, 99.9% (959/960) in high risk and 100% (100/100) in pediatric populations. The GS HIV Combo Ag/Ab EIA significantly reduced the diagnostic window when compared to the 3rd generation screening assay, enabling earlier diagnosis of HIV infection. The performance parameters of the Bio-Rad GS HIV Combo Ag/Ab EIA are well suited for use in HIV diagnostic settings. Copyright © 2011 Elsevier B.V. All rights reserved.

  12. Performance comparison of the 4th generation Bio-Rad Laboratories GS HIV Combo Ag/Ab EIA on the EVOLIS™ automated system versus Abbott ARCHITECT HIV Ag/Ab Combo, Ortho Anti-HIV 1+2 EIA on Vitros ECi and Siemens HIV-1/O/2 enhanced on Advia Centaur.

    Science.gov (United States)

    Mitchell, Elizabeth O; Stewart, Greg; Bajzik, Olivier; Ferret, Mathieu; Bentsen, Christopher; Shriver, M Kathleen

    2013-12-01

    A multisite study was conducted to evaluate the performance of the Bio-Rad 4th generation GS HIV Combo Ag/Ab EIA versus Abbott 4th generation ARCHITECT HIV Ag/Ab Combo. The performance of two 3rd generation EIAs, Ortho Diagnostics Anti-HIV 1+2 EIA and Siemens HIV 1/O/2 was also evaluated. Study objective was comparison of analytical HIV-1 p24 antigen detection, sensitivity in HIV-1 seroconversion panels, specificity in blood donors and two HIV false reactive panels. Analytical sensitivity was evaluated with International HIV-1 p24 antigen standards, the AFFSAPS (pg/mL) and WHO 90/636 (IU/mL) standards; sensitivity in acute infection was compared on 55 seroconversion samples, and specificity was evaluated on 1000 negative blood donors and two false reactive panels. GS HIV Combo Ag/Ab demonstrated better analytical HIV antigen sensitivity compared to ARCHITECT HIV Ag/Ab Combo: 0.41 IU/mL versus 1.2 IU/mL (WHO) and 12.7 pg/mL versus 20.1 pg/mL (AFSSAPS); GS HIV Combo Ag/Ab EIA also demonstrated slightly better specificity compared to ARCHITECT HIV Ag/Ab Combo (100% versus 99.7%). The 4th generation HIV Combo tests detected seroconversion 7-11 days earlier than the 3rd generation HIV antibody only EIAs. Both 4th generation immunoassays demonstrated excellent performance in sensitivity, with the reduction of the serological window period (7-11 days earlier detection than the 3rd generation HIV tests). However, GS HIV Combo Ag/Ab demonstrated improved HIV antigen analytical sensitivity and slightly better specificity when compared to ARCHITECT HIV Ag/Ab Combo assay, with higher positive predictive values (PPV) for low prevalence populations. Copyright © 2013 Elsevier B.V. All rights reserved.

  13. Darlington GS vacuum building - internal structures and foundation

    International Nuclear Information System (INIS)

    Huterer, J.; Brown, D.G.; Yanchula, S.

    1985-01-01

    This paper describes the evolution of the internal structure from initial concept to final design. Fundamental changes to the original configuration were precipitated by the action of large seismic forces acting on a top-heavy configuration. Prestressing was eliminated in deference to high humidity. Aspects of the elevated water tank's peripheral support beam are discussed vis-a-vis an adjacent slipforming operation, and practical construction limitations on steel placement. Also reviewed are the shortening of peripheral columns due to shrinkage and creep, and considerations of crack control for purposes of water-tightness. The authors justify the choice of stainless steel for fabrication of the siphon system's riser pipes. The foundation slab must resist the combined effects of vacuum pressure, hydrostatic uplift, and the seismic reactions of the internal structure and perimeter wall. The dependency of a key foundation component, the gallery roof slab, on the dome tendon layout is high-lighted; and aspects of its constructability are reviewed in light of congestion of vertical tendon anchorages, and of reinforcement. The design of the air-tight slab liner is reviewed, attention focusing on weld design under vacuum and accident temperature loads; on corrosion protection; and on the related construction access bulkhead - its ASME requirements and fabrication tolerances. (orig.)

  14. Case report 432: Granulocytic sarcoma (GS), with hypereosinophilic syndrome (HES)

    Energy Technology Data Exchange (ETDEWEB)

    Xipell, J M; Beamish, M R; Clark, D

    1987-07-01

    A case is presented of a 28-year-old man with a history of the hypereosinophilic syndrome, who subsequently developed granulocytic sarcoma of the tibia which proved resistant to aggressive therapy. He ultimately developed acute myeloid leukemia which also was resistant to therapy. The disease process was characterized by localised skeletal pain, the development of lytic lesions in several areas of the skeleton and progression to frank myeloid leukemia. (orig./SHA).

  15. GS IGBO: BETTER LATE THAN THE LATE Longinus Chukwuemeka ...

    African Journals Online (AJOL)

    JONATHAN

    The genesis of the university studies sprang from the insatiable human cravings ... who are academically and professionally mature and attend self determination and .... Ahumibe,C.(2002) Philosophizing in Education: A Beginers Handbook.

  16. Heavy water GS process R and D achievements

    International Nuclear Information System (INIS)

    Bancroft, A.R.

    1978-10-01

    R and D support of Canadian heavy water production plants during the past five years has involved mainly AECL and Ontario Hydro, and their contractors. Testing has been done in the production plants, in two pilot plants and in research laboratories on topics that include sieve tray design, in-plant behaviour of oil and sulfur and choice of antifoam agent to control excessive foaming. The benefits are increased production through higher plant flows and higher extraction of deuterium from the feed, less down time because of process problems and lower cost for materials used to control water chemistry. (author)

  17. An extended GS method for dense linear systems

    Science.gov (United States)

    Niki, Hiroshi; Kohno, Toshiyuki; Abe, Kuniyoshi

    2009-09-01

    Davey and Rosindale [K. Davey, I. Rosindale, An iterative solution scheme for systems of boundary element equations, Internat. J. Numer. Methods Engrg. 37 (1994) 1399-1411] derived the GSOR method, which uses an upper triangular matrix [Omega] in order to solve dense linear systems. By applying functional analysis, the authors presented an expression for the optimum [Omega]. Moreover, Davey and Bounds [K. Davey, S. Bounds, A generalized SOR method for dense linear systems of boundary element equations, SIAM J. Comput. 19 (1998) 953-967] also introduced further interesting results. In this note, we employ a matrix analysis approach to investigate these schemes, and derive theorems that compare these schemes with existing preconditioners for dense linear systems. We show that the convergence rate of the Gauss-Seidel method with preconditioner PG is superior to that of the GSOR method. Moreover, we define some splittings associated with the iterative schemes. Some numerical examples are reported to confirm the theoretical analysis. We show that the EGS method with preconditioner produces an extremely small spectral radius in comparison with the other schemes considered.

  18. Behind the scenes of GS: Mapping the future of CERN

    CERN Multimedia

    Sophie Louise Hetherton

    2014-01-01

    Focus on the Future Accelerator Studies (FAS) section at CERN who carry out the civil engineering studies for the Laboratory’s future scientific facilities.   The Future Accelerator Studies (FAS) section co-ordinates the civil engineering and infrastructure studies for large-scale future physics projects. These include projects due to complete in a couple of years such as AWAKE, but also projects planned for ten years’ time such as the High Luminosity LHC (HL-LHC) or even longer term projects such as the Future Circular Collider (FCC), for which approval is still pending. “CERN needs to be able to study the feasibility and assess the risks of future projects, even though they are not all fully approved,” explains John Osborne, Head of the FAS section, which also includes two fellows and one technical student. “Our small team works closely with other groups across CERN and with external companies to provide studies from a civil engineering poin...

  19. Point Lepreau G.S. commissioning management experience

    International Nuclear Information System (INIS)

    Alikhan, S.; Walker, W.J.

    1983-05-01

    This paper shares the experience gained by New Brunswick Power in commissioning its first nuclear plant, with particular emphasis on the management techniques that were developed. Some of the areas discussed include: organization of Nuclear Operations Group responsible for commissioning and its interface with construction; outline and scope of documentation required to define, execute and report commissioning to satisfy the licensing requirements, management techniques developed to implement commissioning; and a summary of lessons learned and recommendations for the future

  20. Behind the scenes of GS: CERN’s beating heart

    CERN Multimedia

    Antonella Del Rosso

    2014-01-01

    Founded at the same time as CERN, the library has followed, and sometimes even moved ahead of, the changes in the Organization. Today, far from being a simple book depository, the Scientific Information Service (SIS) that manages CERN's library is increasingly digitising its material and investing in innovative projects, such as Open Access.   Ever since it was set up in Building 52 on 1 September 1957, the library has played a vital role in the Organization.  “Our only official task is to provide a complete list of the publications by CERN researchers, but, in fact, this place is the memory bank of the whole Laboratory,” emphasises Tullio Basaglia, head of the Library Section within SIS.  “The role of the library and archives is to preserve, document and disseminate the knowledge produced at CERN.” Sixty years after its creation, the library today contains 90,000 books, two thirds of which are available in a digital ...

  1. SSCI 125 emulation of Point Lepreau G.S

    International Nuclear Information System (INIS)

    MacLean, M.; Hogg, J.; Newman, H.; Thompson, H.

    1997-01-01

    A C language program has been developed at the Point Lepreau Nuclear Generating Station which emulates the actions of an SSCI 125 computer's instruction set and also emulates the actions of those input and output devices which belong to the plant control computer of the nuclear power plant's full scope training simulator. This enables the same DCC software to run on both the $20 million dollar training simulator and an equivalent desktop simulator whose hardware cost is now $16,000 or less. It facilitates making additional copies of the $20 million dollar training simulator for less than 0.1% of the cost per copy. When this emulation program is run on a 266 MHz DEC single CPU Alpha computer, it simulates the running of the training simulator plant control DCC (digital control computer) at approximately the rate of real time: either faster or slightly slower depending on the compiler options employed and depending on the choice of the modeled machine cycle speed of the SSCI. Using the standard machine cycle speed of 660 nanoseconds, using the emulator fully optimized and using plant process modelling without optimization the speed is 90% as fast as real time - this is the normal use situation for simulator modelers who were the originally intended users of the emulator. If the modeled SSCI machine cycle speed is slowed down to 792 nanoseconds (making use of space capacity on the real SSCI to reduce the workload of emulation), and all objects are compiled as optimized, then it takes only about 20 minutes of clock time to simulate over 30 minutes of modelling time. This mode of simulation may be useful for somebody who is not doing emulator or modeling code development. This could include preparing lesson plans for the training simulator, developing or evaluating plant operating procedures or trying out revised DCC software. (DM)

  2. FRENCH LANGUAGE: A BASIC G.S COURSE FOR NNAMDI ...

    African Journals Online (AJOL)

    JONATHAN

    2016-07-01

    Jul 1, 2016 ... Presently in Nnamdi Azikiwe University (NAU), apart from students majoring in French .... Oyo states that the inclusion of French language into the general studies ... securing a job in the labour market that is already saturated.

  3. Page 1 OMUMŲ OMENALA IGBO NA NGALABA GS NKE ...

    African Journals Online (AJOL)

    JONATHAN

    N' [kwado nke a, Fafunwa (197. Agbxrx qbxla n'agbanyghſ etu ha ha ibu nwere usoro ha si azxlite ma na akxziri xmxntak[r[ ha na nd[ ntorob[a ha ihe, izxlite xmxaka n'obibi ndx d[ ara ya anagh[ abx otu n'agbxrx niile. Nkowa Omenala: E nwere ike ikowa omenala n'uzo dį iche iche. Nke a bų ufodụ nkowa ndị mmadụ nyere.

  4. Molecular Characterization of 2-Chlorobiphenyl Degrading Stenotrophomonas maltophilia GS-103

    Digital Repository Service at National Institute of Oceanography (India)

    Somaraja, P.K.; Gayathri, D.; Ramaiah, N.

    York 2013 Abstract The catabolic potential of transformer oil con- taminated soil bacteria in aerobic degradation of poly- chlorinated biphenyls (PCB) were assessed. Transformer oil contaminated soil sample was subjected to microcosm enrichment..., high insulation property, high fat solubility and low volatility, PCB have been used for several decades in a wide range of industrial applications such as oil in transformers, Con- ductor of heat, dielectrics in capacitors, solvents for paints...

  5. Supplementary report: cooling water systems for Darlington G.S

    International Nuclear Information System (INIS)

    1975-08-01

    This report summarizes Ontario Hydro's existing aquatic environmental programs, presents results of these investigations, and outlines plans and activities for expanded aquatic environment studies including the evaluation of alternative cooling systems. This report outlines specific considerations regarding possible alternative cooling arrangements for the Darlington station. It concludes with a recommendation that a study be initiated to examine the potential benefits of using the heated discharge water in a warm water recreational centre. (author)

  6. The attached algal community near Pickering GS: (II)

    International Nuclear Information System (INIS)

    McKinley, S.R.

    1982-01-01

    Environmental parameters correlated with attached algal standing crop are investigated in this report. Three groups were recognized on the basis of standing crop levels and seasonal standing crop patterns. Factors which appeared to influence the separation among the three groups were substrate size and water temperature. Standing crop levels among the discharge transects, intake and areas outside the station were found to be correlated with a combination of parameters. Standing crop levels outside the station were inversely correlated with wind speed but positively correlated with substrate particle size and depth. Algal standing crop at the intake also was inversely correlated with wind speed. Differences in standing crop levels between the intake and areas outside the station may have been attributed to substrate particle size. Low standing crop level among the discharge transects may have been attributed to higher current velocities and periodically to high water temperature

  7. Behind the scenes of GS: health in the workplace

    CERN Multimedia

    CERN Bulletin

    2014-01-01

    CERN has had its own Medical Service since 1965. Open to members of the personnel, users and visitors, the team offers care and advice with professionalism and commitment.   The Medical Service team, currently consisting of three doctors, four nurses, a lab technician, a psychologist and two administrative assistants, provides an ever-increasing number of consultations. In 2013, around 7800 people were seen by the Medical Service, mainly at walk-in consultations, and more than 6665 further tests were performed (e.g. electrocardiograms, hearing tests, lung function tests, urine tests, blood tests). While its chief objective is to monitor the health of the CERN community in relation to their work through regular medical check-ups, the Medical Service also performs an important primary care function: “More than 10,000 people work in CERN’s offices, workshops, tunnels and worksites every day. As in any community of that size, sometimes certain situations arise that demand imme...

  8. The attached algae community near Pickering GS: III

    International Nuclear Information System (INIS)

    McKinley, S.R.

    1982-01-01

    The relationship between attached algae and macro-invertebrates in the nearshore zone of Lake Ontario was investigated in the vicinity of the Pickering 'A' NGS. Measures of faunal density, richness, evenness, and biomass were generally higher from areas which supported attached algae. Gammarus fasciatus, Cricotopus bicinctus, Dicrotendipes spp., Orthocladius obumbratus, Cladotanytarsus spp., Orthocladius spp., and Parakiefferiella spp., were significantly correlated with algal standing crop. All of the above dominant invertebrates ingested epiphytes associated with Cladophora glomerata. Attempts to explain the distribution of the zoobenthic assemblages using the physical/biological characteristics of the study area indicated algal cover, substrate size, wind velocity and water temperature were most important

  9. Behind the scenes of GS: cross-platform

    CERN Multimedia

    Katarina Anthony

    2014-01-01

    The year was 1989: the dawn of administrative computing. In a laboratory filled to the rafters with paperwork, CERN's then Director-General Carlo Rubbia saw an opportunity for a complete administrative overhaul. He established the Advanced Information Systems (AIS) project to analyse CERN's administration, which in turn suggested the Electronic Document Handling (EDH) system. By 1992, EDH was up and running - the start of a new chapter in CERN history.   If you think you've never come accross EDH, think again. The system is an integral part of CERN life, handling everything from the purchase of materials to leave requests. EDH sees you through your entire CERN life: from your first CERN job application to your final retirement checklist. One platform, sixty-five functions What makes EDH so special is its solitary nature: it is one platform that carries out dozens of varied functions. "Most companies organise their administration in 'vertical' ...

  10. Measurement of the inelastic branch of the stellar 14O(α,p)17F reaction occurring in the explosive burning in Novae and X-ray bursters

    International Nuclear Information System (INIS)

    He, J.J.; Woods, P.J.; Davinson, T.; Aliotta, M.; Buescler, J.; Clement, E.; Delahaye, P.; Hass, M.; Jenkins, D.G.; Kumar, V.; Murphy, A.St.J.; Neyskens, P.; Raabe, R.; Robinson, A.P.; Walle, J. van der; Warr, N.; Wenander, F.

    2010-01-01

    The inelastic component of the key astrophysical resonance (1 - , E x =6.15 MeV) in the 14 O(α,p) 17 F reaction has been studied by using the resonant scattering of 17 F+p. The experiment was done at REX-ISOLDE CERN with the Miniball setup. The thick target method in inverse kinematics was utilized in the present experiment where a 44.2 MeV 17 F beam bombarded a∼40μm thick (CH 2 ) n target. The inelastic scattering protons in coincidence with the de-excited 495 keV γ rays have been clearly seen and they are from the inelastic branch to the first excited state in 17 F following decay of the 1 - resonance in 18 Ne. Some preliminary results are reported.

  11. Tribunale di Palermo - sezione lavoro Ord. 11 aprile 2013, dr Soffientini MM contro GS

    Directory of Open Access Journals (Sweden)

    Calogero Massimo Cammalleri

    2013-07-01

    Full Text Available Lavoro (controversie – area della tutela obbligatoria - licenziamento orale intimato prima del­l'entrata in vigore della legge n. 92 del 2012 - giudizio in­staurato successivamen­te – nuovo rito - applicabilità.* Lavoro (rapporto – licenziamento orale intimato prima del­l'entrata in vigore della leg­ge n. 92 del 2012 – giudizio in­staurato successivamente – art. 18 nuovo testo – applicabili­tà – esclusione.* Lavoro (controversie – lavoro irregolare – differenze retributive connesse all'accerta­mento della natura del rapporto - inammissibilità.* Lavoro (controversie – area della tutela obbligatoria - licenziamento orale intimato prima del­l'entrata in vigore della legge n. 92 del 2012 – mera domanda di condanna al pa­gamento dell'indennità ex art. 8 della l. n. 604 del 1966 – irrilevanza – offerta della pre­stazione – necessità – invito alla reintegrazione – insufficienza – domanda giudiziale di pagamento dell'indennità risarcitoria – irrilevanza – conseguenze – carenza di interesse ad agire – rigetto nel merito .* Alla controversia di impugnazione del licenziamento, il cui ricorso sia stato depositato suc­cessivamente all'entrata in vigore della legge n. 92 del 2012, si applica il nuovo rito speciale, ancorché il licenziamento si sia perfezionato in data anteriore e ancorchè sia assoggettato alla tutela obbligatoria. * L'inefficacia del licenziamento privo del requisito della forma scritta non comporta l'auto­matico riconoscimento, in capo al prestatore di lavoro, del diritto alla corresponsione delle retribuzioni non percepite in seguito alla interruzione di fatto del rapporto contrattuale. Poi­ché non integrano costituzione in mora accipiendi né l'impugnazione del licenziamento con la richiesta stragiudiziale di essere reintegrato, né la domanda giudiziale di condanna all'inden­nità ex art. 8 della legge n.604 del 1966 quest'ultima domanda deve essere rigettata. * La domanda del ricorrente, con riferimento all'accertamento presupposto della natura su­bordinata del rapporto, volta alla corresponsione delle differenze retributive, deve esser di­chiarata inammissibile, atteso che l'art. 1, comma 48 dispone che con il ricorso non possono essere proposte domande diverse da quelle di cui al comma 47 del presente articolo (salvo che siano fondate sugli identici fatti costitutivi

  12. Femtosecond Resolution Timing in Multi-GS/s Waveform Digitizing ASICs

    Science.gov (United States)

    Orel, Peter; Varner, Gary S.

    2017-07-01

    A waveform digitizer with high-resolution timing provides with the possibility of a novel approach to vertex detectors for high-luminosity particle colliders. Present efforts are centered on the development of an application specific integrated circuit (ASIC) intended to measure signal arrival times with timing resolution in the range of 100 fs or less. The design of such an ASIC requires very good understanding of the effects that impact the timing resolution. This paper presents the simulation results that clearly identify and quantify the sources of error and the underlying coupling mechanisms. In addition, a synthetic waveform generator, developed solely for this purpose, is presented and validated through the measurement results. Crucial knowledge, insights, and confidence have been gained for the development of the ASIC or any other fast, wideband RF systems that aim to achieve such performance.

  13. Review of the stoping problem - GS Review of past work rockbreaking

    CSIR Research Space (South Africa)

    Pickering, RGB

    1988-03-01

    Full Text Available supplemented by studies of work carried out by others, both in South Africa and overseas. The document has been prepared as part of a process of critically reviewing what progress has been made in solving the stoping problem and forms the basis for determining...

  14. A 4 GS/sec Instability Feedback Processing System for Intra-bunch Instabilities

    CERN Document Server

    Dusatko, J; Fox, J D; Pollock, K; Rivetta, C H; Turgut, O; Hofle, W

    2013-01-01

    We present the architecture and implementation overview of a proof-of-principle digital signal processing system developed to study control of Electron-Cloud and Transverse Mode Coupling Instabilities (TMCI) in the CERN SPS. This system is motivated by intensity increases planned as part of the High Luminosity LHC upgrade. It is based on a reconfigurable processing architecture which samples intra-bunch motion and applies correction signals at a 4GSa/s rate, allowing multiple samples across a single 3.2ns SPS bunch. This initial demonstration system is a rapidly developed prototype consisting of both commercial and custom- designed hardware that implements feedback control on a single bunch. It contains a high speed ADC and DAC, capable of sampling at up to 4GSa/s, with a 16-tap FIR control filter for each bunch sample slice. Other system features include a timing subsystem to synchronize the sampling to the injection and the bunch 1 markers, the capability of generating arbitrary time domain signals to drive...

  15. MASTER OPTICAL POLARIZATION VARIABILITY DETECTION IN THE MICROQUASAR V404 CYG/GS 2023+33

    Energy Technology Data Exchange (ETDEWEB)

    Lipunov, Vladimir M.; Kornilov, V.; Vlasenko, D. [M.V. Lomonosov Moscow State University, Physics Department, Leninskie gory, GSP-1, Moscow, 119991 (Russian Federation); Gorbovskoy, E.; Tiurina, N.; Balanutsa, P.; Kuznetsov, A. [M.V. Lomonosov Moscow State University, Sternberg Astronomical Institute, Universitetsky pr., 13, Moscow, 119234 (Russian Federation); Krushinskiy, V. [Kourovka Astronomical Observatory, Ural Federal University, Lenin ave. 51, Ekaterinburg 620000 (Russian Federation); Budnev, N.; Gress, O.; Ivanov, K.; Yazev, S. [Applied Physics Institute, Irkutsk State University, 20, Gagarin blvd, 664003, Irkutsk (Russian Federation); Tlatov, A. [Kislovodsk Solar Station of the Main (Pulkovo) Observatory RAS, P.O. Box 45, ul. Gagarina 100, Kislovodsk 357700 (Russian Federation); Rebolo Lopez, R.; Serra-Ricart, M.; Israelyan, G.; Lodieu, N. [Instituto de Astrofsica de Canarias, C/Via Lctea, s/n E-38205, La Laguna, Tenerife (Spain); Buckley, D. A. H. [South African Astronomical Observatory, P.O. Box 9, Observatory 7935, Cape Town (South Africa); Sergienko, Yu.; Gabovich, A. [Blagoveschensk State Pedagogical University, Lenin str., 104, Amur Region, Blagoveschensk 675000 (Russian Federation); and others

    2016-12-20

    On 2015 June 15, the Swift space observatory discovered that the Galactic black hole candidate V404 Cyg was undergoing another active X-ray phase, after 25 years of inactivity. The 12 telescopes of the MASTER Global Robotic Net located at six sites across four continents were the first ground-based observatories to start optical monitoring of the microquasar after its gamma-ray wake up at 18{sup h} 34{sup m} 09{sup s} U.T. on 2015 June 15. In this paper, we report, for the first time, the discovery of variable optical linear polarization, changing by 4%–6% over a timescale of ∼1 hr, on two different epochs. We can conclude that the additional variable polarization arises from the relativistic jet generated by the black hole in V404 Cyg. The polarization variability correlates with optical brightness changes, increasing when the flux decreases.

  16. A study of stress in medical students at Seth G.S. Medical College.

    Directory of Open Access Journals (Sweden)

    Supe A

    1998-01-01

    Full Text Available BACKGROUND: It is usually observed that medical students undergo tremendous stress during various stages of the MBBS course. There is a high rate of suicide among them. METHODS: To determine incidence of stress and factors controlling stress in medical students at various stages of MBBS course at Seth G S Medical college, 238 students (First year 98, Second 76, Third 64 were asked to complete a questionnaire on personal data (gender, stay at hostel, mode of travel, time spent in travel every day, medium of study in school, place of school education., Stress inducing factors, Zung′s depression scale, ways of coping, stress relievers, perceived social support and personality type. Statistical tests used were ANOVA, critical ratio and Student′s ′t′ test. RESULTS: Majority of medical students (175/238--73% perceived stress. Stress was found to be significantly more in Second and Third MBBS students rather than First MBBS levels (p < 0.05. Stress was not found to differ significantly on the basis of sex, stay at hostel, model of travel, time spent in travel every day, medium of study in school, place of school education. Stress was found to be significantly more in students having more than 95% of marks at 12th Standard as compared to others. Academic factors were greater perceived cause of stress in medical students. There was no significant difference in the students at different levels of MBBS regarding academic factors and social factors as a stress inducing factors. Physical factors were found to be significantly more in Second and Third MBBS students as compared to First MBBS students. Emotional factors were found to be significantly more in First MBBS students as compared to Second & Third MBBS students. Stress was more common in medical students who have dominant strategy of coping as positive reappraisal, accepting responsibility and planful problem solving. Stress was less common in medical students at Seth G S Medical College who have dominant strategy of coping as escaping and distancing from difficult situation. Family and Friend as perceived social supports were more in Second MBBS than First MBBS medical students. Stress was not found to be significantly more in students having their personality factor contributing to stress (Type A--52/67 as compared to others (Type B--123/171. This indicates that the stress was not trait oriented but was process oriented (p = NS. CONCLUSION: Stress in medical students is common and is process oriented. It is more in second and third year. Academic factors are greater perceived cause of stress in medical students at Seth G S medical college. Emotional factors are found to be significantly more in First MBBS. It is dependent on person′s ways of coping and social support.

  17. Enhancing the Professionalism of Purchasing Agents (GS 1105s) within the Department of the Army.

    Science.gov (United States)

    1987-09-01

    automated small purchase process offers distinct advantages, as well as cost savings in both time and money , for activities with a large volume of small...resident) Massasoit Northeast $1,888 $6,400 Boston, MA Broward Southeast 1,327 2,765 Ft. Lauder - dale, FL Rock Valley Midwest 1,728 7,552 Rockford, IL De

  18. Natural analogue synthesis report, TDR-NBS-GS-000027 REV00 ICN02

    International Nuclear Information System (INIS)

    Simmons, A.; Nieder-Westermann, G.; Stuckless, J.; Dobson, P.; Unger, A.J.A.; Kwicklis, E.; Lichtner, P.; Carey, B.; Wolde, G.; Murrel, M.; Kneafsey, T.J.; Meijer, A.; Faybishenko, B.

    2002-01-01

    The purpose of this report is to present analogue studies and literature reviews designed to provide qualitative and quantitative information to test and provide added confidence in process models abstracted for performance assessment (PA) and model predictions pertinent to PA. This report provides updates to studies presented in the Yucca Mountain Site Description (CRWMS M and O 2000 [151945], Section 13) and new examples gleaned from the literature, along with results of quantitative studies conducted specifically for the Yucca Mountain Site Characterization Project (YMP). The intent of the natural analogue studies was to collect corroborative evidence from analogues to demonstrate additional understanding of processes expected to occur during postclosure at a potential Yucca Mountain repository. The report focuses on key processes by providing observations and analyses of natural and anthropogenic (human-induced) systems to improve understanding and confidence in the operation of these processes under conditions similar to those that could occur in a nuclear waste repository. The process models include those that represent both engineered and natural barrier processes. A second purpose of this report is to document the various applications of natural analogues to geologic repository programs, focusing primarily on the way analogues have been used by the YMP. This report is limited to providing support for PA in a confirmatory manner and to providing corroborative inputs for process modeling activities. Section 1.7 discusses additional limitations of this report. Key topics for this report are analogues to emplacement drift degradation, waste form degradation, waste package degradation, degradation of other materials proposed for the engineered barrier, seepage into drifts, radionuclide flow and transport in the unsaturated zone (UZ), analogues to coupled thermal-hydrologic-mechanical-chemical processes, saturated zone (SZ) transport, impact of radionuclide release on the biosphere, and potentially disruptive events. Results of these studies will be used to corroborate estimates of the magnitude and limitation of operative processes in order to build realism into conceptual and numerical process models used as a foundation for PA in the representative case of postclosure safety

  19. Eksempler på struktureringer i Kurtágs musik

    DEFF Research Database (Denmark)

    Nielsen, Svend Hvidtfelt

    2004-01-01

    Gennem analyse af en sats fra 12 Mikroludier for strygekvartet samt "...quasi una fantasia" påvises måder hvorpå Kurtag strukturerer sin musik.......Gennem analyse af en sats fra 12 Mikroludier for strygekvartet samt "...quasi una fantasia" påvises måder hvorpå Kurtag strukturerer sin musik....

  20. Exploring Bacterial Diversity in Hospital Environments by GS-FLX Titanium Pyrosequencing

    OpenAIRE

    Poza, Margarita; Gayoso, Carmen; Gómez, Manuel J.; Rumbo-Feal, Soraya; Tomás, María; Aranda, Jesús; Fernández, Ana; Bou, Germán

    2012-01-01

    Understanding microbial populations in hospital environments is crucial for improving human health. Hospital-acquired infections are an increasing problem in intensive care units (ICU). In this work we present an exploration of bacterial diversity at inanimate surfaces of the ICU wards of the University Hospital A Coruña (Spain), as an example of confined hospital environment subjected to selective pressure, taking the entrance hall of the hospital, an open and crowded environment, as referen...

  1. Pickering G.S. boiler repair: an example of planned maintenance

    International Nuclear Information System (INIS)

    Dalrymple, D.G.

    1976-04-01

    The first application of boiler repair tools and procedures is estimated to have yielded a four-fold return on the development investment. The need to develop such technology is a result of the environment in which boiler repairs must be made. As nuclear technology evolves and plants and components get bigger, equipment will increasingly have to be repaired in situ with minimum plant downtime and minimum exposure of repair personnel to radiation. This lecture traces development of the Pickering A boiler repair capability which is seen as an example of how utility and contractor should interact to anticipate and meet maintenance requirements. (author)

  2. AECB staff annual report of Point Lepreau G.S. for the year 1990

    International Nuclear Information System (INIS)

    1991-05-01

    This report is a review by AECB staff of the operation of Point Lepreau Nuclear Generating Station during 1990. The review is based on information contained in the various documents submitted by New Brunswick Power under the terms of the Operating Licence and on information gathered by AECB staff during routine site monitoring, inspections and audits

  3. Muscarinic M2 receptors directly activate Gq/11 and Gs G-proteins

    Czech Academy of Sciences Publication Activity Database

    Michal, Pavel; El-Fakahany, E. E.; Doležal, Vladimír

    2007-01-01

    Roč. 320, č. 2 (2007), s. 607-614 ISSN 0022-3565 R&D Projects: GA ČR GP305/05/P209; GA ČR GA305/05/0452; GA MŠk(CZ) LC554 Grant - others:NIH(US) NS25743 Institutional research plan: CEZ:AV0Z50110509 Keywords : muscarinic * siRNA * G-proteins Subject RIV: CE - Biochemistry Impact factor: 4.003, year: 2007

  4. Carbon steel protection in G.S. [Girldler sulphide] plants: Pt.9

    International Nuclear Information System (INIS)

    Rojo, Enrique.

    1990-01-01

    In heavy water plants that use the bithermal exchange H 2 S-H 2 O, a protective scale against corrosion is formed by the action of a solution of H 2 S at high temperature for a tile between 10 to 14 days. Exposure to humid air during plant shutdown produces an oxidation of the scale. The reexposure to the H 2 S-H 2 O at low temperature do not regenerate the original properties of the scale. It was concluded that a relative humidity of 50 % was enough to exclude the oxidation for a period of several months. (Author) [es

  5. Advances in animal cell recombinant protein production: GS-NS0 expression system.

    Science.gov (United States)

    Barnes, L M; Bentley, C M; Dickson, A J

    2000-02-01

    The production of recombinant proteins using mammalian cell expression systems is of growing importance within biotechnology, largely due to the ability of specific mammalian cells to carry out post-translational modifications of the correct fidelity. The Glutamine Synthetase-NS0 system is now one such industrially important expression system.Glutamine synthetase catalyses the formation ofglutamine from glutamate and ammonia. NS0 cellscontain extremely low levels of endogenous glutaminesynthetase activity, therefore exogenous glutaminesynthetase can be used efficiently as a selectablemarker to identify successful transfectants in theabsence of glutamine in the media. In addition, theinclusion of methionine sulphoximine, an inhibitor ofglutamine synthetase activity, enables furtherselection of those clones producing relatively highlevels of transfected glutamine synthetase and henceany heterologous gene which is coupled to it. Theglutamine synthetase system technology has been usedfor research and development purposes during thisdecade and its importance is clearly demonstrated nowthat two therapeutic products produced using thissystem have reached the market place.

  6. Aspects regarding the safety improvement by corrosion protection on a GS heavy water plant

    International Nuclear Information System (INIS)

    Nicolaescu, G.V.; Nicolaescu, G.I.; Ohai, D.; Pavelescu, M.

    1995-01-01

    A new procedure to form a protective iron sulfide film in heavy water production columns is described and the results obtained are compared with an older procedure, showing the characteristics of protective film in both cases and the advantages of the new method. (Author)

  7. Transcriptome sequencing and de novo analysis of the copepod Calanus sinicus using 454 GS FLX.

    Directory of Open Access Journals (Sweden)

    Juan Ning

    Full Text Available BACKGROUND: Despite their species abundance and primary economic importance, genomic information about copepods is still limited. In particular, genomic resources are lacking for the copepod Calanus sinicus, which is a dominant species in the coastal waters of East Asia. In this study, we performed de novo transcriptome sequencing to produce a large number of expressed sequence tags for the copepod C. sinicus. RESULTS: Copepodid larvae and adults were used as the basic material for transcriptome sequencing. Using 454 pyrosequencing, a total of 1,470,799 reads were obtained, which were assembled into 56,809 high quality expressed sequence tags. Based on their sequence similarity to known proteins, about 14,000 different genes were identified, including members of all major conserved signaling pathways. Transcripts that were putatively involved with growth, lipid metabolism, molting, and diapause were also identified among these genes. Differentially expressed genes related to several processes were found in C. sinicus copepodid larvae and adults. We detected 284,154 single nucleotide polymorphisms (SNPs that provide a resource for gene function studies. CONCLUSION: Our data provide the most comprehensive transcriptome resource available for C. sinicus. This resource allowed us to identify genes associated with primary physiological processes and SNPs in coding regions, which facilitated the quantitative analysis of differential gene expression. These data should provide foundation for future genetic and genomic studies of this and related species.

  8. Natural analogue synthesis report, TDR-NBS-GS-000027 rev00 icn02

    Energy Technology Data Exchange (ETDEWEB)

    Simmons, A.; Nieder-Westermann, G.; Stuckless, J.; Dobson, P.; Unger, A.J.A.; Kwicklis, E.; Lichtner, P.; Carey, B.; Wolde, G.; Murrel,M.; Kneafsey, T.J.; Meijer, A.; Faybishenko, B.

    2002-04-01

    The purpose of this report is to present analogue studies and literature reviews designed to provide qualitative and quantitative information to test and provide added confidence in process models abstracted for performance assessment (PA) and model predictions pertinent to PA. This report provides updates to studies presented in the Yucca Mountain Site Description (CRWMS M&O 2000 [151945], Section 13) and new examples gleaned from the literature, along with results of quantitative studies conducted specifically for the Yucca Mountain Site Characterization Project (YMP). The intent of the natural analogue studies was to collect corroborative evidence from analogues to demonstrate additional understanding of processes expected to occur during postclosure at a potential Yucca Mountain repository. The report focuses on key processes by providing observations and analyses of natural and anthropogenic (human-induced) systems to improve understanding and confidence in the operation of these processes under conditions similar to those that could occur in a nuclear waste repository. The process models include those that represent both engineered and natural barrier processes. A second purpose of this report is to document the various applications of natural analogues to geologic repository programs, focusing primarily on the way analogues have been used by the YMP. This report is limited to providing support for PA in a confirmatory manner and to providing corroborative inputs for process modeling activities. Section 1.7 discusses additional limitations of this report. Key topics for this report are analogues to emplacement drift degradation, waste form degradation, waste package degradation, degradation of other materials proposed for the engineered barrier, seepage into drifts, radionuclide flow and transport in the unsaturated zone (UZ), analogues to coupled thermal-hydrologic-mechanical-chemical processes, saturated zone (SZ) transport, impact of radionuclide release on the biosphere, and potentially disruptive events. Results of these studies will be used to corroborate estimates of the magnitude and limitation of operative processes in order to build realism into conceptual and numerical process models used as a foundation for PA in the representative case of postclosure safety.

  9. GS o mirar los cuerpos sociales y emociones desde Georg Simmel

    Directory of Open Access Journals (Sweden)

    Maya Aguiluz Ibargüen

    2005-03-01

    Full Text Available El artículo pone de relieve los vínculos existentes entre las claves de Georg Simmel sobre la constitución de lo social y la socialidad respecto a los cambios tecnológicos, arreglos culturales, campos discursivos y estructuras de percepción que se entretejieron alcanzando la vida social de las ciudades europeas y de los circuitos moderno-capitalistas del siglo XIX.

  10. Conformational changes in the G protein Gs induced by the β2 adrenergic receptor

    DEFF Research Database (Denmark)

    Chung, Ka Young; Rasmussen, Søren Gøgsig Faarup; Liu, Tong

    2011-01-01

    and initiation of downstream signalling cascades. Despite a wealth of biochemical and biophysical studies on inactive and active conformations of several heterotrimeric G proteins, the molecular underpinnings of G protein activation remain elusive. To characterize this mechanism, we applied peptide amide...

  11. X-Ray Transient in Musca (GRS 1121-68 = GS 1124-683)

    DEFF Research Database (Denmark)

    Lund, Niels; Brandt, Søren; Makino, F.

    1991-01-01

    Research Institute, Lyngby; and Space Research Institute, Moscow), report: "A new x-ray source in Musca, GRS 1121-68, has been discovered in data obtained by the WATCH detectors on Jan. 9. The spectrum of the source was harder than that of the Crab nebula, and the flux was about twice that from t...... was taken as La Silla, showing no new object in the 2 x 2 deg field brighter than mag 7-8; a search plate will be taken with the Schmidt telescope at La Silla....

  12. Cooper, H. (ed. (2013. Teaching History Creatively. Londres: Routledge. 185 págs.

    Directory of Open Access Journals (Sweden)

    Gil de Sola Bellas, Marta

    2015-12-01

    Full Text Available Teaching History Creatively es un libro orientado a los docentes cuya labor se desempeña principalmente durante los primeros años de la educación escolar, más concretamente los últimos años de Educación Infantil y toda la Educación Primaria, aunque también podría adaptarse a los niveles de enseñanza superiores. A través del mismo se pretende introducir a los do centes a la enseñanza de la historia de manera creativa a partir de la realización de investigaciones históricas aptas para el alumnado, de forma que se desarrolle su pensamiento histórico. Esto dotará a los alumnos de una serie de recursos esenciales para el adecuado aprendizaje de la historia, y permitiendo que éstos realicen su propia representación del pasado y analizar los hechos históricos desde un punto de vista crítico.

  13. GS Soil - Assessment and strategic development of INSPIRE compliant Geodata-Services for European Soil Data

    DEFF Research Database (Denmark)

    Krogh, Paul Henning; Münier, Bernd

    facilities and long term observations as part of the Annex III theme "Environmental Monitoring Facilities", • Information about the soil related aspects of Annex III theme "Natural Risk Zones" as e.g. landslides, soil erosion, soil compaction, soil organic carbon decline, salinization, acidification and soil...

  14. A phylogenomic gene cluster resource: The phylogeneticallyinferred groups (PhlGs) database

    Energy Technology Data Exchange (ETDEWEB)

    Dehal, Paramvir S.; Boore, Jeffrey L.

    2005-08-25

    We present here the PhIGs database, a phylogenomic resource for sequenced genomes. Although many methods exist for clustering gene families, very few attempt to create truly orthologous clusters sharing descent from a single ancestral gene across a range of evolutionary depths. Although these non-phylogenetic gene family clusters have been used broadly for gene annotation, errors are known to be introduced by the artifactual association of slowly evolving paralogs and lack of annotation for those more rapidly evolving. A full phylogenetic framework is necessary for accurate inference of function and for many studies that address pattern and mechanism of the evolution of the genome. The automated generation of evolutionary gene clusters, creation of gene trees, determination of orthology and paralogy relationships, and the correlation of this information with gene annotations, expression information, and genomic context is an important resource to the scientific community.

  15. Latviešu literārā valoda 19. gs. 80.–90. gados

    Directory of Open Access Journals (Sweden)

    Aina Blinkena

    2011-11-01

    Full Text Available LETTISCHE SCHRIFTSPRACHE IN DEN 80.–90. J. DES 20. JHZusammenfassungDie Entwicklung der lettischen Schriftsprache hat sich in ihren verschiedenen Bestehungsetappen nicht gleichartig breit erforscht geworden.Die Sprache den letzten Jahrzehnten des 19. Jh. haben die Sprachwissenschaftler weniger Aufmerksamkeit geschenkt, doch in dieser Zeit vollziehen sich aktive Prozesse, die zur heutige Sprachnorm füren.In diesen Jahren hat sich die nationale Kultur gebildet, es entsteht und entwickelt sich die Literatur verschiedener Genres und Stile, die zur Klassik der lettischen Literatur geworden ist, es entwickelt sich schnell das Buchwesen. In 1886–1900 sind mehr als 3500 Titel von Büchern herausgegeben, es bestehen 100 Verlage.Große Rolle für die Erforschung und Pflege des Lettischen hat die Wissenschaftliche Kommission des Rigaer Lettischen Vereins (gegr. 1868 gespielt, die die orthographischen Prinzipien vervollkommen hat und in den von der Kommission herausgegebenen Schriften wurden die theoretischen Forschungen über die lettischen Sprache veröffentlicht. Es bildete sich die wissenschaftliche Terminologie. Die Arbeit haben die ersten akademisch gebildeten Sprachwissenschaftler der lettischen Nation K. Mühlenbach, J. Kauliņš, J. Endzelīns, P. Šmits begonnen, deren Werke als eine Brücke zum 20. Jahrhundert führt.

  16. r isotopes in the yrgueil gs meteoriteX ghronology of e rly sol r ...

    Indian Academy of Sciences (India)

    h ve een deposited intermittently st rting ne r the time of p rent ody form tion nd ontinuing for t le st QH w F he r .... mounts of w ter flowed through the yrgueil p rent m teri l during lter ... n lysis were rried outF pirstD series of le hing experiments ...

  17. The role of global data identification standards for supply chain visibility: the case of GS1

    OpenAIRE

    Semianiaka, Natallia; Silina, Ekaterina

    2012-01-01

    Purpose. Supply chain visibility is among the top concerns expressed by many supply chain leaders. While the traditional enablers of supply chain visibility are information sharing, IT implementation, and relationships between supply chain partners; the role of global supply chain standards as an integral part of each of these enablers is often underestimated. The purpose of this thesis is to investigate the adoption and applicability of global supply chain standards within the provisions of ...

  18. Quality-Assurance Plan for Water-Quality Activities of the U.S. Geological Survey in Miami, Florida

    Science.gov (United States)

    2003-01-01

    Jacqueline Lima GS-12 GS-10 GS-09 GS-09 GS-08 GS-07 GS-06 GS-06 GS-04 GS-04Eleanor Seymore Surface-Water Data Collections & Jon Woolverton Jorge Agis...Thomas J. Smith, III Gordon Anderson Kevin Whelan Don De Angelis Allison Snow GS-13 GS-07 GS-05 GS-12 GS-13 GS-07 GS-12 GS-13 GS-09 GS-07 GS-14 GS-07...fan, active, inactive, inventory only playa , month day year stream channel, digital rec- order, North American Datum of 1927 North American Datum of

  19. Survivability of freeze-dried probiotic Pediococcus pentosaceus strains GS4, GS17 and Lactobacillus gasseri (ATCC 19992 during storage with commonly used pharmaceutical excipients within a period of 120 days

    Directory of Open Access Journals (Sweden)

    Mayur Bagad

    2017-10-01

    Conclusions: Commonly used excipients can be considered as a vehicle for delivering active principle in probiotic formulation and for sustaining the viability and stability of probiotic strains for a period of 120 d.

  20. Inspection of radiation sources and regulatory enforcement (supplement to IAEA Safety Standards Series No. GS-G-1.5)

    International Nuclear Information System (INIS)

    2010-08-01

    The achievement and maintenance of a high level of safety in the use of radiation sources depends on there being a sound legal and governmental infrastructure, including a national regulatory body with well-defined responsibilities and functions. These responsibilities and functions include establishing and implementing a system for carrying out regulatory inspections, and taking necessary enforcement actions. The Safety Requirements publication entitled Legal and Governmental Infrastructure for Nuclear, Radiation, Radioactive Waste and Transport Safety establishes the requirements for legal and governmental infrastructure. The term 'infrastructure' refers to the underlying structure of systems and organizations. This includes requirements concerning the establishment of a regulatory body for radiation sources and the responsibilities and functions assigned to it. The International Basic Safety Standards for Protection against Ionizing Radiation and for the Safety of Radiation Sources (the Basic Safety Standards or the BSS) establish basic requirements for protection against risks associated with exposure to ionizing radiation and for the safety of radiation sources. The application of the BSS is based on the presumption that national infrastructures are in place to enable governments to discharge their responsibilities to for radiation protection and safety. This TECDOC provides practical guidance on the processes for carrying out regulatory inspections and taking enforcement actions. It includes information on the development and use of procedures and standard review plans (i.e. checklists) for inspection. Specific procedures for inspection of radiation practices and sources are provided in the Appendices

  1. Near-complete genome sequencing of swine vesicular disease virus using the Roche GS FLX sequencing platform

    DEFF Research Database (Denmark)

    Nielsen, Sandra Cathrine Abel; Bruhn, Christian Anders Wathne; Samaniego Castruita, Jose Alfredo

    2014-01-01

    Swine vesicular disease virus (SVDV) is an enterovirus that is both genetically and antigenically closely related to human coxsackievirus B5 within the Picornaviridae family. SVDV is the causative agent of a highly contagious (though rarely fatal) vesicular disease in pigs. We report a rapid method...... with significant genetic distances within the same species of viruses. All reference mappings used an iterative method to avoid bias. Further verification was achieved through phylogenetic analysis against published SVDV genomes and additional Enterovirus B sequences. This approach allows high confidence...

  2. Carbon steel protection in G.S. (Girlder sulfide) plants. Influence of the material surface state. Pt. 2

    International Nuclear Information System (INIS)

    Burkart, A.L.; Garavaglia, R.N.

    1983-05-01

    The passivation on carbon steels, in particular ASTM A 516 Degree 60 and ASTM A 333 steels is made, submitting it to the action of H 2 S/H 2 O 1,2 corrosive medium. The steel is rapidly corroded by H 2 S in aqueous solution, forming iron sulfides on the metallic surface in a crystalline layer of various μm of thickness. During this process, various types of iron sulfides at different phases, with different sulfur and iron contents are formed. The influence of temperature, the pH, the exposure time and the corrosive medium composition on formation and quality of the iron sulfides protective layer was also studied. (Author) [es

  3. Short communication: Anti-HIV-1 envelope immunoglobulin Gs in blood and cervicovaginal samples of Beninese commercial sex workers.

    Science.gov (United States)

    Batraville, Laurie-Anne; Richard, Jonathan; Veillette, Maxime; Labbé, Annie-Claude; Alary, Michel; Guédou, Fernand; Kaufmann, Daniel E; Poudrier, Johanne; Finzi, Andrés; Roger, Michel

    2014-11-01

    Characterization of the immune correlates of protection against HIV infection is crucial for the development of preventive strategies. This study examined HIV-1 envelope (Env) glycoproteins, specifically immunoglobulin G (IgG), in systemic and mucosal compartments of female Beninese commercial sex workers (CSWs). Samples of 23 HIV-1-positive and 20 highly exposed HIV-1-seronegative (HESN) CSWs were studied. HIV-1 Env-specific IgG detection in sera and cervicovaginal lavages (CVLs) from the study population was done by cell-based ELISA. The HIV neutralizing activity was evaluated with a neutralization assay. The HIV-1-specific antibody-dependent cellular cytotoxicity (ADCC) response of the cohort was measured with a FACS-based assay evaluating the ADCC-mediated elimination of gp120-coated target cells. No anti-HIV-1 Env-specific IgG neutralizing or ADCC activities were detected in samples from HESN CSWs. Samples from HIV-1-infected CSWs presented ADCC activity in both sera and CVLs. Anti-Env IgG from sera and CVLs from HIV-1-infected CSWs preferentially recognized Env in its CD4-bound conformation. HIV-1-infected CSWs have ADCC-mediating IgG that preferentially recognizes Env in its CD4-bound conformation at the mucosal site.

  4. Crosstalk between Gi and Gq/Gs pathways in airway smooth muscle regulates bronchial contractility and relaxation

    OpenAIRE

    McGraw, Dennis W.; Elwing, Jean M.; Fogel, Kevin M.; Wang, Wayne C.H.; Glinka, Clare B.; Mihlbachler, Kathryn A.; Rothenberg, Marc E.; Liggett, Stephen B.

    2007-01-01

    Receptor-mediated airway smooth muscle (ASM) contraction via Gαq, and relaxation via Gαs, underlie the bronchospastic features of asthma and its treatment. Asthma models show increased ASM Gαi expression, considered the basis for the proasthmatic phenotypes of enhanced bronchial hyperreactivity to contraction mediated by M3-muscarinic receptors and diminished relaxation mediated by β2-adrenergic receptors (β2ARs). A causal effect between Gi expression and phenotype has not been established, n...

  5. Carbon steel protection in G.S. (Girlder sulfide) plants. Iron sulfide scales formation conditions. Pt. 1

    International Nuclear Information System (INIS)

    Bruzzoni, P.; Burkart, A.L.; Garavaglia, R.N.

    1981-11-01

    An ASTM A 516 degree 60 carbon steel superficial protection technique submitted to a hydrogen-water sulfide corrosive medium at 2 MPa of pressure and 40-125 deg C forming on itself an iron sulfide layer was tested. Studies on pH influence, temperature, passivating mean characteristics and exposure time as well as the mechanical resistance of sulfide layers to erosion are included. (Author) [es

  6. Report on the use of programmable digital computers in the shutdown systems of the Darlington G.S

    International Nuclear Information System (INIS)

    1981-06-01

    This report considers the use of large, programmable computers in the shutdown system at the planned Darlington Generating Station. After a review of the document submitted to the Atomic Energy Control Board (AECB) by Atomic Energy of Canada Ltd. Engineering Company in support of gaining AECB's agreement in principle to such a system, the ACNS concludes that no fundamental principle will be challenged by the introduction of computer technology into safety systems. It cautions, however, that the AECB should ensure that existing principles particularly those of independence and redundancy, will not be compromised in the application

  7. Procedure for calculation of potency and efficacy for ligands acting on Gs- and Gi-coupled receptors

    DEFF Research Database (Denmark)

    Meier, Eddi; Schousboe, Arne; Belhage, Bo

    2012-01-01

    Structure activity relationship (SAR) analyses of pharmacological data of compounds constitute an important part of the discovery process in the design of new drug candidates with improved pharmacological properties. In particular G-Protein Coupled Receptors (GPCRs) associated with the cAMP second...

  8. Heat sink considerations during SLAR defuelling activities of the 1995 maintenance outage at the Point Lepreau G.S

    International Nuclear Information System (INIS)

    Richard, R.A.; Edgar, D.J.; Gibb, R.A.

    1996-01-01

    In order to conduct the Spacer Locate and Reposition (SLAR) activities, individual fuel channels were de-fuelled using the SLAR tool itself. The presence of the tool in the channel containing fuel caused concerns over channel flow interruption. A methodology was devised to assess the limited fuel heat up during de-fuelling and during possible prolonged periods of complete flow interruption. Once established, the approach could be used to assess the effect of varying parameters which could effect channel heat-up. Costly delays in SLAR maintenance activities were avoided by ensuring the sequence of channel visits was such that the individual channel powers decayed sufficiently to prevent channel heat up beyond acceptable temperature limits. (author)

  9. Superconducting snake with the field of 75 kGs for the VEPP-2M electron-positron storage ring

    International Nuclear Information System (INIS)

    Anashin, V.V.; Vasserman, I.B.; Vlasov, A.M.

    1985-01-01

    Superconducting ''snake'' with the field of 75 kG is established in the VEPP-2M electron-positron storage ring for increase of colliding beam luminosity up to 2x10 31 cmsup(-2)sdup(-1) in the energy range from 2x200 to 2x700 MeV. The ''snake'' comprises three central magnets with the field of 75 kG and two side ones with the field of 45 kG and it is placed in one of rectilinear experimental gaps. Description of design peculiarities of the ''snake'' and its parameters are given. Parameters of beams with switched on and switched off ''snake'' as well as parameters of coils and superconducting wire are presented

  10. Comment on the paper 'EXAFS measurements on Nb3Ge thin films' by G.S. Brown et al

    International Nuclear Information System (INIS)

    Pande, C.S.; Viswanathan, R.

    1978-01-01

    Brown et al. (Solid State Commun.; 23:875(1977)) have reported that Nb 3 Ge specimens showing superconducting transition temperatures less than the maximum possible value contain a 'quasi-amorphous phase'. The possibility is discussed that the lower values of Tsub(c) of these specimens may be accounted for by the proximity effect due to these quasi-amorphous regions. (author)

  11. GS-8374, a Prototype Phosphonate-Containing Inhibitor of HIV-1 Protease, Effectively Inhibits Protease Mutants with Amino Acid Insertions

    Czech Academy of Sciences Publication Activity Database

    Grantz Šašková, Klára; Kožíšek, Milan; Stray, K.; Jong de, D.; Řezáčová, Pavlína; Brynda, Jiří; Maarseveen van, N. M.; Nijhuis, M.; Cihlář, T.; Konvalinka, Jan

    2014-01-01

    Roč. 88, č. 6 (2014), s. 3586-3590 ISSN 0022-538X R&D Projects: GA ČR GAP207/11/1798 Grant - others:OPPC(XE) CZ.2.16/3.1.00/24016 Institutional support: RVO:61388963 ; RVO:68378050 Keywords : virus type-1 protease * antiviral activity * drug resistance Subject RIV: EE - Microbiology, Virology Impact factor: 4.439, year: 2014

  12. Building Parts Inventory Files Using the AppleWorks Data Base Subprogram and Apple IIe or GS Computers.

    Science.gov (United States)

    Schlenker, Richard M.

    This manual is a "how to" training device for building database files using the AppleWorks program with an Apple IIe or Apple IIGS Computer with Duodisk or two disk drives and an 80-column card. The manual provides step-by-step directions, and includes 25 figures depicting the computer screen at the various stages of the database file…

  13. Developing Inventory Records Using the AppleWorks Data Base Subprogram and Apple IIe or GS Computers.

    Science.gov (United States)

    Schlenker, Richard M.

    This manual is a "how to" training device for developing inventory records in the AppleWorks program using an Apple IIe or Apple IIGS Computer with Duodisk or two disk drives and an 80-column card. The manual provides step-by-step directions, and includes 17 figures depicting the computer screen at the various stages of the inventory…

  14. Building High School Science Department Inventory Records Using the Appleworks Data Base Subprogram and Apple IIe or GS Computers.

    Science.gov (United States)

    Schlenker, Richard M.

    This manual was developed for use as a "how to" training device and provides a step-by-step introduction to using AppleWorks in the database mode. Instructions are given to prepare the original database with the headings of the user's choice. Inserting information records in the new database is covered, along with changing the layout of…

  15. Inspection of radiation sources and regulatory enforcement (supplement to IAEA Safety Standards Series No. GS-G-1.5)

    International Nuclear Information System (INIS)

    2007-04-01

    The achievement and maintenance of a high level of safety in the use of radiation sources depends on there being a sound legal and governmental infrastructure, including a national regulatory body with well-defined responsibilities and functions. These responsibilities and functions include establishing and implementing a system for carrying out regulatory inspections, and taking necessary enforcement actions. The Safety Requirements publication entitled Legal and Governmental Infrastructure for Nuclear, Radiation, Radioactive Waste and Transport Safety establishes the requirements for legal and governmental infrastructure. The term 'infrastructure' refers to the underlying structure of systems and organizations. This includes requirements concerning the establishment of a regulatory body for radiation sources and the responsibilities and functions assigned to it. The International Basic Safety Standards for Protection against Ionizing Radiation and for the Safety of Radiation Sources (the Basic Safety Standards or the BSS) establish basic requirements for protection against risks associated with exposure to ionizing radiation and for the safety of radiation sources. The application of the BSS is based on the presumption that national infrastructures are in place to enable governments to discharge their responsibilities to for radiation protection and safety. This TECDOC provides practical guidance on the processes for carrying out regulatory inspections and taking enforcement actions. It includes information on the development and use of procedures and standard review plans (i.e. checklists) for inspection. Specific procedures for inspection of radiation practices and sources are provided in the Appendices

  16. An Assessment of Talent Management Practices Targeting GS-12/13 Level Members of the Army Acquisition Corps Workforce

    Science.gov (United States)

    2010-05-01

    currently valid OMB control number. 1. REPORT DATE MAY 2010 2. REPORT TYPE 3. DATES COVERED 00-00-2010 to 00-00-2010 4. TITLE AND SUBTITLE An... Control , Strategy or Vision, Challenging Work, Collaboration or Teamwork, Work Culture, Shared Gains, Communication, Concern for People, Technology...As show in Figure 5, the top recruiting strategy, selected by both groups, was an emphasis on flex telework or telecommute programs (Holtshouse, 2009

  17. Discovery of Human IgGs against α-Cobratoxin for Development of Recombinant Antibody-based Antivenom

    DEFF Research Database (Denmark)

    Laustsen, Andreas Hougaard; Engmark, Mikael; Redsted Rasmussen, Arne

    , in which large mammals (typically horses) are immunized with snake venom and antiserum is derived from the animals blood. The incompatibility with the human immune system of these animal derived antivenoms leads to a range of side effects,such as serum sickness, anaphylaxis, and sometimes even death......More than 5.5 million people are bitten by venomous snakes per year on a global basis. This leads to approx. 125,000 deaths and 3 times as many amputations. Particularly Sub-Saharan Africa is affected by the problem. Current antivenoms are still being produced by a method developed in the 1890’s...

  18. NuSTAR detection of 4s Hard X-ray Lags from the Accreting Pulsar GS 0834-430

    DEFF Research Database (Denmark)

    Bachetti, Matteo; Miyasaka, Hiromasa; Harrison, Fiona

    2014-01-01

    is consistent with that observed in many other magnetized accreting pulsars. We fail to detect cyclotron resonance scattering features in either phase-averaged nor phase-resolved spectra that would allow us to constrain the pulsar’s magnetic field. We detect a pulse period of ∼ 12.29 s in all energy bands....... The pulse profile can be modeled with a double Gaussian and shows a strong and smooth hard lag of up to 0.3 cycles in phase, or about 4s between the pulse at ∼ 3 and >∼ 30 keV. This is the first report of such a strong lag in high-mass X-ray binary (HMXB) pulsars. Previously reported lags have been...

  19. REFINED ORBITAL SOLUTION AND QUIESCENT VARIABILITY IN THE BLACK HOLE TRANSIENT GS 1354-64 (= BW Cir)

    International Nuclear Information System (INIS)

    Casares, J.; Zurita, C.; Shahbaz, T.; Corral-Santana, J. M.; Martinez-Pais, I. G.

    2009-01-01

    In Casares et al. we presented the first radial velocity curve of the companion star to BW Cir which demonstrates the presence of a black hole in this historical X-ray transient. But these data were affected by aliasing and two possible periods at 2.5445 days and 2.5635 days were equally possible. Here we present new spectroscopic data that enable us to break the 1-year aliasing and confirm 2.5445 days as the correct orbital period. We also present R-band photometry over 14 years, which reveals the presence of important flaring activity dominating the light curves.

  20. Zemes izmantošanu ietekmējošie faktori 20.gs. Latvijā

    OpenAIRE

    Līkosts, Valdis

    2009-01-01

    Maģistra darbā tiek analizēta lauksaimniecībā izmantojamo zemju apsaimniekojuma struktūra divos Rietumkurzemes augstienes pagastos. Zemes izmantošanu ietekmējošo faktoru ietekmju izvērtēšanai tika izmantota zemju apsaimniekošanas datu statistiskā apstrāde, aprēķinot faktoru ietekmju lielumu un nosakot to būtiskumu. Faktoru analīzes rezultātā tika konstatēts, ka zemes izmantošanu un ainavas dinamiku, šie faktori ietekmē. Faktoru ietekmei piemīt spēcīga mainība gan telpiskā, gan temporālā m...

  1. SYSTEMATIC UNCERTAINTIES IN THE SPECTROSCOPIC MEASUREMENTS OF NEUTRON STAR MASSES AND RADII FROM THERMONUCLEAR X-RAY BURSTS. III. ABSOLUTE FLUX CALIBRATION

    Energy Technology Data Exchange (ETDEWEB)

    Güver, Tolga [Istanbul University, Science Faculty, Department of Astronomy and Space Sciences, Beyazıt, 34119, Istanbul (Turkey); Özel, Feryal; Psaltis, Dimitrios [Department of Astronomy, University of Arizona, 933 N. Cherry Avenue, Tucson, AZ 85721 (United States); Marshall, Herman [Center for Space Research, Massachusetts Institute of Technology, Cambridge, MA 02139 (United States); Guainazzi, Matteo [European Space Astronomy Centre of ESA, P.O. Box 78, Villanueva de la Cañada, E-28691 Madrid (Spain); Díaz-Trigo, Maria [ESO, Karl-Schwarzschild-Strasse 2, D-85748 Garching bei München (Germany)

    2016-09-20

    Many techniques for measuring neutron star radii rely on absolute flux measurements in the X-rays. As a result, one of the fundamental uncertainties in these spectroscopic measurements arises from the absolute flux calibrations of the detectors being used. Using the stable X-ray burster, GS 1826–238, and its simultaneous observations by Chandra HETG/ACIS-S and RXTE /PCA as well as by XMM-Newton EPIC-pn and RXTE /PCA, we quantify the degree of uncertainty in the flux calibration by assessing the differences between the measured fluxes during bursts. We find that the RXTE /PCA and the Chandra gratings measurements agree with each other within their formal uncertainties, increasing our confidence in these flux measurements. In contrast, XMM-Newton EPIC-pn measures 14.0 ± 0.3% less flux than the RXTE /PCA. This is consistent with the previously reported discrepancy with the flux measurements of EPIC-pn, compared with EPIC MOS1, MOS2, and ACIS-S detectors. We also show that any intrinsic time-dependent systematic uncertainty that may exist in the calibration of the satellites has already been implicity taken into account in the neutron star radius measurements.

  2. Insight into partial agonism by observing multiple equilibria for ligand-bound and Gs-mimetic nanobody-bound β1-adrenergic receptor.

    Science.gov (United States)

    Solt, Andras S; Bostock, Mark J; Shrestha, Binesh; Kumar, Prashant; Warne, Tony; Tate, Christopher G; Nietlispach, Daniel

    2017-11-27

    A complex conformational energy landscape determines G-protein-coupled receptor (GPCR) signalling via intracellular binding partners (IBPs), e.g., G s and β-arrestin. Using 13 C methyl methionine NMR for the β 1 -adrenergic receptor, we identify ligand efficacy-dependent equilibria between an inactive and pre-active state and, in complex with G s -mimetic nanobody, between more and less active ternary complexes. Formation of a basal activity complex through ligand-free nanobody-receptor interaction reveals structural differences on the cytoplasmic receptor side compared to the full agonist-bound nanobody-coupled form, suggesting that ligand-induced variations in G-protein interaction underpin partial agonism. Significant differences in receptor dynamics are observed ranging from rigid nanobody-coupled states to extensive μs-to-ms timescale dynamics when bound to a full agonist. We suggest that the mobility of the full agonist-bound form primes the GPCR to couple to IBPs. On formation of the ternary complex, ligand efficacy determines the quality of the interaction between the rigidified receptor and an IBP and consequently the signalling level.

  3. Assessment of the microbial integrity, sensu G.S. Wilson, of piped and bottled drinking water in the condition as ingested.

    Science.gov (United States)

    Mossel, David A A; Struijk, Corry B

    2004-05-01

    The second half of the 20th century witnessed substantial progress in the assurance and verification of microbiological integrity, i.e., safety and sensory quality, of drinking water. Enteropathogenic agents, such as particular viruses and protozoa, not previously identified as transmitted by industrially provided water supplies, were demonstrated to cause disease outbreaks, when ingested with piped water. The potential harm posed by carry-over of orally toxic metabolites of organisms, producing 'algal' (cyanophytic) blooms, was considered. In addition, earlier observations on the colonization of attenuated drinking water bodies by a variety of oligotrophic Gram-negative bacteria were confirmed and extended. This new evidence called for updating both water purification technologies and analytical methodology, serving to verify that goals had been attained. For the former purpose, the hazard analysis empowering control of critical practices (HACCP) strategy, introduced about 1960 in industrial food processing, was successfully adopted. Elimination, devitalization or barrier technologies for the more recently identified water-borne pathogens were elaborated, taking account of the hazard of production of chlorinated compounds with alleged adverse health effects. Biofilm formation throughout water distribution networks was brought under control by strict limitation of concentrations of compounds, assimilable by oligotrophic bacteria. Upon acknowledging that direct detection tests for pathogens were futile, because of their most sporadic and erratic distribution, Schardinger's marker organism concept was anew embraced, rigorously revised and substantially enlarged. Misleading designations, like searches for 'faecal coliforms' were replaced by boundary testing for Escherichia coli and appropriate Enterococcus spp. In addition, though still to be perfected, detection protocols for relevant bacteriophages or index viruses and, to a certain extent, also for spores of aerobic and anaerobic sporing rods were also elaborated. In all monitoring account was taken of sublethally injured target organisms, surviving purification technologies, though not deprived of their ecological significance. A need remains for a rigorously standardized operating procedure (SOP) for colony counts of psychrotrophic, oligotrophic Gram-negative rod-shaped bacteria ('heterotrophic plate count'), which constitute a useful criterion of indicator value. As in the contemporary HACCP approach to food safety, guidelines for assessing success or failure in control of integrity (Water Safety Objectives) were empirically elaborated. These rely on surveys on water samples, originating from drinking water supplies, previously verified as complying with longitudinally integrated HACCP-based purification technologies. Structured Academic dissemination of these innovations, through professional microbiologists to operator and executive levels, is recommended. Web based Distance Learning MSc Programmes, like the one, since the academic year 2003-2004, offered by the University of Hertfordshire, Hatfield, UK, may contribute to such endeavours. Though the complete Course is centered around Food Safety, the Modules in-Residence Practicals and Science and Technology of Drinking Water can be studied as an entity while being employed. Copyright 2004 Elsevier B.V.

  4. The Subcellular Dynamics of the Gs-Linked Receptor GPR3 Contribute to the Local Activation of PKA in Cerebellar Granular Neurons.

    Science.gov (United States)

    Miyagi, Tatsuhiro; Tanaka, Shigeru; Hide, Izumi; Shirafuji, Toshihiko; Sakai, Norio

    2016-01-01

    G-protein-coupled receptor (GPR) 3 is a member of the GPR family that constitutively activates adenylate cyclase. We have reported that the expression of GPR3 in cerebellar granular neurons (CGNs) contributes to neurite outgrowth and modulates neuronal proliferation and survival. To further identify its role, we have analyzed the precise distribution and local functions of GPR3 in neurons. The fluorescently tagged GPR3 protein was distributed in the plasma membrane, the Golgi body, and the endosomes. In addition, we have revealed that the plasma membrane expression of GPR3 functionally up-regulated the levels of PKA, as measured by a PKA FRET indicator. Next, we asked if the PKA activity was modulated by the expression of GPR3 in CGNs. PKA activity was highly modulated at the neurite tips compared to the soma. In addition, the PKA activity at the neurite tips was up-regulated when GPR3 was transfected into the cells. However, local PKA activity was decreased when endogenous GPR3 was suppressed by a GPR3 siRNA. Finally, we determined the local dynamics of GPR3 in CGNs using time-lapse analysis. Surprisingly, the fluorescent GPR3 puncta were transported along the neurite in both directions over time. In addition, the anterograde movements of the GPR3 puncta in the neurite were significantly inhibited by actin or microtubule polymerization inhibitors and were also disturbed by the Myosin II inhibitor blebbistatin. Moreover, the PKA activity at the tips of the neurites was decreased when blebbistatin was administered. These results suggested that GPR3 was transported along the neurite and contributed to the local activation of PKA in CGN development. The local dynamics of GPR3 in CGNs may affect local neuronal functions, including neuronal differentiation and maturation.

  5. Notification and authorization for the use of radiation sources (supplement to IAEA Safety Standards Series No. GS-G-1.5)

    International Nuclear Information System (INIS)

    2010-10-01

    The achievement and maintenance of a high level of safety in the use of radiation sources depend on there being a sound legal and governmental infrastructure, including a national regulatory body with well-defined responsibilities and functions. These responsibilities and functions include establishing and implementing a system for notification and authorization for control over radiation sources, including a system for review and assessment of applications for authorization. The Safety Requirements publication entitled Legal and Governmental Infrastructure for Nuclear, Radiation, Radioactive Waste and Transport Safety establishes the requirements for legal and governmental infrastructure. The term 'infrastructure' refers to the underlying structure of systems and organizations. This includes requirements concerning the establishment of a regulatory body for radiation sources and the responsibilities and functions assigned to it. The International Basic Safety Standards for Protection against Ionizing Radiation and for the Safety of Radiation Sources (the Basic Safety Standards or the BSS) establish basic requirements for protection against risks associated with exposure to ionizing radiation and for the safety of radiation sources. The application of the BSS is based on the presumption that national infrastructures are in place to enable governments to discharge their responsibilities to for radiation protection and safety. This TECDOC provides practical guidance on the process for dealing with applications for authorization and accepting notifications to regulatory bodies. Examples of guidelines that may be used by persons required to notify or apply for authorization and of the regulatory body's review and assessment procedures are provided in the Appendices. The TECDOC is oriented towards national regulatory infrastructures concerned with protection and safety for radiation sources used in medicine, industry, agriculture, research and education

  6. Time-differential observation of α-particle perturbed angular distribution: g-factor measurements for 217Acsup(gs) and 217Acsup(m)

    International Nuclear Information System (INIS)

    Maier, K.H.; Decman, D.J.; Grawe, H.; Kluge, H.

    1981-01-01

    The g-factor measurements of the ground state and an isomeric level in 217 Ac using the DPAD method with α-decay are described in this work. The results of γ-ray g-factor measurements for the isomer and a tentative decay scheme produced by α-γ and γ-γ coincidence experiments are also presented. An analysis of the α-particle angular distributions suggests that nuclear deformation affects the observed anisotropy. (orig.)

  7. De novo assembly and transcriptome analysis of five major tissues of Jatropha curcas L. using GS FLX titanium platform of 454 pyrosequencing

    Directory of Open Access Journals (Sweden)

    Parani Madasamy

    2011-04-01

    Full Text Available Abstract Background Jatropha curcas L. is an important non-edible oilseed crop with promising future in biodiesel production. However, factors like oil yield, oil composition, toxic compounds in oil cake, pests and diseases limit its commercial potential. Well established genetic engineering methods using cloned genes could be used to address these limitations. Earlier, 10,983 unigenes from Sanger sequencing of ESTs, and 3,484 unique assembled transcripts from 454 pyrosequencing of uncloned cDNAs were reported. In order to expedite the process of gene discovery, we have undertaken 454 pyrosequencing of normalized cDNAs prepared from roots, mature leaves, flowers, developing seeds, and embryos of J. curcas. Results From 383,918 raw reads, we obtained 381,957 quality-filtered and trimmed reads that are suitable for the assembly of transcript sequences. De novo contig assembly of these reads generated 17,457 assembled transcripts (contigs and 54,002 singletons. Average length of the assembled transcripts was 916 bp. About 30% of the transcripts were longer than 1000 bases, and the size of the longest transcript was 7,173 bases. BLASTX analysis revealed that 2,589 of these transcripts are full-length. The assembled transcripts were validated by RT-PCR analysis of 28 transcripts. The results showed that the transcripts were correctly assembled and represent actively expressed genes. KEGG pathway mapping showed that 2,320 transcripts are related to major biochemical pathways including the oil biosynthesis pathway. Overall, the current study reports 14,327 new assembled transcripts which included 2589 full-length transcripts and 27 transcripts that are directly involved in oil biosynthesis. Conclusion The large number of transcripts reported in the current study together with existing ESTs and transcript sequences will serve as an invaluable genetic resource for crop improvement in jatropha. Sequence information of those genes that are involved in oil biosynthesis could be used for metabolic engineering of jatropha to increase oil content, and to modify oil composition.

  8. De novo assembly and transcriptome analysis of five major tissues of Jatropha curcas L. using GS FLX titanium platform of 454 pyrosequencing.

    Science.gov (United States)

    Natarajan, Purushothaman; Parani, Madasamy

    2011-04-15

    Jatropha curcas L. is an important non-edible oilseed crop with promising future in biodiesel production. However, factors like oil yield, oil composition, toxic compounds in oil cake, pests and diseases limit its commercial potential. Well established genetic engineering methods using cloned genes could be used to address these limitations. Earlier, 10,983 unigenes from Sanger sequencing of ESTs, and 3,484 unique assembled transcripts from 454 pyrosequencing of uncloned cDNAs were reported. In order to expedite the process of gene discovery, we have undertaken 454 pyrosequencing of normalized cDNAs prepared from roots, mature leaves, flowers, developing seeds, and embryos of J. curcas. From 383,918 raw reads, we obtained 381,957 quality-filtered and trimmed reads that are suitable for the assembly of transcript sequences. De novo contig assembly of these reads generated 17,457 assembled transcripts (contigs) and 54,002 singletons. Average length of the assembled transcripts was 916 bp. About 30% of the transcripts were longer than 1000 bases, and the size of the longest transcript was 7,173 bases. BLASTX analysis revealed that 2,589 of these transcripts are full-length. The assembled transcripts were validated by RT-PCR analysis of 28 transcripts. The results showed that the transcripts were correctly assembled and represent actively expressed genes. KEGG pathway mapping showed that 2,320 transcripts are related to major biochemical pathways including the oil biosynthesis pathway. Overall, the current study reports 14,327 new assembled transcripts which included 2589 full-length transcripts and 27 transcripts that are directly involved in oil biosynthesis. The large number of transcripts reported in the current study together with existing ESTs and transcript sequences will serve as an invaluable genetic resource for crop improvement in jatropha. Sequence information of those genes that are involved in oil biosynthesis could be used for metabolic engineering of jatropha to increase oil content, and to modify oil composition.

  9. gsSKAT: Rapid gene set analysis and multiple testing correction for rare-variant association studies using weighted linear kernels.

    Science.gov (United States)

    Larson, Nicholas B; McDonnell, Shannon; Cannon Albright, Lisa; Teerlink, Craig; Stanford, Janet; Ostrander, Elaine A; Isaacs, William B; Xu, Jianfeng; Cooney, Kathleen A; Lange, Ethan; Schleutker, Johanna; Carpten, John D; Powell, Isaac; Bailey-Wilson, Joan E; Cussenot, Olivier; Cancel-Tassin, Geraldine; Giles, Graham G; MacInnis, Robert J; Maier, Christiane; Whittemore, Alice S; Hsieh, Chih-Lin; Wiklund, Fredrik; Catalona, William J; Foulkes, William; Mandal, Diptasri; Eeles, Rosalind; Kote-Jarai, Zsofia; Ackerman, Michael J; Olson, Timothy M; Klein, Christopher J; Thibodeau, Stephen N; Schaid, Daniel J

    2017-05-01

    Next-generation sequencing technologies have afforded unprecedented characterization of low-frequency and rare genetic variation. Due to low power for single-variant testing, aggregative methods are commonly used to combine observed rare variation within a single gene. Causal variation may also aggregate across multiple genes within relevant biomolecular pathways. Kernel-machine regression and adaptive testing methods for aggregative rare-variant association testing have been demonstrated to be powerful approaches for pathway-level analysis, although these methods tend to be computationally intensive at high-variant dimensionality and require access to complete data. An additional analytical issue in scans of large pathway definition sets is multiple testing correction. Gene set definitions may exhibit substantial genic overlap, and the impact of the resultant correlation in test statistics on Type I error rate control for large agnostic gene set scans has not been fully explored. Herein, we first outline a statistical strategy for aggregative rare-variant analysis using component gene-level linear kernel score test summary statistics as well as derive simple estimators of the effective number of tests for family-wise error rate control. We then conduct extensive simulation studies to characterize the behavior of our approach relative to direct application of kernel and adaptive methods under a variety of conditions. We also apply our method to two case-control studies, respectively, evaluating rare variation in hereditary prostate cancer and schizophrenia. Finally, we provide open-source R code for public use to facilitate easy application of our methods to existing rare-variant analysis results. © 2017 WILEY PERIODICALS, INC.

  10. Comments on the 'Stress corrosion cracking of zirconium and zircaloy-4 in halide aqueous solutions' by S.B. Farina, G.S. Duffo, J.R. Galvele

    International Nuclear Information System (INIS)

    Gutman, E.M.

    2004-01-01

    The above paper [Corros. Sci. 45 (2003) 2497] declares a general approach to describing stress corrosion cracking (SCC) mechanism and despite of the criticism of the so-called 'surface mobility mechanism' (SMM) e.g., [Corros. Sci. 36 (1994) 669, Corros. Sci. 45 (2003) 2105]. The paper [Corros. Sci. 45 (2003) 2497] demonstrates inner contradictions and mutually excluding statements of SMM when fitted calculated and measured values of crack propagation rate. As shown in these Comments, the crack propagation rate calculated using SMM is only the Nabarro-Herring creep deformation rate, which can never be numerically equal to the crack propagation rate. Thus, tests undertaken by the author of SMM cannot be accepted as experimental evidence of the SMM

  11. Unravelling Colletotrichum species associated with Camellia: employing ApMat and GS loci to resolve species in the C. gloeosporioides complex

    NARCIS (Netherlands)

    Liu, F.; Weir, B.S.; Damm, U.; Crous, P.W.; Wang, Y.; Liu, B.; Wang, M.; Zhang, M.; Cai, L.

    2015-01-01

    "We investigated the phylogenetic diversity of 144 Colletotrichum isolates associated with symptomatic and asymptomatic tissues of Camellia sinensis and other Camellia spp. from seven provinces in China (Fujian, Guizhou, Henan, Jiangxi, Sichuan, Yunnan, Zhejiang), and seven isolates obtained from

  12. Unravelling Colletotrichum species associated with Camellia: employing ApMat and GS loci to resolve species in the C. gloeosporioides complex

    NARCIS (Netherlands)

    Liu, F; Weir, B S; Damm, U; Crous, P W; Wang, Y; Liu, B; Wang, M; Zhang, M; Cai, L

    2015-01-01

    We investigated the phylogenetic diversity of 144 Colletotrichum isolates associated with symptomatic and asymptomatic tissues of Camellia sinensis and other Camellia spp. from seven provinces in China (Fujian, Guizhou, Henan, Jiangxi, Sichuan, Yunnan, Zhejiang), and seven isolates obtained from

  13. Notification and authorization for the use of radiation sources (supplement to IAEA Safety Standards Series No. GS-G-1.5)

    International Nuclear Information System (INIS)

    2007-04-01

    The achievement and maintenance of a high level of safety in the use of radiation sources depend on there being a sound legal and governmental infrastructure, including a national regulatory body with well-defined responsibilities and functions. These responsibilities and functions include establishing and implementing a system for notification and authorization for control over radiation sources, including a system for review and assessment of applications for authorization. The Safety Requirements publication entitled Legal and Governmental Infrastructure for Nuclear, Radiation, Radioactive Waste and Transport Safety establishes the requirements for legal and governmental infrastructure. The term 'infrastructure' refers to the underlying structure of systems and organizations. This includes requirements concerning the establishment of a regulatory body for radiation sources and the responsibilities and functions assigned to it. The International Basic Safety Standards for Protection against Ionizing Radiation and for the Safety of Radiation Sources (the Basic Safety Standards or the BSS) establish basic requirements for protection against risks associated with exposure to ionizing radiation and for the safety of radiation sources. The application of the BSS is based on the presumption that national infrastructures are in place to enable governments to discharge their responsibilities to for radiation protection and safety. This TECDOC provides practical guidance on the process for dealing with applications for authorization and accepting notifications to regulatory bodies. Examples of guidelines that may be used by persons required to notify or apply for authorization and of the regulatory body's review and assessment procedures are provided in the Appendices. The TECDOC is oriented towards national regulatory infrastructures concerned with protection and safety for radiation sources used in medicine, industry, agriculture, research and education

  14. Results and interpretation of groundwater data obtained from multiport-instrumented coreholes (GW-131 through GS-135), fiscal years 1990 and 1991

    International Nuclear Information System (INIS)

    Dreier, R.B.; Early, T.O.; King, H.L.

    1993-01-01

    With the increased emphasis by Department of Energy personnel on assessing the environmental impact of past waste disposal practices at all of its facilities, there has been an associated increase in characterization activities that focus on delineating site-specific groundwater flow regimes and contaminant migration pathways. At the Oak Ridge Y-12 Plant, the complex geologic and hydrologic relationships require a more detailed understanding of the three-dimensional properties of groundwater flow regimes than can be obtained by conventional monitoring activities. Thus, as part of groundwater characterization activities conducted by the Environmental Surveillance Section staff of the Y-12 Plant Environmental Management Department, five existing deep core holes were instrumented with multiport monitoring systems to provide greatly enhanced resolution of the hydraulic and hydrochemical properties of the groundwater system within Bear Creek Valley. With a multiport system, it is possible to measure hydraulic head and hydraulic conductivity and collect water samples from multiple levels within a single borehole. In this report, multiport data collected during fiscal years (FYs) 1990 and 1991 are summarized

  15. Carbon steel protection in G.S. (Girlder sulfide) plants. Iron sulfide scales formation on surfaces covered by fabrication produced films. Pt. 4

    International Nuclear Information System (INIS)

    Burkart, A.L.

    1986-04-01

    This work describes the assays aimed to passivate the steel carbon of the process pipings. This steel is marked by the ASTM A 333 G6 and is chemically similar to those of isotopic exchange towers which corrode in contact with in-water hydrogen sulfide solutions forming iron sulfide protective layers. The differences between both materials lie in the surface characteristics to be passivated. The steel of towers has an internal side covered by paint which shall be removed prior to passivation. The steel's internal side shall be covered by a film formed during the fabrication process and constituted by calcinated wastes and iron oxides (magnetite, hematite and wustite). This film interferes in the formation process of passivating layers of pyrrhotite and pyrite. The possibility to passivate the pipes in their actual state was evaluated since it would result highly laborious and expensive to eliminate the film. (Author) [es

  16. Molecular analysis of the interaction between the intracellular loops of the human serotonin receptor type 6 (5-HT6) and the α subunit of GS protein

    International Nuclear Information System (INIS)

    Kang, Hatan; Lee, Won Kyu; Choi, Yun Hui; Vukoti, Krishna Moorthy; Bang, Won Gi; Yu, Yeon Gyu

    2005-01-01

    The serotonin type 6 (5-HT 6 ) receptor is a G-protein coupled receptor (GPCR) coupled to a stimulatory G-protein (G S ). To identify the structural basis for the interaction of the 5-HT 6 receptor with the G S protein, we have dissected the interaction between GST-fusion proteins containing the second intracellular loop (iL2), the third intracellular loop (iL3), or the C-terminal tail of the 5-HT 6 receptor and the α subunit of G S (Gα S ). The direct interaction of iL3 and Gα S was demonstrated by co-immunoprecipitation. Furthermore, the kinetic parameters of the interaction between iL3 and Gα S were measured by surface plasmon resonance, and the apparent dissociation constant was determined to be 0.9 x 10 -6 M. In contrast, the second intracellular loop and C-terminal tail regions showed negligible affinity to Gα S . The critical residues within the iL3 region for the interaction with Gα S were identified as conserved positively charged residues near the C-terminus of iL3 by measuring the cellular levels of cAMP produced in response to 5-HT stimulation of cells transfected with 5-HT 6 receptor mutants

  17. KTA collection of terms and definitions. As of June 30, 1991. (To replace publication KTA-GS--12 of June 30, 1989)

    International Nuclear Information System (INIS)

    Skerhut, G.

    1991-01-01

    The collection of definitions mainly comprises terms which are laid down in the recommendations of the Nuclear Engineering Committee (KTA) or in overriding regulations and specifications. The collection aims at a KTA-standardized use of terms and at the avoidance of groundless divergences. The compiled definitions are followed by a list of the sources considered, namely laws, ordinances, administrative recommendations, KTA regulations as well as other recommendations and standards. (orig.) [de

  18. Analysis of coupling of M2 muscarinic acetylcholine receptors to Gi/o, Gs and Gq heterotrimeric GTP-binding proteins

    Czech Academy of Sciences Publication Activity Database

    Jakubík, Jan; Doležal, Vladimír

    2006-01-01

    Roč. 27, č. S1 (2006), s. 361-361 ISSN 1671-4083. [World Congress of Pharmacology /15./. 02.07.2006-07.07.2006, Beijing] R&D Projects: GA ČR(CZ) GA305/05/0452; GA MŠk(CZ) LC554 Institutional research plan: CEZ:AV0Z50110509 Keywords : M2 receptor * heterotrimeric G-proteins * analysis of coupling Subject RIV: ED - Physiology

  19. Industry-wide Inter-organizational Systems and Data Quality : Exploratory findings of the use of GS1 standards in the Dutch retail market

    NARCIS (Netherlands)

    Dalmolen, Simon; Moonen, Hans; van Hillegersberg, Jos

    2015-01-01

    Standards in general promise more efficiency and effectiveness in doing (electronic) business. Lowering the costs of collaboration, achieving these gains depends of the development and adoption of the standard in its business environment. Several studies report on research on electronic data

  20. Hypoxia activates a Ca2+-permeable cation conductance sensitive to carbon monoxide and to GsMTx-4 in human and mouse sickle erythrocytes.

    OpenAIRE

    David H Vandorpe; Chang Xu; Boris E Shmukler; Leo E Otterbein; Marie Trudel; Frederick Sachs; Philip A Gottlieb; Carlo Brugnara; Seth L Alper

    2010-01-01

    Background: Deoxygenation of sickle erythrocytes activates a cation permeability of unknown molecular identity (Psickle), leading to elevated intracellular [Ca2+] ([Ca2+]i) and subsequent activation of KCa 3.1. The resulting erythrocyte volume decrease elevates intracellular hemoglobin S (HbSS) concentration, accelerates deoxygenation-induced HbSS polymerization, and increases the likelihood of cell sickling. Deoxygenation-induced currents sharing some properties of Psickle have been recorded...

  1. Gérard Guyon, La Règle de Saint Benoît: aux sources du droit..., DMM, Poitiers Cedex, 2012, 190 págs.

    Directory of Open Access Journals (Sweden)

    Guillermo Hierrezuelo Conde

    2013-03-01

    Full Text Available En esta monografía Guyon estudia ampliamente la Regla de San Benito, fundada por su homónimo, considerado como uno de los "Padres de Europa". Sus reglas, influidas en gran medida por el Derecho Romano, alcanzaron gran predicamento sobre todo a partir del siglo VI. Los dos pilares básicos que conformaban la Regla benedictina eran el oficio divino, de una parte, y la lección divina o el trabajo, de otra. San Benito obligaba a dedicar entre cuatro y ocho horas diarias al oficio divino y siete horas para dormir; y las restantes horas a trabajar, a estudiar o a la lectura religiosa. En caso de incumplimiento de las normas se establecían sanciones, que tenían su fundamento en el Derecho privado romano. Asimismo, diferenciaba entre la culpa y el dolo. Además, la Regla se basaba en los principios de la caridad y el acogimiento, si bien limitaba al máximo la permanencia de extranjeros dentro de la comunidad, para evitar que surgieran conflictos internos. La figura del abad en los monasterios adquiría un papel relevante en la medida en que presentaba como un auténtico Padre, pero como un Padre que juzgaba.

  2. LUIS PUELLES ROMERO. Honoré Daumier. La risa republicana. Madrid: Adaba Editores, 2014, 427 págs., 154 ils.

    Directory of Open Access Journals (Sweden)

    Miguel Ángel Gamonal Torres

    2016-07-01

    Full Text Available Hacer una aportación significativa al conocimiento de Daumier, su obra y su época, es una tarea que Luis Puelles, Profesor de Estética y Teoría de las Artes de la Universidad de Málaga, cumple de manera muy satisfactoria, sobre todo para el lector interesado que encuentra un sobresaliente ensayo en español, construido sobre la muy abundante literatura crítica e histórico-artística existente sobre el artista francés, pero también sobre el brillante dominio que el autor muestra de un sinfín de cuestiones y enfoques de índole estético-filosófico, aunque también sociológico, crítico-literario, etc. …

  3. THE DETERMINATION OF NON-PESTICIDAL AND PESTICIDAL ORGANOTIN COMPOUNDS IN WATER BY GAS CHROMATOGRAPHY WITH [PULSED] FLAME PHOTOMETRIC DETECTION (GS/PFPD): THE EFFECTS OF "MASS" DISCRIMINATION

    Science.gov (United States)

    Capillary gas chromatography with GC/PFPD was used in the development of analytical methodology for determining both non-pesticidal and pesticidal organotin compounds in drinking water and other aqueous matrices. The method involves aqueous ethylation of organotin analytes with ...

  4. Notification and authorization for the use of radiation sources (Supplement to IAEA Safety Standards Series No. GS-G-1.5)

    International Nuclear Information System (INIS)

    2011-10-01

    The achievement and maintenance of a high level of safety in the use of radiation sources depend on there being a sound legal and governmental infrastructure, including a national regulatory body with well-defined responsibilities and functions. These responsibilities and functions include establishing and implementing a system for notification and authorization for control over radiation sources, including a system for review and assessment of applications for authorization. The Safety Requirements publication entitled Legal and Governmental Infrastructure for Nuclear, Radiation, Radioactive Waste and Transport Safety establishes the requirements for legal and governmental infrastructure. The term 'infrastructure' refers to the underlying structure of systems and organizations. This includes requirements concerning the establishment of a regulatory body for radiation sources and the responsibilities and functions assigned to it. The International Basic Safety Standards for Protection against Ionizing Radiation and for the Safety of Radiation Sources (the Basic Safety Standards or the BSS) establish basic requirements for protection against risks associated with exposure to ionizing radiation and for the safety of radiation sources. The application of the BSS is based on the presumption that national infrastructures are in place to enable governments to discharge their responsibilities to for radiation protection and safety. This TECDOC provides practical guidance on the process for dealing with applications for authorization and accepting notifications to regulatory bodies. Examples of guidelines that may be used by persons required to notify or apply for authorization and of the regulatory body's review and assessment procedures are provided in the Appendices. The TECDOC is oriented towards national regulatory infrastructures concerned with protection and safety for radiation sources used in medicine, industry, agriculture, research and education. The IAEA officers responsible for this publication were B. Djermouni and T. Boal of the Division of Radiation and Waste Safety.

  5. Cross-communication between Gi and Gs in a G-protein-coupled receptor heterotetramer guided by a receptor C-terminal domain.

    Science.gov (United States)

    Navarro, Gemma; Cordomí, Arnau; Brugarolas, Marc; Moreno, Estefanía; Aguinaga, David; Pérez-Benito, Laura; Ferre, Sergi; Cortés, Antoni; Casadó, Vicent; Mallol, Josefa; Canela, Enric I; Lluís, Carme; Pardo, Leonardo; McCormick, Peter J; Franco, Rafael

    2018-02-28

    G-protein-coupled receptor (GPCR) heteromeric complexes have distinct properties from homomeric GPCRs, giving rise to new receptor functionalities. Adenosine receptors (A 1 R or A 2A R) can form A 1 R-A 2A R heteromers (A 1 -A 2A Het), and their activation leads to canonical G-protein-dependent (adenylate cyclase mediated) and -independent (β-arrestin mediated) signaling. Adenosine has different affinities for A 1 R and A 2A R, allowing the heteromeric receptor to detect its concentration by integrating the downstream G i - and G s -dependent signals. cAMP accumulation and β-arrestin recruitment assays have shown that, within the complex, activation of A 2A R impedes signaling via A 1 R. We examined the mechanism by which A 1 -A 2A Het integrates G i - and G s -dependent signals. A 1 R blockade by A 2A R in the A 1 -A 2A Het is not observed in the absence of A 2A R activation by agonists, in the absence of the C-terminal domain of A 2A R, or in the presence of synthetic peptides that disrupt the heteromer interface of A 1 -A 2A Het, indicating that signaling mediated by A 1 R and A 2A R is controlled by both G i and G s proteins. We identified a new mechanism of signal transduction that implies a cross-communication between G i and G s proteins guided by the C-terminal tail of the A 2A R. This mechanism provides the molecular basis for the operation of the A 1 -A 2A Het as an adenosine concentration-sensing device that modulates the signals originating at both A 1 R and A 2A R.

  6. Time-differential observation of alpha -particle perturbed angular distribution; g-factor measurements for /sup 217/Ac/sup gs/ and /sup 217/Ac/sup m/

    CERN Document Server

    Maier, K H; Grawe, H; Kluge, H

    1981-01-01

    The g-factor measurements of the ground state and an isomeric level in /sup 217/Ac using the DPAD method with alpha -decay are described. The results of gamma -ray g-factor measurements for the isomer and a tentative decay scheme produced by alpha - gamma and gamma - gamma coincidence experiments are also presented. An analysis of the alpha - particle angular distributions suggests that nuclear deformation affects the observed anisotropy. (13 refs).

  7. Antonio María Baggio, Adriana Cosseddu y Antonio Márquez Prieto (Coord., Fraternidad y Justicia, Comares, Granada, 2012, 94 págs.

    Directory of Open Access Journals (Sweden)

    Guillermo Hierrezuelo Conde

    2013-03-01

    Full Text Available Esta obra nos ofrece una visión triádica entre libertad, justicia y fraternidad, destacando el carácter novedoso de esta última. En efecto, únicamente un análisis conjunto de las tres categorías permitiría alcanzar, según sus autores, un significado pleno de la fraternidad. Esta relación queda en evidencia en el art. 1 de la Declaración Universal de los Derechos del hombre. De hecho, se destaca a la fraternidad como el principio olvidado de la revolución francesa (liberté, egalité, fraternité. Diversos autores la analizan como categoría política, lo que permitiría corregir algunos errores e injusticias de los sistemas políticos. Por otro lado, en la fraternidad podemos observar la relacionalidad, entendida como las relaciones entre los hombres. Asimismo, cuando hablamos de justicia se requieren tres elementos: la relacionalidad, la reciprocidad y la socialidad, en la medida en que la relación requiere lugar en el espacio social, donde adquiere sentido.

  8. Polymerase recognition of 2-thio-iso-guanine·5-methyl-4-pyrimidinone (iGs·P)--A new DD/AA base pair.

    Science.gov (United States)

    Lee, Dong-Kye; Switzer, Christopher

    2016-02-15

    Polymerase specificity is reported for a previously unknown base pair with a non-standard DD/AA hydrogen bonding pattern: 2-thio-iso-guanine·5-methyl-4-pyrimidinone. Our findings suggest that atomic substitution may provide a solution for low fidelity previously associated with enzymatic copying of iso-guanine. Copyright © 2016 Elsevier Ltd. All rights reserved.

  9. Energy-based culture medium design for biomanufacturing optimization: A case study in monoclonal antibody production by GS-NS0 cells.

    Science.gov (United States)

    Quiroga-Campano, Ana L; Panoskaltsis, Nicki; Mantalaris, Athanasios

    2018-03-02

    Demand for high-value biologics, a rapidly growing pipeline, and pressure from competition, time-to-market and regulators, necessitate novel biomanufacturing approaches, including Quality by Design (QbD) principles and Process Analytical Technologies (PAT), to facilitate accelerated, efficient and effective process development platforms that ensure consistent product quality and reduced lot-to-lot variability. Herein, QbD and PAT principles were incorporated within an innovative in vitro-in silico integrated framework for upstream process development (UPD). The central component of the UPD framework is a mathematical model that predicts dynamic nutrient uptake and average intracellular ATP content, based on biochemical reaction networks, to quantify and characterize energy metabolism and its adaptive response, metabolic shifts, to maintain ATP homeostasis. The accuracy and flexibility of the model depends on critical cell type/product/clone-specific parameters, which are experimentally estimated. The integrated in vitro-in silico platform and the model's predictive capacity reduced burden, time and expense of experimentation resulting in optimal medium design compared to commercially available culture media (80% amino acid reduction) and a fed-batch feeding strategy that increased productivity by 129%. The framework represents a flexible and efficient tool that transforms, improves and accelerates conventional process development in biomanufacturing with wide applications, including stem cell-based therapies. Copyright © 2018. Published by Elsevier Inc.

  10. Biased Gs Versus Gq Proteins and β-Arrestin Signaling in the NK1 Receptor Determined by Interactions in the Water Hydrogen Bond Network

    DEFF Research Database (Denmark)

    Valentin-Hansen, Louise; Frimurer, Thomas M; Mokrosinski, Jacek

    2015-01-01

    X-ray structures, molecular dynamics simulations, and mutational analysis have previously indicated that an extended water hydrogen bond network between trans-membranes I-III, VI, and VII constitutes an allosteric interface essential for stabilizing different active and inactive helical...... of the highly conserved AspII:10 (2.50). Here, we find that this GluII:10 occupies the space of a putative allosteric modulating Na(+) ion and makes direct inter-helical interactions in particular with SerIII:15 (3.39) and AsnVII:16 (7.49) of the NPXXY motif. Mutational changes in the interface between GluII:10....... It is concluded that the interface between position II:10 (2.50), III:15 (3.39), and VII:16 (7.49) in the center of the water hydrogen bond network constitutes a focal point for fine-tuning seven trans-membrane receptor conformations activating different signal transduction pathways....

  11. William F. Sater, La imagen heroica de Chile: Arturo Prat, santo secular, Santiago, Centro de Estudios Bicentenario, 2005, 231 págs.

    Directory of Open Access Journals (Sweden)

    SANTIAGO ARÁNGUIZ PINTO

    2011-10-01

    Full Text Available LA PERSONA Y LA FIGURA de Arturo Prat parece que, a simple vista, representan una misma y única unidad. Pero, si profundizamos algo más en la vida de este marino y abogado, nos daremos cuenta de que sus datos biográficos y la percepción que tuvo la sociedad de éste, varían considerablemente, pues, por su misma condición de héroe, está sujeto a los vaivenes interpretativos propios de la sobreabundante mitología nacional. Y es que el héroe, dice Sater, plantea otras problemáticas y disyuntivas cuando se le estudia, diferente a las del hombre público que posee figuración o renombre. En el héroe, por el contrario, confluyen elementos que responden a otro tipo de variables sociales, espirituales y culturales, y que es, por cierto, la preocupación fundamental que se ha propuesto desarrollar en este libro el historiador norteamericano. Analizar, comprender o estudiar la imagen heroica de Prat exige la participación de otros elementos analíticos que, a su vez, se plantean en relación a determinados momentos de la historia de Chile. No hay dudas al respecto: a nadie dejaba indiferente los rasgos y virtudes que desprendía la cautivante personalidad de Prat, considerando que éste era un ejemplo único de abnegación, heroísmo y de entrega hacia su patria, digno de imitar y difundir hacia el resto de la sociedad. Cada vez que ocurría alguna desgracia, el país requería a su vez de un estímulo moral para superar los problemas nacionales. ¿Cómo lograrlo? Recurriendo a Prat, que luego se transformaría en una práctica común, que excedió los límites de la mesura y el entendimiento.

  12. Bourke, Joanna. Los violadores: historia del estupro de 1860 a nuestros días. Barcelona: Crítica, 2009, 702 págs

    Directory of Open Access Journals (Sweden)

    Ingrid Viviana Serrano Ramírez

    2012-07-01

    Full Text Available Joanna Bourke es nacida en Blenheim, Nueva Zelanda en el año de 1963, actualmente es catedrática de Historia en el Birkbeck College, de la Universidad de Londres. se describe a sí misma como una «socialista feminista», ha tratado un amplio abanico de temas en sus investigaciones: la historia de la clase obrera y el trabajo de las mujeres, las experiencias de los hombres y las mujeres durante la guerra, la historia de las emociones, especialmente del miedo y el odio, y la historia de la violencia sexual. Actualmente, dirige una investigación sobre el dolor corporal a lo largo de los dos últimos siglos. Entre sus libros están traducidos La Segunda Guerra Mundial: una historia de las víctimas Empúries, 2003; Paidós, 2002, Sed de sangre: historia íntima del combate cuerpo a cuerpo en las guerras del siglo XX (Crítica, 2008 y Los violadores: historia del estupro de 1860 a nuestros días (Crítica, 2009. Recientemente, ha publicado What it Means to be Human. Reflections from 1791 to the Present (Virago, 2011.

  13. Studies on formation of unconfined detonable vapor cloud using explosive means.

    Science.gov (United States)

    Apparao, A; Rao, C R; Tewari, S P

    2013-06-15

    Certain organic liquid fuels like hydrocarbons, hydrocarbon oxides, when dispersed in air in the form of small droplets, mix with surrounding atmosphere forming vapor cloud (aerosol) and acquire explosive properties. This paper describes the studies on establishment of conditions for dispersion of fuels in air using explosive means resulting in formation of detonable aerosols of propylene oxide and ethylene oxide. Burster charges based on different explosives were evaluated for the capability to disperse the fuels without causing ignition. Parameters like design of canister, burster tube, burster charge type, etc. have been studied based on dispersion experiments. The detonability of the aerosol formed by the optimized burster charge system was also tested. Copyright © 2013 Elsevier B.V. All rights reserved.

  14. Bursting oscillations, bifurcation and synchronization in neuronal systems

    Energy Technology Data Exchange (ETDEWEB)

    Wang Haixia [School of Science, Nanjing University of Science and Technology, Nanjing 210094 (China); Wang Qingyun, E-mail: drwangqy@gmail.com [Department of Dynamics and Control, Beihang University, Beijing 100191 (China); Lu Qishao [Department of Dynamics and Control, Beihang University, Beijing 100191 (China)

    2011-08-15

    Highlights: > We investigate bursting oscillations and related bifurcation in the modified Morris-Lecar neuron. > Two types of fast-slow bursters are analyzed in detail. > We show the properties of some crucial bifurcation points. > Synchronization transition and the neural excitability are explored in the coupled bursters. - Abstract: This paper investigates bursting oscillations and related bifurcation in the modified Morris-Lecar neuron. It is shown that for some appropriate parameters, the modified Morris-Lecar neuron can exhibit two types of fast-slow bursters, that is 'circle/fold cycle' bursting and 'subHopf/homoclinic' bursting with class 1 and class 2 neural excitability, which have different neuro-computational properties. By means of the analysis of fast-slow dynamics and phase plane, we explore bifurcation mechanisms associated with the two types of bursters. Furthermore, the properties of some crucial bifurcation points, which can determine the type of the burster, are studied by the stability and bifurcation theory. In addition, we investigate the influence of the coupling strength on synchronization transition and the neural excitability in two electrically coupled bursters with the same bursting type. More interestingly, the multi-time-scale synchronization transition phenomenon is found as the coupling strength varies.

  15. The non-analog double charge exchange transition /sup 12/C(π/sup +/,π/sup -/)/sup 12/O/sub (g.s.)/ and /sup 16/O(π/sup +/,π/sup -/)/sup 16/Ne/sub (g.s.)/

    International Nuclear Information System (INIS)

    Wei-hsing, M.; Si-wen, W.; Gao-you, Z.; Chung-Kuang, C.; Zhen-rong, Y.; Shu-ping, Z.

    1986-01-01

    We proposed six possible reason exchange current mechanism for pion induced non-analog double charge exchange transition on /sup 12/C(π/sup +/, π/sup -/)/sup 12/O(g.s.) and /sup 16/O(π/sup +/, π/sup -/)/sup 16/N/sub e/(g.s.). Under the model, the authors calculated 164 MeV angular distribution. The theoretical results are compared with the existed data and are in a good agreement with the experimental data available. It strongly indicates that the non-analog DCX process is basically a diffractive process through double isobar excitation on a single nucleon and the dominant contribution to the process comes from one of the six diagrams, that is a π/sup +/ collides with a neutron to excite this neutron into an isobar Δ(1232) with charge of one unit; subsequently, the Δ/sup +/ decays to give π/sup +/Δ/sup o/ and then produced π/sup +/ is absorbed by the second target neutron which will be then turned to a proton. Meanwhile the traveling Δ/sup o/ finally decays into π/sup -/P so that the course of the process under consideration here is ended

  16. Theory of optical flashes

    International Nuclear Information System (INIS)

    London, R.A.

    1983-01-01

    The theory of optical flashes created by x- and γ-ray burst heating of stars in binaries is reviewed. Calculations of spectra due to steady-state x-ray reprocessing and estimates of the fundamental time scales for the non-steady case are discussed. The results are applied to the extant optical data from x-ray and γ-ray bursters. Finally, I review predictions of flashes from γ-ray bursters detectable by a state of the art all-sky optical monitor

  17. Cosmic gamma-ray bursts

    International Nuclear Information System (INIS)

    Hurley, K.

    1989-01-01

    This paper reviews the essential aspects of the gamma-ray burst (GRB) phenomenon, with emphasis on the more recent results. GRBs are introduced by their time histories, which provide some evidence for a compact object origin. The energy spectra of bursts are presented and they are seen to demonstrate practically unambiguously that the origin of some GRBs involves neutron stars. Counterpart searches are reviewed briefly and the statistical properties of bursters treated. This paper presents a review of the three known repeating bursters (the Soft Gamma Repeaters). Extragalactic and galactic models are discussed and future prospects are assessed

  18. Explosive Transient Camera (ETC) Program

    Science.gov (United States)

    1991-10-01

    Discovery of the first of the slow X-ray pulsars , GX 1+4 (1970). • Discovery of the size and shape of the hard X-ray emitting region of the Crab Nebula (1974... pulsars (1968), gamma-ray bursters (1970), and X-ray bursters (1973). For each of these classes of objects, the initial discovery was made by non-optical...ray galaxies typified by NGC5506 (1977) • Discovery of the first "X-ray QSO," MR2251-178 (1977). Development of a highly efficient ground-based, solid

  19. Robert Muchembled. El Orgasmo y Occidente. Una Historia del Placer desde el Siglo XVI a nuestros días. Buenos Aires: Fondo de Cultura Económica, 2008, 425 págs.

    Directory of Open Access Journals (Sweden)

    Diana Crucelly González Rey

    2012-07-01

    Full Text Available El orgasmo, la voluptuosidad, el disfrute, solían ser un tema tabú en occidente. Robert Muchembled presenta esta historia social, producto de su estancia académica en el Institute for Advanced Study de Princenton, en un extenso argumento que abarca desde el Renacimiento en los siglos XVI y XVII hasta nuestros días en lo que el autor ha denominado “el triunfo del narcisismo”.

  20. Model Regulations for the Use of Radiation Sources and for the Management of the Associated Radioactive Waste. Supplement to IAEA Safety Standards Series No. GS-G-1.5

    International Nuclear Information System (INIS)

    2015-01-01

    IAEA Safety Standards Series No. GSR Part 1, Governmental, Legal and Regulatory Framework for Safety, requires that governments establish laws and statutes to make provisions for an effective governmental, legal and regulatory framework for safety. The framework for safety includes the establishment of a regulatory body. The regulatory body has the authority and responsibility for promulgating regulations, and for preparing their implementation. This publication provides advice on an appropriate set of regulations covering all aspects of the use of radiation sources and the safe management of the associated radioactive waste. The regulations provide the framework for the regulatory requirements and conditions to be incorporated into individual authorizations for the use of radiation sources in industry, medical facilities, research and education and agriculture. The regulations also establish criteria to be used for assessing compliance. This publication allows States to appraise the adequacy of their existing regulations and regulatory guides, and can be used as a reference for those States developing regulations for the first time. The regulations set out in this publication will need to be adapted to take account of local conditions, technical resources and the scale of facilities and activities in the State. The set of regulations in this publication is based on the requirements established in the IAEA safety standards series, in particular in IAEA Safety Standards Series No. GSR Part 3 (Interim), Radiation Protection and Safety of Radiation Sources: International Basic Safety Standards, in IAEA Safety Standards Series No. GSR Part 5, Predisposal Management of Radioactive Waste, and in IAEA Safety Standards Series No. SSR-5, Disposal of Radioactive Waste. They are also derived from the Code of Conduct of the Safety and Security of Radiation Sources and the Guidance on the Import and Export of Radioactive Sources. This publication allows States to appraise the adequacy of their existing regulations and regulatory guides

  1. Manuel J. Peláez (dir., Diccionario de Canonistas y Eclesiasticistas Europeos y Americanos (Tomo I, AV Akademikerverlag GmbH & Co. KG, EAE, Saarbrücken, 2012, 547 págs.

    Directory of Open Access Journals (Sweden)

    Purificación Alcaide-Pulido

    2013-03-01

    Full Text Available ¿Por qué se otorga escasa atención a los canonistas y eclesiasticistas dentro del Derecho canónico y del Derecho eclesiástico? Esta es la cuestión que surge y el motivo de la aparición de la obra Diccionario de canonistas y eclesiasticistas europeos y americanos. Dicha obra aparece como una necesidad científica emanada de la escasa atención que en el ámbito citado se presta a canonistas y a eclesiasticistas, a través de una recopilación de los pensadores más influyentes en las diversas áreas que comprenden el Derecho Canónico y Eclesiástico, a lo largo del último milenio y, por ende, también de interés para iushistoricistas.

  2. Comment on 'Clay mineralogy of the Pelagic sediments: along a west-east transect in the Indian Ocean by G.S. Roonwal and S.K. Srivastava' Journal of the Geological Society of India 38; 1991; 37-54'

    Digital Repository Service at National Institute of Oceanography (India)

    Rao, V.P

    stream_size 2 stream_content_type text/plain stream_name J_Geol_Soc_India_38_539.pdf.txt stream_source_info J_Geol_Soc_India_38_539.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset=ISO-8859-1 ...

  3. Antonio Sánchez-Bayón, Sistema de Derecho Comparado y global: de las familias jurídicas mundiales al nuevo Derecho común, Tirant lo Blanch, Valencia, 2012, 161 págs.

    Directory of Open Access Journals (Sweden)

    Natalia del Barrio

    2013-03-01

    Full Text Available Dr. Sánchez-Bayón untersucht in dieser Studie die Notwendigkeit, das Konzept des Vergleichenden Rechts in Zeiten der Globalisierung neu zu überdenken. Die kulturellen, politischen und soziologischen Wechsel müssen an die neue Weltlage angepasst werden. Die juristischen Lösungen müssen verglichen werden, so dass die Spielregeln und der professionelle technische Sprachgebrauch angeglichen werden können; nur so können die Antworten auf die Konsolidierung des gemeinschaftlichen Rechts gefunden werden. Der Autor stellt den formalistischen Positivismus des Staates in Frage.

  4. Salustiano de Dios y Eugenia Torijano (coords., Cultura, política y práctica del Derecho. Juristas de Salamanca, Siglos XV-XX, Ediciones Universidad de Salamanca, Salamanca, 2012, 567 págs.

    Directory of Open Access Journals (Sweden)

    Guillermo Hierrezuelo Conde

    2013-03-01

    Full Text Available En esta obra se recogen hasta siete estudios relativos a juristas de Salamanca en el período que comprende desde el s. XV hasta el pasado siglo XX. El primero de ellos está dedicado a distintos juristas salmantinos que vivieron durante el s. XV, destacando la figura de Pedro de Luna, conocido como papa Benedicto XIII; el segundo de los artículos pone de relieve la importancia de los colegios mayores salmantinos, institución en la que se tramitaron numerosos expedientes a los colegiales para la averiguación de la limpieza de sangre, así como otros aspectos, como la honorabilidad de la línea familiar; la tercera de las colaboraciones gira en torno a la figura del oficial de la administración española en el s. XVIII, y a las referencias que sobre ella se recogen en la obra de Jean Pierre Dedieu titulada La muerte del letrado; el cuarto estudia la personalidad del catedrático Vicente Fernández de Ocampo, que vivió entre 1743 y 1815; el quinto al informe realizado al proyecto de Código Civil de 1851 por la Facultad de jurisprudencia de la Universidad de Salamanca, que aunque no llegó a entrar en vigor adquirió gran trascendencia en el ámbito civil; el sexto, a la importancia de las audiencias de lo criminal de Salamanca y Ciudad Rodrigo, hasta la supresión de esta última; y el último de ellos, a aquellos profesores de la Universidad de Salamanca que vivieron los primeros años de la Dictadura franquista, entre los que podemos citar a Teodoro Andrés Marcos y Nicolás Rodríguez Aniceto, entre otros.

  5. Model Regulations for the Use of Radiation Sources and for the Management of the Associated Radioactive Waste. Supplement to IAEA Safety Standards Series No. GS-G-1.5

    International Nuclear Information System (INIS)

    2013-12-01

    IAEA Safety Standards Series No. GSR Part 1, Governmental, Legal and Regulatory Framework for Safety, requires that governments establish laws and statutes to make provisions for an effective governmental, legal and regulatory framework for safety. The framework for safety includes the establishment of a regulatory body. The regulatory body has the authority and responsibility for promulgating regulations, and for preparing their implementation. This publication provides advice on an appropriate set of regulations covering all aspects of the use of radiation sources and the safe management of the associated radioactive waste. The regulations provide the framework for the regulatory requirements and conditions to be incorporated into individual authorizations for the use of radiation sources in industry, medical facilities, research and education and agriculture. The regulations also establish criteria to be used for assessing compliance. This publication allows States to appraise the adequacy of their existing regulations and regulatory guides, and can be used as a reference for those States developing regulations for the first time. The regulations set out in this publication will need to be adapted to take account of local conditions, technical resources and the scale of facilities and activities in the State. The set of regulations in this publication is based on the requirements established in the IAEA safety standards series, in particular in IAEA Safety Standards Series No. GSR Part 3 (Interim), Radiation Protection and Safety of Radiation Sources: International Basic Safety Standards, in IAEA Safety Standards Series No. GSR Part 5, Predisposal Management of Radioactive Waste, and in IAEA Safety Standards Series No. SSR-5, Disposal of Radioactive Waste. They are also derived from the Code of Conduct of the Safety and Security of Radiation Sources and the Guidance on the Import and Export of Radioactive Sources. This publication allows States to appraise the adequacy of their existing regulations and regulatory guides

  6. Final Site-Specific Technical Report for the Evaluation of Thermatrix GS Series Flameless Thermal Oxidzer for Off-Gas Treatment of Trichloroethene Vapors at Building 181 Air Force Plant 4, Texas

    National Research Council Canada - National Science Library

    Archabal, Steven

    1998-01-01

    The Air Force Center for Environmental Excellence (AFCEE) has sponsored an ongoing program to promote the use of cost-effective soil vapor treatment technologies in conjunction with soil vapor extraction (SVE...

  7. Site-Specific Technical Report for the Evaluation of Thermatrix GS Series Flameless Thermal Oxidizer for Off-Gas Treatment of Soil Vapors with Volatile Organic Compounds at the Source Area Reduction System, Former Lowry Air Force Base, Colorado

    National Research Council Canada - National Science Library

    Archabal, Steven

    1998-01-01

    The Air Force Center for Environmental Excellence (AFCEE) has sponsored an ongoing program to promote the use of cost-effective soil vapor treatment technologies in conjunction with soil vapor extraction (SVE...

  8. RESEÑA DE: PÉREZ GARZÓN, Juan Sisinio (ed.: Experiencias republicanas en la historia de España, Madrid, Los Libros de la Catarata, 2015, 349 págs.

    Directory of Open Access Journals (Sweden)

    Sergio Sánchez Collantes

    2016-05-01

    Full Text Available Este nuevo libro reúne un conjunto de investigaciones que dirigen su atención a varias de las lagunas que todavía demandan un tratamiento específico por parte de la historiografía. Se trata de uno de los frutos de un proyecto de investigación que, financiado por el Ministerio de Economía y Competitividad, fue dirigido por Juan Sisinio Pérez Garzón en la Universidad de Castilla-La Mancha, con la que se relacionan todos los autores de la obra por formación o por vinculación laboral. Los capítulos no se estructuran en bloques, pero, si nos propusiéramos agruparlos por temas, que es lo que haremos en nuestra exposición, hallamos dos biografías, tres estudios sobre aspiraciones republicanas, un par de análisis que cabría relacionar con las condiciones o fórmulas de acceso al poder y otros dos trabajos que, cronológicamente, vienen a servir de alfa y omega a todos los anteriores. 

  9. Discovery and Synthesis of GS-5734, a Phosphoramidate Prodrug of a Pyrrolo[2,1 f][triazin-4-amino] Adenine C-Nucleoside for the Treatment of Ebola and Emerging Viruses

    Science.gov (United States)

    2017-01-26

    10 mM KCl, 1 mM dithiothreitol (DTT), 0.1 mg/ml bovine serum albumin (BSA), 0.2 U/µl RNasin Plus RNase inhibitor (Promega),4 ng/µl sshRNA, 5 mM...for 90 min at 30 °C. After 90 min, 10 µl of the reaction mixture was spotted on DE81 anion exchange paper (Whatman, United Kingdom), which was then...washed with 3× Na2HPO4 (125 mM [pH 9]), 1× water, and 1× ethyl alcohol (EtOH). The filter paper was air-dried and exposed to the phosphorimager

  10. Calf thymus histone-conjugated magnetic poly(2-oxoethyl methacrylate) microspheres for affinity isolation of anti-histone IgGs from the blood serum of patients with systemic lupus erythematosus

    Czech Academy of Sciences Publication Activity Database

    Horák, Daniel; Plichta, Zdeněk; Starykovych, M.; Myronovskij, S.; Kit, Y.; Chopyak, V.; Stoika, R.

    2015-01-01

    Roč. 5, č. 77 (2015), s. 63050-63055 ISSN 2046-2069 R&D Projects: GA MŠk(CZ) 7E12053 EU Projects: European Commission(XE) 246513 - NADINE Institutional support: RVO:61389013 Keywords : magnetic * systemic lupus erythematosis * histone Subject RIV: CD - Macromolecular Chemistry Impact factor: 3.289, year: 2015

  11. In brown adipocytes, adrenergically induced β1-/β3-(Gs)-, α2-(Gi)- and α1-(Gq)-signalling to Erk1/2 activation is not mediated via EGF receptor transactivation

    International Nuclear Information System (INIS)

    Wang, Yanling; Fälting, Johanna M.; Mattsson, Charlotte L.; Holmström, Therése E.; Nedergaard, Jan

    2013-01-01

    Brown adipose tissue is unusual in that the neurotransmitter norepinephrine influences cell destiny in ways generally associated with effects of classical growth factors: regulation of cell proliferation, of apoptosis, and progression of differentiation. The norepinephrine effects are mediated through G-protein-coupled receptors; further mediation of such stimulation to e.g. Erk1/2 activation is in cell biology in general accepted to occur through transactivation of the EGF receptor (by external or internal pathways). We have examined here the significance of such transactivation in brown adipocytes. Stimulation of mature brown adipocytes with cirazoline (α 1 -adrenoceptor coupled via G q ), clonidine (α 2 via G i ) or CL316243 (β 3 via G s ) or via β 1 -receptors significantly activated Erk1/2. Pretreatment with the EGF receptor kinase inhibitor AG1478 had, remarkably, no significant effect on Erk1/2 activation induced by any of these adrenergic agonists (although it fully abolished EGF-induced Erk1/2 activation), demonstrating absence of EGF receptor-mediated transactivation. Results with brown preadipocytes (cells in more proliferative states) were not qualitatively different. Joint stimulation of all adrenoceptors with norepinephrine did not result in synergism on Erk1/2 activation. AG1478 action on EGF-stimulated Erk1/2 phosphorylation showed a sharp concentration–response relationship (IC 50 0.3 µM); a minor apparent effect of AG1478 on norepinephrine-stimulated Erk1/2 phosphorylation showed nonspecific kinetics, implying caution in interpretation of partial effects of AG1478 as reported in other systems. Transactivation of the EGF receptor is clearly not a universal prerequisite for coupling of G-protein coupled receptors to Erk1/2 signalling cascades. - Highlights: • In brown adipocytes, norepinephrine regulates proliferation, apoptosis, differentiation. • EGF receptor transactivation is supposed to mediate GPCR-induced Erk1/2 activation. • α 1 -, α 2 -, β 1 -, β 3 -adrenoceptors all activate Erk1/2—but EGF receptor transactivation is not involved. • Adrenergic regulation of proliferation, apoptosis, differentiation must utilize cell-specific pathways in brown adipocytes. • EGF receptor transactivation is not universal in mediating GPCR-induced Erk1/2 activation

  12. The INTEGRAL view of intermediate long X-ray bursts

    DEFF Research Database (Denmark)

    a degenerated helium white dwarf. Of special interest are bursters showing events with very different durations, thus allowing us to study transitions between different nuclear burning regimes. Depending on the actual accretion rate, either the burning of a large amount of H is triggered by an He flash...

  13. What can NuSTAR do for X-ray bursts?

    DEFF Research Database (Denmark)

    Chenevez, Jérôme; Tomsick, John; Chakrabarty, Deepto

    2012-01-01

    burning are ejected in the burst expansion wind. We have investigated the possibility of observing with NuSTAR some X-ray bursters selected for their high burst rate and trend to exhibit so-called superexpansion bursts. Our main ambition is to detect the photoionization edges associated with the ejected...

  14. The dance of the double stars

    International Nuclear Information System (INIS)

    Theokas, A.

    1985-01-01

    The paper concerns pairs of stars orbiting one another. The evolutionary path model for close binary stars, involving a mass transfer of gases between the stars, is described. The life history of a single star; cataclysmic variables; the algol paradox, matter and lagranges' point; x-ray binaries and bursters; and pulsars; are all briefly discussed. (U.K.)

  15. INTEGRAL finds renewed X-ray activity of the Neutron star X-ray transient SAX J1750.8-2900

    DEFF Research Database (Denmark)

    Sanchez-Fernandez, Celia; Chenevez, Jérôme; Kuulkers, Erik

    2015-01-01

    INTEGRAL Galactic bulge monitoring observations (ATel #438) on UT 13 September 2015 18:50-22:32 reveal renewed X-ray activity from the low-mass X-ray binary transient and Type I X-ray burster SAX J1750.8-2900 (IAU Circ. #6597). The last outburst from this source was reported in 2011 (ATels #3170,...

  16. ORF Alignment: NC_005140 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available se ... [Vibrio vulnificus YJ016] ... Length = 74 ... Query: 670 AKELEIASKYKSEFLANMSHELRTPLNSILILSQLFANNKDGNLTAKQIESAKAINSS...GS 729 ... AKELEIASKYKSEFLANMSHELRTPLNSILILSQLFANNKDGNLTAKQIESAKAINSS...GS Sbjct: 1 ... AKELEIASKYKSEFLANMSHELRTPLNSILILSQLFANNKDGNLTAKQIESAKAINSSGS 60 ...

  17. ORF Alignment: NC_004460 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available se ... [Vibrio vulnificus YJ016] ... Length = 74 ... Query: 659 AKELEIASKYKSEFLANMSHELRTPLNSILILSQLFANNKDGNLTAKQIESAKAINSS...GS 718 ... AKELEIASKYKSEFLANMSHELRTPLNSILILSQLFANNKDGNLTAKQIESAKAINSS...GS Sbjct: 1 ... AKELEIASKYKSEFLANMSHELRTPLNSILILSQLFANNKDGNLTAKQIESAKAINSSGS 60 ...

  18. Study of the high energy emission of accreting compact objects with SPI/INTEGRAL

    International Nuclear Information System (INIS)

    Droulans, R.

    2011-01-01

    observed spectral variability in the framework of a new Comptonization model which accounts self-consistently for the presence of a magnetic field and introduce a purely non-thermal scenario as an alternative interpretation of the luminous hard state of accreting black hole binaries. Finally, I present a long term study of the high energy emission of the X-ray burster GS 1826-24. The accretion flow being extraordinarily stable, I integrated over 8 Msec of data allowing to measure the average source spectrum up to 500 keV. Once again, there is strong evidence for a hard spectral tail above 150 keV, establishing that this feature is not exclusively associated to black hole systems. I compare the results obtained for the three sources and discuss the possible physical origins of the high energy emission of stellar-size compact objects, emphasizing that all observed spectral shapes can be explained by a non-thermal magnetized corona model. (author)

  19. Summary Information on Employment, Characteristics, Supply, and Training

    Science.gov (United States)

    1967-05-01

    AGRICULTURAL SCIENCES and pest GS 406 Agricultural extension serv- ice GS 471 Agronomy GS 437 Horticulture GS 450 General agricultural admin...sciences Agronomy Animal husbandry Fish and wildlife Forestry and range sciences Horticulture Soil specialties Biological sciences Anatomy...enzymology 7704—Experimental therapeutics , clin- ical 770&—Industrial chemicals 7706 —Neuropharmacology 7707—Pharmacodynamics 7708

  20. Glutamine Synthetase Deficiency in Murine Astrocytes Results in Neonatal Death

    NARCIS (Netherlands)

    He, Youji; Hakvoort, Theodorus B. M.; Vermeulen, Jacqueline L. M.; Labruyère, Wilhelmina T.; de Waart, D. Rudi; van der Hel, W. Saskia; Ruijter, Jan M.; Uylings, Harry B. M.; Lamers, Wouter H.

    2010-01-01

    Glutamine synthetase (GS) is a key enzyme in the "glutamine-glutamate cycle" between astrocytes and neurons, but its function in vivo was thus far tested only pharmacologically. Crossing GS(fl/lacZ) or GS(fl/f)l mice with hGFAP-Cre mice resulted in prenatal excision of the GS(fl) allele in

  1. Three types of generalized synchronization

    Energy Technology Data Exchange (ETDEWEB)

    Yang Junzhong [School of Science, Beijing University of Posts and Telecomunications, Beijing 100876 (China)]. E-mail: jzyang@bupt.edu.cn; Hu Gang [China Center for Advanced Science and Technology (CCAST) (World Laboratory), PO Box 8730, Beijing 100080 (China) and Department of Physics, Beijing Normal University, Beijing 100875 (China)]. E-mail: ganghu@bnu.edu.cn

    2007-02-05

    The roles played by drive and response systems on generalized chaos synchronization (GS) are studied. And the generalized synchronization is classified, based on these roles, to three distinctive types: the passive GS which is mainly determined by the response system and insensitive to the driving signal; the resonant GS where phase synchronization between the drive and response systems is preceding GS; and the interacting GS where both the drive and response have influences on the status of GS. The features of these GS types and the possible changes from one types to others are investigated.

  2. Three types of generalized synchronization

    International Nuclear Information System (INIS)

    Yang Junzhong; Hu Gang

    2007-01-01

    The roles played by drive and response systems on generalized chaos synchronization (GS) are studied. And the generalized synchronization is classified, based on these roles, to three distinctive types: the passive GS which is mainly determined by the response system and insensitive to the driving signal; the resonant GS where phase synchronization between the drive and response systems is preceding GS; and the interacting GS where both the drive and response have influences on the status of GS. The features of these GS types and the possible changes from one types to others are investigated

  3. Dicty_cDB: SHJ393 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 1554 |AR551554.1 Sequence 6685 from patent US 6747137. 58 3e-04 1 DY586119 |DY586119.1 GS01JG03 Acropora millepora presettlement... |DY586847.1 GS01OG04 Acropora millepora presettlement library GS01 Acropora mill...epora cDNA clone GS01OG04, mRNA sequence. 38 0.029 2 DY587622 |DY587622.1 GS01YD02 Acropora millepora presettlement

  4. Growth hormone increases and maturation decreases glutamine synthetase turnover rate in rat liver

    International Nuclear Information System (INIS)

    Lin, C.K.

    1985-01-01

    An investigation was made of the effect of hypophysectomy and growth hormone (GH) replacement regimen (1 mg/100 g twice daily for 30 days); and maturation (from 25 up to 90 days) on the liver and brain glutamine synthetase (GS) mass and turnover rates in rats. The first order decay rate of enzyme 14 C radioactivity was determined between 1 and 4 days to obtain the half-life (T/sub 1/2/) of GS. The hepatic GS mass was determined by immunoassay. GS turnover (GS/sub s/) was calculated from T/sub 1/2/ and the GS mass (i.e., K = 0.693/T/sub 1/2/; GS/sub s/ = K x GS mass). It was concluded that: (1) GS specific activity is not decreased by hypophysectomy or increased by GH. These results suggested that observed endocrine induced changes in GS are due to changes in GS mass. (2) The liver GS turnover rate is significantly reduced by hypophysectomy and increased by GH replacement. It was proposed that GH specifically enhances synthesis of GS in the liver. (3) Maturation (25, 40, 60, and 90 days) decreases GS turnover rate in both liver and brain of normal rats. This similar effect of maturation suggests that the observed age induced decline in GS turnover rate is not related to GH in all tissues

  5. Differential diagnosis of Bartter syndrome, Gitelman syndrome, and pseudo-Bartter/Gitelman syndrome based on clinical characteristics.

    Science.gov (United States)

    Matsunoshita, Natsuki; Nozu, Kandai; Shono, Akemi; Nozu, Yoshimi; Fu, Xue Jun; Morisada, Naoya; Kamiyoshi, Naohiro; Ohtsubo, Hiromi; Ninchoji, Takeshi; Minamikawa, Shogo; Yamamura, Tomohiko; Nakanishi, Koichi; Yoshikawa, Norishige; Shima, Yuko; Kaito, Hiroshi; Iijima, Kazumoto

    2016-02-01

    Phenotypic overlap exists among type III Bartter syndrome (BS), Gitelman syndrome (GS), and pseudo-BS/GS (p-BS/GS), which are clinically difficult to distinguish. We aimed to clarify the differences between these diseases, allowing accurate diagnosis based on their clinical features. A total of 163 patients with genetically defined type III BS (n = 30), GS (n = 90), and p-BS/GS (n = 43) were included. Age at diagnosis, sex, body mass index, estimated glomerular filtration rate, and serum and urine electrolyte concentrations were determined. Patients with p-BS/GS were significantly older at diagnosis than those with type III BS and GS. Patients with p-BS/GS included a significantly higher percentage of women and had a lower body mass index and estimated glomerular filtration rate than did patients with GS. Although hypomagnesemia and hypocalciuria were predominant biochemical findings in patients with GS, 17 and 23% of patients with type III BS and p-BS/GS, respectively, also showed these abnormalities. Of patients with type III BS, GS, and p-BS/GS, 40, 12, and 63%, respectively, presented with chronic kidney disease. This study clarified the clinical differences between BS, GS, and p-BS/GS for the first time, which will help clinicians establish differential diagnoses for these three conditions.

  6. Relationship between the pitch of modulation collimators and the determination accuracy of source positions

    International Nuclear Information System (INIS)

    Fujii, Masami; Nishimura, Jun

    1989-01-01

    The celestial positions of X-ray bursters and gamma-ray burst sources can be accurately determined with rotating modulation collimators which possess wide fields of view and also high angular resolutions. Since the determination accuracy is dependent on the signal to noise ratio of incident photons, the distribution of signal power is analysed and the optimum pitch of the modulation collimator for a burst of a given size is discussed. (author)

  7. Nuclear astrophysics and nuclei far from stability

    International Nuclear Information System (INIS)

    Schatz, H.

    2003-01-01

    Unstable nuclei play a critical role in a number of astrophysical scenarios and are important for our understanding of the origin of the elements. Among the most important scenarios are the r-process (Supernovae), Novae, X-ray bursters, and Superbursters. For these astrophysical events I review the open questions, recent developments in astronomy, and how nuclear physics, in particular experiments with radioactive beams, needs to contribute to find the answers. (orig.)

  8. Inelastic Branch of the Stellar Reaction $^{14}$O$(\\alpha,p)^{17}$F

    CERN Multimedia

    Hass, M; Van duppen, P L E

    2002-01-01

    We propose to use the upgraded REX-ISOLDE beam energy to study the astrophysically important $^{14}$O($\\alpha$, p)$^{17}$F reaction in time reverse kinematics. In particular, we will use the highly efficient miniball + CD detection system to measure the previously undetermined inelastic proton branch of the 1$^-$ state at 6.15 MeV in $^{18}$Ne. This state dominates the reaction rate under X-ray burster conditions.

  9. INTEGRAL reports renewed activity from KS 1741-293

    DEFF Research Database (Denmark)

    Chenevez, Jérôme; Kuulkers, E.; Alfonso-Garzón, J.

    2010-01-01

    The low-mass X-ray binary and burster source KS 1741-293 has been detected during recent INTEGRAL Galactic bulge (see ATel #438) observations by the JEM-X instrument. On February 25, 2010, between UTC 13:04 and 14:08, KS 1741-293 was detected at a 3-10 keV flux of 9 +/- 4 mCrab, and an upper limi...

  10. Gamma-ray transients and related astrophysical phenomena

    International Nuclear Information System (INIS)

    Lingenfelter, R.E.; Hudson, H.S.; Worrall, D.M.

    1982-01-01

    The workshop covered the study of the explosive phenomena responsible for the various gamma ray transients. X-ray burster observations and theories were also reviewed with emphasis on their relationship to gamma ray bursts. Recent observational data, particularly from the SMM, HEAO, and VENERA satellites made the workshop especially timely. Major headings include: gamma-ray transients, x-ray bursts, solar transients, and instrumental concepts. Individual items from the workshop were prepared separately for the data base

  11. The INTEGRAL Galactic bulge monitoring program: the first 1.5 years

    DEFF Research Database (Denmark)

    Kuulkers, E.; Shaw, S.E.; Paizis, A.

    2007-01-01

    V) black-hole candidate X-ray transient and three active weaker (less than or similar to 25 mCrab, 20-60 keV) neutron star X-ray transients. Most of the time a clear anti-correlation can be seen between the soft and hard X-ray emission in some of the X-ray bursters. Hard X-ray flares or outbursts in X...

  12. Modified gravity (MOG), the speed of gravitational radiation and the event GW170817/GRB170817A

    Science.gov (United States)

    Green, M. A.; Moffat, J. W.; Toth, V. T.

    2018-05-01

    Modified gravity (MOG) is a covariant, relativistic, alternative gravitational theory whose field equations are derived from an action that supplements the spacetime metric tensor with vector and scalar fields. Both gravitational (spin 2) and electromagnetic waves travel on null geodesics of the theory's one metric. MOG satisfies the weak equivalence principle and is consistent with observations of the neutron star merger and gamma ray burster event GW170817/GRB170817A.

  13. On exotic theories of gamma-ray bursts

    International Nuclear Information System (INIS)

    Hurley, K.; Toulouse-3 Univ., 31

    1989-01-01

    Some of the essential observational aspects of gamma ray bursts are reviewed. Although there is good evidence for a neutron star origin for perhaps 1 out of 4 bursters, the origin of the remaining 3 out of 4 is almost impossible to determine from the observations alone. The arguments in favor of a neutron star origin and in favor of an extragalactic origin are summarized. (orig.)

  14. Limits on the space density of gamma-ray burst sources

    International Nuclear Information System (INIS)

    Epstein, R.I.

    1985-01-01

    Gamma-ray burst spectra which extend to several MeV without significant steepening indicate that there is negligible degradation due to two-photon pair production. The inferred low rate of photon-photon reactions is used to give upper limits to the distances to the sources and to the intensity of the radiation from the sources. These limits are calculated under the assumptions that the bursters are neutron stars which emit uncollimated gamma rays. The principal results are that the space density of the gamma-ray burst sources exceeds approx.10 -6 pc -3 if the entire surface of the neutron star radiates and exceeds approx.10 -3 pc -3 if only a small cap or thin strip in the stellar surface radiates. In the former case the density of gamma-ray bursters is approx.1% of the inferred density of extinct pulsars, and in the latter case the mean mass density of burster sources is a few percent of the density of unidentified dark matter in the solar neighborhood. In both cases the X-ray intensity of the sources is far below the Rayleigh-Jeans limit, and the total flux is at most comparable to the Eddington limit. This implies that low-energy self-absorption near 10 keV is entirely negligible and that radiation-driven explosions are just barely possible

  15. Gene expression, cellular localisation and function of glutamine synthetase isozymes in wheat (Triticum aestivum L.)

    DEFF Research Database (Denmark)

    Bernard, Stéphanie M.; Møller, Anders Laurell Blom; Dionisio, Giuseppe

    2008-01-01

    ). Phylogenetic analysis showed that the wheat GS sub-families together with the GS genes from other monocotyledonous species form four distinct clades. Immunolocalisation studies in leaves, stems and rachis in plants at flowering showed GS protein to be present in parenchyma, phloem companion and perifascicular......We present the first cloning and study of glutamine synthetase (GS) genes in wheat (Triticum aestivum L.). Based on sequence analysis, phylogenetic studies and mapping data, ten GS sequences were classified into four sub-families: GS2 (a, b and c), GS1 (a, b and c), GSr (1 and 2) and GSe (1 and 2...... sheath cells. In situ localisation confirmed that GS1 transcripts were present in the perifascicular sheath cells whilst those for GSr were confined to the vascular cells. Studies of the expression and protein profiles showed that all GS sub-families were differentially expressed in the leaves, peduncle...

  16. Cytosolic glutamine synthetase in barley

    DEFF Research Database (Denmark)

    Thomsen, Hanne Cecilie

    remobilisation from ageing plant parts. Thus, GS is highly involved in determining crop yield and NUE. The major objective of this PhD project was to investigate the NUE properties of transgenic barley designed to constitutively overexpress a GS1 isogene (HvGS1.1). These transgenic lines exhibited an increased...... for N demand. Of the GS isogenes, only the transcript levels of root HvGS1.1 increased when plants were transferred from high to low N. This change coincided with an increase in total GS activity. Pronounced diurnal variation was observed for root nitrate transporter genes and GS isogenes in both root...... fertilizer requirement. The enzyme glutamine synthetase (GS) has been a major topic in plant nitrogen research for decades due to its central role in plant N metabolism. The cytosolic version of this enzyme (GS1) plays an important role in relation to primary N assimilation as well as in relation to N...

  17. Borja Gómez, Jaime y Rodríguez Jiménez, Pablo. Historia de la vida privada en Colombia. Tomo I: Las fronteras difusas del siglo XVI a 1880. Bogotá: Taurus, 2011, 396 págs.

    OpenAIRE

    Didier Francisco Ríos García

    2012-01-01

    Desde mediados de los ochenta cuando Philippe Ariès y George Duby, sacaron a la luz un trabajo sobre la vida privada, se ha generado un nuevo movimiento historiográfico que ha recorrido el mundo, el cual no trata lo que siempre la historia había trabajado, sino que se concentraba en la vida de las vidas secretas de las personas, ya fueran personajes públicos o desconocidas, también se hablo de la...

  18. Categorizing renal oncocytic neoplasms on core needle biopsy: a morphologic and immunophenotypic study of 144 cases with clinical follow-up. Alderman MA, Daignault S, Wolf JS Jr, Palapattu GS, Weizer AZ, Hafez KS, Kunju LP, Wu AJ. Hum Pathol.September 2016;55:1-10.

    Science.gov (United States)

    Kryvenko, Oleksandr N

    2017-06-01

    There is limited literature on renal oncocytic neoplasms diagnosed on core biopsy. All renal oncocytic neoplasm core biopsies from 2006 to 2013 were, retrospectively, reviewed. Morphologic features and an immunohistochemical panel of CK7, c-KIT, and S100A1 were assessed. Concordance with resection diagnosis, statistical analysis including a random forest classification, and follow-up were recorded. The postimmunohistochemical diagnoses of 144 renal oncocytic core biopsies were favor oncocytoma (67%), favor renal cell carcinoma (RCC) (12%), and cannot exclude RCC (21%). Diagnosis was revised following immunohistochemistry in 7% of cases. The most common features for oncocytoma (excluding dense granular cytoplasm) were nested architecture, edematous stroma, binucleation and tubular architecture; the most common features for favor RCC were sheet-like architecture, nuclear pleomorphism, papillary architecture, and prominent cell borders. High nuclear grade, necrosis, extensive papillary architecture, raisinoid nuclei, and frequent mitoses were not seen in oncocytomas. Comparing the pathologist and random forest classification, the overall out-of-bag estimate of classification error dropped from 23% to 13% when favor RCC and cannot exclude RCC was combined into 1 category. Resection was performed in 19% (28 cases) with a 94% concordance (100% of favor RCC biopsies and 90% of cannot exclude RCC biopsies confirmed as RCC; 83% of favor oncocytomas confirmed); ablation in 23%; and surveillance in 46%. Follow-up was available in 92% (median follow-up, 33 months) with no adverse outcomes. Renal oncocytic neoplasms comprise a significant subset (16%) of all core biopsies, and the majority (78%) can be classified as favor oncocytoma or favor RCC. Copyright © 2017 Elsevier Inc. All rights reserved.

  19. Antonio Maria Baggio (ed., Adriana Cossedu, Paolo Giusta, Rodrigo Mardones Z. y Antonio Márquez Prieto, Caino e i suoi fratelli. Il fondamento relazionale nella politica e nel diritto, Città Nuova, Roma, 2012, 247 págs.

    Directory of Open Access Journals (Sweden)

    María Salas Porras

    2013-03-01

    Full Text Available Los estudios recogidos en este volumen intentan reinterpretar los fundamentos de la Política y del Derecho, enmarcados en el horizonte relacional que la fraternidad les abre. Desde esta perspectiva, la fraternidad asume una relevancia política y jurídica en la medida en que se la entienda sustancialmente ligada a la libertad y a la igualdad. Cada una de las tres categorías, en la medida en que sean consideradas conjuntamente, llegan a adquirir su propio significado a través de la relación con las otras. El redescubrimiento de la fraternidad significa por tanto volver a proponer el "tríptico" entero, para recuperar, a través del mismo, el proyecto humanísitico de la modernidad, y liberarnos del destino del conflicto radical al que nuestro tiempo parece condenado: Caín no sólo ha matado a su hermano, sino que también ha fundado la primera ciudad, es decir, el lugar donde la violencia se ve confinada por el gobierno y por las leyes. Abrir el Derecho al horizonte de la fraternidad significa, hoy, llevar la racionalidad jurídica más allá de la mera racionalidad técnica; permitir renovar la relación jurídica, volver a encontrar sus fundamentos humanísticos, redescubriendo una justicia que reconcilia y reconstruye, fortificando el vínculo social. Considerar la fraternidad una categoría política significa poder emitir juicios políticos, capaces de producir un pensamiento político a través de la óptica de la fraternidad; se abandonan así las lógicas de la ideología, para intentar construir una forma de pensamiento en disposición de pasar, de una idea intuitiva de fraternidad, a una definición que la haga operativa, "operacionalizable". Es una tarea que no corresponde hoy a una sola disciplina, sino que interesa a todo el conjunto de los ya numerosos estudiosos que se han enrolado en este frente, interactuando entre sí de manera interdisiciplinar y abriendo un camino en el cual resulte posible, a todos los que han abrazado un humanismo y un ideal político, encontrar las mejores razones de su esperanza.

  20. RESEñA DEL LIBRO “LA GENERACIóN App. CóMO LOS JóVENES GESTIONAN SU IDENTIDAD, SU PRIVACIDAD y SU IMAGINACIóN EN EL MUNDO DIGITAL” HOWARD GARDNER y kATIE DAVIS (2014). BARCELONA, PAIDóS, 238 PáGS.

    OpenAIRE

    Carlos Bolívar Bonilla Baquero

    2015-01-01

    os autores logran una crítica equilibrada al sustentar, cualitativa y estadísticamente, las bondades y riesgos de las nuevas tecnologías de la comunicación para la construcción subjetiva de los jóvenes de la "Generación app" (aplicaciones o programas informáticos en los dispositivos móviles). De manera prudente no les asignan a las tecnologías un carácter de causalidad determinante en los actuales comportamientos juveniles, pero admiten que se trata de un poderoso fenómeno tanto imparable com...

  1. Lexikon der Romanistischen Linguistik (LRL. Edité par Günter Holtus -Michael Metzeltin - Christian Schmitt. Volume VI,l. Aragones/Navarro, Español, Asturiano/Leonés. Max Niemeyer Verlag, Tübingen 1992, págs. XXXVIII+708

    Directory of Open Access Journals (Sweden)

    Mitja Skubic

    1993-12-01

    Full Text Available El Diccionario enciclopédico de lingüistica románica (LRL es un compendio general de todo el saber romanistico sobre Ia génesis, el desarrollo y el estado actual de las lenguas romanicas. La obra consta de ocho volúmenes, de los cuales han aparecido, hasta ahora, los que tratan de las lenguas románicas desde el Renacimiento basta nuestros dias, con excepción del volumen reservado al gallego y portugués. Esperamos, por tanto, con gran interes la aparición del segundo volumen, dedicado al latín y al desarrollo de las lenguas románicas desde la Edad Media basta el Renacimiento.

  2. SERRANO ESTRELLA, Felipe (ed.. Cien obras maestras de la Catedral de Jaén. Jaén: Universidad de Jaén, Cabildo de la Santa Iglesia Catedral de Jaén, 2012, 303 págs.

    Directory of Open Access Journals (Sweden)

    Inmaculada Rodríguez Moya

    2013-01-01

    Full Text Available Bajo el patrocinio de la Universidad de Jaén y el Cabildo de la Catedral de Jaén este magno catálogo permite acercarse a las cien obras más importantes custodiadas por la Catedral. De sobra conocido, este edificio fue iniciado por el arquitecto Andrés de Vandelvira y enriquecido con el trabajo de obispos, miembros del cabildo, por la propia ciudad de Jaén, por los papas, y por peregrinos y devotos, que han configurado una de las colecciones catedralicias más ricas y con piezas únicas de gran interés. Un extenso equipo de investigadores de la Universidad giennense, y de otras universidades andaluzas, son los autores de los magníficos textos, donde abundan las referencias bibliográficas necesarias en una obra de gran rigor como la que nos ocupa. Se hacía necesaria una recopilación de este tipo, con la firmeza de ofrecer datos procedentes de los Inventarios de Alhajas y la rica documentación capitular que custodia el Archivo de la Catedral. Sin duda, la riqueza de la edición y del formato, de lujo y con maravillosas imágenes ha limitado el número de piezas muebles e inmuebles presentes en esta edición, a la espera de futuras adiciones.

  3. RESEñA DEL LIBRO “LA GENERACIóN App. CóMO LOS JóVENES GESTIONAN SU IDENTIDAD, SU PRIVACIDAD y SU IMAGINACIóN EN EL MUNDO DIGITAL” HOWARD GARDNER y kATIE DAVIS (2014. BARCELONA, PAIDóS, 238 PáGS.

    Directory of Open Access Journals (Sweden)

    Carlos Bolívar Bonilla Baquero

    2015-11-01

    Full Text Available os autores logran una crítica equilibrada al sustentar, cualitativa y estadísticamente, las bondades y riesgos de las nuevas tecnologías de la comunicación para la construcción subjetiva de los jóvenes de la "Generación app" (aplicaciones o programas informáticos en los dispositivos móviles. De manera prudente no les asignan a las tecnologías un carácter de causalidad determinante en los actuales comportamientos juveniles, pero admiten que se trata de un poderoso fenómeno tanto imparable como coadyuvante en las concepciones dominantes del mundo y las prácticas de interacción social, fenómeno que debe estudiarse en conexión con múltiples factores familiares, educativos, culturales, económicos y políticos del desarrollo histórico social que vivimos.

  4. López Guzmán, Rafael; Gutiérrez Viñuales, Rodrigo (coords.). Alhambras: arquitectura neoárabe en Latinoamérica. Granada: Almed, 2016, 341 págs. Ilustr. ISBN: 978-84-15063-73-5

    OpenAIRE

    Juan Manuel Barrios Rozúa

    2017-01-01

    Con el libro Alhambras. Arquitectura neoárabe en Latinoamérica el lector se adentrará en el sugestivo mundo de la arquitectura orientalista que, inspirada en cualquier tipo de arquitectura musulmana, podemos encontrar en América. Ciertamente la Alhambra es el modelo más recurrente, pero abundan también los edificios que toman como referentes en mayor o menor medida la arquitectura otomana, egipcia, iraní o mogol, sin olvidar otros edificios de al-Andalus como la mezquita de Córdoba o la Giral...

  5. López Guzmán, Rafael; Gutiérrez Viñuales, Rodrigo (coords.. Alhambras: arquitectura neoárabe en Latinoamérica. Granada: Almed, 2016, 341 págs. Ilustr. ISBN: 978-84-15063-73-5

    Directory of Open Access Journals (Sweden)

    Juan Manuel Barrios Rozúa

    2017-06-01

    Full Text Available Con el libro Alhambras. Arquitectura neoárabe en Latinoamérica el lector se adentrará en el sugestivo mundo de la arquitectura orientalista que, inspirada en cualquier tipo de arquitectura musulmana, podemos encontrar en América. Ciertamente la Alhambra es el modelo más recurrente, pero abundan también los edificios que toman como referentes en mayor o menor medida la arquitectura otomana, egipcia, iraní o mogol, sin olvidar otros edificios de al-Andalus como la mezquita de Córdoba o la Giralda.

  6. Gudrun Stenglein, Condición femenina y delincuencia: Estudio comparado hispano-alemán y una propuesta sistémica europea, AV Akademikerverlag GmbH & Co. KG, EAE, Saarbrücken, 2012, 252 págs.

    Directory of Open Access Journals (Sweden)

    Manuel J. Peláez

    2013-03-01

    Full Text Available Wenn über Kriminalität gesprochen wird, scheint es sich um ein reines Männerthema zu handeln. Sind die Frauen wirklich weniger straffällig als die Männer? Die Frau als Straftäterin wird in der Literatur vernachlässigt. In der modernen Kriminologie erscheint die Frau fast nur in der Opferrolle. Die angeführte Studie befaßt sich mit den Fragen, die sich aus dieser Problematik ergeben. Die Straffälligkeit der Frauen wird einer multidisziplinären Analyse unterzogen, traditionelle und moderne Erklärungsansätze werden systematisiert und in Verbindung zueinander gebracht. Anhand von Statistiken werden sowohl die Anzahl der Straftäterinnen als auch die Delikte, die scheinbar frauentypisch sind, untersucht und zwischen den Modellen der mediterranen und nordeuropäischen Länder verglichen. Es überrascht, dass es so gut wie keine internationalen oder nationalen Programme zur Verbrechensvorbeugung bezüglich der Frauenkrimialität gibt. Scheint es doch so, dass der Staat als einzige Antwort auf dieses Phänomen die Strafverfolgung kennt (traditionelles Strafrecht. Untersuchungen in Strafanstalten zeigen aber, dass die Frauen in den meisten Fällen aufgrund ihres sozialen Umfelds und ihrer geringeren Chancen auf Ausbildung und Ausübung eines Berufes zur Straftäterin werden. Eine effiziente Kriminalpolitik müsste mit der Ungleichbehandlung der Frauen aufräumen und eine adäquate Sozialisierung für die Frauen schaffen, die oft auf sich gestellt und mit der Versorgung ihrer Familie überfordert sind. Es stellt sich heraus, dass, wenn über ein vereintes Europa gesprochen wird, die Wirklichkeit einer gemeinsamen europäischen Kriminalpolitik noch weit entfernt ist. Außerdem wird die Ernsthaftigkeit dieses Vorhabens bezweifelt, da zuviele Unterschiede, Differenzen und Vorbehalte unter den europäischen Mitgliedsstaaten bestehen. Es handelt sich eher um ein fadenscheiniges Agieren der Politiker.

  7. André Thibault, Perfecto simple y perfecto compuesto en español preclásico. Estudio de los perfectos de indicativo en "La Celestina", el "Teatro" de Encina y el "Dialogo de Ia lengua". Beihefte zur ZRPh, Band 301, Max Niemeyer Verlag, Tübingen 2000; págs.

    Directory of Open Access Journals (Sweden)

    Mitja Skubic

    2001-12-01

    Full Text Available La suerte del perfectum latino en lenguas románicas no deja de atraer a los investigadores de los problemas sintácticos. Suenan como profecía las palabras con las cuales el Autor concluyó su trabajo diciendo que en este campo queda todavía mucho por hacer; la profecía parece válida no solo para el español, sino para todo el mundo romance. Prof. André Thibault ha restringido su investigación sobre el pretérito simple y compuesto (permítaseme la terminologia a la cual estoy acostumbrado a los tres grandes acontecimientos en la literatura española, indicados en el título, pero antepuso a su trabajo un amplio panorama histórico, incluyendo en ello anotaciones sobre las tendencias en algunos idiomas indoeuropeos que demuestran los usos de las formas simples y las compuestas y no sólo en el campo del pretérito.

  8. MARIA JOÃO PEREIRA COUTINHO y SÍLVIA FERREIRA. Artistas e Artífices da Lisboa Barroca. A Irmandade de Nossa Senhora da Doutrina da Igreja de São Roque. Lisboa: Esfera do Caos Editores, 2014, 287 págs.

    Directory of Open Access Journals (Sweden)

    Juan Jesús López-Guadalupe Muñoz

    2016-07-01

    Full Text Available Desde hace décadas el concepto de Barroco ibérico hermana los estudios de esta época entre Portugal y España demostrando realidades parangonables que se explican mutuamente. El mundo de las artes, con sus peculiaridades intrínsecas a cada territorio, es una de ellas como lo es también la esfera de las relaciones sociales y religiosas a través de congregaciones o hermandades…

  9. Borja Gómez, Jaime y Rodríguez Jiménez, Pablo. Historia de la vida privada en Colombia. Tomo I: Las fronteras difusas del siglo XVI a 1880. Bogotá: Taurus, 2011, 396 págs.

    Directory of Open Access Journals (Sweden)

    Didier Francisco Ríos García

    2012-07-01

    Full Text Available Desde mediados de los ochenta cuando Philippe Ariès y George Duby, sacaron a la luz un trabajo sobre la vida privada, se ha generado un nuevo movimiento historiográfico que ha recorrido el mundo, el cual no trata lo que siempre la historia había trabajado, sino que se concentraba en la vida de las vidas secretas de las personas, ya fueran personajes públicos o desconocidas, también se hablo de las situaciones que vivían los sectores marginales de la población, todos visto desde el punto de vista de su vida en los ambientes alejados del escrutinio público, desde su forma de vestir, sus amores, sus aventuras, su alimentación y de las mismos espacios que frecuentaban.

  10. Antonio Maria Baggio (ed.), Adriana Cossedu, Paolo Giusta, Rodrigo Mardones Z. y Antonio Márquez Prieto, Caino e i suoi fratelli. Il fondamento relazionale nella politica e nel diritto, Città Nuova, Roma, 2012, 247 págs.

    OpenAIRE

    María Salas Porras

    2013-01-01

    Los estudios recogidos en este volumen intentan reinterpretar los fundamentos de la Política y del Derecho, enmarcados en el horizonte relacional que la fraternidad les abre. Desde esta perspectiva, la fraternidad asume una relevancia política y jurídica en la medida en que se la entienda sustancialmente ligada a la libertad y a la igualdad. Cada una de las tres categorías, en la medida en que sean consideradas conjuntamente, llegan a adquirir su propio significado a través de la relación con...

  11. Regulation of glutamine synthetase isoforms in two differentially drought-tolerant rice (Oryza sativa L.) cultivars under water deficit conditions.

    Science.gov (United States)

    Singh, Kamal Krishna; Ghosh, Shilpi

    2013-02-01

    KEY MESSAGE : The regulation of GS isoforms by WD was organ specific. Two GS isoforms i.e. OsGS1;1 and OsGS2 were differentially regulated in IR-64 (drought-sensitive) and Khitish (drought-tolerant) cultivars of rice. Water deficit (WD) has adverse effect on rice (Oryza sativa L.) and acclimation requires essential reactions of primary metabolism to continue. Rice plants utilize ammonium as major nitrogen source, which is assimilated into glutamine by the reaction of Glutamine synthetase (GS, EC 6.3.1.2). Rice plants possess one gene (OsGS2) for chloroplastic GS2 and three genes (OsGS1;1, OsGS1;2 and OsGS1;3) for cytosolic GS1. Here, we report the effect of WD on regulation of GS isoforms in drought-sensitive (cv. IR-64) and drought-tolerant (cv. Khitish) rice cultivars. Under WD, total GS activity in root and leaf decreased significantly in IR-64 seedlings in comparison to Khitish seedlings. The reduced GS activity in IR-64 leaf was mainly due to decrease in GS2 activity, which correlated with decrease in corresponding transcript and polypeptide contents. GS1 transcript and polypeptide accumulated in leaf during WD, however, GS1 activity was maintained at a constant level. Total GS activity in stem of both the varieties was insensitive to WD. Among GS1 genes, OsGS1;1 expression was differently regulated by WD in the two rice varieties. Its transcript accumulated more abundantly in IR-64 leaf than in Khitish leaf. Following WD, OsGS1;1 mRNA level in stem and root tissues declined in IR-64 and enhanced in Khitish. A steady OsGS1;2 expression patterns were noted in leaf, stem and root of both the cultivars. Results suggest that OsGS2 and OsGS1;1 expression may contribute to drought tolerance of Khitish cultivar under WD conditions.

  12. Griscelli syndrome type 2: A rare and fatal syndrome in a South Indian boy

    Directory of Open Access Journals (Sweden)

    R Rajyalakshmi

    2016-01-01

    Full Text Available Griscelli syndrome (GS is a rare autosomal recessive disorder caused by mutation in the MYO5A (GS1, RAB27A (GS2, and MLPH (GS3 genes, characterized by a common feature, partial albinism. The common variant of three, GS type 2, in addition, shows primary immunodeficiency which leads to recurrent infections and hemophagocytic lymphohistiocytosis. We, herewith, describe a case of GS type 2, in a 4-year-old male child who presented with chronic and recurrent fever, lymphadenopathy, hepatosplenomegaly, and secondary neurological deterioration; highlighting the cytological and histopathological features of lymph nodes. Hair shaft examination of the child confirmed the diagnosis.

  13. Will genomic selection be a practical method for plant breeding?

    Science.gov (United States)

    Nakaya, Akihiro; Isobe, Sachiko N

    2012-11-01

    Genomic selection or genome-wide selection (GS) has been highlighted as a new approach for marker-assisted selection (MAS) in recent years. GS is a form of MAS that selects favourable individuals based on genomic estimated breeding values. Previous studies have suggested the utility of GS, especially for capturing small-effect quantitative trait loci, but GS has not become a popular methodology in the field of plant breeding, possibly because there is insufficient information available on GS for practical use. In this review, GS is discussed from a practical breeding viewpoint. Statistical approaches employed in GS are briefly described, before the recent progress in GS studies is surveyed. GS practices in plant breeding are then reviewed before future prospects are discussed. Statistical concepts used in GS are discussed with genetic models and variance decomposition, heritability, breeding value and linear model. Recent progress in GS studies is reviewed with a focus on empirical studies. For the practice of GS in plant breeding, several specific points are discussed including linkage disequilibrium, feature of populations and genotyped markers and breeding scheme. Currently, GS is not perfect, but it is a potent, attractive and valuable approach for plant breeding. This method will be integrated into many practical breeding programmes in the near future with further advances and the maturing of its theory.

  14. Transcriptome sequencing of the blind subterranean mole rat, Spalax galili: Utility and potential for the discovery of novel evolutionary patterns

    KAUST Repository

    Malik, Assaf; Korol, Abraham; Hü bner, Sariel; Hernandez, Alvaro G.; Thimmapuram, Jyothi; Ali, Shahjahan; Glaser, Fabian; Paz, Arnon; Avivi, Aaron; Band, Mark

    2011-01-01

    sequencing of Spalax galili, a chromosomal type of S. ehrenbergi. cDNA pools from muscle and brain tissues isolated from animals exposed to hypoxic and normoxic conditions were sequenced using Sanger, GS FLX, and GS FLX Titanium technologies. Assembly

  15. The comparative recall of Google Scholar versus PubMed in identical searches for biomedical systematic reviews: a review of searches used in systematic reviews

    OpenAIRE

    Bramer, Wichor M; Giustini, Dean; Kramer, Bianca MR; Anderson, PF

    2013-01-01

    Background The usefulness of Google Scholar (GS) as a bibliographic database for biomedical systematic review (SR) searching is a subject of current interest and debate in research circles. Recent research has suggested GS might even be used alone in SR searching. This assertion is challenged here by testing whether GS can locate all studies included in 21 previously published SRs. Second, it examines the recall of GS, taking into account the maximum number of items that can be viewed, and te...

  16. Will genomic selection be a practical method for plant breeding?

    OpenAIRE

    Nakaya, Akihiro; Isobe, Sachiko N.

    2012-01-01

    Background Genomic selection or genome-wide selection (GS) has been highlighted as a new approach for marker-assisted selection (MAS) in recent years. GS is a form of MAS that selects favourable individuals based on genomic estimated breeding values. Previous studies have suggested the utility of GS, especially for capturing small-effect quantitative trait loci, but GS has not become a popular methodology in the field of plant breeding, possibly because there is insufficient information avail...

  17. Tertiary Gleason pattern in radical prostatectomy specimens is associated with worse outcomes than the next higher Gleason score group in localized prostate cancer.

    Science.gov (United States)

    Özsoy, Mehmet; D'Andrea, David; Moschini, Marco; Foerster, Beat; Abufaraj, Mohammad; Mathieu, Romain; Briganti, Alberto; Karakiewicz, Pierre I; Roupret, Morgan; Seitz, Christian; Czech, Anna Katarzyna; Susani, Martin; Shariat, Shahrokh F

    2018-04-01

    To assess the predictive value of TGP on biochemical recurrence (BCR) and its association with clinicopathological outcomes in a large, multicenter cohort of patients with localized prostate cancer (PCa) treated with radical prostatectomy (RP). Records of 6,041 patients who were treated with RP between 2000 and 2011 for clinically nonmetastatic PCa were, retrospectively, analyzed from prospectively collected datasets. BCR-free survival rates were assessed using univariable and multivariable cox-regression analyses. Median patient age was 61 years (interquartile range [IQR]: 57-66) with a median preoperative prostrate specific antigen of 6ng/ml (IQR: 4-9). Overall, 28% of patients had Gleason score (GS) 6, 0.3% GS 6 + TGP, 33% GS 7 (3 + 4), 0.2% GS 7 (3 + 4) + TGP, 22% GS 7 (4 + 3), 0.2% GS 7 (4 + 3) + TGP, 0.1% GS 8 and 0.4% GS 9 or 10. Median follow-up was 45 months (IQR: 31-57). Harboring a TGP was associated with higher rates of positive surgical margins, lymphovascular invasion, extraprostatic extension, and seminal vesicle invasion than their counterparts within the same GS group as well as in the next higher GS group (all P ≤ 0.05). At 5 years post-RP, BCR estimates were 5% for patients with GS 6, 13% for patients with GS 6 + TGP, 6% for patients with GS 7 (3 + 4), 22% for patients with GS 7 (3 + 4) + TGP, 16% for patients with GS 7 (4 + 3), 41% for patients with GS 7 (4 + 3) + TGP, 38% for patients with GS 8 (4 + 4) and 46% for patients with GS 9 or 10. Patients harboring a TGP had higher BCR rates than the patients in the next higher GS group: GS 6 + TGP vs. GS 7 (3 + 4), HR = 1.6, P = 0.02 and GS 7 (3 + 4)+TGP vs. GS 7 (4 + 3), HR = 1.4, P = 0.03. Patients with a TGP in the GS 7 (4 + 3) group had comparable BCR rates as patients with GS = 8 (P = 0.4) and GS 9 to 10 (P = 0.2). On multivariable analysis that adjusted for the effects of preoperative prostrate specific antigen, nodal involvement, positive surgical margin, extraprostatic disease (pT3a

  18. Allelic variation at Glu-1 loci and its association with grain quality of ...

    African Journals Online (AJOL)

    The high molecular weight glutenin subunits (HMW-GS) are important determinants of wheat flour quality. The HMW-GS patterns of the major released wheat cultivars in Sudan, in addition to some advanced lines, were analyzed using SDS-PAGE. The associations of the HMW-GS quality scores (Glu-1 QS) with the flour ...

  19. Proximal tubule-specific glutamine synthetase deletion alters basal and acidosis-stimulated ammonia metabolism

    NARCIS (Netherlands)

    Lee, Hyun-Wook; Osis, Gunars; Handlogten, Mary E.; Lamers, Wouter H.; Chaudhry, Farrukh A.; Verlander, Jill W.; Weiner, I. David

    2016-01-01

    Glutamine synthetase (GS) catalyzes the recycling of NH4 (+) with glutamate to form glutamine. GS is highly expressed in the renal proximal tubule (PT), suggesting ammonia recycling via GS could decrease net ammoniagenesis and thereby limit ammonia available for net acid excretion. The purpose of

  20. Dicty_cDB: Contig-U16566-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available _GS-35-01-01-1... 64 3e-27 3 ( EJ044277 ) 1095454111632 Global-Ocean-Sampling_GS-...male Pupae Nasoni... 105 8e-21 2 ( EJ805472 ) 1093017455782 Global-Ocean-Sampling_GS-30-02-01-1... 68 8e-21 3 ( EK141129 ) 1095454111

  1. Hydrothermal synthesis of hydrous ruthenium oxide/graphene sheets for high-performance supercapacitors

    International Nuclear Information System (INIS)

    Lin, Na; Tian, Jianhua; Shan, Zhongqiang; Chen, Kuan; Liao, Wenming

    2013-01-01

    Ruthenium oxide particles were supported on graphene sheets (GS) by hydrothermal and low temperature annealing process. The GS was prepared from graphene oxide by an expansion process and different expanding temperatures were studied and polystyrene sulfonate sodium was used as dispersion agent of hydrophobic GS. Different Ru content of the RuO 2 /GS composites on the influence of the electrochemical properties was studied. Atomic force microscope analysis was applied to test the layers of GS. The morphology of GS and RuO 2 /GS composites were confirmed by field emission transmission electron microscopy analysis. X-ray diffraction, Raman spectroscopy and liquid-nitrogen cryosorption were used to characterize the structure and morphology of the GS and RuO 2 /GS. The RuO 2 /GS (Ru:40 wt%) composites used as electrode materials of supercapacitors exhibited a specific capacitance of 551 F/g at 1 A/g in 1 M H 2 SO 4 electrolyte. Besides, both the rate capability and cycle performance of RuO 2 /GS composites had a great improvement compared with GS

  2. An Appreciative Inquiry Exploring Game Sense Teaching in Physical Education

    Science.gov (United States)

    Pill, Shane

    2016-01-01

    This paper reports on research framed as a strengths-based appreciative inquiry (AI) into the use of a game sense (GS) approach for sport and games teaching in physical education (PE). The aim of this research was to find the elements which sustain teachers in the use of a GS approach. This is particularly pertinent given strong advocacy for GS as…

  3. Applying Modeling Tools to Ground System Procedures

    Science.gov (United States)

    Di Pasquale, Peter

    2012-01-01

    As part of a long-term effort to revitalize the Ground Systems (GS) Engineering Section practices, Systems Modeling Language (SysML) and Business Process Model and Notation (BPMN) have been used to model existing GS products and the procedures GS engineers use to produce them.

  4. 29 CFR 1960.2 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... comprehensive survey of all or part of a workplace in order to detect safety and health hazards. Inspections are... person having equipment and competence to recognize safety and/or health hazards in the workplace. (r... Health Manager/Specialist GS-018 Safety Engineer GS-803 Fire Prevention Engineer GS-804 Industrial...

  5. Gender-Segregated Schooling: A Problem Disguised as a Solution

    Science.gov (United States)

    Fabes, Richard A.; Martin, Carol Lynn; Hanish, Laura D.; Galligan, Kathrine; Pahlke, Erin

    2015-01-01

    Gender-segregated (GS) schooling has become popular in the United States despite the fact that every major review has concluded that GS schooling is not superior to coeducational schooling. Moreover, concern has been raised that GS schooling leads to negative effects, including increased gender stereotyping. We argue that these negative effects…

  6. Enzymology and Molecular Biology of Cell Wall Biosynthesis. Final Technical Report

    Energy Technology Data Exchange (ETDEWEB)

    Dr. Peter M. Ray

    2000-04-01

    The following aspects of enzymology of cell wall synthesis were pursued under this cited grant: (1) Isolation of plasma membrane-localized glucan synthase II (GS-II) of pea; (2) Cloning of genes for possible plant GS-II components; (3) Golgi glucan synthase-I (GS-I); and (4) Golgi reversibly glycosylated protein 1 (RGP1).

  7. General surgery workloads and practice patterns in the United States, 2007 to 2009: a 10-year update from the American Board of Surgery.

    Science.gov (United States)

    Valentine, R James; Jones, Andrew; Biester, Thomas W; Cogbill, Thomas H; Borman, Karen R; Rhodes, Robert S

    2011-09-01

    To assess changes in general surgery workloads and practice patterns in the past decade. Nearly 80% of graduating general surgery residents pursue additional training in a surgical subspecialty. This has resulted in a shortage of general surgeons, especially in rural areas. The purpose of this study is to characterize the workloads and practice patterns of general surgeons versus certified surgical subspecialists and to compare these data with those from a previous decade. The surgical operative logs of 4968 individuals recertifying in surgery 2007 to 2009 were reviewed. Data from 3362 (68%) certified only in Surgery (GS) were compared with 1606 (32%) with additional American Board of Medical Specialties certificates (GS+). Data from GS surgeons were also compared with data from GS surgeons recertifying 1995 to 1997. Independent variables were compared using factorial ANOVA. GS surgeons performed a mean of 533 ± 365 procedures annually. Women GS performed far more breast operations and fewer abdomen, alimentary tract and laparoscopic procedures compared to men GS (P surgery procedures. GS practice patterns are heterogeneous; gender, age, and practice setting significantly affect operative caseloads. A substantial portion of general surgery procedures currently are performed by GS+ surgeons, whereas GS surgeons continue to perform considerable numbers of specialty operations. Reduced general surgery operative experience in GS+ residencies may negatively impact access to general surgical care. Similarly, narrowing GS residency operative experience may impair specialty operation access.

  8. Novel substrate specificity of glutathione synthesis enzymes from Streptococcus agalactiae and Clostridium acetobutylicum

    International Nuclear Information System (INIS)

    Kino, Kuniki; Kuratsu, Shoko; Noguchi, Atsushi; Kokubo, Masahiro; Nakazawa, Yuji; Arai, Toshinobu; Yagasaki, Makoto; Kirimura, Kohtaro

    2007-01-01

    Glutathione (GSH) is synthesized by γ-glutamylcysteine synthetase (γ-GCS) and glutathione synthetase (GS) in living organisms. Recently, bifunctional fusion protein, termed γ-GCS-GS catalyzing both γ-GCS and GS reactions from gram-positive firmicutes Streptococcus agalactiae, has been reported. We revealed that in the γ-GCS activity, S. agalactiae γ-GCS-GS had different substrate specificities from those of Escherichia coli γ-GCS. Furthermore, S. agalactiae γ-GCS-GS synthesized several kinds of γ-glutamyltripeptide, γ-Glu-X aa -Gly, from free three amino acids. In Clostridium acetobutylicum, the genes encoding γ-GCS and putative GS were found to be immediately adjacent by BLAST search, and had amino acid sequence homology with S. agalactiae γ-GCS-GS, respectively. We confirmed that the proteins expressed from each gene showed γ-GCS and GS activity, respectively. C. acetobutylicum GS had broad substrate specificities and synthesized several kinds of γ-glutamyltripeptide, γ-Glu-Cys-X aa . Whereas the substrate specificities of γ-GCS domain protein and GS domain protein of S. agalactiae γ-GCS-GS were the same as those of S. agalactiae γ-GCS-GS

  9. Glucose dependence of glycogen synthase activity regulation by GSK3 and MEK/ERK inhibitors and angiotensin-(1-7) action on these pathways in cultured human myotubes.

    Science.gov (United States)

    Montori-Grau, Marta; Tarrats, Núria; Osorio-Conles, Oscar; Orozco, Anna; Serrano-Marco, Lucía; Vázquez-Carrera, Manuel; Gómez-Foix, Anna M

    2013-05-01

    Glycogen synthase (GS) is activated by glucose/glycogen depletion in skeletal muscle cells, but the contributing signaling pathways, including the chief GS regulator GSK3, have not been fully defined. The MEK/ERK pathway is known to regulate GSK3 and respond to glucose. The aim of this study was to elucidate the GSK3 and MEK/ERK pathway contribution to GS activation by glucose deprivation in cultured human myotubes. Moreover, we tested the glucose-dependence of GSK3 and MEK/ERK effects on GS and angiotensin (1-7) actions on these pathways. We show that glucose deprivation activated GS, but did not change phospho-GS (Ser640/1), GSK3β activity or activity-activating phosphorylation of ERK1/2. We then treated glucose-replete and -depleted cells with SB415286, U0126, LY294 and rapamycin to inhibit GSK3, MEK1/2, PI3K and mTOR, respectively. SB415286 activated GS and decreased the relative phospho-GS (Ser640/1) level, more in glucose-depleted than -replete cells. U0126 activated GS and reduced the phospho-GS (Ser640/1) content significantly in glucose-depleted cells, while GSK3β activity tended to increase. LY294 inactivated GS in glucose-depleted cells only, without affecting relative phospho-GS (Ser640/1) level. Rapamycin had no effect on GS activation. Angiotensin-(1-7) raised phospho-ERK1/2 but not phospho-GSK3β (Ser9) content, while it inactivated GS and increased GS phosphorylation on Ser640/1, in glucose-replete cells. In glucose-depleted cells, angiotensin-(1-7) effects on ERK1/2 and GS were reverted, while relative phospho-GSK3β (Ser9) content decreased. In conclusion, activation of GS by glucose deprivation is not due to GS Ser640/1 dephosphorylation, GSK3β or ERK1/2 regulation in cultured myotubes. However, glucose depletion enhances GS activation/Ser640/1 dephosphorylation due to both GSK3 and MEK/ERK inhibition. Angiotensin-(1-7) inactivates GS in glucose-replete cells in association with ERK1/2 activation, not with GSK3 regulation, and glucose

  10. Efeito da Gymnema sylvestre na elevação da lipidemia após administração de gordura de origem animal em ratos wistar - DOI: 10.4025/actascibiolsci.v26i3.1602 The influence of Gymnema sylvestre on the elevation of blood levels of lipids after administration of animal fat in male wistar rats - DOI: 10.4025/actascibiolsci.v26i3.1602

    Directory of Open Access Journals (Sweden)

    Márcia Regina Batista

    2004-04-01

    Full Text Available Neste trabalho investigamos a influência da Gymnema sylvestre (Gs na elevação da lipidemia após administração de gordura de origem animal em ratos machos Wistar (230g - 250g. Os animais, em jejum por 22 horas, foram divididos em 5 grupos que receberam via intragástrica às 8h os seguintes tratamentos: 1 2mL de gordura suína Batavo®/kg de peso corpóreo (GSB; 2 GSB + 500mg/kg de peso corpóreo de Gs (Gs 500mg; 3 GSB + 1g/kg de peso corpóreo de Gs (Gs 1g; 4 Gs 500mg; 5 Gs 1g. Os animais foram sacrificados 30min após a administração destas substâncias. Não observamos diferenças significativas na concentração sérica de lipídeos totais, triglicerídeos e colesterol total nos ratos que receberam GSB na ausência ou presença de Gs 500mg ou Gs 1g. Portanto, nossos resultados sugerem que a Gs não afeta a absorção intestinal de lipídeosThe aim of the present experiment was to investigate the influence of Gymnema sylvestre (Gs on the elevation of blood levels of lipids after administration of animal fat in male Wistar rats (230–250g. The animals, which were fasted for 22h, were separated in five groups that received (8:00 a.m intragastric administration of: 1 2ml of pork fat Batavo® /kg of body weight (PFB; 2 PFB+500mg/kg of Gs body weight (Gs 500mg; 3 PFB + 1g/kg of Gs body weight (Gs 1 g; 4 Gs 500mg; 5 Gs 1g. The animals were sacrificed 30min after the administration of these substances. No significant differences were verified in the serum concentration of total lipids, triglycerides and cholesterol in the animals, which received PBF in the presence or absence of Gs 500mg or Gs 1g. Therefore, the results showed that Gs could not affect the intestinal absorption of lipids

  11. La inútil añoranza de la normalidad

    Directory of Open Access Journals (Sweden)

    Margarita Valencia

    2012-01-01

    Full Text Available Litchis de Madagascar. Aquiles Cuervo. Editorial Elfin de la noche. Buenos Aires, 2011, 91 págs. El ruido de las cosas al caer. Juan Gabriel Vásquez. Premio Alfaguara de novela 2011. Alfaguara. Bogotá. 2011, 259 págs. Tres ataúdes blancos. Antonio Ungar. Premio Herralde de Novela. Editorial Anagrama. Barcelona. 2010, 259 págs. Suicídame. Andrés Arias. Ediciones B. Bogotá, 2010, 261 págs. C.M. no récord. Juan Álvarez. Alfaguara. Bogotá, 2010, 262 págs.

  12. Lowest Price, Technically Acceptable Evaluation Criteria Used in the November 2014 Request for Proposal for the Program Executive Office Soldier Systems Engineering and Technical Assistance (SETA) Contract

    Science.gov (United States)

    2017-09-01

    GS-0895-09 Industrial Engineering Technician 23.04 7.56 GS-0810-09 Civil Engineering Developmental (Programming) 23.04 7.56 GS-0810-11 Civil ... Engineering –Programming 27.88 9.14 GS-0810-12 Civil Engineering –Design 33.41 10.96 GS-2210-09 Info Tech Spec (Network Systems/Customer Support) 23.04...USED IN THE NOVEMBER 2014 REQUEST FOR PROPOSAL FOR THE PROGRAM EXECUTIVE OFFICE SOLDIER SYSTEMS ENGINEERING AND TECHNICAL ASSISTANCE (SETA) CONTRACT

  13. Walla Walla District History. Part 3. 1975-80

    Science.gov (United States)

    1980-01-01

    Clearwater Basin--and in Oregon. Nonetheless, some success was found in locating suitab 1 e spots, parti cul ar ly at Lyons Ferry near Starbuck , Washi...GS-13 Supv Elee Engr GS-12 Starbuck , Wash. NPWOP-GG Com l I Tel 208-476- 3294 NPWOP-OW Com’l Tel 509-843-3796 1 M.eeh Eng r GS-ll 1 Elee Engr GS- 9...DISTRIBUTION BRANCH Jerome P. McDonald Supply Officer • Ext 181 1 Supply Clerk 1 Supply Clerk (Typ) 1 Warehouseman P age 1 1 Chief GS- 9

  14. Identifying crucial parameter correlations maintaining bursting activity.

    Directory of Open Access Journals (Sweden)

    Anca Doloc-Mihu

    2014-06-01

    Full Text Available Recent experimental and computational studies suggest that linearly correlated sets of parameters (intrinsic and synaptic properties of neurons allow central pattern-generating networks to produce and maintain their rhythmic activity regardless of changing internal and external conditions. To determine the role of correlated conductances in the robust maintenance of functional bursting activity, we used our existing database of half-center oscillator (HCO model instances of the leech heartbeat CPG. From the database, we identified functional activity groups of burster (isolated neuron and half-center oscillator model instances and realistic subgroups of each that showed burst characteristics (principally period and spike frequency similar to the animal. To find linear correlations among the conductance parameters maintaining functional leech bursting activity, we applied Principal Component Analysis (PCA to each of these four groups. PCA identified a set of three maximal conductances (leak current, [Formula: see text]Leak; a persistent K current, [Formula: see text]K2; and of a persistent Na+ current, [Formula: see text]P that correlate linearly for the two groups of burster instances but not for the HCO groups. Visualizations of HCO instances in a reduced space suggested that there might be non-linear relationships between these parameters for these instances. Experimental studies have shown that period is a key attribute influenced by modulatory inputs and temperature variations in heart interneurons. Thus, we explored the sensitivity of period to changes in maximal conductances of [Formula: see text]Leak, [Formula: see text]K2, and [Formula: see text]P, and we found that for our realistic bursters the effect of these parameters on period could not be assessed because when varied individually bursting activity was not maintained.

  15. Beasts in Lambda-CDM zoo

    Science.gov (United States)

    Dolgov, A. D.

    2017-09-01

    Recent astronomical discoveries of supermassive black holes (quasars), gamma-bursters, super-novae, and dust at high redshifts, z = (5-10), are reviewed. Such a dense population of the early universe is at odds with the conventional mechanisms of its possible origin. Similar data from the contemporary universe, which are also in conflict with natural expectations, are considered too. Two possible mechanisms are suggested, at least one of which can potentially solve all these problems. As a by-product of the last model, an abundant cosmological antimatter may be created.

  16. X-Ray Spectral Diagnostics of Gamma-Ray Burst Environments.

    Science.gov (United States)

    Paerels; Kuulkers; Heise; Liedahl

    2000-05-20

    Recently, detection of discrete features in the X-ray afterglow spectra of GRB 970508 and GRB 970828 was reported. The most natural interpretation of these features is that they are redshifted Fe K emission complexes. The identification of the line emission mechanism has drastic implications for the inferred mass of radiating material and hence the nature of the burst site. X-ray spectroscopy provides a direct observational constraint on these properties of gamma-ray bursters. We briefly discuss how these constraints arise in the context of an application to the spectrum of GRB 970508.

  17. Exploding superstars understanding supernovae and gamma-ray bursts

    CERN Document Server

    Mazure, Alain

    2009-01-01

    The exceptional cosmic history and the fabulous destinies of exploding stars – supernovae and gamma-ray bursters – are highly fertile areas of research and are also very special tools to further our understanding of the universe. In this book, cosmologists Dr Alain Mazure and Dr Stéphane Basa throw light on the assemblage of facts, hypotheses and cosmological conclusions and show how these ‘beacons’ illuminate their immediate surroundings and allow us to study the vast cosmos, like searchlights revealing the matter comprising our universe.

  18. Half-life determination of T{sub z} = -1 and T{sub z} = -(1)/(2) proton-rich nuclei and the β decay of {sup 58}Zn

    Energy Technology Data Exchange (ETDEWEB)

    Kucuk, L.; Oktem, Y.; Cakirli, R.B.; Ganioglu, E.; Susoy, G. [Istanbul University, Department of Physics, Istanbul (Turkey); Orrigo, S.E.A.; Montaner-Piza, A.; Rubio, B. [CSIC-Universidad de Valencia, Instituto de Fisica Corpuscular, Valencia (Spain); Fujita, Y. [Osaka University, Department of Physics, Toyonaka, Osaka (Japan); Osaka University, Research Center for Nuclear Physics, Ibaraki, Osaka (Japan); Gelletly, W. [CSIC-Universidad de Valencia, Instituto de Fisica Corpuscular, Valencia (Spain); University of Surrey, Department of Physics, Guildford, Surrey (United Kingdom); Blank, B.; Ascher, P.; Giovinazzo, J.; Grevy, S. [Centre d' Etudes Nucleaires de Bordeaux Gradignan, CNRS/IN2P3 - Universite de Bordeaux, Gradignan (France); Adachi, T.; Fujita, H.; Tamii, A. [Osaka University, Research Center for Nuclear Physics, Ibaraki, Osaka (Japan); Algora, A. [CSIC-Universidad de Valencia, Instituto de Fisica Corpuscular, Valencia (Spain); Inst. of Nuclear Research of the Hung. Acad. of Sciences, Debrecen (Hungary); France, G. de; Oliveira Santos, F. de; Thomas, J.C. [Grand Accelerateur National d' Ions Lourds (GANIL), CEA/DRF-CNRS/IN2P3, Caen (France); Marques, F.M. [Laboratoire de Physique Corpusculaire de Caen, ENSICAEN, UNICAEN, IN2P3/CNRS, Caen (France); Molina, F. [CSIC-Universidad de Valencia, Instituto de Fisica Corpuscular, Valencia (Spain); Comision Chilena de Energia Nuclear, Casilla 188-D, Santiago (Chile); Perrot, L. [IPN Orsay, Orsay (France); Raabe, R. [Grand Accelerateur National d' Ions Lourds (GANIL), CEA/DRF-CNRS/IN2P3, Caen (France); KU Leuven, Instituut voor Kern- en Stralingsfysica, Leuven (Belgium); Srivastava, P.C. [Grand Accelerateur National d' Ions Lourds (GANIL), CEA/DRF-CNRS/IN2P3, Caen (France); Indian Institute of Technology, Department of Physics, Roorkee (India)

    2017-06-15

    We have measured the β-decay half-lives of 16 neutron-deficient nuclei with T{sub z} = -1/2 and -1, ranging from chromium to germanium. They were produced in an experiment carried out at GANIL and optimized for the production of {sup 58}Zn, for which in addition we present the decay scheme and absolute Fermi and Gamow-Teller transition strengths. Since all of these nuclei lie on the rp-process pathway, the T{sub 1/2} values are important ingredients for the rp-process reaction flow calculations and for models of X-ray bursters. (orig.)

  19. New Eyes on the Universe Twelve Cosmic Mysteries and the Tools We Need to Solve Them

    CERN Document Server

    Webb, Stephen

    2012-01-01

    "New Eyes on the Universe -- Twelve Cosmic Mysteries and the Tools We Need to Solve Them" gives an up-to-date broad overview of some of the key issues in modern astronomy and cosmology. It describes the vast amount of observational data that the new generation of observatories and telescopes are currently producing, and how that data might solve some of the outstanding puzzles inherent in our emerging world view. Included are questions such as: What is causing the Universe to blow itself apart? What could be powering the luminous gamma-ray bursters? Where is all the matter in the Uni

  20. Hubble Space Telescope STIS observations of GRB 000301C: CCD imaging and near-ultraviolet MAMA spectroscopy

    DEFF Research Database (Denmark)

    Smette, A.; Fruchter, A.S.; Gull, T.R.

    2001-01-01

    We present Space Telescope Imaging Spectrograph observations of the optical transient (OT) counterpart of the c-ray burster GRB 000301C obtained 5 days after the burst, on 2000 March 6. CCD clear-aperture imaging reveals a R similar or equal to 21.50 +/- 0.15 source with no apparent host galaxy...... Telescope images appear to lie on the stellar field of a host galaxy, and as the large H I column density measured here and in later ground-based observations is unlikely on a random line of sight, we believe we are probably seeing absorption from H I in the host galaxy. In any case, this represents...

  1. Very low luminosity stars with very large amplitude flares

    International Nuclear Information System (INIS)

    Schaefer, B.E.

    1990-01-01

    CCD frames of CZ Cnc, KY Cep, the gamma-ray burster optical transient, and NSV 12006 are analyzed. Also studied are 549 archival photographic plates of the CZ Cnc field. These observations are compared with the data of Lovas (1976). Flare events on CZ Cnc are examined. Based on the data it is noted that CZ Cnc is a main-sequence star, has a magnitude of 16.1, a distance of 100 pc, occasional large-amplitude flares, and frequent flares with amplitudes greater than 4 mag. 36 refs

  2. Brany Liouville inflation

    International Nuclear Information System (INIS)

    Ellis, John; Mavromatos, Nikolaos; Nanopoulos, Dimitri; Sakharov, Alexander

    2004-01-01

    We present a specific model for cosmological inflation driven by the Liouville field in a non-critical supersymmetric string framework, in which the departure from criticality is due to open strings stretched between two moving Type-II 5-branes. We use WMAP and other data on fluctuations in the cosmic microwave background to fix the parameters of the model, such as the relative separation and velocity of the 5-branes, respecting also the constraints imposed by data on light propagation from distant gamma-ray bursters. The model also suggests a small, relaxing component in the present vacuum energy that may accommodate the breaking of supersymmetry

  3. Structural Understanding of the Glutathione-dependent Reduction Mechanism of Glutathionyl-Hydroquinone Reductases*

    Science.gov (United States)

    Green, Abigail R.; Hayes, Robert P.; Xun, Luying; Kang, ChulHee

    2012-01-01

    Glutathionyl-hydroquinone reductases (GS- HQRs) are a newly identified group of glutathione transferases, and they are widely distributed in bacteria, halobacteria, fungi, and plants. GS-HQRs catalyze glutathione (GSH)-dependent reduction of glutathionyl-hydroquinones (GS-hydroquinones) to hydroquinones. GS-hydroquinones can be spontaneously formed from benzoquinones reacting with reduced GSH via Michael addition, and GS-HQRs convert the conjugates to hydroquinones. In this report we have determined the structures of two bacterial GS-HQRs, PcpF of Sphingobium chlorophenolicum and YqjG of Escherichia coli. The two structures and the previously reported structure of a fungal GS-HQR shared many features and displayed complete conservation for all the critical residues. Furthermore, we obtained the binary complex structures with GS-menadione, which in its reduced form, GS-menadiol, is a substrate. The structure revealed a large H-site that could accommodate various substituted hydroquinones and a hydrogen network of three Tyr residues that could provide the proton for reductive deglutathionylation. Mutation of the Tyr residues and the position of two GSH molecules confirmed the proposed mechanism of GS-HQRs. The conservation of GS-HQRs across bacteria, halobacteria, fungi, and plants potentiates the physiological role of these enzymes in quinone metabolism. PMID:22955277

  4. Proximal tubule-specific glutamine synthetase deletion alters basal and acidosis-stimulated ammonia metabolism

    Science.gov (United States)

    Lee, Hyun-Wook; Osis, Gunars; Handlogten, Mary E.; Lamers, Wouter H.; Chaudhry, Farrukh A.; Verlander, Jill W.

    2016-01-01

    Glutamine synthetase (GS) catalyzes the recycling of NH4+ with glutamate to form glutamine. GS is highly expressed in the renal proximal tubule (PT), suggesting ammonia recycling via GS could decrease net ammoniagenesis and thereby limit ammonia available for net acid excretion. The purpose of the present study was to determine the role of PT GS in ammonia metabolism under basal conditions and during metabolic acidosis. We generated mice with PT-specific GS deletion (PT-GS-KO) using Cre-loxP techniques. Under basal conditions, PT-GS-KO increased urinary ammonia excretion significantly. Increased ammonia excretion occurred despite decreased expression of key proteins involved in renal ammonia generation. After the induction of metabolic acidosis, the ability to increase ammonia excretion was impaired significantly by PT-GS-KO. The blunted increase in ammonia excretion occurred despite greater expression of multiple components of ammonia generation, including SN1 (Slc38a3), phosphate-dependent glutaminase, phosphoenolpyruvate carboxykinase, and Na+-coupled electrogenic bicarbonate cotransporter. We conclude that 1) GS-mediated ammonia recycling in the PT contributes to both basal and acidosis-stimulated ammonia metabolism and 2) adaptive changes in other proteins involved in ammonia metabolism occur in response to PT-GS-KO and cause an underestimation of the role of PT GS expression. PMID:27009341

  5. Development of Semiliquid Ingredients from Grape Skins and Their Potential Impact on the Reducing Capacity of Model Functional Foods

    Directory of Open Access Journals (Sweden)

    Milan Stojanovic

    2018-01-01

    Full Text Available Grape skins (GS, which can be considered as reusable coproducts of winemaking, were processed to develop semiliquid ingredients for functional foods, as an alternative to powdered GS, which needs high energy input for drying. Processing of semiliquid GS ingredients included blanching, dilution to obtain dispersions with 2% or 10% of dry solids, milling, homogenization, and pasteurization. The individual phenolic contents and in vitro ferric ion reducing capacity (FRAP of semiliquid GS ingredients were compared with those of air-dried and freeze-dried GS. With respect to freeze-dried GS, the recovery of FRAP values was ~75% for both air-dried GS and 2% GS dispersion and 59% for 10% GS dispersion. The average particle size diameters of solids in semiliquid GS ingredients were similar to those observed in commercial apple skin products. Possible applications of GS semiliquid ingredients to increase the reducing capacity of food 10 times include formulation into beverages and ice-type desserts and use in bakery products.

  6. Los cuentos tristes

    Directory of Open Access Journals (Sweden)

    Alberto Aguirre

    1993-01-01

    Full Text Available La casa del ruego y de la lluvia. Milciades Arévalo. 1992, 119 págs. Esta risa no es de loco. Medardo Arias Satizábal. 1992, 70 págs. La caja de música. Mauricio Peñaranda Castillo. 1992, 69 págs. Mariposas negras sobre la ciudad. Jesús Rincón Murcia. 1992, 167 págs. Acerca y de lejos. Celso Román. 1992, 127 págs. El informe de Galves. Roberto Rubiano Vargas. 1992, 137 págs. El retablo del reposo. Guido Leonardo Tamayo. 1991, 87 págs.

  7. Mineral nitrogen sources differently affect root glutamine synthetase isoforms and amino acid balance among organs in maize.

    Science.gov (United States)

    Prinsi, Bhakti; Espen, Luca

    2015-04-03

    Glutamine synthetase (GS) catalyzes the first step of nitrogen assimilation in plant cell. The main GS are classified as cytosolic GS1 and plastidial GS2, of which the functionality is variable according to the nitrogen sources, organs and developmental stages. In maize (Zea mays L.) one gene for GS2 and five genes for GS1 subunits are known, but their roles in root metabolism are not yet well defined. In this work, proteomic and biochemical approaches have been used to study root GS enzymes and nitrogen assimilation in maize plants re-supplied with nitrate, ammonium or both. The plant metabolic status highlighted the relevance of root system in maize nitrogen assimilation during both nitrate and ammonium nutrition. The analysis of root proteomes allowed a study to be made of the accumulation and phosphorylation of six GS proteins. Three forms of GS2 were identified, among which only the phosphorylated one showed an accumulation trend consistent with plastidial GS activity. Nitrogen availabilities enabled increments in root total GS synthetase activity, associated with different GS1 isoforms according to the nitrogen sources. Nitrate nutrition induced the specific accumulation of GS1-5 while ammonium led to up-accumulation of both GS1-1 and GS1-5, highlighting co-participation. Moreover, the changes in thermal sensitivity of root GS transferase activity suggested differential rearrangements of the native enzyme. The amino acid accumulation and composition in roots, xylem sap and leaves deeply changed in response to mineral sources. Glutamine showed the prevalent changes in all nitrogen nutritions. Besides, the ammonium nutrition was associated with an accumulation of asparagine and reducing sugars and a drop in glutamic acid level, significantly alleviated by the co-provision with nitrate. This work provides new information about the multifaceted regulation of the GS enzyme in maize roots, indicating the involvement of specific isoenzymes/isoforms, post

  8. BEOLCHINI, Valeria y PAVÓN RAMÍREZ, Marta. Dentro del archivo secreto del Vaticano. Guía para la investigación a partir de documentos sobre el País Vasco. Época Medieval (1198-1458). Vizcaya: Servicio Editorial de la Universidad del País Vasco, 2014. 91 págs. [17 x 24].

    OpenAIRE

    Rodríguez Segura, Joan

    2015-01-01

    "Con más de 85 kilómetros lineales de estantería, más de 650 fondos archivísticos y un arco cronológico que cubre más de doce siglos son, en efecto, unos números que abruman". Con esta afirmación Cristina Jular Pérez-Alfaro, inicia la presentación de este pequeño libro.

  9. The Generalizing Work on History and Culture of the Cossacks (Book Review: Essays on the History and Culture of the Cossacks of Southern Russia: Collective Monograph [Text] / ed. by G. G. Matishov, I. O. Tyumentsev ; Southern Scientic Centre of the Russian Academy of Sciences; Volgograd Branch of Federal State Budgetary Educational Institution of Higher Professional Education “Russian Presidential Academy of National Economy and Public Administration”. – Volgograd : Izd-vo Volgogradskogo Filiala FGBOU VPO RANKhiGS, 2014. – 624 p.

    Directory of Open Access Journals (Sweden)

    Bugay Nikolay F.

    2016-06-01

    Full Text Available This article represents a review of the collective monograph “Essays on the history and culture of the Cossacks of Southern Russia”, published in 2014 under the auspices of the Southern Scientific Centre of the Russian Academy of Sciences and the Volgograd branch of Russian Presidential Academy of National Economy and Public Administration. The review provides a critical analysis of the material in the collective monograph on the problems of studying the history and culture of the Cossacks. The author notes that the revival of Cossacks that began in the 1990s, not only drew attention to the Cossack problem in modern Russia, but also stimulated scientific and public interest in the history and culture of the Cossacks. Russian Cossacks have rich past and its culture is colorful and specific, its role in the history of Russia is significant. Issues of origin and development of the Cossacks, their place among the peoples of Russia, the specificity of cultural practices are constantly causing great interest for researchers. All this has led scientistsspecialists in the history and culture of the Cossacks to the idea of the creation of this scientific work, which has become a generalization of accumulated research experience on the most important issues of the Cossacks’ historical existence. The authors of the monograph limited their research by Southern Russia because of the complexity of creating general work on all Cossack troops which have historically existed in the Russian state and had sometimes very great cultural differences and special historical destiny. The authors made a very successful attempt to highlight the main problematic aspects of the history and culture of the Cossacks. The genre of essay chosen for creating a collective monograph, has allowed not only to identify the most relevant topics of the Cossack history and culture, but also to consider them in relation and development. Each essay contains material that allows to identify the most important problems of different historical periods and various Cossack communities. Together, we get an idea not only about the history of the Cossacks, but also on the results of professional scientific developments in this area. Essays on the history and culture of the Cossacks of Southern Russia – work in which the efforts of its sponsors were systematically analyzed and the main existing today information and research materials on the history and culture of the Cossacks of Southern Russia were compiled into a single concept.

  10. Gilbert\\'s Syndrome

    Directory of Open Access Journals (Sweden)

    Erkan Cure

    2014-04-01

    Full Text Available Gilbert\\'s syndrome (GS is a benign condition that does not progress to chronic liver disease or fibrosis. GS diagnosis should be considered in patients with chronic elevation of unconjugated bilirubin. In these patients the presence of hemolysis and other diseases of the liver should be excluded. GS is an autosomal recessive disease. The mutation of UDP-glucuronyl transferase is seen in 10-16% of the population. There is a 70-80% decrease in bilirubin glucuronidation. In cases of unexplained indirect hyperbilirubinemia with no history of drugs, smoking or alcohol use, GS should be considered. Firstly, hemolysis should be excluded. It has been reported that having increased levels of indirect bilirubin lowers the incidence of carotid plaque and coronary artery disease in patients of GS. The antioxidation and resistance to oxidative stress status of patients with GS is known to be high. However, GS is associated with breast and colon cancer. Several studies have reported that liver transplantation from a patient with GS had no harm to himself or to the recipient. An exact relationship between schizophrenia and GS has not been demonstrated. GS patients have a risk of breast and colon cancer so frequent follow up may be recommended.

  11. [Effects of soil water status on gas exchange of peanut and early rice leaves].

    Science.gov (United States)

    Chen, Jiazhou; Lü, Guoan; He, Yuanqiu

    2005-01-01

    The gas exchange characteristics of peanut and early rice leaves were investigated in experimental plots under different soil water conditions over a long growth period. The results showed that at the branching stage of peanut, the stomatal conductance (Gs) and transpiration rate (Tr) decreased slightly under mild and moderate soil water stress, while the net photosynthetic rate (Pn) and leaf water use efficiency (WUE) increased. The Gs/Tr ratio also increased under mild water stress, but decreased under moderate water stress. At podding stage, the Gs, Tr, Gs/Tr ratio and Pn decreased, while WUE increased significantly under mild and moderate water stress. The peanut was suffered from water stress at its pod setting stage. At the grain filling stage of early rice, the Gs, Tr and Gs/Tr ratio fluctuated insignificantly under mild and moderate water stress, while Pn and WUE increased significantly, with an increase in grain yield under mild water stress. It's suggested that the combination of Gs and Gs/Tr ratio could be a reference index for crop water stress, namely, crops could be hazarded by water stress when Gs and Gs/Tr decreased synchronously.

  12. Glycerin Suppositories Use in Very Low Birth Weight Infants.

    Science.gov (United States)

    Patel, Shalinkumar; Dereddy, Narendra; Talati, Ajay J; Gaston, Kan; Dhanireddy, Ramasubbareddy

    2017-01-01

    Objective  To study the characteristics of very low birth weight (VLBW) infants receiving glycerin suppositories (GS) and evaluate the association of GS use with outcomes. Study Design  This is a retrospective study of VLBW infants admitted to a level III neonatal intensive care unit. Infants with birth weight between 500 and 1,499 g were evaluated. We evaluated the frequency of GS use and compared the characteristics and outcomes of the GS group with the no-GS group. Multivariate analyses controlling for gestational age and small for gestational age status were performed to study the effect of GS on outcomes. Results  A total of 1,073 infants were included in the study. Out of those, 527 (49.1%) infants received GS. Incidence of necrotizing enterocolitis was not significantly different between the two groups, while days to reach full enteral feeds and length of hospital stay were significantly longer in the GS group. Conclusion  Frequent use of GS warrants further prospective studies to evaluate its safety and efficacy in view of our study showing association with longer time to reach full enteral feeds. We speculate that GS use could be a marker for gastrointestinal dysmotility and hence the association with unfavorable clinical outcomes. Thieme Medical Publishers 333 Seventh Avenue, New York, NY 10001, USA.

  13. A Taiwanese Propolis Derivative Induces Apoptosis through Inducing Endoplasmic Reticular Stress and Activating Transcription Factor-3 in Human Hepatoma Cells

    Directory of Open Access Journals (Sweden)

    Fat-Moon Suk

    2013-01-01

    Full Text Available Activating transcription factor-(ATF- 3, a stress-inducible transcription factor, is rapidly upregulated under various stress conditions and plays an important role in inducing cancer cell apoptosis. NBM-TP-007-GS-002 (GS-002 is a Taiwanese propolin G (PPG derivative. In this study, we examined the antitumor effects of GS-002 in human hepatoma Hep3B and HepG2 cells in vitro. First, we found that GS-002 significantly inhibited cell proliferation and induced cell apoptosis in dose-dependent manners. Several main apoptotic indicators were found in GS-002-treated cells, such as the cleaved forms of caspase-3, caspase-9, and poly(ADP-ribose polymerase (PARP. GS-002 also induced endoplasmic reticular (ER stress as evidenced by increases in ER stress-responsive proteins including glucose-regulated protein 78 (GRP78, growth arrest- and DNA damage-inducible gene 153 (GADD153, phosphorylated eukaryotic initiation factor 2α (eIF2α, phosphorylated protein endoplasmic-reticular-resident kinase (PERK, and ATF-3. The induction of ATF-3 expression was mediated by mitogen-activated protein kinase (MAPK signaling pathways in GS-002-treated cells. Furthermore, we found that GS-002 induced more cell apoptosis in ATF-3-overexpressing cells. These results suggest that the induction of apoptosis by the propolis derivative, GS-002, is partially mediated through ER stress and ATF-3-dependent pathways, and GS-002 has the potential for development as an antitumor drug.

  14. Congenital chloride diarrhea needs to be distinguished from Bartter and Gitelman syndrome.

    Science.gov (United States)

    Matsunoshita, Natsuki; Nozu, Kandai; Yoshikane, Masahide; Kawaguchi, Azusa; Fujita, Naoya; Morisada, Naoya; Ishimori, Shingo; Yamamura, Tomohiko; Minamikawa, Shogo; Horinouchi, Tomoko; Nakanishi, Keita; Fujimura, Junya; Ninchoji, Takeshi; Morioka, Ichiro; Nagase, Hiroaki; Taniguchi-Ikeda, Mariko; Kaito, Hiroshi; Iijima, Kazumoto

    2018-05-30

    Pseudo-Bartter/Gitelman syndrome (p-BS/GS) encompasses a clinically heterogeneous group of inherited or acquired disorders similar to Bartter syndrome (BS) or Gitelman syndrome (GS), both renal salt-losing tubulopathies. Phenotypic overlap frequently occurs between p-BS/GS and BS/GS, which are difficult to diagnose based on their clinical presentation and require genetic tests for accurate diagnosis. In addition, p-BS/GS can occur as a result of other inherited diseases such as cystic fibrosis, autosomal dominant hypocalcemia, Dent disease, or congenital chloride diarrhea (CCD). However, the detection of the variants in genes other than known BS/GS-causing genes by conventional Sanger sequencing requires substantial time and resources. We studied 27 cases clinically diagnosed with BS/GS, but with negative genetic tests for known BS/GS genes. We conducted targeted sequencing for 22 genes including genes responsible for tubulopathies and other inherited diseases manifesting with p-BS/GS symptoms. We detected the SLC26A3 gene variants responsible for CCD in two patients. In Patient 1, we found the SLC26A3 compound heterozygous variants: c.354delC and c.1008insT. In Patient 2, we identified the compound heterozygous variants: c.877G > A, p.(Glu293Lys), and c.1008insT. Our results suggest that a comprehensive genetic screening system using targeted sequencing is useful for the diagnosis of patients with p-BS/GS with alternative genetic origins.

  15. Are fixed grain size ratios useful proxies for loess sedimentation dynamics? Experiences from Remizovka, Kazakhstan

    Science.gov (United States)

    Schulte, Philipp; Sprafke, Tobias; Rodrigues, Leonor; Fitzsimmons, Kathryn E.

    2018-04-01

    Loess-paleosol sequences (LPS) are sensitive terrestrial archives of past aeolian dynamics and paleoclimatic changes within the Quaternary. Grain size (GS) analysis is commonly used to interpret aeolian dynamics and climate influences on LPS, based on granulometric parameters such as specific GS classes, ratios of GS classes and statistical manipulation of GS data. However, the GS distribution of a loess sample is not solely a function of aeolian dynamics; rather complex polygenetic depositional and post-depositional processes must be taken into account. This study assesses the reliability of fixed GS ratios as proxies for past sedimentation dynamics using the case study of Remizovka in southeast Kazakhstan. Continuous sampling of the upper 8 m of the profile, which shows extremely weak pedogenic alteration and is therefore dominated by primary aeolian activity, indicates that fixed GS ratios do not adequately serve as proxies for loess sedimentation dynamics. We find through the calculation of single value parameters, that "true" variations within sensitive GS classes are masked by relative changes of the more frequent classes. Heatmap signatures provide the visualization of GS variability within LPS without significant data loss within the measured classes of a sample, or across all measured samples. We also examine the effect of two different commonly used laser diffraction devices on GS ratio calculation by duplicate measurements, the Beckman Coulter (LS13320) and a Malvern Mastersizer Hydro (MM2000), as well as the applicability and significance of the so-called "twin peak ratio" previously developed on samples from the same section. The LS13320 provides higher resolution results than the MM2000, nevertheless the GS ratios related to variations in the silt-sized fraction were comparable. However, we could not detect a twin peak within the coarse silt as detected in the original study using the same device. Our GS measurements differ from previous works at

  16. Molecular cloning and characterization of glycogen synthase in Eriocheir sinensis.

    Science.gov (United States)

    Li, Ran; Zhu, Li-Na; Ren, Li-Qi; Weng, Jie-Yang; Sun, Jin-Sheng

    2017-12-01

    Glycogen plays an important role in glucose and energy homeostasis at cellular and organismal levels. In glycogen synthesis, glycogen synthase (GS) is a rate-limiting enzyme catalysing the addition of α-1,4-linked glucose units from (UDP) 3 -glucose to a nascent glycogen chain using glycogenin (GN) as a primer. While studies on mammalian liver GS (GYS2) are numerous, enzymes from crustaceans, which also use glycogen and glucose as their main energy source, have received less attention. In the present study, we amplified full-length GS cDNA from Eriocheir sinensis. Tissue expression profiling revealed the highest expression of GS in the hepatopancreas. During moulting, GS expression and activity declined, and glycogen levels in the hepatopancreas were reduced. Recombinant GS was expressed in Escherichia coli Rosetta (DE3), and induction at 37°C or 16°C yielded EsGS in insoluble inclusion bodies (EsGS-I) or in soluble form (EsGS-S), respectively. Enzyme activity was measured in a cell-free system containing glucose-6-phosphate (G6P), and both forms possessed glycosyltransferase activity, but refolded EsGS-I was more active. Enzyme activity of both GS and EsGS-I in the hepatopancreas was optimum at 25°C, which is coincident with the optimum growth temperature of Chinese mitten crab, and higher (37°C) or lower (16°C) temperatures resulted in lower enzyme activity. Taken together, the results suggest that GS may be important for maintaining normal physiological functions such as growth and reproduction. Copyright © 2017 Elsevier Inc. All rights reserved.

  17. Constitutive stimulatory G protein activity in limb mesenchyme impairs bone growth.

    Science.gov (United States)

    Karaca, Anara; Malladi, Vijayram Reddy; Zhu, Yan; Tafaj, Olta; Paltrinieri, Elena; Wu, Joy Y; He, Qing; Bastepe, Murat

    2018-05-01

    GNAS mutations leading to constitutively active stimulatory G protein alpha-subunit (Gsα) cause different tumors, fibrous dysplasia of bone, and McCune-Albright syndrome, which are typically not associated with short stature. Enhanced signaling of the parathyroid hormone/parathyroid hormone-related peptide receptor, which couples to multiple G proteins including Gsα, leads to short bones with delayed endochondral ossification. It has remained unknown whether constitutive Gsα activity also impairs bone growth. Here we generated mice expressing a constitutively active Gsα mutant (Gsα-R201H) conditionally upon Cre recombinase (cGsα R201H mice). Gsα-R201H was expressed in cultured bone marrow stromal cells from cGsα R201H mice upon adenoviral-Cre transduction. When crossed with mice in which Cre is expressed in a tamoxifen-regulatable fashion (CAGGCre-ER™), tamoxifen injection resulted in mosaic expression of the transgene in double mutant offspring. We then crossed the cGsα R201H mice with Prx1-Cre mice, in which Cre is expressed in early limb-bud mesenchyme. The double mutant offspring displayed short limbs at birth, with narrow hypertrophic chondrocyte zones in growth plates and delayed formation of secondary ossification center. Consistent with enhanced Gsα signaling, bone marrow stromal cells from these mice demonstrated increased levels of c-fos mRNA. Our findings indicate that constitutive Gsα activity during limb development disrupts endochondral ossification and bone growth. Given that Gsα haploinsufficiency also leads to short bones, as in patients with Albright's hereditary osteodystrophy, these results suggest that a tight control of Gsα activity is essential for normal growth plate physiology. Copyright © 2018 Elsevier Inc. All rights reserved.

  18. Discovery of new dipper stars with K2: a window into the inner disc region of T Tauri stars

    Science.gov (United States)

    Hedges, Christina; Hodgkin, Simon; Kennedy, Grant

    2018-05-01

    In recent years, a new class of young stellar object (YSO) has been defined, referred to as dippers, where large transient drops in flux are observed. These dips are too large to be attributed to stellar variability, last from hours to days and can reduce the flux of a star by 10-50 per cent. This variability has been attributed to occultations by warps or accretion columns near the inner edge of circumstellar discs. Here, we present 95 dippers in the Upper Scorpius association and ρ Ophiuchus cloud complex found in K2 Campaign 2 data using supervised machine learning with a random forest classifier. We also present 30 YSOs that exhibit brightening events on the order of days, known as bursters. Not all dippers and bursters are known members, but all exhibit infrared excesses and are consistent with belonging to either of the two young star-forming regions. We find 21.0 ± 5.5 per cent of stars with discs are dippers for both regions combined. Our entire dipper sample consists only of late-type (KM) stars, but we show that biases limit dipper discovery for earlier spectral types. Using the dipper properties as a proxy, we find that the temperature at the inner disc edge is consistent with interferometric results for similar and earlier type stars.

  19. The Terzan 2 Cluster Taken by the High Energy Astronomy Observatory (HEAO)-2

    Science.gov (United States)

    1980-01-01

    The dramatic change in x-ray emission from the Terzan 2 cluster is shown in this series of 2.5-minute exposures taken with the High Energy Astronomy Observatory (HEAO)-2/Einstein Observatory immediately before, during, and after the burst. Total exposure (20 minutes) of the object, including the outburst, is shown in the fourth photograph. These images represent the first observation of an x-ray burst in progress. The actual burst lasted 50 seconds. Among the rarest, and most bizarre, phenomena observed by x-ray astronomers are the so-called cosmic bursters (x-ray sources that suddenly and dramatically increase in intensity then subside). These sudden bursts of intense x-ray radiation apparently come from compact objects with a diameter smaller than 30 miles (48 kilometers). Yet, despite their minuscule size, a typical x-ray burster can release more x-ray energy in a single brief burst than our Sun does in an entire week. The HEAO-2, the first imaging and largest x-ray telescope built to date, was capable of producing actual photographs of x-ray objects. Shortly after launch, the HEAO-2 was nicknamed the Einstein Observatory by its scientific experimenters in honor of the centernial of the birth of Albert Einstein, whose concepts of relativity and gravitation have influenced much of modern astrophysics, particularly x-ray astronomy. The HEAO was designed and developed by TRW, Inc. under the project management of the Marshall Space Flight Center.

  20. One-step synthesis of graphene/SnO2 nanocomposites and its application in electrochemical supercapacitors.

    Science.gov (United States)

    Li, Fenghua; Song, Jiangfeng; Yang, Huafeng; Gan, Shiyu; Zhang, Qixian; Han, Dongxue; Ivaska, Ari; Niu, Li

    2009-11-11

    A one-step method was developed to fabricate conductive graphene/SnO2 (GS) nanocomposites in acidic solution. Graphite oxides were reduced by SnCl2 to graphene sheets in the presence of HCl and urea. The reducing process was accompanied by generation of SnO2 nanoparticles. The structure and composition of GS nanocomposites were confirmed by means of transmission electron microscopy, x-ray photoelectron and Raman spectroscopy. Moreover, the ultracapacitor characteristics of GS nanocomposites were studied by cyclic voltammograms (CVs) and electrical impedance spectroscopy (EIS). The CVs of GS nanocomposites are nearly rectangular in shape and the specific capacitance degrades slightly as the voltage scan rate is increased. The EIS of GS nanocomposites presents a phase angle close to pi/2 at low frequency, indicating a good capacitive behavior. In addition, the GS nanocomposites could be promisingly applied in many fields such as nanoelectronics, ultracapacitors, sensors, nanocomposites, batteries and gas storage.

  1. Genome Editing in Mouse Spermatogonial Stem Cell Lines Using TALEN and Double-Nicking CRISPR/Cas9

    Directory of Open Access Journals (Sweden)

    Takuya Sato

    2015-07-01

    Full Text Available Mouse spermatogonial stem cells (SSCs can be cultured for multiplication and maintained for long periods while preserving their spermatogenic ability. Although the cultured SSCs, named germline stem (GS cells, are targets of genome modification, this process remains technically difficult. In the present study, we tested TALEN and double-nicking CRISPR/Cas9 on GS cells, targeting Rosa26 and Stra8 loci as representative genes dispensable and indispensable in spermatogenesis, respectively. Harvested GS cell colonies showed a high targeting efficiency with both TALEN and CRISPR/Cas9. The Rosa26-targeted GS cells differentiated into fertility-competent sperm following transplantation. On the other hand, Stra8-targeted GS cells showed defective spermatogenesis following transplantation, confirming its prime role in the initiation of meiosis. TALEN and CRISPR/Cas9, when applied in GS cells, will be valuable tools in the study of spermatogenesis and for revealing the genetic mechanism of spermatogenic failure.

  2. Dicty_cDB: Contig-U16033-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available -02-01-1... 34 1.1 3 ( EJ915913 ) 1093018560378 Global-Ocean-Sampling_GS-30-02-01-1... 34 1.4 3 ( AC158501 ) Med..., clone FCL-AA01. 391 e-104 1 ( EK191864 ) 1095460021744 Global-Ocean-Sampling_GS-31-01-01-1... 56 9e-04 2 (... EJ958500 ) 1093018985227 Global-Ocean-Sampling_GS-30-02-01-1... 42 0.007 3 ( EJ050843 ) 1095454146814 Global-Ocean-Sampli...ng_GS-26-01-01-1... 40 0.010 2 ( ER362701 ) 1093017965703 Global-Ocean-Sampli...ng_GS-34-01-01-1... 40 0.011 2 ( EJ677614 ) 1092955098484 Global-Ocean-Sampling_GS-30-02-01-1... 4

  3. El equívoco de la literatura infantil

    Directory of Open Access Journals (Sweden)

    Claudia Cadena Silva

    1991-05-01

    Full Text Available Torta de cumpleaños: Historias de Eusebio, I. Ivar da Coll. Ilustraciones del autor. Carlos Valencia Editores, Bogotá, 1989, 28 págs. Tengo miedo: Historias de Eusebio, II. Ivar da Coll. Ilustraciones del autor. Carlos Valencia Editores, Bogotá, 1989, 36 págs. Garabato: Historias de Eusebio, III. Ivar da Coll. Ilustraciones del autor. Carlos Valencia Editores, Bogotá, 1990, 32 págs. Isabel en invierno. Antonio Caballero. Ilustraciones del autor. Carlos Valencia Editores, Bogotá, 1989, 24 págs. Pégale duro, Joey. Beatriz Caballero. Ilustraciones de Ernesto Díaz. Carlos Valencia Editores, Bogotá, 20 págs. Conjuros y sortilegios. Irene Vasco, Cristina López. Ilustraciones de Cristina López. Carlos Valencia Editores, Bogotá, 1990, 24 págs.

  4. Libros que son eso, libros, y no son, ni remotamente, productos literarios

    Directory of Open Access Journals (Sweden)

    Julio Daniel Chaparro H.

    1990-01-01

    Full Text Available La tragedia de Armero. Augusto Cardona Agudelo. Ediciones Pijao, Bogotá, 1988, 127 págs. El último mártir de las bananeras. Miguel Madrid García. Ediciones Pijao, Bogotá, 1988, 55 págs. La muerte no respeta banderas. Antonio Echeverry Gil. Ediciones Pijao, Bogotá, 1988, 126 págs. Los oficios del hambre. Miguel Torres. Editorial Tiempo Presente, Bogotá, 1988, 126 págs. Los duros de la salsa también bailan bolero. Laureano Alba. Secretaría de Educación, Cultura y Recreación de Cali, Cali, 1987, 154 págs. Jepira. José Soto. Arango Editoriales, Bogotá, 1989, 169 págs.

  5. Para dejar que la luz siga bebiéndome

    Directory of Open Access Journals (Sweden)

    Jorge H. Cadavid

    1992-09-01

    Full Text Available La casa. Víctor López Rache. Editorial Retina, Bogotá, 1992, 64 págs. Noche y sol. Augusto Rincón Castro. Editorial Retina, Bogotá, 1992, 60 págs. Libro de alquimia y soledad. Gabriel Arturo Castro Morales. Editorial Retina, Bogotá, 1992, 64 págs. Travesia del ojo. Carlos Jiménez. Universidad del Valle, Cali, 1992, 95 pags.

  6. Book review: The Latin American left after more than a decade in power

    Directory of Open Access Journals (Sweden)

    María Reneé Barrientos Garrido

    2014-09-01

    Full Text Available Reviewed books: Pedrosa, Fernando La otra izquierda. La socialdemocracia en América Latina. Capital Intelectual, 2012. 484 págs. Levitsky, Steven y Roberts, Kenneth (eds. The Resurgence of the Latin American Left. The John Hopkins University Press, 2011. 496 págs. Dominguez, Francisco; Lievesley, Ge­raldine y Ludlam, Steve (coords. Right-wing Politics in the New Latin America: Reaction and Revolt. ZedBooks, 2011. 280 págs.

  7. Toxicological Effects of a Post Emergent Herbicide on Spirodela polyrhiza as a Model Macrophyte: A Comparison of the Effects of Pure and Nano-capsulated Form of the Herbicide

    OpenAIRE

    Samaneh Torbati *; Mehdi Mahmoudian; Neda Alimirzaei

    2018-01-01

    Background: One of the main reasons of environmental contaminations is the broad application of herbicides. Controlled release technologies such as encapsulation of herbicides are as an effective tool to reduce environmental contaminations. The aim of the present study was successful nanocapsulation of Gallant Super (GS), its characterization and compare the physiological responses of Spirodela polyrhiza L. upon exposure to GS and its encapsulated form. Methods: Nanocapsulation of GS in th...

  8. Correlates of gambling on high-school grounds

    Science.gov (United States)

    Foster, Dawn W.; Hoff, Rani A.; Pilver, Corey E.; Yau, Yvonne H. C.; Steinberg, Marvin A.; Wampler, Jeremy; Krishnan-Sarin, Suchitra; Potenza, Marc N.

    2015-01-01

    Objective This study examined adolescent gambling on school grounds (GS+) and how such behavior was associated with gambling-related attitudes. Further, we examined whether GS+ moderated associations between at-risk problem-gambling (ARPG) and gambling behaviors related to gambling partners. Method Participants were 1988 high-school students who completed survey materials. Demographic, perceptions, attitudes, and gambling variables were stratified by problem-gambling severity (ARPG versus recreational gambling) and GS+ status. Chi-square and adjusted logistic regression models were used to examine relationships among study variables. Results Nearly 40% (39.58%) of students reported past-year GS+, with 12.91% of GS+ students, relative to 2.63% of those who did not report gambling on school grounds (GS), meeting DSM-IV criteria for pathological gambling (pgambling behaviors. Weaker links in GS+ students, in comparison with GS-, students, were observed between problem-gambling severity and gambling with family members (interaction odds ratio (IOR)=0.60; 95%CI=0.39–0.92) and gambling with friends (IOR=0.21; 95%CI=0.11–0.39). Conclusions GS+ is common and associated with pathological gambling and more permissive attitudes towards gambling. The finding that GS+ (relative to GS-) youth show differences in how problem-gambling is related to gambling partners (friends and family) warrants further investigation regarding whether and how peer and familial interactions might be improved to diminish youth problem-gambling severity. The high frequency of GS+ and its relationship with ARPG highlight a need for school administrators and personnel to consider interventions that target school-based gambling. PMID:26232102

  9. Genome Size Diversity in Lilium (Liliaceae Is Correlated with Karyotype and Environmental Traits

    Directory of Open Access Journals (Sweden)

    Yun-peng Du

    2017-07-01

    Full Text Available Genome size (GS diversity is of fundamental biological importance. The occurrence of giant genomes in angiosperms is restricted to just a few lineages in the analyzed genome size of plant species so far. It is still an open question whether GS diversity is shaped by neutral or natural selection. The genus Lilium, with giant genomes, is phylogenetically and horticulturally important and is distributed throughout the northern hemisphere. GS diversity in Lilium and the underlying evolutionary mechanisms are poorly understood. We performed a comprehensive study involving phylogenetically independent analysis on 71 species to explore the diversity and evolution of GS and its correlation with karyological and environmental traits within Lilium (including Nomocharis. The strong phylogenetic signal detected for GS in the genus provides evidence consistent with that the repetitive DNA may be the primary contributors to the GS diversity, while the significant positive relationships detected between GS and the haploid chromosome length (HCL provide insights into patterns of genome evolution. The relationships between GS and karyotypes indicate that ancestral karyotypes of Lilium are likely to have exhibited small genomes, low diversity in centromeric index (CVCI values and relatively high relative variation in chromosome length (CVCL values. Significant relationships identified between GS and annual temperature and between GS and annual precipitation suggest that adaptation to habitat strongly influences GS diversity. We conclude that GS in Lilium is shaped by both neutral (genetic drift and adaptive evolution. These findings will have important consequences for understanding the evolution of giant plant genomes, and exploring the role of repetitive DNA fraction and chromosome changes in a plant group with large genomes and conservation of chromosome number.

  10. Molecular Mechanisms of Glutamine Synthetase Mutations that Lead to Clinically Relevant Pathologies.

    Directory of Open Access Journals (Sweden)

    Benedikt Frieg

    2016-02-01

    Full Text Available Glutamine synthetase (GS catalyzes ATP-dependent ligation of ammonia and glutamate to glutamine. Two mutations of human GS (R324C and R341C were connected to congenital glutamine deficiency with severe brain malformations resulting in neonatal death. Another GS mutation (R324S was identified in a neurologically compromised patient. However, the molecular mechanisms underlying the impairment of GS activity by these mutations have remained elusive. Molecular dynamics simulations, free energy calculations, and rigidity analyses suggest that all three mutations influence the first step of GS catalytic cycle. The R324S and R324C mutations deteriorate GS catalytic activity due to loss of direct interactions with ATP. As to R324S, indirect, water-mediated interactions reduce this effect, which may explain the suggested higher GS residual activity. The R341C mutation weakens ATP binding by destabilizing the interacting residue R340 in the apo state of GS. Additionally, the mutation is predicted to result in a significant destabilization of helix H8, which should negatively affect glutamate binding. This prediction was tested in HEK293 cells overexpressing GS by dot-blot analysis: Structural stability of H8 was impaired through mutation of amino acids interacting with R341, as indicated by a loss of masking of an epitope in the glutamate binding pocket for a monoclonal anti-GS antibody by L-methionine-S-sulfoximine; in contrast, cells transfected with wild type GS showed the masking. Our analyses reveal complex molecular effects underlying impaired GS catalytic activity in three clinically relevant mutants. Our findings could stimulate the development of ATP binding-enhancing molecules by which the R324S mutant can be repaired extrinsically.

  11. Meta para unos, don para otros

    Directory of Open Access Journals (Sweden)

    Jorge H. Cadavid

    1996-01-01

    Full Text Available Manos ineptas. Carlos Héctor Trejos. Editorial Universidad de Amioquia, Medellín,1995, 100 págs. El libro de las cosas. Ómar Ortiz Forero. Editorial Universidad de Antioquia. Medellín, 1995. 111 págs. Espacios relojes y tiempo. Luz Amparo Palacios M. Editorial Feriva, Armenia. 1995, 43 págs.

  12. ¿Cómo se concibe la aventura?

    Directory of Open Access Journals (Sweden)

    Alicia Fajardo M.

    1989-01-01

    Full Text Available La tortuga desdentada. Alfonso Lobo Amaya. Edilux, Medellín, 1988, 16 págs. (Ilustraciones de Pilar Pabón Z .. El maravilloso viaje de Rosendo Bucurú. Celso Román. Carlos Valencia Editores, Bogotá, 96 págs. (Ilustraciones de Diana Castellanos. Una a ventura en el papel. Roberto Rubiano Vargas. Carlos Valencia. Editores, Bogotá, 1988, 104 págs. (Ilustraciones de Diana Castellanos

  13. Resenha de: Velhos Regimentos

    Directory of Open Access Journals (Sweden)

    Odilon Nogueira de Matos

    1967-03-01

    Full Text Available FORTES (Heitor Borges . — Velhos Regimentos. Rio de Janeiro, Biblioteca do Exército, 1964. 380 págs. — CAMPOS (Sena . — Logistica para a Invasão. Rio de Janeiro, Biblioteca do Exército, 1965. 196 págs. — PILLAR (Olyntho . — Os Patrônos das Fôrças Armadas. Rio de Ja-neiro, Biblioteca do Exército, 1966. 320 págs.

  14. PCR-based isolation and identification of full-length low-molecular-weight glutenin subunit genes in bread wheat (Triticum aestivum L.).

    Science.gov (United States)

    Zhang, Xiaofei; Liu, Dongcheng; Jiang, Wei; Guo, Xiaoli; Yang, Wenlong; Sun, Jiazhu; Ling, Hongqing; Zhang, Aimin

    2011-12-01

    Low-molecular-weight glutenin subunits (LMW-GSs) are encoded by a multi-gene family and are essential for determining the quality of wheat flour products, such as bread and noodles. However, the exact role or contribution of individual LMW-GS genes to wheat quality remains unclear. This is, at least in part, due to the difficulty in characterizing complete sequences of all LMW-GS gene family members in bread wheat. To identify full-length LMW-GS genes, a polymerase chain reaction (PCR)-based method was established, consisting of newly designed conserved primers and the previously developed LMW-GS gene molecular marker system. Using the PCR-based method, 17 LMW-GS genes were identified and characterized in Xiaoyan 54, of which 12 contained full-length sequences. Sequence alignments showed that 13 LMW-GS genes were identical to those found in Xiaoyan 54 using the genomic DNA library screening, and the other four full-length LMW-GS genes were first isolated from Xiaoyan 54. In Chinese Spring, 16 unique LMW-GS genes were isolated, and 13 of them contained full-length coding sequences. Additionally, 16 and 17 LMW-GS genes in Dongnong 101 and Lvhan 328 (chosen from the micro-core collections of Chinese germplasm), respectively, were also identified. Sequence alignments revealed that at least 15 LMW-GS genes were common in the four wheat varieties, and allelic variants of each gene shared high sequence identities (>95%) but exhibited length polymorphism in repetitive regions. This study provides a PCR-based method for efficiently identifying LMW-GS genes in bread wheat, which will improve the characterization of complex members of the LMW-GS gene family and facilitate the understanding of their contributions to wheat quality.

  15. CERN Shuttles - Enlarged Regular Shuttle Services as from 8/02/2010

    CERN Multimedia

    2010-01-01

    As of Monday 8 February 2010, please note the enhancement of the regular shuttle services: - with now two shuttles dedicated to the transportation within and between both CERN sites, Meyrin and Prevessin with bus stop at more buildings - To and from the Geneva airport every hour (from building 500) to complement the TPG bus Y For timetable details, please click here: http://gs-dep.web.cern.ch/gs-dep/groups/sem/ls/RegularShuttleTimetable_Feb2010.htm GS-SEM

  16. Oral nano-delivery of anticancer ginsenoside 25-OCH3-PPD, a natural inhibitor of the MDM2 oncogene: Nanoparticle preparation, characterization, in vitro and in vivo anti-prostate cancer activity, and mechanisms of action.

    Science.gov (United States)

    Voruganti, Sukesh; Qin, Jiang-Jiang; Sarkar, Sushanta; Nag, Subhasree; Walbi, Ismail A; Wang, Shu; Zhao, Yuqing; Wang, Wei; Zhang, Ruiwen

    2015-08-28

    The Mouse Double Minute 2 (MDM2) oncogene plays a critical role in cancer development and progression through p53-dependent and p53-independent mechanisms. Both natural and synthetic MDM2 inhibitors have been shown anticancer activity against several human cancers. We have recently identified a novel ginsenoside, 25-OCH3-PPD (GS25), one of the most active anticancer ginsenosides discovered thus far, and have demonstrated its MDM2 inhibition and anticancer activity in various human cancer models, including prostate cancer. However, the oral bioavailability of GS25 is limited, which hampers its further development as an oral anticancer agent. The present study was designed to develop a novel nanoparticle formulation for oral delivery of GS25. After GS25 was successfully encapsulated into PEG-PLGA nanoparticles (GS25NP) and its physicochemical properties were characterized, the efficiency of MDM2 targeting, anticancer efficacy, pharmacokinetics, and safety were evaluated in in vitro and in vivo models of human prostate cancer. Our results indicated that, compared with the unencapsulated GS25, GS25NP demonstrated better MDM2 inhibition, improved oral bioavailability and enhanced in vitro and in vivo activities. In conclusion, the validated nano-formulation for GS25 oral delivery improves its molecular targeting, oral bioavailability and anticancer efficacy, providing a basis for further development of GS25 as a novel agent for cancer therapy and prevention.

  17. The role of adrenal hormones in the response of glutamine synthetase to fasting in adult and old rats.

    Science.gov (United States)

    Mezzarobba, V; Torrent, A; Leydier, I; Alles, S; Brajon, B; Mignon, M; Attaix, D; Meynial-Denis, D

    2003-12-01

    During fasting, skeletal muscle exports increased amounts of glutamine (Gln) while increasing the production of this amino acid by glutamine synthetase (GS) in order to maintain the intramuscular Gln pool. Glucocorticoid hormones are believed to be the principal mediators of GS induction during stress conditions. The aim of this study was to evaluate (1) the effect of fasting on GS activity and expression in skeletal muscle during aging and consequently, (2) the role of glucocorticoids in fasting-induced GS activity. Male Wistar rats (6-, 22-month old) were fasted for 5 days and both the activity and expression of GS were measured in tibialis anterior muscle. To better demonstrate the role of glucocorticoids in the response of GS to fasting, we suppressed their action by RU38486 administration (a potent glucocorticoid antagonist) and their production by adrenalectomy in fed and fasted rats. An increase in fasting-induced GS activity was observed in skeletal muscles from both adult and aged rats. Adrenalectomy, but surprisingly not RU38486, suppressed the fasting-induced increase in GS activity and expression. The data clearly show that the GS responsiveness to fasting was not modified by aging in skeletal muscle.

  18. Epigallocatechin Gallate-Modified Gelatin Sponges Treated by Vacuum Heating as a Novel Scaffold for Bone Tissue Engineering.

    Science.gov (United States)

    Honda, Yoshitomo; Takeda, Yoshihiro; Li, Peiqi; Huang, Anqi; Sasayama, Satoshi; Hara, Eiki; Uemura, Naoya; Ueda, Mamoru; Hashimoto, Masanori; Arita, Kenji; Matsumoto, Naoyuki; Hashimoto, Yoshiya; Baba, Shunsuke; Tanaka, Tomonari

    2018-04-11

    Chemical modification of gelatin using epigallocatechin gallate (EGCG) promotes bone formation in vivo. However, further improvements are required to increase the mechanical strength and bone-forming ability of fabricated EGCG-modified gelatin sponges (EGCG-GS) for practical applications in regenerative therapy. In the present study, we investigated whether vacuum heating-induced dehydrothermal cross-linking of EGCG-GS enhances bone formation in critical-sized rat calvarial defects. The bone-forming ability of vacuum-heated EGCG-GS (vhEGCG-GS) and other sponges was evaluated by micro-computed tomography and histological staining. The degradation of sponges was assessed using protein assays, and cell morphology and proliferation were verified by scanning electron microscopy and immunostaining using osteoblastic UMR106 cells in vitro. Four weeks after the implantation of sponges, greater bone formation was detected for vhEGCG-GS than for EGCG-GS or vacuum-heated gelatin sponges (dehydrothermal cross-linked sponges without EGCG). In vitro experiments revealed that the relatively low degradability of vhEGCG-GS supports cell attachment, proliferation, and cell-cell communication on the matrix. These findings suggest that vacuum heating enhanced the bone forming ability of EGCG-GS, possibly via the dehydrothermal cross-linking of EGCG-GS, which provides a scaffold for cells, and by maintaining the pharmacological effect of EGCG.

  19. Improved antimicrobial activity of Pediococcus acidilactici against Salmonella Gallinarum by UV mutagenesis and genome shuffling.

    Science.gov (United States)

    Han, Geon Goo; Song, Ahn Ah; Kim, Eun Bae; Yoon, Seong-Hyun; Bok, Jin-Duck; Cho, Chong-Su; Kil, Dong Yong; Kang, Sang-Kee; Choi, Yun-Jaie

    2017-07-01

    Pediococcus acidilactici is a widely used probiotic, and Salmonella enterica serovar Gallinarum (SG) is a significant pathogen in the poultry industry. In this study, we improved the antimicrobial activity of P. acidilactici against SG using UV mutation and genome shuffling (GS). To improve antimicrobial activity against SG, UV mutagenesis was performed against wild-type P. acidilactici (WT), and five mutants showed improved antimicrobial activity. To further improve antimicrobial activity, GS was performed on five UV mutants. Following GS, four mutants showed improved antimicrobial activity compared with the UV mutants and WT. The antimicrobial activity of GS1 was highest among the mutants; however, the activity was reduced when the culture supernatant was treated with proteinase K, suggesting that the improved antimicrobial activity is due to a proteinous substance such as bacteriocin. To validate the activity of GS1 in vivo, we designed multi-species probiotics and performed broiler feeding experiments. Groups consisted of no treatment (NC), avilamycin-treated (PC), probiotic group 1 containing WT (T1), and probiotic group 2 containing GS1 (T2). In broiler feeding experiments, coliform bacteria were significantly reduced in T2 compared with NC, PC, and T1. The cecal microbiota was modulated and pathogenic bacteria were reduced by GS1 oral administration. In this study, GS1 showed improved antimicrobial activity against SG in vitro and reduced pathogenic bacteria in a broiler feeding experiment. These results suggest that GS1 can serve as an efficient probiotic, as an alternative to antibiotics in the poultry industry.

  20. Ursodeoxycholic acid improves gastrointestinal motility defects in gallstone patients

    Science.gov (United States)

    Colecchia, A; Mazzella, G; Sandri, L; Azzaroli, F; Magliuolo, M; Simoni, P; Bacchi-Reggiani, ML; Roda, E; Festi, D

    2006-01-01

    AIM: To simultaneously evaluate the presence of defects in gallbladder and gastric emptying, as well as in intestinal transit in gallstone patients (GS) and the effect of chronic ursodeoxycholic acid (UDCA) administration on these parameters and on serum bile acids and clinical outcome in GS and controls (CTR). METHODS: After a standard liquid test meal, gallbla-dder and gastric emptying (by ultrasound), oroileal transit time (OITT) (by an immunoenzymatic technique) and serum bile acids (by HPLC) were evaluated before and after 3 mo of UDCA (12 mg/kg bw/d) or placebo administration in 10 symptomatic GS and 10 matched healthy CTR. RESULTS: OITT was longer in GS than in CTR (P < 0.0001); UDCA significantly reduced OITT in GS (P < 0.0001), but not in CTR. GS had longer gastric half-emptying time (t1/2) than CTR (P < 0.0044) at baseline; after UDCA, t1/2 significantly decreased (P < 0.006) in GS but not in CTR. Placebo administration had no effect on gastric emptying and intestinal transit in both GS and CTR. CONCLUSION: The gallstone patient has simultaneous multiple impairments of gallbladder and gastric emptying, as well as of intestinal transit. UDCA administration restores these defects in GS, without any effect in CTR. These results confirm the pathogenetic role of gastrointestinal motility in gallstone disease and suggest an additional mechanism of action for UDCA in reducing bile cholesterol supersaturation. PMID:16981264

  1. Intercomparison of the Gulf Stream in ocean reanalyses: 1993-2010

    Science.gov (United States)

    Chi, Lequan; Wolfe, Christopher L. P.; Hameed, Sultan

    2018-05-01

    In recent years, significant progress has been made in the development of high-resolution ocean reanalysis products. This paper compares aspects of the Gulf Stream (GS) from the Florida Straits to south of the Grand Banks-particularly Florida Strait transport, separation of the GS near Cape Hatteras, GS properties along the Oleander Line (from New Jersey to Bermuda), GS path, and the GS north wall positions-in 13 widely used global reanalysis products of various resolutions, including two unconstrained products. A large spread across reanalysis products is found. HYCOM and GLORYS2v4 stand out for their superior performance by most metrics. Some common biases are found in all discussed models; for example, the velocity structure of the GS near the Oleander Line is too symmetrical and the maximum velocity is too weak compared with observations. Less than half of the reanalysis products show significant correlations (at the 95% confidence level) with observations for the GS separation latitude at Cape Hatteras, the GS transport, and net transport across Oleander Line. The cross-stream velocity structure is further discussed by a theoretical model idealizing GS as a smoothed PV front.

  2. Electrical Circuits and Water Analogies

    Science.gov (United States)

    Smith, Frederick A.; Wilson, Jerry D.

    1974-01-01

    Briefly describes water analogies for electrical circuits and presents plans for the construction of apparatus to demonstrate these analogies. Demonstrations include series circuits, parallel circuits, and capacitors. (GS)

  3. Autoayuda, alzhéimer, resiliencia y detectives en libros para niños

    Directory of Open Access Journals (Sweden)

    Carlos Sánchez Lozano

    2016-08-01

    Full Text Available Palabras mágicas que curan. Mario Angulo Mosquera. Carolina Gamboa (Ilustradora. Panamericana, Bogotá, 2011, 68 págs. ¡La abuela perdió un recuerdo! Carlos Vásquez-Zawadski, Rocío Parra (Ilustradora. Panamericana, Bogotá, 2011, 52 págs. Tapir. Jairo Aníbal Niño, Michi Peláez (Ilustradora. Panamericana, Bogotá, 2011, 164 págs. Una aventura en el papel. Roberto Rubiano Vargas, Michi Peláez (Ilustradora. Panamericana, Bogotá, 2011, 108 págs.

  4. ORF Alignment: NC_006905 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available GPACNLACRYCYYPQGETPVEKMNESTLEVFICRYIAAQPASAREINFVWQ 82 ... PFHILAKPIGPACNLACRYCYYPQGETPVEKMNESTLEVFIC...RYIAAQPASAREINFVWQ Sbjct: 1 ... PFHILAKPIGPACNLACRYCYYPQGETPVEKMNESTLEVFICRYIAAQPASAREINFVWQ 60 ... Query: 143 GS... ... Choleraesuis str. SC-B67] ... Length = 269 ... Query: 23 ... PFHILAKPI

  5. Testing the link between genome size and growth rate in maize

    Directory of Open Access Journals (Sweden)

    Maud I. Tenaillon

    2016-09-01

    Full Text Available Little is known about the factors driving within species Genome Size (GS variation. GS may be shaped indirectly by natural selection on development and adaptative traits. Because GS variation is particularly pronounced in maize, we have sampled 83 maize inbred lines from three well described genetic groups adapted to contrasted climate conditions: inbreds of tropical origin, Flint inbreds grown in temperate climates, and Dent inbreds distributed in the Corn Belt. As a proxy for growth rate, we measured the Leaf Elongation Rate maximum during nighttime (LERmax as well as GS in all inbred lines. In addition we combined available and new nucleotide polymorphism data at 29,090 sites to characterize the genetic structure of our panel. We found significant variation for both LERmax and GS among groups defined by our genetic structuring. Tropicals displayed larger GS than Flints while Dents exhibited intermediate values. LERmax followed the opposite trend with greater growth rate in Flints than in Tropicals. In other words, LERmax and GS exhibited a significantly negative correlation (r = − 0.27. However, this correlation was driven by among-group variation rather than within-group variation—it was no longer significant after controlling for structure and kinship among inbreds. Our results indicate that selection on GS may have accompanied ancient maize diffusion from its center of origin, with large DNA content excluded from temperate areas. Whether GS has been targeted by more intense selection during modern breeding within groups remains an open question.

  6. Molecular mechanism by which AMP-activated protein kinase activation promotes glycogen accumulation in muscle

    DEFF Research Database (Denmark)

    Hunter, Roger W; Treebak, Jonas Thue; Wojtaszewski, Jørgen

    2011-01-01

    AND METHODS We recently generated knock-in mice in which wild-type muscle GS was replaced by a mutant (Arg582Ala) that could not be activated by glucose-6-phosphate (G6P), but possessed full catalytic activity and could still be activated normally by dephosphorylation. Muscles from GS knock-in or transgenic......-insensitive GS knock-in mice, although AICAR-stimulated AMPK activation, glucose transport, and total glucose utilization were normal. CONCLUSIONS We provide genetic evidence that AMPK activation promotes muscle glycogen accumulation by allosteric activation of GS through an increase in glucose uptake...

  7. Libros colombianos raros y curiosos: junio de 1964

    Directory of Open Access Journals (Sweden)

    Ignacio Rodríguez Guerrero

    1964-06-01

    Full Text Available El documento presenta la reseña del siguiente título: RIVAS VICUÑA FRANCISCO. (¿ 1881- ... ? . Las Guerras de Bolívar. Tomo 1. Biblioteca de Historia Nacional. Vol. XLIX. Imp. Nal. 18 x 25 ctms. XI-281 págs. Bogotá, 1934. Tomo 2. Bibl. de Hist. N al. Vol. LI. Ibid. 328 págs. Bogotá, 1936. Tomo 3. Bibl. de Hist. N al. Vol. LII. Ibid. 321 págs. Bogotá, 1938. Tomo 4. Bibl. de Hist. N al. Vol. LIJI. Ibid. 641 págs. Bogotá, 1938.

  8. Synthesis and phototoxicity of isomeric 7,9-diglutathione pyrrole adducts: Formation of reactive oxygen species and induction of lipid peroxidation

    Directory of Open Access Journals (Sweden)

    Liang Ma

    2015-09-01

    Full Text Available Pyrrolizidine alkaloids (PAs are hepatotoxic, genotoxic, and carcinogenic in experimental animals. Because of their widespread distribution in the world, PA-containing plants are probably the most common poisonous plants affecting livestock, wildlife, and humans. Upon metabolism, PAs generate reactive dehydro-PAs and other pyrrolic metabolites that lead to toxicity. Dehydro-PAs are known to react with glutathione (GSH to form 7-GSH-(+/−-6,7-dihydro-7-hydroxy-1-hydroxymethyl-5H-pyrrolizine (7-GS-DHP in vivo and in vitro and 7,9-diGS-DHP in vitro. To date, the phototoxicity of GS-DHP adducts has not been well studied. In this study, we synthesized 7-GS-DHP, a tentatively assigned 9-GS-DHP, and two enantiomeric 7,9-diGS-DHP adducts by reaction of dehydromonocrotaline with GSH. The two 7,9-diGS-DHPs were separated by high performance liquid chromatography (HPLC and their structures were characterized by 1H nuclear magnetic resonance (NMR and 1H–1H correlation spectroscopy (COSY NMR spectral analysis. Photoirradiation of 7-GS-DHP, 9-GS-DHP, and the two 7,9-diGS-DHPs as well as dehydromonocrotaline, dehydroheliotrine, and the 7-R enantiomer of DHP (DHR, by UVA light at 0 J/cm2, 14 J/cm2, and 35 J/cm2 in the presence of a lipid, methyl linoleate, all resulted in lipid peroxidation in a light dose-responsive manner. The levels of lipid peroxidation induced by the two isomeric 7,9-diGS-DHPs were significantly higher than that by 7-GS-DHP and 9-GS-DHP. When 7,9-diGS-DHP was irradiated in the presence of sodium azide (NaN3, the level of lipid peroxidation decreased; lipid peroxidation was enhanced when methanol was replaced by deuterated methanol. These results suggest that singlet oxygen is a product induced by the irradiation of 7,9-diGS-DHP. When irradiated in the presence of superoxide dismutase (SOD, the level of lipid peroxidation decreased, indicating that lipid peroxidation is also mediated by superoxide. These results indicate that lipid

  9. Glutamine Synthetase: Localization Dictates Outcome

    Directory of Open Access Journals (Sweden)

    Alessandra Castegna

    2018-02-01

    Full Text Available Glutamine synthetase (GS is the adenosine triphosphate (ATP-dependent enzyme that catalyses the synthesis of glutamine by condensing ammonium to glutamate. In the circulatory system, glutamine carries ammonia from muscle and brain to the kidney and liver. In brain reduction of GS activity has been suggested as a mechanism mediating neurotoxicity in neurodegenerative disorders. In cancer, the delicate balance between glutamine synthesis and catabolism is a critical event. In vitro evidence, confirmed in vivo in some cases, suggests that reduced GS activity in cancer cells associates with a more invasive and aggressive phenotype. However, GS is known to be highly expressed in cells of the tumor microenvironment, such as fibroblasts, adipocytes and immune cells, and their ability to synthesize glutamine is responsible for the acquisition of protumoral phenotypes. This has opened a new window into the complex scenario of the tumor microenvironment, in which the balance of glutamine consumption versus glutamine synthesis influences cellular function. Since GS expression responds to glutamine starvation, a lower glutamine synthesizing power due to the absence of GS in cancer cells might apply a metabolic pressure on stromal cells. This event might push stroma towards a GS-high/protumoral phenotype. When referred to stromal cells, GS expression might acquire a ‘bad’ significance to the point that GS inhibition might be considered a conceivable strategy against cancer metastasis.

  10. Selective determination of dopamine using quantum-sized gold nanoparticles protected with charge selective ligands

    Science.gov (United States)

    Kwak, Kyuju; Kumar, S. Senthil; Lee, Dongil

    2012-06-01

    We report here the selective determination of dopamine (DA) using quantum-sized gold nanoparticles coated with charge selective ligands. Glutathione protected gold nanoparticles (GS-Au25) were synthesized and immobilized into a sol-gel matrix via thiol linkers. The GS-Au25 modified sol-gel electrode was found to show excellent electrocatalytic activity towards the oxidation of DA but no activity towards the oxidation of ascorbic acid. The role of electrostatic charge in the selective electrocatalytic activity of GS-Au25 was verified by voltammetry of redox markers carrying opposite charges. The pH dependent sensitivity for the determination of DA further confirmed the charge screening effect of GS-Au25. Mechanistic investigation revealed that the selectivity is attained by the selective formation of an electrostatic complex between the negatively charged GS-Au25 and DA cation. The GS-Au25 modified sol-gel electrode also showed excellent selectivity for DA in the presence of an interferent, ascorbic acid.We report here the selective determination of dopamine (DA) using quantum-sized gold nanoparticles coated with charge selective ligands. Glutathione protected gold nanoparticles (GS-Au25) were synthesized and immobilized into a sol-gel matrix via thiol linkers. The GS-Au25 modified sol-gel electrode was found to show excellent electrocatalytic activity towards the oxidation of DA but no activity towards the oxidation of ascorbic acid. The role of electrostatic charge in the selective electrocatalytic activity of GS-Au25 was verified by voltammetry of redox markers carrying opposite charges. The pH dependent sensitivity for the determination of DA further confirmed the charge screening effect of GS-Au25. Mechanistic investigation revealed that the selectivity is attained by the selective formation of an electrostatic complex between the negatively charged GS-Au25 and DA cation. The GS-Au25 modified sol-gel electrode also showed excellent selectivity for DA in the

  11. Improving the efficiency of CHO cell line generation using glutamine synthetase gene knockout cells.

    Science.gov (United States)

    Fan, Lianchun; Kadura, Ibrahim; Krebs, Lara E; Hatfield, Christopher C; Shaw, Margaret M; Frye, Christopher C

    2012-04-01

    Although Chinese hamster ovary (CHO) cells, with their unique characteristics, have become a major workhorse for the manufacture of therapeutic recombinant proteins, one of the major challenges in CHO cell line generation (CLG) is how to efficiently identify those rare, high-producing clones among a large population of low- and non-productive clones. It is not unusual that several hundred individual clones need to be screened for the identification of a commercial clonal cell line with acceptable productivity and growth profile making the cell line appropriate for commercial application. This inefficiency makes the process of CLG both time consuming and laborious. Currently, there are two main CHO expression systems, dihydrofolate reductase (DHFR)-based methotrexate (MTX) selection and glutamine synthetase (GS)-based methionine sulfoximine (MSX) selection, that have been in wide industrial use. Since selection of recombinant cell lines in the GS-CHO system is based on the balance between the expression of the GS gene introduced by the expression plasmid and the addition of the GS inhibitor, L-MSX, the expression of GS from the endogenous GS gene in parental CHOK1SV cells will likely interfere with the selection process. To study endogenous GS expression's potential impact on selection efficiency, GS-knockout CHOK1SV cell lines were generated using the zinc finger nuclease (ZFN) technology designed to specifically target the endogenous CHO GS gene. The high efficiency (∼2%) of bi-allelic modification on the CHO GS gene supports the unique advantages of the ZFN technology, especially in CHO cells. GS enzyme function disruption was confirmed by the observation of glutamine-dependent growth of all GS-knockout cell lines. Full evaluation of the GS-knockout cell lines in a standard industrial cell culture process was performed. Bulk culture productivity improved two- to three-fold through the use of GS-knockout cells as parent cells. The selection stringency was

  12. The Impact of Group Size on Welfare Indicators of Ewes during Pregnancy

    Science.gov (United States)

    Averós, Xavier; Beltrán de Heredia, Ignacia; Ruiz, Roberto; Estevez, Inma

    2016-01-01

    Group size (GS) and space allowance have major implications for the welfare of production species, however their effects are often confounded. In a previous study we investigated the impact of varying space allowance at constant GS. In the present work we report the consequences of varying GS on pregnant ewes while controlling space allowance. We housed ewes at 6 (GS6) or 12 ewes/enclosure (GS12), while controlling space allowance to 1.5 m2/ewe (3 enclosures/treatment), and necessarily varying enclosure size. Therefore, when indicating GS effects we implicitly reflect a confounding effect with that of enclosure size. Movement, use of space, behaviour, serum cortisol concentration and body condition score (BCS) were collected during the last 12 gestation weeks. Movement, use of space, and behaviour were collected every other week, during 2 days/week, using 10 minute continuous scan samplings. Blood was collected during weeks 10, 13, 17, and 21 of gestation, and BCS during weeks 15 and 21. Data were analysed using repeated measures, generalized linear mixed models, with GS, week, and their interaction as fixed effects, and enclosure as random effect. GS mainly affected movement and use of space. GS12 ewes walked longer distances using longer steps (Pewe is given during gestation, larger GS will result in larger effective space, and no major implications for the welfare of ewes should be expected as GS increases. Ewes will adapt their movement patterns and use of space to enclosure size, and no further behavioural, physiological and physical consequences should be expected. PMID:27893817

  13. THE IMPORTANCE OF HIGH-MOLECULAR-WEIGHT GLUTENIN SUBUNITS FOR WHEAT QUALITY EVALUATION

    Directory of Open Access Journals (Sweden)

    G. Drezner

    2006-06-01

    Full Text Available High-molecular-weight glutenin subunits (HMW-GS composition was analyzed by sodium-dodecyl-sulfat-polyacrilamid-gel electrophoresis (SDS-PAGE, while the quantitative determination of total HMW-GS was obtained by reversed phase- high performance liquid chromatography (RP-HPLC. Considering HMW-GS composition, the most frequent subunits at Glu-A1 locus were N, at Glu-B1 locus 7+9 and at Glu-D1 locus 2+12. The cultivars with the GS 5+10 at Glu-D1 locus have shown better technological characteristics in contrast to cultivars with the GS 2+12. The cultivars Žitarka, Srpanjka, Barbara, Klara and Golubica in spite of presence HMW-GS 2+12 have shown very good and good technological properties because they had optimal proportions (>10% of total HMW-GS. The results of the linear correlation analysis between quality parameters and HMW-GS composition have shown significant (P<0.05 positive influence of HMW-GS (Glu-1 score on sedimentation value (r=0.55, Gluten Index (r=0.72, dough energy (r=0.61, maximum resistance (r=0.64 and resistance to extensibility ratio (r=0.58. The influence of HMW GS proportions on technological parameters, compared to HMW-GS composition, was more pronounced on protein content (r=0.82, dough development time (r=0.70, degree of softening (r=-0.90, dough energy (r=0.74 and loaf volume (r=0.65.

  14. Potential of Genomic Selection in Mass Selection Breeding of an Allogamous Crop: An Empirical Study to Increase Yield of Common Buckwheat

    Directory of Open Access Journals (Sweden)

    Shiori Yabe

    2018-03-01

    Full Text Available To evaluate the potential of genomic selection (GS, a selection experiment with GS and phenotypic selection (PS was performed in an allogamous crop, common buckwheat (Fagopyrum esculentum Moench. To indirectly select for seed yield per unit area, which cannot be measured on a single-plant basis, a selection index was constructed from seven agro-morphological traits measurable on a single plant basis. Over 3 years, we performed two GS and one PS cycles per year for improvement in the selection index. In GS, a prediction model was updated every year on the basis of genotypes of 14,598–50,000 markers and phenotypes. Plants grown from seeds derived from a series of generations of GS and PS populations were evaluated for the traits in the selection index and other yield-related traits. GS resulted in a 20.9% increase and PS in a 15.0% increase in the selection index in comparison with the initial population. Although the level of linkage disequilibrium in the breeding population was low, the target trait was improved with GS. Traits with higher weights in the selection index were improved more than those with lower weights, especially when prediction accuracy was high. No trait changed in an unintended direction in either GS or PS. The accuracy of genomic prediction models built in the first cycle decreased in the later cycles because the genetic bottleneck through the selection cycles changed linkage disequilibrium patterns in the breeding population. The present study emphasizes the importance of updating models in GS and demonstrates the potential of GS in mass selection of allogamous crop species, and provided a pilot example of successful application of GS to plant breeding.

  15. Pilot study for supervised target detection applied to spatially registered multiparametric MRI in order to non-invasively score prostate cancer.

    Science.gov (United States)

    Mayer, Rulon; Simone, Charles B; Skinner, William; Turkbey, Baris; Choykey, Peter

    2018-03-01

    Gleason Score (GS) is a validated predictor of prostate cancer (PCa) disease progression and outcomes. GS from invasive needle biopsies suffers from significant inter-observer variability and possible sampling error, leading to underestimating disease severity ("underscoring") and can result in possible complications. A robust non-invasive image-based approach is, therefore, needed. Use spatially registered multi-parametric MRI (MP-MRI), signatures, and supervised target detection algorithms (STDA) to non-invasively GS PCa at the voxel level. This study retrospectively analyzed 26 MP-MRI from The Cancer Imaging Archive. The MP-MRI (T2, Diffusion Weighted, Dynamic Contrast Enhanced) were spatially registered to each other, combined into stacks, and stitched together to form hypercubes. Multi-parametric (or multi-spectral) signatures derived from a training set of registered MP-MRI were transformed using statistics-based Whitening-Dewhitening (WD). Transformed signatures were inserted into STDA (having conical decision surfaces) applied to registered MP-MRI determined the tumor GS. The MRI-derived GS was quantitatively compared to the pathologist's assessment of the histology of sectioned whole mount prostates from patients who underwent radical prostatectomy. In addition, a meta-analysis of 17 studies of needle biopsy determined GS with confusion matrices and was compared to the MRI-determined GS. STDA and histology determined GS are highly correlated (R = 0.86, p < 0.02). STDA more accurately determined GS and reduced GS underscoring of PCa relative to needle biopsy as summarized by meta-analysis (p < 0.05). This pilot study found registered MP-MRI, STDA, and WD transforms of signatures shows promise in non-invasively GS PCa and reducing underscoring with high spatial resolution. Copyright © 2018 Elsevier Ltd. All rights reserved.

  16. The need for central pathology tumor grading in prostate cancer using radiation therapy oncology group(RTOG)8531

    International Nuclear Information System (INIS)

    Winter, K.; Grignon, D.; Pajak, T.F.; Pilepich, M.; Byhardt, R.; Lawton, C.; Gallagher, M.; Mesic, J.; Roach, M.; Hanks, G.; Coughlin, C.; Porter, A.

    1997-01-01

    Purpose/Objective: Inconsistent reproducibility among pathologists when grading the tumor with the Gleason system is well known. Its impact on results and conclusions of clinical trials will be investigated. Materials and Methods: RTOG 8531 was a Phase III trial that tested the timing of hormones with radiotherapy in patients with prostate cancer. There were 977 patients were entered into RTOG 8531, of which 760 had both an institutional and a centrally reviewed Gleason Score(GS). The centrally reviewed GS were performed by a single pathologist and institutional GS came from over 70 different participating institutions. Results: The concordance rate between the grouping of the two scores was 36% (GS 2-5), 70% (GS 6-7) and 73% (GS 8-10) with the discrepancies occurring in both directions. Using patients from the delayed hormone arm, there was a highly significant survival difference between the centrally reviewed GS groups (p = .0001). When the institutional GS groups were used, there was no significant survival difference (p=.19). Another survival analysis compared the treatment arms for GS 8-10 patients. When the centrally reviewed GS were used, there was a significant difference(p = .02), but when the institutional GS were used there was no significant difference in survival between the treatments (p=.48). Conclusions: The lack of reproducibility of Gleason scores among pathologists can lead to very different results and conclusions from clinical trials depending on whether the centrally reviewed or institutional Gleason scores are used. Whenever results are being reported by Gleason score, it is necessary to also report how many pathologists were involved in the grading. If Gleason scores are going to be used in the analysis of treatment, a central review of the Gleason scores is crucial

  17. Potential of Genomic Selection in Mass Selection Breeding of an Allogamous Crop: An Empirical Study to Increase Yield of Common Buckwheat.

    Science.gov (United States)

    Yabe, Shiori; Hara, Takashi; Ueno, Mariko; Enoki, Hiroyuki; Kimura, Tatsuro; Nishimura, Satoru; Yasui, Yasuo; Ohsawa, Ryo; Iwata, Hiroyoshi

    2018-01-01

    To evaluate the potential of genomic selection (GS), a selection experiment with GS and phenotypic selection (PS) was performed in an allogamous crop, common buckwheat ( Fagopyrum esculentum Moench). To indirectly select for seed yield per unit area, which cannot be measured on a single-plant basis, a selection index was constructed from seven agro-morphological traits measurable on a single plant basis. Over 3 years, we performed two GS and one PS cycles per year for improvement in the selection index. In GS, a prediction model was updated every year on the basis of genotypes of 14,598-50,000 markers and phenotypes. Plants grown from seeds derived from a series of generations of GS and PS populations were evaluated for the traits in the selection index and other yield-related traits. GS resulted in a 20.9% increase and PS in a 15.0% increase in the selection index in comparison with the initial population. Although the level of linkage disequilibrium in the breeding population was low, the target trait was improved with GS. Traits with higher weights in the selection index were improved more than those with lower weights, especially when prediction accuracy was high. No trait changed in an unintended direction in either GS or PS. The accuracy of genomic prediction models built in the first cycle decreased in the later cycles because the genetic bottleneck through the selection cycles changed linkage disequilibrium patterns in the breeding population. The present study emphasizes the importance of updating models in GS and demonstrates the potential of GS in mass selection of allogamous crop species, and provided a pilot example of successful application of GS to plant breeding.

  18. Plant nutritional status modulates glutamine synthetase levels in ripe tomatoes (Solanum lycopersicum cv. Micro-Tom).

    Science.gov (United States)

    Scarpeci, Telma E; Marro, Martin L; Bortolotti, Santiago; Boggio, Silvana B; Valle, Estela M

    2007-02-01

    Tomato (Solanum lycopersicum) fruit ripening implies that chloroplastic proteins are degraded and new proteins are synthesized. Supplementary nutrition is frequently required when tomato plants begin to fruit and continues until the end of the plant's life cycle. Ammonium assimilation is crucial in these fruit maturation and ripening processes. Glutamine synthetase (GS; EC 6.3.1.2), the main ammonium-fixing enzyme in plants, could not be detected in red fruits of several tomato varieties when growing under standard nutrition. In this paper, we analyze the influence of the nutritional status on the ammonium assimilation capacity of ripe tomato (cv. Micro-Tom) fruit. For this purpose, GS expression and protein profiles were followed in mature green and red fruits harvested from plants grown under standard or supplemented nutrition. Under standard nutrient regime (weekly supplied with 0.5 x Hoagland solution) GS activity was found in chloroplasts (GS2) of mature green fruits, but it was not detected either in the chromoplasts or in the cytosol of red fruits. When plants were shifted to a supplemented nutritional regime (daily supplied with 0.5 x Hoagland solution), GS was found in red fruits. Also, cytosolic transcripts (gs1) preferentially accumulated in red fruits under high nutrition. These results indicate that mature green Micro-Tom fruits assimilate ammonia through GS2 under standard nutrition, while ripe red fruits accumulate GS1 under high nutrition, probably in order to assimilate the extra N-compounds made available through supplemented nutrition.

  19. Dicty_cDB: Contig-U16473-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available clavatum 18S ribosomal RNA gene, pa... 54 0.022 1 ( AY230088 ) Chama sp. Seychelles...-GS-2003 isolate b 18S riboso... 54 0.022 1 ( AY230087 ) Chama sp. Seychelles-GS-2003 isolate a 18S riboso

  20. Perfluorocarbons and Gilbert syndrome (phenotype) in the C8 Health Study Population

    Energy Technology Data Exchange (ETDEWEB)

    Fan, Hongmin [Cancer Center, School of Public Health, West Virginia University, Morgantown, WV 265050-9190 (United States); Department of Epidemiology and Statistics, School of Public Health, Hebei United University, Hebei 063000 (China); Ducatman, Alan [Department of Occupational and Environmental Health, School of Public Health, West Virginia University (United States); Department of Medicine, School of Medicine, West Virginia University (United States); Clinical Translational Science Institute, West Virginia University (United States); Zhang, Jianjun [Department of Biostatistics, School Public Health, West Virginia University (United States)

    2014-11-15

    Background: Gilbert syndrome (GS) is an inherited defect of bilirubin conjugation, most commonly caused by a gene mutation for the enzyme UGT1A. GS is known to affect the metabolism and excretion of drugs and xenobiotics. Perfluorocarbon compounds (PFCs) are bio-persistent environmental contaminants that affect metabolic regulation. In this study, we examined the associations of GS phenotype and serum PFCs in the C8 Health Study Population. Materials and methods: Using 2005–2006 data from a large PFC-exposure population survey, we compared serum PFCs concentrations between GS and non GS clinical phenotypes, in a cross sectional design, adjusting for standard risk factors, including age, BMI, smoking status, socioeconomic status and gender. Results: Among 10 PFC compounds considered, only perfluorohexanoic acid (PFHxA) was seen at a significantly higher concentration in GS men and women. Conclusion: PFHxA exposure may be associated with GS. Our findings do not support increased exposure in GS for other PFCs. - Highlights: • Most serum PFCs are not associated with clinically evident Gilbert syndrome. • However, serum perfluorohexanoic acid is positively associated. • The investigation addresses the clinical presentation, not the genetic mutation.

  1. Breeding schemes for the implementation of genomic selection in wheat (Triticum spp.).

    Science.gov (United States)

    Bassi, Filippo M; Bentley, Alison R; Charmet, Gilles; Ortiz, Rodomiro; Crossa, Jose

    2016-01-01

    In the last decade the breeding technology referred to as 'genomic selection' (GS) has been implemented in a variety of species, with particular success in animal breeding. Recent research shows the potential of GS to reshape wheat breeding. Many authors have concluded that the estimated genetic gain per year applying GS is several times that of conventional breeding. GS is, however, a new technology for wheat breeding and many programs worldwide are still struggling to identify the best strategy for its implementation. This article provides practical guidelines on the key considerations when implementing GS. A review of the existing GS literature for a range of species is provided and used to prime breeder-oriented considerations on the practical applications of GS. Furthermore, this article discusses potential breeding schemes for GS, genotyping considerations, and methods for effective training population design. The components of selection intensity, progress toward inbreeding in half- or full-sibs recurrent schemes, and the generation of selection are also presented. Copyright © 2015 The Authors. Published by Elsevier Ireland Ltd.. All rights reserved.

  2. Cadmium tolerance and bioremediation potential of bacteria isolated from soils irrigated with untreated industrial effluent

    International Nuclear Information System (INIS)

    Ahmad, R.; Hassan, M.M.U.

    2015-01-01

    The present study was aimed to investigate the Cd tolerance of bacteria isolated from municipal effluent irrigated soils. Thirty bacterial strains were isolated and screened for their Cd+ tolerance by growing on nutrient agar plates amended with varying amount of Cd +. Out of them four bacteria (GS 2, GS5, GS10 and GS20) were found highly Cd tolerant (600 ppm Cd). The minimum inhibitory concentration of Cd+ was found 200 ppm. The isolates showed optimum growth at 30 degree C and pH 7.5-8.5. Growth curve study against different concentrations of Cd (0-600 ppm) revealed that GS2 was more tolerant among selected strains showing only 33% reduction in growth compared to 64% by GS5 and 77% by both GS 10 and GS20 at 600 ppm Cd. Inoculation of maize seeds with Cd tolerant bacteria for root elongation demonstrated upto 1.7 fold increase in root elongation (in the absence of Cd) and up to 1.5 fold (in the presence of 50 ppm Cd) compared to the un-inoculated plants. The results of the study revealed that the bacterial isolates exhibiting great Cd tolerance and growth promoting activity can be potential candidates for bioremediation of metal contaminated soils and wastewaters. (author)

  3. The effect of general surgery clerkship rotation on the attitude of medical students towards general surgery as a future career.

    Science.gov (United States)

    Al-Heeti, Khalaf N M; Nassar, Aussama K; Decorby, Kara; Winch, Joanne; Reid, Susan

    2012-01-01

    Literature suggests declining interest in General Surgery (GS) and other surgical specialties, with fewer Canadian medical residency applicants identifying a surgical specialty as their first choice. Although perceptions of surgical careers may begin before enrollment in clerkship, clerkship itself provides the most concentrated environment for perceptions to evolve. Most students develop perceptions about specialties during their clinical clerkships. This study examines the immediate impact of GS clerkship on student attitudes toward GS as a career, and on preferences towards GS compared with other specialties. A pre-post design involved 61 McMaster clinical clerks. Two instruments were used to collect data from students over the course of clerkship (2008-2009). Paired comparison (PC) compared ranking of career choices before and after clerkship. Semantic differential (SD) measured attitudes toward GS and variables that may have affected attitudes before and after clerkship. Analyses used SPSS 16.0 (SPSS Inc., Chicago, IL). Clerks ranked preferences for GS changed substantially after clerkship, moving from the 10th to the 5th position compared with other specialties. Ranks of surgical subspecialties also changed, though GS demonstrated the largest improvement. SD results were consistent with PC, showing improved attitudes after rotation, with differences both statistically and practically significant (t = 3.81, p staff (including attending surgeons and nurses), ensure that teaching hospital staff provide a positive experience for clerks, and should provide opportunities to learn basic technical skills during GS clerkship. Copyright © 2012 Association of Program Directors in Surgery. Published by Elsevier Inc. All rights reserved.

  4. Capture of circulatory endothelial progenitor cells and accelerated re-endothelialization of a bio-engineered stent in human ex vivo shunt and rabbit denudation model

    NARCIS (Netherlands)

    K. Larsen (Katarína); C. Cheng (Caroline (Ka Lai)); D. Tempel (Dennie); S. Parker (Sherry); S. Yazdani (Saami); W.K. den Dekker (Wijnand); H.J. Houtgraaf (Jaco); R. de Jong (Renate); S. Swager-ten Hoor (Stijn); E. Ligtenberg (Erik); S.R. Hanson (Stephen); R. Rowland (Steve); F. Kolodgie (Frank); P.W.J.C. Serruys (Patrick); R. Virmani (Renu); H.J. Duckers (Henricus)

    2012-01-01

    textabstractThe Genous™ Bio-engineered R™ stent (GS) aims to promote vascular healing by capture of circulatory endothelial progenitor cells (EPCs) to the surface of the stent struts, resulting in accelerated re-endothelialization. Here, we assessed the function of the GS in comparison to bare-metal

  5. A new method to study simple shear processing of wheat gluten-starch mixtures

    NARCIS (Netherlands)

    Peighambardoust, S.H.; Goot, A.J. van der; Hamer, R.J.; Boom, R.M.

    2004-01-01

    This article introduces a new method that uses a shearing device to study the effect of simple shear on the overall properties of pasta-like products made from commercial wheat gluten-starch (GS) blends. The shear-processed GS samples had a lower cooking loss (CL) and a higher swelling index (SI)

  6. Balones que inspiran

    Directory of Open Access Journals (Sweden)

    Daniel Samper Pizano

    2005-09-01

    Full Text Available Unión Magdalena "el fervor de un pueblo". Varios Autores. Universidad del Magdalena, Santa Marta, 2004, 271 págs., il. Rey de corazones. El Medellín, una pasión crónica. Varios autores. Medellín, Pregón Ediciones, 2004, 162 págs.

  7. Glucagon-Like Peptide-1 Secreting Cell Function as well as Production of Inflammatory Reactive Oxygen Species Is Differently Regulated by Glycated Serum and High Levels of Glucose

    Directory of Open Access Journals (Sweden)

    Alessandra Puddu

    2014-01-01

    Full Text Available Glucagon-like peptide-1 (GLP-1, an intestinal hormone contributing to glucose homeostasis, is synthesized by proglucagon and secreted from intestinal neuroendocrine cells in response to nutrients. GLP-1 secretion is impaired in type 2 diabetes patients. Here, we aimed at investigating whether diabetic toxic products (glycated serum (GS or high levels of glucose (HG may affect viability, function, and insulin sensitivity of the GLP-1 secreting cell line GLUTag. Cells were cultured for 5 days in presence or absence of different dilutions of GS or HG. GS and HG (alone or in combination increased reactive oxygen species (ROS production and upregulated proglucagon mRNA expression as compared to control medium. Only HG increased total production and release of active GLP-1, while GS alone abrogated secretion of active GLP-1. HG-mediated effects were associated with the increased cell content of the prohormone convertase 1/3 (PC 1/3, while GS alone downregulated this enzyme. HG upregulated Glucokinase (GK and downregulated SYNTHAXIN-1. GS abrogated SYNTHAXIN-1 and SNAP-25. Finally, high doses of GS alone or in combination with HG reduced insulin-mediated IRS-1 phosphorylation. In conclusion, we showed that GS and HG might regulate different pathways of GLP-1 production in diabetes, directly altering the function of neuroendocrine cells secreting this hormone.

  8. Books Reviews La UE ante su presente inmediato: de la rectificación obligatoria a los retos ineludibles

    Directory of Open Access Journals (Sweden)

    Alfredo Crespo Alcázar

    2015-12-01

    Full Text Available Blanc Altemir, Antonio La Unión Europea y los BRICS (Brasil, Rusia, India, China y Sudáfrica Thomson Reuters Aranzadi, 2015 212 págs. Hewitt, Gavin Europa a la deriva Alianza Editorial, 2015 358 págs.

  9. Toxicological Effects of a Post Emergent Herbicide on Spirodela polyrhiza as a Model Macrophyte: A Comparison of the Effects of Pure and Nano-capsulated Form of the Herbicide

    Directory of Open Access Journals (Sweden)

    Samaneh Torbati *

    2018-02-01

    Full Text Available Background: One of the main reasons of environmental contaminations is the broad application of herbicides. Controlled release technologies such as encapsulation of herbicides are as an effective tool to reduce environmental contaminations. The aim of the present study was successful nanocapsulation of Gallant Super (GS, its characterization and compare the physiological responses of Spirodela polyrhiza L. upon exposure to GS and its encapsulated form. Methods: Nanocapsulation of GS in the poly (methyl methacrylate (PMMA was performed in the Department of Nanotechnology, Faculty of Sciences and biological effects of the contaminants on S. polyrhiza was investigated in Biotechnology Research Center, both in Urmia University, Urmia, Iran in 2016. The surface morphology of PMMA/GS nanocapsules was studied by SEM and TEM and their chemical characterization was determined by FT-IR spectroscopy. For assessment of the effects of the encapsulated Gallant Super (ECGS and GS on S. polyrhiza, some plant physiological parameters were investigated. Results: Direct treatment of GS had more and notable negative effects on the plant growth when compared with ECGS treatments. Moreover, different examined concentrations of the two contaminant groups led to the remarkable induction of the activities of the antioxidant enzymes such as SOD. Even though the enhancement of the antioxidant enzymes activities when the plant was treated with GS was notably more than the effects of ECGS. Conclusion: ECGS caused to the fewer changes in the plant physiological parameters and negative effects of the treatment of ECGs were less than when the plant had direct contact with GS.

  10. "It Is Complicated!": Practices and Challenges of Generic Skills Assessment in Vietnamese Universities

    Science.gov (United States)

    Nghia, Tran Le Huu

    2018-01-01

    Contributing to a lack of studies related to generic skills (GS) assessment, especially in non-Western university contexts, this article reports a study that explored practices and challenges of assessing students' GS in the Business Administration programmes in six Vietnamese universities. Content analysis of interviews with 41 teachers of skills…

  11. Generalized synchronization via impulsive control

    International Nuclear Information System (INIS)

    Zhang Rong; Xu Zhenyuan; Yang, Simon X.; He Xueming

    2008-01-01

    This paper demonstrates theoretically that two completely different systems can implement GS via impulsive control, moreover by using impulsive control, for a given manifold y = H(x) we construct a response system to achieve GS with drive system and the synchronization manifold is y = H(x). Our theoretical results are supported by numerical examples

  12. EVIDENCE FOR EXISTENCE OF IMMUNOGLOBULINS THAT BLOCK OVARIAN GRANULOSA-CELL GROWTH-INVITRO - A PUTATIVE ROLE IN RESISTANT OVARY SYNDROME

    NARCIS (Netherlands)

    VANWEISSENBRUCH, MM; HOEK, A; VAN VLIET BLEEKER, I.; SCHOEMAKER, J; DREXHAGE, H

    The sera of 26 patients with premature ovarian failure were examined in order to detect immunoglobulin-G (IgGs) that can block FSH-induced in vitro granulosa cell DNA synthesis via, a Feulgen cytochemical bioassay system. The IgGs of four patients with polycystic ovary-like disease, five

  13. Evidence for Existence of Immunoglobulins that Block Ovarian Granulosa Cell Growth in Vitro. A Putative Role in Resistant Ovary Syndrome?

    NARCIS (Netherlands)

    WEISSENBRUCH, MIRJAM M. van; HOEK, ANNEMIEKE; VLIET-BLEEKER, INGRID van; SCHOEMAKER, JOOP; DREXHAGE, HEMMO

    1991-01-01

    The sera of 26 patients with premature ovarian failure were examined in order to detect immunoglobulin-G (IgGs) that can block FSH-induced in vitro granulosa cell DNA synthesis via, a Feulgen cytochemical bioassay system. The IgGs of four patients with polycystic ovary-like disease, five

  14. An Investigation of Civilians Preparedness to Compete with Individuals with Military Experience for Army Board Select Acquisition Positions

    Science.gov (United States)

    2017-05-25

    supervisor’s name and correct email address are 12 listed in your IDP. If your current supervisor is not listed in your IDP, please advise your...and General Staff College (LTC/GS-14 level boards) and/or Senior Staff College (COL/GS-15 level boards). Potential board members are nominated by

  15. Structure-function relationships of family GH70 glucansucrase and 4,6-α-glucanotransferase enzymes, and their evolutionary relationships with family GH13 enzymes

    NARCIS (Netherlands)

    Meng, Xiangfeng; Gangoiti, Joana; Bai, Yuxiang; Pijning, Tjaard; Van Leeuwen, Sander S; Dijkhuizen, Lubbert

    2016-01-01

    Lactic acid bacteria (LAB) are known to produce large amounts of α-glucan exopolysaccharides. Family GH70 glucansucrase (GS) enzymes catalyze the synthesis of these α-glucans from sucrose. The elucidation of the crystal structures of representative GS enzymes has advanced our understanding of their

  16. Identifying evidence for public health guidance: a comparison of citation searching with Web of Science and Google Scholar.

    Science.gov (United States)

    Levay, Paul; Ainsworth, Nicola; Kettle, Rachel; Morgan, Antony

    2016-03-01

    To examine how effectively forwards citation searching with Web of Science (WOS) or Google Scholar (GS) identified evidence to support public health guidance published by the National Institute for Health and Care Excellence. Forwards citation searching was performed using GS on a base set of 46 publications and replicated using WOS. WOS and GS were compared in terms of recall; precision; number needed to read (NNR); administrative time and costs; and screening time and costs. Outcomes for all publications were compared with those for a subset of highly important publications. The searches identified 43 relevant publications. The WOS process had 86.05% recall and 1.58% precision. The GS process had 90.7% recall and 1.62% precision. The NNR to identify one relevant publication was 63.3 with WOS and 61.72 with GS. There were nine highly important publications. WOS had 100% recall, 0.38% precision and NNR of 260.22. GS had 88.89% recall, 0.33% precision and NNR of 300.88. Administering the WOS results took 4 h and cost £88-£136, compared with 75 h and £1650-£2550 with GS. WOS is recommended over GS, as citation searching was more effective, while the administrative and screening times and costs were lower. Copyright © 2015 John Wiley & Sons, Ltd.

  17. Packetizing OCP Transactions in the MANGO Network-on-Chip

    DEFF Research Database (Denmark)

    Bjerregaard, Tobias; Sparsø, Jens

    2006-01-01

    facilitating IP reuse by standard socket access points. Two types of services are available: connection-less best-effort routing and connection-oriented guaranteed service (GS) routing. This paper presents the core-centric programming model for establishing and using GS connections in MANGO. We show how OCP...

  18. A simple way to prepare reduced graphene oxide nanosheets/Fe2O3-Pd/N-doped carbon nanosheets and their application in catalysis.

    Science.gov (United States)

    Yao, Tongjie; Zhang, Junshuai; Zuo, Quan; Wang, Hao; Wu, Jie; Zhang, Xiao; Cui, Tieyu

    2016-04-15

    The catalysts with Pd and γ-Fe2O3 nanoparticles embedded between reduced graphene oxide nanosheets (rGS) and N-doped carbon nanosheets (NCS) were prepared through a two-step method. Firstly, graphene oxide nanosheets (GS)/prussian blue (PB)-Pd/polypyrrole (PPy) composites were synthesized by using pyrrole monomer as reductant, K3Fe(CN)6 and PdCl2 as oxidants in the presence of GS via a redox reaction. Subsequently, the as-obtained GS/PB-Pd/PPy composites were calcinated in N2 atmosphere. During the heat-treatment, carbonization of PPy to NCS, conversion of nonmagnetic PB to magnetic γ-Fe2O3 nanoparticles, and reduction of GS to rGS were finished, simultaneously. rGS/Fe2O3-Pd/NCS composites exhibited good catalytic activity toward reduction of 4-nitrophenol. The rate constant k and turnover frequency were calculated and compared with recent reports. Owing to γ-Fe2O3 nanoparticles, the rGS/Fe2O3-Pd/NCS composites could be quickly separated by magnet and reused without obvious decrease in activity. Copyright © 2016 Elsevier Inc. All rights reserved.

  19. Igual que en un circo pobre

    Directory of Open Access Journals (Sweden)

    Rodrigo Pérez Gil

    2005-09-01

    Full Text Available Los casibandidos que casi ruban el sol. Triunfo Arciniegas. Fondo de Cultura Económica, México, 2003. 39 págs., il. Balada peluda. Ivar da Coll. Fondo de Cuhura Económica. México, 2004, 38 págs., il.

  20. Wheat cultivars selected for high Fv/Fm under heat stress maintain high photosynthesis, total chlorophyll, stomatal conductance, transpiration and dry matter

    DEFF Research Database (Denmark)

    Sharma, Dew Kumari; Andersen, Sven Bode; Ottosen, Carl Otto

    2015-01-01

    ) than the low group, accompanied by higher stomatal conductance (gs), transpiration rate (E) and evaporative cooling of the leaf (ΔT). The difference in PN between the groups was not caused by differences in PSII capacity or gs as the variation in Fv/Fm and intracellular CO2 (Ci) was non...