WorldWideScience

Sample records for burster gs 1826-238

  1. DIAGNOSING THE BURST INFLUENCE ON ACCRETION IN THE CLOCKED BURSTER GS 1826-238

    Energy Technology Data Exchange (ETDEWEB)

    Ji, Long; Zhang, Shu; Chen, YuPeng; Zhang, Shuang-Nan; Chang, Zhi [Laboratory for Particle Astrophysics, Institute of High Energy Physics, Beijing 100049 (China); Torres, Diego F. [Institució Catalana de Recerca i Estudis Avançats (ICREA), E-08010 Barcelona (Spain); Kretschmar, Peter; Kuulkers, Erik [European Space Astronomy Centre (ESA/ESAC), Science Operations Department, Villanueva de la Cañada (Madrid) (Spain); Li, Jian [Institute of Space Sciences (CSIC–IEEC), Campus UAB, Carrer de Can Magrans, s/n E-08193, Barcelona (Spain)

    2015-06-10

    Type I X-ray bursts on the surface of a neutron star are a unique probe into accretion in X-ray binary systems. However, we know little about the feedback of the burst emission on accretion. Hard X-ray shortages and enhancements of the persistent emission at soft X-rays have been observed. To put these findings in context with the aim of understanding the possible mechanism underneath, we investigated 68 bursts seen by the Rossi X-ray Timing Explorer from the clocked burster GS 1826-238. We diagnosed jointly the burst influence of both soft and hard X-rays, and we found that the observations can be described by the CompTT model with variable normalization, electron temperature, and optical depth. Putting these results in a scenario of coronal Compton cooling via the burst emission would lead to a shortage of cooling power, which may suggest that additional considerations, like the influence of the burst on corona formation, should be accounted for as well.

  2. A soft X-ray spectral episode for the Clocked Burster, GS 1826-24 as measured by Swift and NuSTAR

    DEFF Research Database (Denmark)

    Chenevez, J.; Galloway, D.K.; in ’t Zand, J.J.M.

    2016-01-01

    Edd within the range of previous observations. However, the best-fit spectral model, adopting the double Comptonization used previously, exhibits significantly softer components. We detect seven type-I X-ray bursts, all significantly weaker (and with shorter rise and decay times) than observed previously......We report on NuSTAR and Swift observations of a soft state of the neutron star low-mass X-ray binary GS 1826–24, commonly known as the "clocked" burster. The transition to the soft state was recorded in 2014 June through an increase of the 2–20 keV source intensity measured by MAXI, simultaneous...

  3. A Soft X-Ray Spectral Episode for the Clocked Burster, GS 1826-24 as Measured by Swift and NuSTAR

    Science.gov (United States)

    Chenvez, J.; Galloway, D. K.; Zand, J. J. M. In 'T; Tomsick, J. A.; Barret, D.; Chakrabarty, D.; Fuerst, F.; Boggs, S. E.; Christensen, F. E.; Craig, W. W.; hide

    2016-01-01

    We report on NuSTAR and Swift observations of a soft state of the neutron star low-mass X-ray binary GS 1826-24, commonly known as the "clocked" burster. The transition to the soft state was recorded in 2014 June through an increase of the 2-20 keV source intensity measured by MAXI, simultaneous with a decrease of the 15-50 keV intensity measured by Swift/BAT. The episode lasted approximately two months, after which the source returned to its usual hard state. We analyze the broadband spectrum measured by Swift/XRT and NuSTAR and estimate the accretion rate during the soft episode to be approximately equal to 13% m(sub Edd), within the range of previous observations. However, the best-fit spectral model, adopting the double Comptonization used previously, exhibits significantly softer components. We detect seven type-I X-ray bursts, all significantly weaker (and with shorter rise and decay times) than observed previously. The burst profiles and recurrence times vary significantly, ruling out the regular bursts that are typical for this source. One burst exhibited photospheric radius expansion?and we estimate the source distance as (5.7 +/- 0.2) xi(sub b)(exp -1/2) kpc, where xi(sub b) parameterizes the possible anisotropy of the burst emission. The observed soft state may most likely be interpreted as a change in accretion geometry at about similar bolometric luminosity as in the hard state. The different burst behavior can therefore be attributed to this change in accretion flow geometry, but the fundamental cause and process for this effect remain unclear.

  4. Uhuru observations of the Norma X-ray burster

    Science.gov (United States)

    Grindlay, J.; Gursky, H.

    1976-01-01

    Four X-ray bursts consistent with a single source in Norma are reported which were discovered by reexamining Uhuru data obtained between 1970 and 1973. The temporal and spectral characteristics of the bursts are described and shown to be similar to those displayed by bursts from the globular cluster NGC 6224. An error box of the source location is given, and it is found that both the position and intensity of the four bursts are consistent with those of 10 bursts detected by the Vela satellites in 1976. It is concluded that the source is the same as that observed by the Vela and is an X-ray burster with characteristics similar to those of certain other bursters. XB 1608-52 is suggested as the designation of this burster, possible burst models are considered, and it is noted that the error box of the present source contains an identified globular cluster.

  5. Recent activity of the Rapid Burster (MXB 1730-335)

    NARCIS (Netherlands)

    Kuulkers, E.; Brandt, S.; Markwardt, C.; Remillard, R.A.; Shaw, S.; Beckmann, V.; Chenevez, J.; Courvoisier, T.J.L.; Domingo, A.; Ebisawa, K.; Jonker, P.; Kretschmar, P.; Oosterbroek, T.; Paizis, A.; Risquez, D.; Sanchez-Fernandez, C.; Wijnands, R.

    2008-01-01

    Observations taken as part of the INTEGRAL Galactic bulge monitoring program (see ATel #1385) on 2008, February 23 13:32-17:13 (UT) showed bursting activity from the X-ray transient, the Rapid Burster (MXB 1730-335). During one of the 1800-sec pointings when the source was in the field- of-view of

  6. Recent activity of the Rapid Burster (MXB 1730-335)

    DEFF Research Database (Denmark)

    Kuulkers, E.; Brandt, Søren Kristian; Markwardt, C.

    2008-01-01

    Observations taken as part of the INTEGRAL Galactic bulge monitoring program (see ATel #1385) on 2008, February 23 13:32-17:13 (UT) showed bursting activity from the X-ray transient, the Rapid Burster (MXB 1730-335). During one of the 1800-sec pointings when the source was in the field- of-view o...

  7. INTEGRAL monitoring of the X-ray burster XTE J1739-285

    DEFF Research Database (Denmark)

    Sánchez-Fernández, C.; Kuulkers, E.; Chenevez, Jérôme

    2008-01-01

    XTE J1739-285 is a recurrent X-ray transient first discovered by INTEGRAL as an X-ray burster. We have carried out a systematic search for X-ray bursts at various levels of accretion rate onto the Neutron Star surface during the source outbursts in 2005 and 2006. A total of 25 X-ray bursts were...

  8. Improving noise resistance of intrinsic rhythms in a square-wave burster model.

    Science.gov (United States)

    Kohno, Takashi; Aihara, Kazuyuki

    2013-06-01

    The square-wave burster (Wang and Rinzel, 2003) is a class of autonomous bursting cells that share a bifurcation structure. It is known that this class of cells is involved in the generation of various life-supporting rhythms. In our research to realize an electronic circuit that mimics the rhythm generating mechanism in the square-wave burster, our circuit experimentally exhibited severe fluctuations in its rhythmic activity. We have found a noise-sensitive region in the phase portrait of the ideal model and have proposed modifications of the model that can reduce this fluctuation. A possible modification to ionic-conductance neuron models (Kohno and Aihara, 2011) was inspired by them. This modification, however, cannot be applied to a group of square-wave bursters, including the Butera-Rinzel-Smith model (Butera et al., 1999; Del Negro et al., 2001), which is a model of the pre-Bötzinger complex bursting neuron that plays a crucial role in the generation of respiration rhythms, because this modification premises that the slow dynamics originates from an activation gate variable of a hyperpolarizing ionic current. However, in some square-wave bursters, they are controlled by an inactivation gate variable of a depolarizing ionic current. In this study, we proposed a similar modification with a completely different mechanism that can be applied to this group of square-wave bursters. In the presence of noises, the modified Butera-Rinzel-Smith model can generate rhythmic activity that is more stable and similar to biological observations than the original model. The mechanisms underlying this modification are explained with noisy bifurcation diagrams. Copyright © 2013 Elsevier Ireland Ltd. All rights reserved.

  9. CONSTRAINTS ON THE MASS AND RADIUS OF THE ACCRETING NEUTRON STAR IN THE RAPID BURSTER

    Energy Technology Data Exchange (ETDEWEB)

    Sala, G.; Jose, J.; Parikh, A.; Longland, R. [Departament de Fisica i Enginyeria Nuclear, EUETIB, Universitat Politecnica de Catalunya, c/ Comte d' Urgell 187, E-08036 Barcelona (Spain); Haberl, F. [Max-Planck-Institut fuer extraterrestrische Physik, Giessenbachstrasse, D-85748 Garching (Germany); Pardo, L. C. [Grup de Caracteritzacio de Materials, Departament de Fisica i Enginyeria Nuclear, ETSEIB, Universitat Politecnica de Catalunya, Diagonal 647, E-08028 Barcelona, Catalonia (Spain); Andersen, M. [Research and Scientific Support Department, European Space Agency, ESTEC, Keplerlaan 1, NL-2200 AG Noordwijk (Netherlands)

    2012-06-20

    The Rapid Burster (MXB 1730-335) is a unique object, showing both type I and type II X-ray bursts. A type I burst of the Rapid Burster was observed with Swift/X-Ray Telescope on 2009 March 5, showing photospheric radius expansion (PRE) for the first time in this source. We report here on the mass and radius determination from this PRE burst using a Bayesian approach. After marginalization over the likely distance of the system (5.8-10 kpc), we obtain M = 1.1 {+-} 0.3 M{sub Sun} and R = 9.6 {+-} 1.5 km (1{sigma} uncertainties) for the compact object, ruling out the stiffest equations of state for the neutron star. We study the sensitivity of the results to the distance, the color correction factor, and the hydrogen mass fraction in the envelope. We find that only the distance plays a crucial role.

  10. NICER Discovers mHz Oscillations and Marginally Stable Burning in GS 1826-24

    Science.gov (United States)

    Strohmayer, Tod E.; Gendreau, Keith C.; Keek, Laurens; Bult, Peter; Mahmoodifar, Simin; Chakrabarty, Deepto; Arzoumanian, Zaven; NICER Science Team

    2018-01-01

    To date, marginally stable thermonuclear burning, evidenced as mHz X-ray flux oscillations, has been observed in only five accreting neutron star binaries, 4U 1636-536, 4U 1608-52, Aql X-1, 4U 1323-619 and Terzan 5 X-2. Here we report the discovery with NASA's Neutron Star Interior Composition Explorer (NICER) of such oscillations from the well-known X-ray burster GS 1826-24. NICER observed GS 1826-24 on 9 September, 2017 for a total exposure of about 4 ksec. Timing analysis revealed highly significant oscillations at a frequency of 8.2 mHz in two successive pointings. The oscillations have a fractional modulation amplitude of approximately 3% for photon energies less than 6 keV. The observed frequency is consistent with the range observed in the other mHz QPO systems, and indeed is slightly higher than the frequency measured in 4U 1636-536 below which mHz oscillations ceased and unstable burning (X-ray bursts) resumed. We discuss the mass accretion rate dependence of the oscillations as well as the X-ray spectrum as a function of pulsation phase. We place the observations in the context of the current theory of marginally stable burning and briefly discuss the potential for constraining neutron star properties using mHz oscillations.

  11. The GS09 double parton distribution functions

    Science.gov (United States)

    Gaunt, J. R.

    It is anticipated that hard double parton scattering (DPS) will occur frequently in the collisions of the LHC, producing interesting signals and significant backgrounds to certain single scattering processes. In order to make theoretical predictions of double scattering rates and properties, the double parton distributions (dPDFs) D_p^{j_1j_2}(x_1,x_2;Q_A,Q_B) are required. We discuss the first publicly available set of equal-scale (Q_A=Q_B) leading order dPDFs -- the GS09 dPDFs. A brief account is given describing how pQCD evolution effects and sum rule constraints (the latter derived by us) have been incorporated into this set of dPDFs. We then present a summary of a phenomenological investigation into same-sign W pair production conducted using GS09. In this, the DPS signal produced using GS09 is compared with that obtained using simple products of single PDFs multiplied by (1-x_1-x_2)^n, and the single scattering backgrounds (W+-W+-jj, di-boson and heavy flavour) are carefully calculated. It is found that the correlations in GS09 manifest themselves in non-trivial kinematic correlations between the W bosons. However, it is unlikely that these correlations will be measurable at the LHC in the near future owing to the fact that the background is significant even after cuts.

  12. Probing the MSP Prenatal Stage: The Optical Identification of the X-Ray Burster EXO 1745-248 in Terzan 5

    NARCIS (Netherlands)

    Ferraro, F. R.; Pallanca, C.; Lanzoni, B.; Cadelano, M.; Massari, D.; Dalessandro, E.; Mucciarelli, A.

    We report on the optical identification of the neutron star burster EXO 1745-248 in Terzan 5. The identification was performed by exploiting Hubble Space Telescope/Advanced Camera for Surveys images acquired in Director's Discretionary Time shortly after (approximately one month) the Swift detection

  13. Behind the scenes of GS: preventing and curing - the GS-SE group

    CERN Multimedia

    CERN, GS-SE

    2013-01-01

    With over 3,000 CERN personnel and more than 300 visitors on the site, CERN’s infrastructure takes a real hammering every day of the year. Fortunately, the GS-SE Group is on the watch… Here, like everywhere else, nothing stays shiny and new for very long. That’s why it’s important to carry out regular, even daily, maintenance of buildings, equipment, pipes and roads which every single day see thousands of CERN personnel and visitors passing by. The team responsible for this weighty task is part of the GS-SE Group.

  14. Liquid helium centrifugal pump characteristics from 80 g/s to 1200 g/s

    CERN Document Server

    Pengo, R; Junker, S

    2010-01-01

    The large amount of data collected from three different centrifugal liquid helium pumps tested, namely with 80, 600 and 1200 g/s nominal mass flow are reviewed. The data include the analysis of the characteristic curves, their total efficiencies, their Net Positive Suction Head (NPSH) and the slip factor. The 1200 g/s pumps tested are of the full emission type, with curved blades, whilst the other pumps have straight blades. The pumps were also tested at different rotary speeds. The pumps were manufactured by Barber \\& Nichols (Denver, USA). (C) 2009 Elsevier Ltd. All rights reserved.

  15. Behind the scenes of GS: shared mobility

    CERN Multimedia

    Corinne Pralavorio

    2014-01-01

    The GS-IS team responsible for mobility is working on the problematic equation of improving transport with a growing number of people on site.   Congested car parks and sites that are far apart mean that going from one place to another at CERN often requires patience. Transport is major a concern not only for people working at the Organization, but also those in charge of the road infrastructure. The 120-hectare Meyrin site and the distance between the various sites mean that efficient modes of transport are essential. The growing number of people on site and the increasingly congested car parks have made the problem even trickier. Over the past five years, the GS-IS group has launched several initiatives to facilitate mobility on site without proportionately increasing CERN’s fleet of vehicles. Sharing is the only solution! The shuttle service has been reinforced:  since 2010, four regular routes have been set up as well as a service for operators working shifts during t...

  16. Behind the scenes of GS: preventing and curing - the GS-SE group (VERSION FR)

    CERN Multimedia

    CERN, GS-SE

    2013-01-01

    Avec, chaque jour, plus de 3000 Cernois sur le site et plus de 300 visiteurs, le CERN et ses infrastructures en voient des vertes et des pas mûres. Heureusement, le groupe GS-SE veille au grain… Ici comme partout ailleurs, rien ne reste jamais neuf bien longtemps. D’où l’importance d’entretenir régulièrement, pour ne pas dire « quotidiennement », les bâtiments, équipements, canalisations, routes, qui voient passer, jour après jour, des milliers de Cernois et de visiteurs. Au CERN, l’équipe en charge de cette lourde tâche fait partie du groupe GS-SE.

  17. ROSAT and follow-up infrared observations of the X-ray burster KS 1731-260

    Science.gov (United States)

    Barret, Didier; Motch, Christian; Predehl, Peter

    1998-01-01

    We report on the ROSAT HRI (High Resolution Imager) observation of the X-ray burster KS 1731-260. The observation was split in two parts; the first took place in 1995, March 16 lasting for ~ 1 kilosecond and the second one between September 3rd and 14th, 1996 for about 5 kiloseconds. In both observations, KS 1731-260 was clearly detected with a count rate of 0.82 and 7.9ctss respectively. From the first observation we found that the X-ray source is located at a position alpha = 17() h 34() mn 13.5() s and delta = -26() deg 05' 16.8'' (equinox 2000) with an associated error radius of 10.1 arcsec (90% confidence level combining the attitude and centroid uncertainties). The position derived from the second part of the observation is consistent with the previous one. The ROSAT HRI position rules out the two counterparts that have been proposed so far. Our CFHT J and H infrared imaging of the HRI error box reveals at least 13 possible candidates. As expected from a comparison with other X-ray bursters, the upper limits derived for the infrared brightness of KS 1731-260 imply the presence of a low mass companion for the neutron star. We also report on a refined spectral analysis of the PSPC data taken during the all sky survey in September 1990. These data, together with data recorded by TTM and PCA/RXTE indicate that the column density towards KS 1731-260 varies between ~ 1 to 6 x 10(22) H atoms cm(-2) ; thus suggesting that the source is characterized by variable intrinsic absorption. The change in the HRI count rate could be better explained by a change in the column density between the two observations rather than by a true source intensity variation. The numerous detections of the source since its discovery in 1988 together with its recent monitoring by the RXTE/ASM show that KS 1731-260 is a persistent source rather than a soft X-ray transient, as originally thought.

  18. Behind the scenes of GS: precious stones

    CERN Multimedia

    Anaïs Schaeffer

    2014-01-01

    Since the laying of the foundation stone for the Synchrocyclotron in June 1954, CERN has been expanding constantly to reach a current constructed surface area of 580,000 m2 covered by some 650 buildings (just 125 of which account for 70% of this area).   This year, while CERN’s 60th anniversary is an important milestone in the Laboratory’s history, it also highlights another reality: CERN is a collection of ageing buildings, no less than 60% of which are more than 40 years old. “Of the 580,000 m2 of buildings, around 52,000 m2 are nearing the end of their useful life and 140,000 m2 are in need of extensive renovations,” says Natacha Lopez, GS-SE-PO Section Leader. “Of course, we’ve already started several renovation projects, but it's a huge challenge as we have to renovate buildings constructed in the 1960s and 70s while complying with modern standards, which are very different from those that were in force when they were bu...

  19. Behind the scenes of GS: Sweet dreams!

    CERN Multimedia

    Anaïs Schaeffer

    2014-01-01

    The CERN Hostel is located in the heart of the Meyrin site and provides the Organization’s many users with a comfortable and peaceful place to stay. The services offered by the Hostel, which is managed by the GS-IS Group, have seen many changes over the years.   The first CERN Hostel (Building 38) was built in 1982 in response to an increasing demand for accommodation, which until then had been met by a handful of converted bedrooms in Building 5 and, since 1974, by 81 additional bedrooms made available to CERN through an agreement with the Foyer Schumann in Saint-Genis-Pouilly. Let’s not even mention the fact that the barracks now occupied by the CERN clubs used to be dormitories… The Hostel was gradually extended, particularly in 1995 with the construction of Building 39, and then in 2007, when Building 41 was added, resulting in a total of 413 rooms (495 beds) today. In addition, a new agreement now gives users access to 151 low-cost rooms at the Foyer Schuma...

  20. Behind the scenes of GS: Open Sesame!

    CERN Multimedia

    Anaïs Schaeffer

    2014-01-01

    The section in the GS-IS Group responsible for running the CERN Stores processes hundreds of orders per day, checks the quality of each and every product and is responsible for warehousing thousands of items available in a richly-stocked catalogue.   Sprawling across several buildings (73, 128 and 129), a total surface area of 3640 m2, and providing 28,300 cubic metres of storage space, the equivalent of 330 semi-trailers, the CERN stores are a veritable treasure trove! The products on offer range from office stationery and computer hardware to fire extinguishers, cables, steel and chemicals. The new (above) and old storage system for the CERN stores. The CERN Stores catalogue contains nearly 48,000 referenced items, 12,000 of which are available on site. Goods arrive at either Building 194 (Meyrin) or Building 904 (Prévessin) and are then forwarded to the central stores in Building 73. “Every item that arrives here undergoes a strict quality control,” says M...

  1. Accuracy of Mass and Radius Determination for Neutron Stars in X-ray Bursters from Simulated LOFT Spectra

    Science.gov (United States)

    Majczyna, A.; Madej, J.; Różańska, A.; Należyty, M.

    2017-06-01

    We present a simulation of an X-ray spectrum of a hot neutron star, as would be seen by the LAD detector on board of LOFT satellite. We also compute a grid of theoretical spectra corresponding to a range of effective temperatures Teff and surface gravities log g with values corresponding to compact stars in Type I X-ray bursters. A neutron star with the mass M=1.64 M⊙ and the radius R=11.95 km (which yields the surface gravity log g=14.30 [cgs] and the surface redshift z=0.30) is used in simulation. Accuracy of mass and radius determination by fitting theoretical spectra to the observed one is found to be M=1.64+0.16-0.02 M⊙ and R=11.95+1.57-0.40 km (2σ). The confidence contours for these two variables are narrow but elongated, and therefore the resulting constraints on the EOS cannot be strong. Note, that in this paper we aim to discuss error contours of NS mass and radius, whereas discussion of EOS is beyond the scope of this work.

  2. Evaluation of Two Guralp Preamplifiers for GS13 Seismometer Application.

    Energy Technology Data Exchange (ETDEWEB)

    Merchant, Bion J. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)

    2017-09-01

    Sandia National Laboratories has tested and evaluated a new preamplifier, the Guralp Preamplifier for GS13, manufactured by Guralp. These preamplifiers are used to interface between Guralp digitizers and Geotech GS13 Seismometers. The purpose of the preamplifier evaluation was to measure the performance characteristics in such areas as power consumption, input impedance, sensitivity, full scale, self-noise, dynamic range, system noise, response, passband, and timing. The Guralp GS13 Preamplifiers are being evaluated for potential use in the International Monitoring System (IMS) of the Comprehensive Nuclear Test-Ban-Treaty Organization (CTBTO).

  3. Affine Fullerene C60 in a GS-Quasigroup

    Directory of Open Access Journals (Sweden)

    Vladimir Volenec

    2014-01-01

    Full Text Available It will be shown that the affine fullerene C60, which is defined as an affine image of buckminsterfullerene C60, can be obtained only by means of the golden section. The concept of the affine fullerene C60 will be constructed in a general GS-quasigroup using the statements about the relationships between affine regular pentagons and affine regular hexagons. The geometrical interpretation of all discovered relations in a general GS-quasigroup will be given in the GS-quasigroup C(1/2(1+5.

  4. Cardiac Effects of Attenuating Gsα - Dependent Signaling.

    Directory of Open Access Journals (Sweden)

    Marcus R Streit

    Full Text Available Inhibition of β-adrenergic signalling plays a key role in treatment of heart failure. Gsα is essential for β-adrenergic signal transduction. In order to reduce side-effects of beta-adrenergic inhibition diminishing β-adrenergic signalling in the heart at the level of Gsα is a promising option.We analyzed the influence of Gsα on regulation of myocardial function and development of cardiac hypertrophy, using a transgenic mouse model (C57BL6/J mice overexpressing a dominant negative Gsα-mutant under control of the α-MHC-promotor. Cardiac phenotype was characterized in vivo and in vitro and under acute and chronic β-adrenergic stimulation. At rest, Gsα-DN-mice showed bradycardia (602 ± 13 vs. 660 ± 17 bpm, p<0.05 and decreased dp/dtmax (5037 ± 546- vs. 6835 ± 505 mmHg/s, p = 0.02. No significant differences were found regarding ejection fraction, heart weight and cardiomyocyte size. β-blockade by propranolol revealed no baseline differences of hemodynamic parameters between wildtype and Gsα-DN-mice. Acute adrenergic stimulation resulted in decreased β-adrenergic responsiveness in Gsα-DN-mice. Under chronic adrenergic stimulation, wildtype mice developed myocardial hypertrophy associated with increase of LV/BW-ratio by 23% (4.4 ± 0.2 vs. 3.5 ± 0.1 mg/g, p<0.01 and cardiac myocyte size by 24% (14927 ± 442 px vs. 12013 ± 583 px, p<0.001. In contrast, both parameters were unchanged in Gsα-DN-mice after chronic isoproterenol stimulation.Overexpression of a dominant negative mutant of Gsα leads to decreased β-adrenergic responsiveness and is protective against isoproterenol-induced hypertrophy. Thus, Gsα-DN-mice provide novel insights into β-adrenergic signal transduction and its modulation in myocardial overload and failure.

  5. Behinds the scenes of GS: a DSO like no other

    CERN Multimedia

    Antonella Del Rosso

    2014-01-01

    At CERN, Departmental Safety Officers (DSOs) are responsible for making the members of their department aware of safety issues. They’re our first point of call every time a problem arises relating to environmental matters or the safety of people and installations. In GS, this role is even more crucial as the Department’s activities are scattered across the Laboratory and affect everyone.   As we have pointed out in our article series "Behind the scenes of GS”, the GS Department is responsible for the construction, renovation and maintenance of buildings and related technical infrastructures. The latter include heating and toilet facilities; detection and alarm systems; the management of the hotels, stores, stocks, shuttle services and mail; and the development of technical and administrative databases. The activities of the Medical Service and the Fire and Rescue Service also come under the umbrella of GS, as do the many other daily activities that are pa...

  6. Regulation of PDH, GS and insulin signalling in skeletal muscle

    DEFF Research Database (Denmark)

    Biensø, Rasmus Sjørup

    The aims of the present thesis were to investigate 1) The impact of physical inactivity on insulinstimulated Akt, TBC1D4 and GS regulation in human skeletal muscle, 2) The impact of exercise training on glucose-mediated regulation of PDH and GS in skeletal muscle in elderly men, 3) The impact...... with physical inactivity in humans, and physical inactivity did not affect the ability of exercise to enhance insulinmediated skeletal muscle glucose extraction. 2) Exercise training-improved glucose handling in aged human skeletal muscle was associated with increased content of key proteins in glucose...

  7. MDM Redshift of the Host of ASASSN-17gs

    Science.gov (United States)

    Chornock, R.; Margutti, R.

    2017-06-01

    The optical transient ASASSN-17gs = AT2017egv (http://www.astronomy.ohio-state.edu/ assassin/transients.html, https://wis-tns.weizmann.ac.il/object/2017egv) was associated with the new Fermi LAT source J1544-0649 and a new, bright X-ray source Swift 154419.7-064915 by Ciprini et al. (ATel #10482).

  8. 336-IJBCS-Article- Prof G.S Bimenya

    African Journals Online (AJOL)

    User

    indexmedicus.afro.who.int. Kidney function and DDT value comparison in pre- and post-spray plasma of the spray personnel in Northern Uganda in 2008. G.S. BIMENYA 1*, M. HABARULEMA 2, J.P. OKOT 2, A.L. OKWI 1 and. Myers LUGEMWA 3.

  9. Measurement of the inelastic branch of the $^{14}$O(α,p)$^{17}$F reaction Implications for explosive burning in novae and x-ray bursters

    CERN Document Server

    He, J J; Davinson, T; Aliotta, M; Büscher, J; Clement, E; Delahaye, P; Hass, M; Jenkins, D G; Kumar, V; Murphy, A St J; Neyskens, P; Raabe, R; Robinson, A P; Voulot, D; van der Walle, J; Warr, N; Wenander, F

    2009-01-01

    A measurement of the inelastic component of the key astrophysical resonance in the 14O(α,p)17F reaction for burning and breakout from hot carbon-nitrogen-oxygen (CNO) cycles is reported. The inelastic component is found to be comparable to the ground-state branch and will enhance the 14O(α,p)17F reaction rate. The current results for the reaction rate confirm that the 14O(α,p)17F reaction is unlikely to contribute substantially to burning and breakout from the CNO cycles under novae conditions. The reaction can, however, contribute strongly to the breakout from the hot CNO cycles under the more extreme conditions found in x-ray bursters.

  10. Behind the scenes of GS: the impact of IMPACT

    CERN Multimedia

    Katarina Anthony

    2014-01-01

    Carrying out a job at CERN can be a complicated task, with coordinators reaching across departments to manage personnel, ensure safety and minimise the impact of their activities on the rest of the Laboratory.  To help coordinators with this tough task, the GS Department developed IMPACT, the platform that, since 2011, has unified CERN's major experiment, accelerator and injector coordination tools.   When planning interventions both large and small, IMPACT (the Intervention Management Planning and Coordination Tool) is the go-to gizmo on every CERN coordinator's tool belt. "IMPACT is a central repository of activity requests that standardises the way work is declared at CERN," says Benoit Daudin, GS-AIS-PM Section Leader. "If you need to intervene in any of CERN's major facilities, you need to declare this work on IMPACT. The tool will analyse the job and see whose approval is required. This could simply b...

  11. Test Report : GS Battery, EPC power HES RESCU

    Energy Technology Data Exchange (ETDEWEB)

    Rose, David Martin [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Schenkman, Benjamin L. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Borneo, Daniel R. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)

    2013-10-01

    The Department of Energy Office of Electricity (DOE/OE), Sandia National Laboratories (SNL) and the Base Camp Integration Lab (BCIL) partnered together to incorporate an energy storage system into a microgrid configured Forward Operating Base to reduce the fossil fuel consumption and to ultimately save lives. Energy storage vendors will be sending their systems to SNL Energy Storage Test Pad (ESTP) for functional testing and then to the BCIL for performance evaluation. The technologies that will be tested are electro-chemical energy storage systems comprising of lead acid, lithium-ion or zinc-bromide. GS Battery and EPC Power have developed an energy storage system that utilizes zinc-bromide flow batteries to save fuel on a military microgrid. This report contains the testing results and some limited analysis of performance of the GS Battery, EPC Power HES RESCU.

  12. Behind the scenes of GS: an eye for accuracy

    CERN Document Server

    Anaïs Schaeffer

    2014-01-01

    The CERN sites are constantly evolving… with new buildings, extensions, redevelopment and renovation. The team in charge of geographical information in the GS Department measures and records even the smallest changes so that it can provide everyone at CERN with the most up-to-date plans possible.   The “Patrimony” team in the GS-SE-DOP Section is responsible for geographical information and has the job of updating all of the information relating to CERN's property, including the land made available to the Organization by Switzerland (110 hectares) and France (516 hectares), green spaces, buildings, underground structures, underground networks (gas, water, electricity, etc. – for which the "Patrimony” team works closely with numerous other groups and departments), car parks, roads… and much more. “Our team consists of seven surveyors and GIS specialists, who identify, define, measure, catalogue and pinpoi...

  13. Conformational changes in the G protein Gs induced by the β2 adrenergic receptor

    DEFF Research Database (Denmark)

    Chung, Ka Young; Rasmussen, Søren Gøgsig Faarup; Liu, Tong

    2011-01-01

    the receptor-binding surface and the nucleotide-binding pocket of Gs that undergo higher levels of hydrogen-deuterium exchange than would be predicted from the crystal structure of the β(2)AR-Gs complex. Together with X-ray crystallographic and electron microscopic data of the β(2)AR-Gs complex (from refs 2, 3...

  14. Severe Obesity and Insulin Resistance due to Deletion of the Maternal Gsα Allele Is Reversed by Paternal Deletion of the Gsα Imprint Control Region

    Science.gov (United States)

    Xie, Tao; Chen, Min; Gavrilova, Oksana; Lai, Edwin W.; Liu, Jie; Weinstein, Lee S.

    2008-01-01

    The G protein α-subunit Gsα mediates receptor-stimulated cAMP production and is imprinted with reduced expression from the paternal allele in specific tissues. Disruption of the Gsα maternal (but not paternal) allele leads to severe obesity, hypertriglyceridemia, and insulin resistance in mice and obesity in patients with Albright hereditary osteodystrophy. Paternal deletion of a Gsα imprint control region (1A) leads to loss of tissue-specific Gsα imprinting. To determine whether the metabolic abnormalities resulting from disruption of the Gsα maternal allele could be reversed by loss of paternal Gsα imprinting, females with a heterozygous Gsα exon 1 deletion were mated to males with heterozygous deletion of the imprint control region (1A) to generate mice with maternal Gsα deletion (E1m−), paternal 1A deletion (1Ap−), double mutants (E1m−:1Ap−), and wild type. E1m− mice developed obesity, glucose intolerance, insulin resistance, and hypertriglyceridemia, which were all normalized by the paternal 1A deletion in E1m−:1Ap− mice. Obesity in E1m− was associated with reduced energy expenditure and sympathetic nerve activity, and these were also normalized in E1m−:1Ap− mice. 1Ap− mice had reduced body weight associated with proportional decreases in fat and lean mass as well as increased activity levels. The metabolic phenotype resulting from maternal Gsα deletion is rescued by a genetic lesion that leads to loss of tissue-specific Gsα imprinting, consistent with this phenotype being a direct consequence of Gsα imprinting in one or more specific tissues. PMID:18202131

  15. Behind the scenes of GS: nothing left to chance

    CERN Multimedia

    Anaïs Schaeffer

    2014-01-01

    The AS (Alarm Systems) Section in the GS-ASE Group is, as its name suggests, in charge of the various alarm systems spread across CERN’s many sites. Its mission? To install, manage and maintain more than 26,000 alarms of all types located both above ground and in the tunnels.   Detection Among these systems, the best known are of course the heat and/or smoke detectors, which quickly raise the alarm in the event of a fire. CERN has 8500 of these devices in total. In combination with these, evacuation alarms are also found all over the Laboratory, including some 1800 break glass call points for 2000 sirens. In the LHC tunnel, the evacuation alarms are connected to 200 Oxygen Deficiency Hazard (ODH) sensors, but this is not the only way of triggering an alarm. “The Fire Brigade permanently monitors the evolution of safety conditions in the LHC tunnels,” says Henrik Nissen, who is responsible for “Alarm Transmission” in the GS-ASE-AS Section. &...

  16. Behind the scenes of GS: preventing and curing

    CERN Multimedia

    Anaïs Schaeffer

    2014-01-01

    With about 10,000 persons on the site every day, CERN’s infrastructure takes a real hammering every day of the year. Fortunately, the GS-SE Group is on the watch…   Here, like everywhere else, nothing stays shiny and new for very long. That’s why it’s important to carry out regular, even daily, maintenance of buildings, equipment, pipes and roads which every single day see thousands of CERN personnel and visitors passing by. The team responsible for this weighty task is part of the GS-SE Group. Suspicious steam All CERN’s buildings are heated by two heating plants (see the article in Bulletin 13-14/2011) via the underground hot-water network. Seen from below the ground, this is a labyrinth of pipes stretching over 30 km (including both the Meyrin and Prévessin sites). And with some of these pipes now over 40 years old, it goes without saying that leaks are a common hazard. “At the end of 2013, we had to deal with a big l...

  17. PROBING THE MSP PRENATAL STAGE: THE OPTICAL IDENTIFICATION OF THE X-RAY BURSTER EXO 1745-248 IN TERZAN 5

    Energy Technology Data Exchange (ETDEWEB)

    Ferraro, F. R.; Pallanca, C.; Lanzoni, B.; Cadelano, M.; Dalessandro, E.; Mucciarelli, A. [Dipartimento di Fisica e Astronomia, Università degli Studi di Bologna, v.le Berti Pichat 6/2, I-40127 Bologna (Italy); Massari, D. [INAF-Osservatorio Astronomico di Bologna, via Ranzani 1, I-40127 Bologna (Italy)

    2015-07-01

    We report on the optical identification of the neutron star burster EXO 1745-248 in Terzan 5. The identification was performed by exploiting Hubble Space Telescope/Advanced Camera for Surveys images acquired in Director's Discretionary Time shortly after (approximately one month) the Swift detection of the X-ray burst. The comparison between these images and previous archival data revealed the presence of a star that is currently brightened by ∼3 mag, consistent with expectations during an X-ray outburst. The centroid of this object well agrees with the position, in the archival images, of a star located in the turn-off/sub-giant-branch region of Terzan 5. This supports the scenario that the companion should have recently filled its Roche Lobe. Such a system represents the prenatal stage of a millisecond pulsar, an evolutionary phase during which heavy mass accretion on the compact object occurs, thus producing X-ray outbursts and re-accelerating the neutron star.

  18. Polyketides from the Halotolerant Fungus Myrothecium sp. GS-17

    Directory of Open Access Journals (Sweden)

    Tao Liu

    2013-12-01

    Full Text Available Two new polyketides, myrothecol (1 and 5-hydroxy-3-methyl-4-(1- hydroxylethyl-furan-2(5H-one (2, were isolated from the fermentation broth of the halotolerant fungus Myrothecium sp. GS-17 along with three known compounds, 5-hydroxyl-3-[(1S-1-hydroxyethyl]-4-methylfuran-2(5H-one (3, 3,5-dimethyl-4- hydroxylmethyl-5-methoxyfuran-2(5H-one (4, and 3,5-dimethyl-4-hydroxymethyl-5- hydroxyfuran-2(5H-one (5. Compound 1 is the first natural occurring polyketide with a unique furylisobenzofuran skeleton. The structures of these compounds were established via extensive spectroscopic analyses including 1D-, 2D-NMR, HRESI-MS, and crystal X-ray diffraction analysis.

  19. Ground Source Integrated Heat Pump (GS-IHP) Development

    Energy Technology Data Exchange (ETDEWEB)

    Baxter, V. D. [ORNL; Rice, K. [ORNL; Murphy, R. [ORNL; Munk, J. [ORNL; Ally, Moonis [ORNL; Shen, Bo [ORNL; Craddick, William [ORNL; Hearn, Shawn A. [ClimateMaster, Inc.

    2013-05-24

    Between October 2008 and May 2013 ORNL and ClimateMaster, Inc. (CM) engaged in a Cooperative Research and Development Agreement (CRADA) to develop a groundsource integrated heat pump (GS-IHP) system for the US residential market. A initial prototype was designed and fabricated, lab-tested, and modeled in TRNSYS (SOLAR Energy Laboratory, et al, 2010) to predict annual performance relative to 1) a baseline suite of equipment meeting minimum efficiency standards in effect in 2006 (combination of air-source heat pump (ASHP) and resistance water heater) and 2) a state-of-the-art (SOA) two-capacity ground-source heat pump with desuperheater water heater (WH) option (GSHPwDS). Predicted total annual energy savings, while providing space conditioning and water heating for a 2600 ft{sup 2} (242 m{sup 2}) house at 5 U.S. locations, ranged from 52 to 59%, averaging 55%, relative to the minimum efficiency suite. Predicted energy use for water heating was reduced 68 to 78% relative to resistance WH. Predicted total annual savings for the GSHPwDS relative to the same baseline averaged 22.6% with water heating energy use reduced by 10 to 30% from desuperheater contributions. The 1st generation (or alpha) prototype design for the GS-IHP was finalized in 2010 and field test samples were fabricated for testing by CM and by ORNL. Two of the alpha units were installed in 3700 ft{sup 2} (345 m{sup 2}) houses at the ZEBRAlliance site in Oak Ridge and field tested during 2011. Based on the steady-state performance demonstrated by the GS-IHPs it was projected that it would achieve >52% energy savings relative to the minimum efficiency suite at this specific site. A number of operational issues with the alpha units were identified indicating design changes needed to the system before market introduction could be accomplished. These were communicated to CM throughout the field test period. Based on the alpha unit test results and the diagnostic information coming from the field test

  20. Behind the scenes of GS: security affects us all

    CERN Multimedia

    Antonella Del Rosso

    2014-01-01

    A CERN manager, supported by two outside companies, manages the three entities in the GS Department that are in charge of various aspects of security. In total, about 80 people, 300 cameras, a surveillance centre (CSA) and 22 kilometres of fences are responsible for ensuring that the Organization is secure. But in spite of these significant resources, the best strategy for maintaining a good level of security at CERN is the active support of its users.   CERN’s security service covers three main areas: access control, comprising the security guards and a patrol service that ensures the site is secure and monitors compliance with traffic and parking rules; registration; and locks and keys. The 22 guards on the day shift and the seven on the night shift, who constantly monitor access, are spread across the two main sites and the four experiment sites. “The guards’ main job is to check that only those who are authorised to do so enter the site,” explains...

  1. Behind the scenes of GS: Service orientation CERN-wide

    CERN Multimedia

    Corinne Pralavorio

    2014-01-01

    A far-reaching project to improve the management of services was initiated in 2010, through the implementation of standard methods and tools to improve the efficiency of CERN services continuously.   Everyone at CERN now knows the telephone number 77777, the e-mail address service-desk@cern.ch and the CERN Service Portal. Behind all this lies a one-stop-shop where a team of operators is ready to answer your call as swiftly as possible and help you send that over-sized parcel to Patagonia or repair those faulty blinds (see Bulletin article 44-45/2013). But that’s not all, as Reinoud Martens, head of the Service Management Support Group in the GS Department, explains: “As far as the service management project is concerned, receiving and assigning incoming calls is just the tip of the iceberg! More generally, the aim of this massive project, launched in 2010 in close collaboration with the IT Department, is to enhance service management and implement standardised met...

  2. Behind the scenes of GS: keeping CERN clean

    CERN Multimedia

    Antonella Del Rosso

    2014-01-01

    More than 350,000 square metres to be maintained, two different cleaning companies due to CERN’s sites being in two different countries, underground installations where cleanliness is a question of safety… the CERN team in charge of supervising cleaning services overcomes all these challenges to ensure that our workplace remains clean and pleasant every day.   Ensuring the cleanliness of sites containing a huge variety of buildings is an enormous challenge for the two experts in the GS Department in charge of cleaning services. Alain Bertrand has been at CERN for 29 years and knows all there is to know about the Organization’s buildings and what they are used for, the condition of their toilet facilities and, of course, the location of the border between France and Switzerland which, in terms of cleaning services, denotes the transition point between the two companies used. David Chameaux has been doing the same job as Alain for two years, working with him to ensu...

  3. G-Protein α-Subunit Gsα Is Required for Craniofacial Morphogenesis.

    Directory of Open Access Journals (Sweden)

    Run Lei

    Full Text Available The heterotrimeric G protein subunit Gsα couples receptors to activate adenylyl cyclase and is required for the intracellular cAMP response and protein kinase A (PKA activation. Gsα is ubiquitously expressed in many cell types; however, the role of Gsα in neural crest cells (NCCs remains unclear. Here we report that NCCs-specific Gsα knockout mice die within hours after birth and exhibit dramatic craniofacial malformations, including hypoplastic maxilla and mandible, cleft palate and craniofacial skeleton defects. Histological and anatomical analysis reveal that the cleft palate in Gsα knockout mice is a secondary defect resulting from craniofacial skeleton deficiencies. In Gsα knockout mice, the morphologies of NCCs-derived cranial nerves are normal, but the development of dorsal root and sympathetic ganglia are impaired. Furthermore, loss of Gsα in NCCs does not affect cranial NCCs migration or cell proliferation, but significantly accelerate osteochondrogenic differentiation. Taken together, our study suggests that Gsα is required for neural crest cells-derived craniofacial development.

  4. French language: A basic G.S course for Nnamdi Azikiwe University ...

    African Journals Online (AJOL)

    The finding indicated that some universities have adopted French as one of the GS courses. It suggested that French language be taught in UNIZIK as a GS course. The work was based on NUC benchmark minimum academic standards for undergraduate progammes in Nigerian universities (BMMAS) of 2007. Key words: ...

  5. Collaborative Activities Enabled by GroupScribbles (GS): An Exploratory Study of Learning Effectiveness

    Science.gov (United States)

    Looi, Chee-Kit; Chen, Wenli; Ng, Foo-Keong

    2010-01-01

    This paper describes the findings of an exploratory cycle of a design-based research project and examines the learning effectiveness of collaborative activities that are supported by the GroupScribbles (GS) software technology in two Singapore primary science classrooms. The students had ten weeks of GS-based lessons in science, which were…

  6. ACR11 is an Activator of Plastid-Type Glutamine Synthetase GS2 in Arabidopsis thaliana.

    Science.gov (United States)

    Osanai, Takashi; Kuwahara, Ayuko; Otsuki, Hitomi; Saito, Kazuki; Yokota Hirai, Masami

    2017-04-01

    Glutamine synthetase (GS) is an important enzyme for nitrogen assimilation, and GS2, encoded by GLN2, is the only plastid-type GS in Arabidopsis thaliana. A co-expression analysis suggested that the expression level of the gene encoding a uridylyltransferase-like protein, ACR11, is strongly correlated with GLN2 expression levels. Here we showed that the recombinant ACR11 protein increased GS2 activity in vitro by reducing the Km values of its substrate glutamine. A T-DNA insertion mutant of ACR11 exhibited a reduced GS activity under low nitrate conditions and reduced glutamine levels. Biochemical analyses revealed that ACR11 and GS2 interacted both in vitro and in vivo. These data demonstrate that ACR11 is an activator of GS2, giving it a mechanistic role in the nitrogen assimilation of A. thaliana. © The Author 2017. Published by Oxford University Press on behalf of Japanese Society of Plant Physiologists. All rights reserved. For permissions, please email: journals.permissions@oup.com.

  7. Page 1 342 GS Ranganath velocity much smaller than that for the ...

    Indian Academy of Sciences (India)

    . Chem. Phys. 45 1452. Prost J 1972 Solid State Commun. 11 183. Putterman SJ 1974 Superfluid hydrodynamics (Amsterdam: North Holland). Ranganath GS 1983 Mol. Cryst. Liq. Cryst. Lett. (in press). Richardson E G and Tyler E 1929 Proc.

  8. Accumulated Expression Level of Cytosolic Glutamine Synthetase 1 Gene (OsGS1;1 or OsGS1;2) Alter Plant Development and the Carbon-Nitrogen Metabolic Status in Rice

    Science.gov (United States)

    Bao, Aili; Zhao, Zhuqing; Ding, Guangda; Shi, Lei; Xu, Fangsen; Cai, Hongmei

    2014-01-01

    Maintaining an appropriate balance of carbon to nitrogen metabolism is essential for rice growth and yield. Glutamine synthetase is a key enzyme for ammonium assimilation. In this study, we systematically analyzed the growth phenotype, carbon-nitrogen metabolic status and gene expression profiles in GS1;1-, GS1;2-overexpressing rice and wildtype plants. Our results revealed that the GS1;1-, GS1;2-overexpressing plants exhibited a poor plant growth phenotype and yield and decreased carbon/nitrogen ratio in the stem caused by the accumulation of nitrogen in the stem. In addition, the leaf SPAD value and photosynthetic parameters, soluble proteins and carbohydrates varied greatly in the GS1;1-, GS1;2-overexpressing plants. Furthermore, metabolite profile and gene expression analysis demonstrated significant changes in individual sugars, organic acids and free amino acids, and gene expression patterns in GS1;1-, GS1;2-overexpressing plants, which also indicated the distinct roles that these two GS1 genes played in rice nitrogen metabolism, particularly when sufficient nitrogen was applied in the environment. Thus, the unbalanced carbon-nitrogen metabolic status and poor ability of nitrogen transportation from stem to leaf in GS1;1-, GS1;2-overexpressing plants may explain the poor growth and yield. PMID:24743556

  9. Cosmological Gamma-Ray Bursters

    Science.gov (United States)

    Tamblyn, P.; Melia, F.

    1993-05-01

    The distribution of gamma-ray burst sources detected with BATSE is iso\\-tro\\-pic yet non-uniform. There is a deficit of weak events which is commonly expressed by a \\vvm less than the 0.5 expected for a uniform Eu\\-clid\\-ean distribution. It has been argued (e.g., Mao and Paczynski 1992) that this may be a signature of a Cosmological expansion in a FRW universe with a uniform, co-moving distribution of sources. However, a comparison of the \\vvm and burst detection rates of several experiments presents an apparent paradox: e.g., Konus detected the bursts more frequently than SMM, implying a better sensitivity and larger sampling volume, yet its measured \\vvm was ~ 0.45 compared to SMM's value of ~ 0.40, suggesting instead a lesser deviation from Eu\\-clid\\-ean space. We point out that this apparent conflict stems from the assumption that all bursts have a standard spectrum with a single power law. But realistic spectra often exhibit broken power laws, with a break energy 100;keV ~ lessepsilon_b ~ less 3 MeV. \\ Thus, the flux measured by a particular instrument depends on both the redshift of the source and the energy window of the detector. In other words, for a given energy window, the flux of a more distant burst will be further decreased below the value expected from the Cosmological model due to the red-shifting of epsilon_b across the window. We show that the inclusion of an intrinsic epsilon_b ( ~ 500 keV) and a consideration of the different detector energy responses and sensitivities can self-consistently account for the rates and \\vvm of the Konus, PVO, SMM, and BATSE datasets. Because of the dependence of the observed characteristics on the energy window, a subset of the BATSE catalog, based solely on the burst fluence in the higher energy (i.e., 4{th}) channel, provides an additional ``data'' point in the \\vvm versus rate plane. In particular, Konus's higher rate for a larger value of \\vvm is due to its better sensitivity, but smaller and lower energy window than SMM. \\ In the context of this improved model, BATSE is apparently sampling a source distribution out to a redshift zmax ~ 1.3, whereas Konus was limited to zmax ~ 0.5, SMM to ~ 0.3, and PVO to ~ 0.2.

  10. GsMTx4-D is a cardioprotectant against myocardial infarction during ischemia and reperfusion.

    Science.gov (United States)

    Wang, Jinli; Ma, Yina; Sachs, Frederick; Li, Ji; Suchyna, Thomas M

    2016-09-01

    GsMTx4 is a selective inhibitor of cationic mechanosensitive ion channels (MSCs) and has helped establish the role of MSCs in cardiac physiology. Inhomogeneous local mechanical stresses due to hypercontracture and swelling during ischemic reperfusion injury (IRI) likely induce elevated MSC activity that can contribute to cation imbalance. The aim of this study was to determine if the D enantiomer of GsMTx4 can act as a cardioprotectant in a mouse IRI model. Ischemia and reperfusion involved ligating a coronary artery followed by release of the ligature. GsMTx4-D was tested by either acute intravenous injection during the ischemic event or by two day pretreatment by intraperitoneal injection, both methods achieving similar results. Based on pharmacokinetic studies, GsMTx4-D dosage was set to achieve expected plasma concentrations between 50 and 5000nM and heart tissue concentrations between 1 and 200nM by intravenous injection. Relative to vehicle injected animals, GsMTx4-D reduced infarct area by ~40% for acute and pretreated animals for both 20 and 45min ischemic challenges. Many indicators of cardiac output were indistinguishable from sham-treated control hearts after GsMTx4-D treatment showing improvement at both 4 and 48h post ischemia, and premature ventricular beats immediately following reperfusion were also significantly reduced. To determine if GsMTx4-D cardioprotection could act directly at the level of cardiomyocytes, we tested its effects in vitro on indicators of IRI damage like cation influx and activation of inflammatory kinases in isolated myocytes cultured under hypoxic conditions. Hypoxia challenged cardiomyocytes treated with 10μM GsMTx4-D showed improved contractility and near normal contraction-related Ca(2+) influx. GsMTx4-D inhibited indicators of ischemic damage such as the apoptotic signaling system JNK/c-Jun, but also inhibited the energy response signaling system Akt kinase. We conclude that GsMTx4-D is a potent cardioprotectant in vivo

  11. FiGS: a filter-based gene selection workbench for microarray data

    Directory of Open Access Journals (Sweden)

    Yun Taegyun

    2010-01-01

    Full Text Available Abstract Background The selection of genes that discriminate disease classes from microarray data is widely used for the identification of diagnostic biomarkers. Although various gene selection methods are currently available and some of them have shown excellent performance, no single method can retain the best performance for all types of microarray datasets. It is desirable to use a comparative approach to find the best gene selection result after rigorous test of different methodological strategies for a given microarray dataset. Results FiGS is a web-based workbench that automatically compares various gene selection procedures and provides the optimal gene selection result for an input microarray dataset. FiGS builds up diverse gene selection procedures by aligning different feature selection techniques and classifiers. In addition to the highly reputed techniques, FiGS diversifies the gene selection procedures by incorporating gene clustering options in the feature selection step and different data pre-processing options in classifier training step. All candidate gene selection procedures are evaluated by the .632+ bootstrap errors and listed with their classification accuracies and selected gene sets. FiGS runs on parallelized computing nodes that capacitate heavy computations. FiGS is freely accessible at http://gexp.kaist.ac.kr/figs. Conclusion FiGS is an web-based application that automates an extensive search for the optimized gene selection analysis for a microarray dataset in a parallel computing environment. FiGS will provide both an efficient and comprehensive means of acquiring optimal gene sets that discriminate disease states from microarray datasets.

  12. FiGS: a filter-based gene selection workbench for microarray data.

    Science.gov (United States)

    Hwang, Taeho; Sun, Choong-Hyun; Yun, Taegyun; Yi, Gwan-Su

    2010-01-26

    The selection of genes that discriminate disease classes from microarray data is widely used for the identification of diagnostic biomarkers. Although various gene selection methods are currently available and some of them have shown excellent performance, no single method can retain the best performance for all types of microarray datasets. It is desirable to use a comparative approach to find the best gene selection result after rigorous test of different methodological strategies for a given microarray dataset. FiGS is a web-based workbench that automatically compares various gene selection procedures and provides the optimal gene selection result for an input microarray dataset. FiGS builds up diverse gene selection procedures by aligning different feature selection techniques and classifiers. In addition to the highly reputed techniques, FiGS diversifies the gene selection procedures by incorporating gene clustering options in the feature selection step and different data pre-processing options in classifier training step. All candidate gene selection procedures are evaluated by the .632+ bootstrap errors and listed with their classification accuracies and selected gene sets. FiGS runs on parallelized computing nodes that capacitate heavy computations. FiGS is freely accessible at http://gexp.kaist.ac.kr/figs. FiGS is an web-based application that automates an extensive search for the optimized gene selection analysis for a microarray dataset in a parallel computing environment. FiGS will provide both an efficient and comprehensive means of acquiring optimal gene sets that discriminate disease states from microarray datasets.

  13. Characterization of a glutamine synthetase gene DvGS1 from Dunaliella viridis and investigation of the impact on expression of DvGS1 in transgenic Arabidopsis thaliana.

    Science.gov (United States)

    Zhu, Chenguang; Fan, Qianlan; Wang, Wei; Shen, Chunlei; Wang, Peipei; Meng, Xiangzong; Tang, Yuanping; Mei, Bing; Xu, Zhengkai; Song, Rentao

    2014-01-01

    A novel glutamine synthetase (GS) gene DvGS1 showing highest amino acid sequence identity of 78 % with the other homologous GS proteins from green algae, was isolated and characterized from Dunaliella viridis. Phylogenetic analysis revealed that DvGS1 occupied an independent phylogenetic position which was different with the GSs from higher plants, animals and microbes. Functional complement in E. coli mutant confirmed that the DvGS1 encoded functional GS enzyme. Real-time PCR analysis of DvGS1 in D. viridis cells under nitrogen starvation revealed that the mRNA level of DvGS1 was positively up-regulated in 12 h. The DvGS1 levels at the points of 12 and 24 h were separately twofold and fourfold of the level before nitrogen starvation. In order to investigate the potential application of DvGS1 in higher plants, the transgenic study of DvGS1 in Arabidopsis thaliana was carried out. Phenotype identification demonstrated that all three transgenic lines of T3 generation showed obviously enhanced root length (26 %), fresh weight (22-46 % at two concentrations of nitrate supplies), stem length (26 %), leaf size (29 %) and silique number (30 %) compared with the wild-type Arabidopsis. Biochemical analysis confirmed that all three transgenic lines had higher total nitrogen content, soluble protein concentration, total amino acid content and the leaf GS activity than the wild type plants. The free NH4 (+) and NO3 (-) concentration in fresh leaves of three transgenic lines were reduced by 17-26 % and 14-15 % separately (at two concentrations of nitrate supplies) compared with those of the wild types. All the results indicated that over-expression of DvGS1 in Arabidopsis significantly results in the improvement of growth phenotype and the host's nitrogen use efficiency.

  14. A novel Glycine soja cysteine proteinase inhibitor GsCPI14, interacting with the calcium/calmodulin-binding receptor-like kinase GsCBRLK, regulated plant tolerance to alkali stress.

    Science.gov (United States)

    Sun, Xiaoli; Yang, Shanshan; Sun, Mingzhe; Wang, Sunting; Ding, Xiaodong; Zhu, Dan; Ji, Wei; Cai, Hua; Zhao, Chaoyue; Wang, Xuedong; Zhu, Yanming

    2014-05-01

    It has been well demonstrated that cystatins regulated plant stress tolerance through inhibiting the cysteine proteinase activity under environmental stress. However, there was limited information about the role of cystatins in plant alkali stress response, especially in wild soybean. Here, in this study, we focused on the biological characterization of a novel Glycine soja cystatin protein GsCPI14, which interacted with the calcium/calmodulin-binding receptor-like kinase GsCBRLK and positively regulated plant alkali stress tolerance. The protein-protein interaction between GsCBRLK and GsCPI14 was confirmed by using split-ubiquitin based membrane yeast two-hybrid analysis and bimolecular fluorescence complementation assay. Expression of GsCPI14 was greatly induced by salt, ABA and alkali stress in G. soja, and GsCBRLK overexpression (OX) in Glycine max promoted the stress induction of GmCPI14 expression under stress conditions. Furthermore, we found that GsCPI14-eGFP fusion protein localized in the entire Arabidopsis protoplast and onion epidermal cell, and GsCPI14 showed ubiquitous expression in different tissues of G. soja. In addition, we gave evidence that the GST-GsCPI14 fusion protein inhibited the proteolytic activity of papain in vitro. At last, we demonstrated that OX of GsCPI14 in Arabidopsis promoted the seed germination under alkali stress, as evidenced by higher germination rates. GsCPI14 transgenic Arabidopsis seedlings also displayed better growth performance and physiological index under alkali stress. Taken together, results presented in this study demonstrated that the G. soja cysteine proteinase inhibitor GsCPI14 interacted with the calcium/calmodulin-binding receptor-like kinase GsCBRLK and regulated plant tolerance to alkali stress.

  15. Propiedades psicométricas del Maslach Burnout Inventory-GS en una muestra multiocupacional venezolana

    Directory of Open Access Journals (Sweden)

    Anthony Constant Millán de Lange

    2012-06-01

    Full Text Available Psychometric properties of the Maslach Burnout Inventory-GS in a Venezuelan sampleThe assessment of work stress is one of the most important aspects in the current scope of occupational psychological health, especially when it comes to chronic levels of involvement.Here are the results of the Venezuelan psychometric validation of the Cuban version of the Maslach Burnout Inventory-General Survey (MBI-GS. Results show adequate reliability of the instrument and suggest the need to remove item 1 to ensure its construct validity.Some indicators reveal the divergent criterion validity of the MBI-GS on the degree of the participant’s psychological well-being.

  16. Stellarator Microinstability and Turbulence Simulations Using Gyrofluid (GryfX) and Gyrokinetic (GS2) Codes

    Science.gov (United States)

    Martin, Mike; Landreman, Matt; Mandell, Noah; Dorland, William

    2016-10-01

    GryfX is a delta-f code that evolves the gyrofluid set of equations using sophisticated nonlinear closures, with the option to evolve zonal flows (ky =0) kinetically. Since fluid models require less memory to store than a kinetic model, GryfX is ideally suited and thus written to run on a Graphics Processing Unit (GPU), yielding about a 1,200 times performance advantage over GS2. Here we present the first stellarator simulations using GryfX. Results compare linear growth rates of the Ion Temperature Gradient (ITG) mode between GryfX and the gyrokinetic code, GS2, using stellarator geometries from the National Compact Stellarator Experiment (NCSX) and Wendelstein 7-X (W7X). Strong agreement of W7X geometries. Nonlinear stellarator results using GS2/GryfX are also presented.

  17. Crystal structure of the β2 adrenergic receptor-Gs protein complex

    DEFF Research Database (Denmark)

    Rasmussen, Søren Gøgsig Faarup; DeVree, Brian T; Zou, Yaozhong

    2011-01-01

    G protein-coupled receptors (GPCRs) are responsible for the majority of cellular responses to hormones and neurotransmitters as well as the senses of sight, olfaction and taste. The paradigm of GPCR signalling is the activation of a heterotrimeric GTP binding protein (G protein) by an agonist......-occupied receptor. The β(2) adrenergic receptor (β(2)AR) activation of Gs, the stimulatory G protein for adenylyl cyclase, has long been a model system for GPCR signalling. Here we present the crystal structure of the active state ternary complex composed of agonist-occupied monomeric β(2)AR and nucleotide-free Gs...... by a GPCR....

  18. Ectopic Expression of GsPPCK3 and SCMRP in Medicago sativa Enhances Plant Alkaline Stress Tolerance and Methionine Content

    Science.gov (United States)

    Zhao, Yang; Zhao, Chaoyue; DuanMu, Huizi; Yu, Yang; Ji, Wei; Zhu, Yanming

    2014-01-01

    So far, it has been suggested that phosphoenolpyruvate carboxylases (PEPCs) and PEPC kinases (PPCKs) fulfill several important non-photosynthetic functions. However, the biological functions of soybean PPCKs, especially in alkali stress response, are not yet well known. In previous studies, we constructed a Glycine soja transcriptional profile, and identified three PPCK genes (GsPPCK1, GsPPCK2 and GsPPCK3) as potential alkali stress responsive genes. In this study, we confirmed the induced expression of GsPPCK3 under alkali stress and investigated its tissue expression specificity by using quantitative real-time PCR analysis. Then we ectopically expressed GsPPCK3 in Medicago sativa and found that GsPPCK3 overexpression improved plant alkali tolerance, as evidenced by lower levels of relative ion leakage and MDA content and higher levels of chlorophyll content and root activity. In this respect, we further co-transformed the GsPPCK3 and SCMRP genes into alfalfa, and demonstrated the increased alkali tolerance of GsPPCK3-SCMRP transgenic lines. Further investigation revealed that GsPPCK3-SCMRP co-overexpression promoted the PEPC activity, net photosynthetic rate and citric acid content of transgenic alfalfa under alkali stress. Moreover, we also observed the up-regulated expression of PEPC, CS (citrate synthase), H+-ATPase and NADP-ME genes in GsPPCK3-SCMRP transgenic alfalfa under alkali stress. As expected, we demonstrated that GsPPCK3-SCMRP transgenic lines displayed higher methionine content than wild type alfalfa. Taken together, results presented in this study supported the positive role of GsPPCK3 in plant response to alkali stress, and provided an effective way to simultaneously improve plant alkaline tolerance and methionine content, at least in legume crops. PMID:24586886

  19. Image quality enhancement and computation acceleration of 3D holographic display using a symmetrical 3D GS algorithm.

    Science.gov (United States)

    Zhou, Pengcheng; Bi, Yong; Sun, Minyuan; Wang, Hao; Li, Fang; Qi, Yan

    2014-09-20

    The 3D Gerchberg-Saxton (GS) algorithm can be used to compute a computer-generated hologram (CGH) to produce a 3D holographic display. But, using the 3D GS method, there exists a serious distortion in reconstructions of binary input images. We have eliminated the distortion and improved the image quality of the reconstructions by a maximum of 486%, using a symmetrical 3D GS algorithm that is developed based on a traditional 3D GS algorithm. In addition, the hologram computation speed has been accelerated by 9.28 times, which is significant for real-time holographic displays.

  20. [Isolation and functional analysis of GsTIFY11b relevant to salt and alkaline stress from Glycine soja].

    Science.gov (United States)

    Zhu, Dan; Bai, Xi; Zhu, Yan-Ming; Cai, Hua; Li, Yong; Ji, Wei; Chen, Chao; An, Lin; Zhu, Yi

    2012-02-01

    Using homologous cloning and RT-PCR technology, we isolated a novel TIFY family gene, GsTIFY11b, from Glycine soja L. G07256, a species that is tolerant to saline and alkaline environments. Phylogenetic analysis indicated that GsTIFY11b was closely related to AtTIFY11a with 56% similarity in amino acid identity. Protein sequence analysis showed that GsTIFY11b protein also had conserved TIFY domain, N-terminal domain, and a C-terminal Jas motif. Quantitative realtime PCR analysis indicated that the expression of GsTIFY11b was induced by both saline and alkaline stresses. Two homozygous GsTIFY11b over-expressing transgenic Arabidopsis lines were obtained. Phenotypic analysis of the transgenic and wild-type Arabidopsis indicated that over-expressing GsTIFY11b in Arabidopsis did not enhance plant tolerance to saline and alkaline stresses, whereas it showed an increased sensitivity to saline stress during seed germination and seedling development. Expression analysis of saline stress response marker genes in transgenic and wild-type plants under stress condition indicated that GsTIFY11b regulated the expression of RD29B, KIN1, and DREB. The transient expression of a GsTIFY11b-GFP fusion protein in onion epidermal cells showed that GsTIFY11b was localized to the nucleus, suggesting a role as a transcriptional regulator in the saline stress response pathway.

  1. Crystal structure of the β2 adrenergic receptor-Gs protein complex

    Energy Technology Data Exchange (ETDEWEB)

    Rasmussen, Søren G.F.; DeVree, Brian T; Zou, Yaozhong; Kruse, Andrew C; Chung, Ka Young; Kobilka, Tong Sun; Thian, Foon Sun; Chae, Pil Seok; Pardon, Els; Calinski, Diane; Mathiesen, Jesper M; Shah, Syed T.A.; Lyons, Joseph A; Caffrey, Martin; Gellman, Samuel H; Steyaert, Jan; Skiniotis, Georgios; Weis, William I; Sunahara, Roger K; Kobilka, Brian K [Brussels; (Trinity); (Michigan); (Stanford-MED); (Michigan-Med); (UW)

    2011-12-07

    G protein-coupled receptors (GPCRs) are responsible for the majority of cellular responses to hormones and neurotransmitters as well as the senses of sight, olfaction and taste. The paradigm of GPCR signalling is the activation of a heterotrimeric GTP binding protein (G protein) by an agonist-occupied receptor. The β2 adrenergic receptor (β2AR) activation of Gs, the stimulatory G protein for adenylyl cyclase, has long been a model system for GPCR signalling. Here we present the crystal structure of the active state ternary complex composed of agonist-occupied monomeric β2AR and nucleotide-free Gs heterotrimer. The principal interactions between the β2AR and Gs involve the amino- and carboxy-terminal α-helices of Gs, with conformational changes propagating to the nucleotide-binding pocket. The largest conformational changes in the β2AR include a 14Å outward movement at the cytoplasmic end of transmembrane segment 6 (TM6) and an α-helical extension of the cytoplasmic end of TM5. The most surprising observation is a major displacement of the α-helical domain of Gαs relative to the Ras-like GTPase domain. This crystal structure represents the first high-resolution view of transmembrane signalling by a GPCR.

  2. Metafectene is superior to lipofectamine in the transfection of G(s) alpha prostate cancer cells.

    Science.gov (United States)

    Iczkowski, Kenneth A; Omara-Opyene, A Levi; Klösel, Roland

    2004-10-01

    Transfection efficiency of the novel reagent metafectene has not been compared with that of lipofectamine in the published English literature. We used these agents to transfect two prostate cancer cell lines, PC3 and G(s) alpha, with a deoxyribonucleic acid (DNA) expression vector that generates double-stranded ribonucleic acid (RNA) for RNA interference (RNAi). Cotransfection of the green fluorescent protein (GFP) reporter gene revealed that the mean (+/- standard deviation) transfection efficiencies with lipofectamine were 5.8+/-0.4% for PC3 cells and 3.6+/-1.5% for G(s) alpha cells. Mean transfection efficiency with metafectene declined to 0.1+/-0% for PC3 cells but improved to 54.6+/-5.5% for G(s) alpha cells. With G(s) alpha cells, metafectene transfection of GFP plasmid alone yielded 46.9% positive cells, and cotransfection with CD44v9 expression vector yielded 45.9% positive cells. The visual impact of the transfected RNAi construct was detectable at the protein level 4 to 6 d posttransfection and was more dramatic after using metafectene than after using lipofectamine. Thus, in vitro, metafectene transfection efficiency was sufficient to allow us to assess the functional significance of our RNAi construct, suggesting metafectene as an excellent candidate for RNAi-mediated anticancer gene therapy.

  3. Construction of recombinant Pichia strain GS115-Ch-Glu expressing ...

    African Journals Online (AJOL)

    A recombinant Pichia strain GS115-Ch-Glu expressing both ß-glucosidase and cyanide hydratase was constructed to remove cyanogenic glycosides in edible plants. The & ß-glucosidase could hydrolyze cyanogenic glycosides into cyanide and its gene (Glu) was amplified by reverse transcriptase-polymerase chain ...

  4. Anti-amyloidogenic activity of IgGs contained in normal plasma.

    Science.gov (United States)

    O'Nuallain, Brian; Williams, Angela D; McWilliams-Koeppen, Helen P; Acero, Luis; Weber, Alfred; Ehrlich, Hartmut; Schwarz, Hans P; Solomon, Alan

    2010-05-01

    We have previously shown that a subpopulation of naturally occurring human IgGs has therapeutic potential for the amyloid-associated disorders. These molecules cross-react with conformational epitopes on amyloidogenic assemblies, including amyloid beta (Abeta) protein fibrils that are a pathological hallmark of Alzheimer's disease. Using our europium-linked immunosorbant assay, we established that approximately 95% of 260 screened donor plasma samples had amyloid fibril-reactive IgGs and Abeta conformer-reactive IgGs with minimal binding to Abeta monomers. Anti-amyloidogenic reactivity was diverse and attributed to Abeta targeting multiple fibril-related binding sites and/or variations in multidentate binding. There was no correlation between anti-fibril and anti-oligomer reactivity and donor age (19 to 60 years old) or gender. These findings demonstrate the inherent but diverse anti-amyloidogenic activity of natural IgGs contained in normal plasma. Our studies provide support for investigating the clinical significance and physiological function of this novel class of antibodies.

  5. The Glycine soja NAC transcription factor GsNAC019 mediates the regulation of plant alkaline tolerance and ABA sensitivity.

    Science.gov (United States)

    Cao, Lei; Yu, Yang; Ding, Xiaodong; Zhu, Dan; Yang, Fan; Liu, Beidong; Sun, Xiaoli; Duan, Xiangbo; Yin, Kuide; Zhu, Yanming

    2017-10-01

    Overexpression of Gshdz4 or GsNAC019 enhanced alkaline tolerance in transgenic Arabidopsis. We proved that Gshdz4 up-regulated both GsNAC019 and GsRD29B but GsNAC019 may repress the GsRD29B expression under alkaline stress. Wild soybean (Glycine soja) has a high tolerance to environmental challenges. It is a model species for dissecting the molecular mechanisms of salt-alkaline stresses. Although many NAC transcription factors play important roles in response to multiple abiotic stresses, such as salt, osmotic and cold, their mode of action in alkaline stress resistance is largely unknown. In our study, we identified a G. soja NAC gene, GsNAC019, which is a homolog of the Arabidopsis AtNAC019 gene. GsNAC019 was highly up-regulated by 50 mM NaHCO3 treatment in the roots of wild soybean. Further investigation showed that a well-characterized transcription factor, Gshdz4 protein, bound the cis-acting element sequences (CAATA/TA), which are located in the promoter of the AtNAC019/GsNAC019 genes. Overexpression of Gshdz4 positively regulated AtNAC019 expression in transgenic Arabidopsis, implying that AtNAC019/GsNAC019 may be the target genes of Gshdz4. GsNAC019 was demonstrated to be a nuclear-localized protein in onion epidermal cells and possessed transactivation activity in yeast cells. Moreover, overexpression of GsNAC019 in Arabidopsis resulted in enhanced tolerance to alkaline stress at the seedling and mature stages, but reduced ABA sensitivity. The closest Arabidopsis homolog mutant plants of Gshdz4, GsNAC019 and GsRD29B containing athb40, atnac019 and atrd29b were sensitive to alkaline stress. Overexpression or the closest Arabidopsis homolog mutant plants of the GsNAC019 gene in Arabidopsis positively or negatively regulated the expression of stress-related genes, such as AHA2, RD29A/B and KIN1. Moreover, this mutation could phenotypically promoted or compromised plant growth under alkaline stress, implying that GsNAC019 may contribute to alkaline stress

  6. [Effects of ginsenoside Rh2(GS-Rh2) on cell cycle of Eca-109 esophageal carcinoma cell line].

    Science.gov (United States)

    Li, Li; Qi, Feng-ying; Liu, Jun-ru; Zuo, Lian-fu

    2005-10-01

    To investigate the effects of ginsenoside Rh2 (GS-Rh2) on growth inhibition and cell cycle of Eca-109 esophageal carcinoma cell line in culture. The effects of GS-Rh2 on cell growth inhibition was detected by MTT assay. Cell cycle was analyzed by flow cytometry (FCM). Cell morphology was observed by a light microscope after HE staining. The protein expression of cell cycle components (cyclinE, CDK2, p21WAF1) were examined by immunocytochemistry and Western blot. The mRNA expression were examined by semiquantitative RT-PCR. GS-Rh2 inhibited the proliferation of Eca-109 cells in dose and time-dependent manners. The inhibition rate was about 50% after 1-day treatment with 20 microg x mL(-1) GS-Rh2 x 20 microg x mL(-1) GS-Rh2 induced the mature differentiation and morphological reversion. With increasing dose of GS-Rh2 treatment, the cell number of G0/G1 phase was increased, whereas it decreased at S and G2/M phase. There was significant difference between 10, 20 microg x mL(-1) GS-Rh2 groups and the corresponding group without GS-Rh2 treatement. After treating cells by 20 microg x mL(-1) GS-Rh2 for 1, 2, 3 days individually, the protein and mRNA expression of both cyclinE and CDK2 reduced, while the expression of p21WAF1 enhanced gradually. GS-Rh2 could arrest Eca-109 cells at G0/G1 phase and induce cell differentiation tending to normal. Furthermore, GS-Rh2 had an effect on expression of cell cycle components (cyclinE, CDK2 and p21WAF1) to inhibit Eca-109 cell proliferation.

  7. gsGator: an integrated web platform for cross-species gene set analysis.

    Science.gov (United States)

    Kang, Hyunjung; Choi, Ikjung; Cho, Sooyoung; Ryu, Daeun; Lee, Sanghyuk; Kim, Wankyu

    2014-01-14

    Gene set analysis (GSA) is useful in deducing biological significance of gene lists using a priori defined gene sets such as gene ontology (GO) or pathways. Phenotypic annotation is sparse for human genes, but is far more abundant for other model organisms such as mouse, fly, and worm. Often, GSA needs to be done highly interactively by combining or modifying gene lists or inspecting gene-gene interactions in a molecular network. We developed gsGator, a web-based platform for functional interpretation of gene sets with useful features such as cross-species GSA, simultaneous analysis of multiple gene sets, and a fully integrated network viewer for visualizing both GSA results and molecular networks. An extensive set of gene annotation information is amassed including GO & pathways, genomic annotations, protein-protein interaction, transcription factor-target (TF-target), miRNA targeting, and phenotype information for various model organisms. By combining the functionalities of Set Creator, Set Operator and Network Navigator, user can perform highly flexible and interactive GSA by creating a new gene list by any combination of existing gene sets (intersection, union and difference) or expanding genes interactively along the molecular networks such as protein-protein interaction and TF-target. We also demonstrate the utility of our interactive and cross-species GSA implemented in gsGator by several usage examples for interpreting genome-wide association study (GWAS) results. gsGator is freely available at http://gsGator.ewha.ac.kr. Interactive and cross-species GSA in gsGator greatly extends the scope and utility of GSA, leading to novel insights via conserved functional gene modules across different species.

  8. A theoretical study of ZnO-GS nanosensor to detect H{sub 2}S at room temperature

    Energy Technology Data Exchange (ETDEWEB)

    Mohammadi-Manesh, E., E-mail: emanesh@mail.kntu.ac.ir; Rahmani, S.

    2017-05-01

    In this paper, to detect hydrogen sulfide (H{sub 2}S) gas. the electronic structure, density of states, charge population analysis and electrical conductivity change at room temperature for Zinc oxide decorated graphene sheets (ZnO-GS) nanostructure were studied in detail. The calculations were performed using Density Functional Theory. The results strongly showed that the ZnO-GS nanostructure could be used as a nanosensor to detect H{sub 2}S gas at room temperature. Based on this set of calculations, H{sub 2}S adsorption energy on ZnO-GS showed a significant increase compared to the pure graphene sheets. The electrical conductivity of ZnO-GS was significantly changed at room temperature, after adsorption of H{sub 2}S. Based on these studies, the ZnO-GS nanosensor can be used to detect H{sub 2}S. Obtained results are in excellent agreement with reported experimental results. - Highlights: • Adsorption mechanism of H{sub 2}S on ZnO-GS nanosensors are studied. • The most stable configuration of each structure is obtained by using DFT method. • Electrical conductance of ZnO-GS before and after adsorption H{sub 2}S are calculated. • ZnO-GS nanosensor has more sensitivity in H{sub 2}S detection.

  9. Improved method for reliable HMW-GS identification by RP-HPLC and SDS-PAGE in common wheat cultivars

    Science.gov (United States)

    The accurate identification of alleles for high-molecular weight glutenins (HMW-GS) is critical for wheat breeding programs targeting end-use quality. RP-HPLC methods were optimized for separation of HMW-GS, resulting in enhanced resolution of 1By and 1Dx subunits. Statistically significant differe...

  10. Gsα deficiency in adipose tissue improves glucose metabolism and insulin sensitivity without an effect on body weight.

    Science.gov (United States)

    Li, Yong-Qi; Shrestha, Yogendra B; Chen, Min; Chanturiya, Tatyana; Gavrilova, Oksana; Weinstein, Lee S

    2016-01-12

    Gsα, the G protein that transduces receptor-stimulated cAMP generation, mediates sympathetic nervous system stimulation of brown adipose tissue (BAT) thermogenesis and browning of white adipose tissue (WAT), which are both potential targets for treating obesity, as well as lipolysis. We generated a mouse line with Gsα deficiency in mature BAT and WAT adipocytes (Ad-GsKO). Ad-GsKO mice had impaired BAT function, absent browning of WAT, and reduced lipolysis, and were therefore cold-intolerant. Despite the presence of these abnormalities, Ad-GsKO mice maintained normal energy balance on both standard and high-fat diets, associated with decreases in both lipolysis and lipid synthesis. In addition, Ad-GsKO mice maintained at thermoneutrality on a standard diet also had normal energy balance. Ad-GsKO mice had improved insulin sensitivity and glucose metabolism, possibly secondary to the effects of reduced lipolysis and lower circulating fatty acid binding protein 4 levels. Gsα signaling in adipose tissues may therefore affect whole-body glucose metabolism in the absence of an effect on body weight.

  11. Haplotypes of the TaGS5-A1 gene are associated with thousand-kernel weight in Chinese bread wheat

    Directory of Open Access Journals (Sweden)

    Wang Sha Sha

    2016-06-01

    Full Text Available In previous work, we cloned TaGS5 gene and found the association of TaGS5-A1 alleles with agronomic traits. In this study, the promoter sequence of the TaGS5-A1 gene was isolated from bread wheat. Sequencing results revealed that a G insertion was found in position -1925 bp of the TaGS5-A1 gene (Reference to ATG, which occurred in the Sp1 domain of the promoter sequence. Combined with previous single nucleotide polymorphism (SNP in the TaGS5-A1 exon sequence, four genotypes were formed at the TaGS5-A1 locus and were designated as TaGS5-A1a-a, TaGS5-A1a-b, TaGS5-A1b-a, and TaGS5-A1b-b, respectively. Analysis of the association of TaGS5-A1 alleles with agronomic traits indicated that cultivars with the TaGS5-A1a-b allele possessed significantly higher thousand-kernel weight (TKW and lower plant height than cultivars with the TaGS5-A1a-a allele, and cultivars with the TaGS5-A1b-b allele showed higher TKW than cultivars with the TaGS5-A1b-a allele. The differences of these traits between the TaGS5-A1a-a and TaGS5-A1a-b alleles were larger than those of the TaGS5-A1b-a and TaGS5-A1b-b alleles, suggesting that the -1925G insertion plays the more important role in TaGS5-A1a genotypes than in TaGS5-A1b genotypes. qRT-PCR indicated that TaGS5-A1b-b possessed the significantly highest expression level among four TaGS5-A1 haplotypes in mature seeds and further showed a significantly higher expression level than TaGS5-A1b-a at five different developmental stages of the seeds, suggesting that high expression of TaGS5-A1 was positively associated with high TKW in bread wheat. This study could provide a relatively superior genotype in view of TKW in wheat breeding programs and could also provide important information for dissection of the regulatory mechanism of the yield-related traits.

  12. Power line identification of millimeter wave radar based on PCA-GS-SVM

    Science.gov (United States)

    Fang, Fang; Zhang, Guifeng; Cheng, Yansheng

    2017-12-01

    Aiming at the problem that the existing detection method can not effectively solve the security of UAV's ultra low altitude flight caused by power line, a power line recognition method based on grid search (GS) and the principal component analysis and support vector machine (PCA-SVM) is proposed. Firstly, the candidate line of Hough transform is reduced by PCA, and the main feature of candidate line is extracted. Then, upport vector machine (SVM is) optimized by grid search method (GS). Finally, using support vector machine classifier optimized parameters to classify the candidate line. MATLAB simulation results show that this method can effectively identify the power line and noise, and has high recognition accuracy and algorithm efficiency.

  13. General Framework for Animal Food Safety Traceability Using GS1 and RFID

    Science.gov (United States)

    Cao, Weizhu; Zheng, Limin; Zhu, Hong; Wu, Ping

    GS1 is global traceability standard, which is composed by the encoding system (EAN/UCC, EPC), the data carriers identified automatically (bar codes, RFID), electronic data interchange standards (EDI, XML). RFID is a non-contact, multi-objective automatic identification technique. Tracing of source food, standardization of RFID tags, sharing of dynamic data are problems to solve urgently for recent traceability systems. The paper designed general framework for animal food safety traceability using GS1 and RFID. This framework uses RFID tags encoding with EPCglobal tag data standards. Each information server has access tier, business tier and resource tier. These servers are heterogeneous and distributed, providing user access interfaces by SOAP or HTTP protocols. For sharing dynamic data, discovery service and object name service are used to locate dynamic distributed information servers.

  14. GS Soil - Assessment and strategic development of INSPIRE compliant Geodata-Services for European Soil Data

    DEFF Research Database (Denmark)

    Krogh, Paul Henning; Münier, Bernd

    in Annex II and III. According to this, the thematic focus of GS Soil is set on soil as an important parameter according to climate, land use, geology and geomorphology. At the same time soils are the basis for food production and consumer health, for the ecological and economical balance and for many......GS Soil aims at establishing a Best Practice Network dealing with a cluster of the data themes listed in the Annexes I to III of the INSPIRE Directive (2007/2/EC) and focused on soil related issues. The establishment of the soil thematic strategy and the new transboundary EU approach for protected...... sites management has enforced the link between soil conservation and best practice use and geo-information. This has generated the need for interoperable, accessible and harmonised datasets for the EU. The link is also addressed by the INSPIRE Directive which pursues an EU Spatial Data Infrastructure...

  15. Glutathione Preservation during Storage of Rat Lenses in Optisol-GS and Castor Oil

    DEFF Research Database (Denmark)

    Holm, Thomas; Brøgger-Jensen, Martin Rocho; Johnson, Leif

    2013-01-01

    Glutathione concentration in the lens decreases in aging and cataractous lenses, providing a marker for tissue condition. Experimental procedures requiring unfrozen lenses from donor banks rely on transportation in storage medium, affecting lens homeostasis and alterations in glutathione levels....... The aim of the study was to examine the effects of Optisol-GS and castor oil on lens condition, determined from their ability to maintain glutathione concentrations....

  16. G-s0 mode converter with lateral gold mirrors for nano-plasmonic integrated circuits.

    Science.gov (United States)

    Lee, Dong Hun; Son, Jung-Han; Park, Hae-Ryeong; Kim, Min-Su; Leel, Myung-Hyun

    2014-11-01

    We propose a waveguide-typed plasmonic mode converter with lateral gold mirrors (LGMs) at a wavelength of 1.55 μm. The 17.5 μm-long gap-s0 mode converter (G-s0 MC) is composed of an input 4.5 μm-wide insulator-metal-insulator-metal-insulator waveguide (IMIMI-W) and an output 2.0 μm-wide metal-insulator-metal waveguide (MIM-W) with LGMs connected by a laterally tapered (LT) IMIMI-W with LGMs. The strip thicknesses of the IMIMI-Ws and MIM-W are 20 nm and 50 nm, respectively. The 12.0 μm-long LGMs with 1.5 μm thickness are located beside the LT-IMIMI-W and MIM-W. All metals in the IMIMI-Ws, MIM-W, and LGMs are designed with gold. A low-loss polymer is used for the 30 μm-thick upper and lower cladding layers. The thickness of the central insulator in both the IMIMI-Ws and MIM-W was designed to be 500 nm. The input Ss0 mode with the size of -5.9 μm x 4.8 μm is converted to the output G-s0 mode with the size of 1.1 μm x 0.5 μm. The total loss of the G-s0 MC, including conversion loss, is -6.96 dB in simulation. The proposed G-s0 MC may be potentially useful for bridging micro- to nano-plasmonic integrated circuits.

  17. The Research of Petroleum Enterprise Information System Architecture Based on the G/S Model

    Science.gov (United States)

    Rui, Liu; Xirong, Guo; Fang, Miao

    This paper explains the petroleum engineering technologies of petroleum enterprise supported by G/S model, which combine process of exploring, developing, and transporting of petroleum enterprise, these key technologies with spatial information technology supported by Digital Earth Platform, resulting in the improvement of the scientificity, accuracy, and rationality of the petroleum engineering technologies and the reduction of the cost and the increase of the benefits.

  18. Further evidence supporting a role for gs signal transduction in severe malaria pathogenesis.

    Directory of Open Access Journals (Sweden)

    Sarah Auburn

    2010-04-01

    Full Text Available With the functional demonstration of a role in erythrocyte invasion by Plasmodium falciparum parasites, implications in the aetiology of common conditions that prevail in individuals of African origin, and a wealth of pharmacological knowledge, the stimulatory G protein (Gs signal transduction pathway presents an exciting target for anti-malarial drug intervention. Having previously demonstrated a role for the G-alpha-s gene, GNAS, in severe malaria disease, we sought to identify other important components of the Gs pathway. Using meta-analysis across case-control and family trio (affected child and parental controls studies of severe malaria from The Gambia and Malawi, we sought evidence of association in six Gs pathway candidate genes: adenosine receptor 2A (ADORA2A and 2B (ADORA2B, beta-adrenergic receptor kinase 1 (ADRBK1, adenylyl cyclase 9 (ADCY9, G protein beta subunit 3 (GNB3, and regulator of G protein signalling 2 (RGS2. Our study amassed a total of 2278 cases and 2364 controls. Allele-based models of association were investigated in all genes, and genotype and haplotype-based models were investigated where significant allelic associations were identified. Although no significant associations were observed in the other genes, several were identified in ADORA2A. The most significant association was observed at the rs9624472 locus, where the G allele (approximately 20% frequency appeared to confer enhanced risk to severe malaria [OR = 1.22 (1.09-1.37; P = 0.001]. Further investigation of the ADORA2A gene region is required to validate the associations identified here, and to identify and functionally characterize the responsible causal variant(s. Our results provide further evidence supporting a role of the Gs signal transduction pathway in the regulation of severe malaria, and request further exploration of this pathway in future studies.

  19. Nepilngadīgo darba tiesības Latvijā 19.– 21. gs.

    OpenAIRE

    Jakovļevs, Andrejs

    2007-01-01

    Bakalaura darba temats ir „Nepilngadīgo darba tiesības Latvijā (XIX – XX gs.). Tā mērķis ir izpētīt, kāds ir bijis nepilngadīgo personu darba tiesību regulējums Latvijā hronoloģiski no XIX līdz XX gs., līdz laikam, kad pēc Padomju Savienības sabrukšanas Latvija atkal iekļāvās kontinentālās Eiropas tiesību lokā. Darbs ir rakstīts balstoties uz attiecīgā laika posmā spēkā esošo normatīvo aktu analīzi. Pētījumu aizsāk nepilngadīgo darba tiesības XIX gs., kad Eiropas valstīs un tai skatā Latvijā ...

  20. Behind the scenes of GS: each to his own lock and key

    CERN Multimedia

    Anaïs Schaeffer

    2014-01-01

    The GS-ASE team in charge of access control has an access solution for every type of premises, from radiation-controlled areas to simple administrative offices.   Although CERN is unquestionably open to the world, some of its doors must remain closed for a simple reason: as an industrial site, it must put safety and security at the top of its priorities and control access to certain areas in order to protect people and property from hazards. The AC (Access Control) section of the GS-ASE group uses a range of access control tools as the type of restrictions varies considerably according to the type of premises or area concerned: the requirements at the entrances to the different CERN sites may be quite different, for example, to those at the entrances to a specific building, a storage area, a workshop or an experiment hall within the fenced part of the CERN site. “We use different types of access systems at CERN”, explains Rui Nunes, head of the GS-ASE-AC section. &ldq...

  1. Proteolytic activity of IgGs from blood serum of wistar rats at experimental rheumatoid arthritis

    Directory of Open Access Journals (Sweden)

    Yu. Ya. Kit

    2014-10-01

    Full Text Available The aim of this work was to study the proteolytic activity of IgGs purified from blood serum of Wistar rats at experimental rheumatoid arthritis (ERA induced by an injection of bovine collagen of type II. Twenty rats were immunized with a preparation of bovine collagen II (Sigma-Aldrich, USA in the presence of complete Freund’s adjuvant. ERA development was determined by inflammation in limbs of treated animals. IgG preparations were isolated from blood serum of immunized and non-immunized animals by precipitation of antibodies with 33% ammonium sulfate followed by chromatography on the Protein G-Sepharose column. Human histone H1, bovine collagen II, calf thymus histones, myelin basic protein (MBP, bovine serum albumin (BSA, and bovine casein were used as substrates of the proteolytic activity of IgGs. It was found that IgG preparations from blood serum of rats with ERA were capable of cleaving histone H1 and MBP, however, they were catalytically inactive towards collagen II, casein, BSA, and core histones. IgGs from blood serum of non-immunized rats were proteolytically inactive towards all used protein substrates. Thus, we demonstrated that immunization of rats with bovine collagen II induced IgG-antibodies possessing the proteolytic activity towards histone H1 and MBP. This activity might be associated with the development of inflammatory processes in the immunized rats.

  2. High-throughput analysis and characterization of Astragalus membranaceus transcriptome using 454 GS FLX.

    Science.gov (United States)

    Liu, Xiu-Bo; Ma, Ling; Zhang, Ai-Hua; Zhang, Yan-He; Jiang, Jing; Ma, Wei; Zhang, Lei-Ming; Ren, Wei-Chao; Kong, Xiang-Jun

    2014-01-01

    Astragalus membranaceus (Fisch.) Bge (AR), one of the most important medicinal plants in Asia, was found to exhibit various bioactivities. Due to limited genomic and transcriptomic data, the biosynthetic pathway of the major bioactive compound in AR, is currently unclear. In this study, 454 GS FLX technology was employed to produce a substantial expressed sequence tag (EST) dataset from the AR. In all, 742721 high-quality reads from the AR were produced using Roche GS FLX Titanium. A total of 9893 unique sequences were obtained and annotated by a similarity search against the public databases, and involved in the secondary metabolic pathway, which would facilitate deciphering the molecular mechanism of secondary metabolism in AR. The assembled sequences were annotated with gene names and Gene Ontology (GO) terms. GO revealed the unique sequences that could be assigned to 34 vocabularies. In the KEGG mapping, unique sequences were established as associated with 46 biochemical pathways. These results provided the largest EST collections in AR and will contribute to biosynthetic and biochemical studies that lead to drug improvement. With respect to the genes related to metabolism and biosynthesis pathway were also found. Our work demonstrated the utility of 454 GS FLX as a method for the rapid and cost-effective identification of AR transcriptome, and this EST dataset will be a powerful resource for further studies such as taxonomy, molecular breeding, and secondary metabolism in AR.

  3. A novel Fe(III) dependent bioflocculant from Klebsiella oxytoca GS-4-08: culture conditions optimization and flocculation mechanism.

    Science.gov (United States)

    Yu, Lei; Tang, Qing-Wen; Zhang, Yu-Jia; Chen, Rong-Ping; Liu, Xin; Qiao, Wei-Chuan; Li, Wen-Wei; Ruan, Hong-Hua; Song, Xin

    2016-10-07

    In this work, the effect of cultivation factors on the flocculation efficiency (FE) of bioflocculant P-GS408 from Klebsiella oxytoca was optimized by the response surface methodology. The most significant factor, i.e. culture time, was determined by gray relational analysis. A total of 240 mg of purified P-GS408 was prepared from 1 liter of culture solution under the optimal conditions. GC-MS analysis results indicated that the polysaccharide of P-GS408 mainly contains Rhamnose and Galactose, and the existence of abundant hydroxyl, carboxyl and amino groups was evidenced by FTIR and XPS analyses. With the aid of Fe3+, the FE of kaolin solution by P-GS408 could achieve 99.48% in ten minutes. Functional groups of polysaccharide were involved in the first adsorption step and the zeta potential of kaolin solution changed from -39.0 mV to 43.4 mV in the presence of Fe3+ and P-GS408. Three-dimensional excitation-emission (EEM) fluorescence spectra demonstrates that the trivalent Fe3+ and Al3+ can bind efficiently with P-GS408, while those univalent and divalent cations cannot. With the help of SEM images, FTIR, zeta potential and EEM spectra, we proposed the P-GS408 flocculation mechanism, which consists of coordination bond combination, charge neutrality, adsorption and bridging, and net catching.

  4. The Beneficial Effects of ETS-GS, a Novel Vitamin E Derivative, on a Rat Model of Crush Injury.

    Science.gov (United States)

    Nakagawa, Junichiro; Matsumoto, Naoya; Nakane, Yuko; Yamakawa, Kazuma; Yamada, Tomoki; Matsumoto, Hisatake; Shimazaki, Junya; Imamura, Yukio; Ogura, Hiroshi; Jin, Takashi; Shimazu, Takeshi

    2016-12-01

    Crush syndrome is a devastating condition leading to multiple organ failure. The mechanisms by which local traumatic injuries affect distant organs remain unknown. ETS-GS is a novel water-soluble, stable anti-oxidative agent composed of vitamin E derivative. Given that one of the main pathophysiological effects in crush syndrome is massive ischemia-reperfusion, reactive oxygen species (ROS) generated from the injured extremities would be systemically involved in distant organ damage. We investigated whether ETS-GS could suppress inflammatory response and improve mortality in a rat model of crush injury. Crush injury was induced by compression of bilateral hindlimbs for 6 h followed by release of compression. Seven-day survival was significantly improved by ETS-GS treatment. To estimate anti-oxidative and anti-inflammatory effects of ETS-GS, serum was collected 6 and 20 h after the injury. ETS-GS treatment significantly dampened the up-regulation of malondialdehyde and reduction of superoxide dismutase in the serum, which were induced by crush injury. Serum levels of interleukin 6 and high mobility group box 1 were significantly decreased in the ETS-GS group compared with those in the control group. Lung damage shown by hematoxylin-eosin staining at 20 h after the injury was ameliorated by the treatment. Ex vivo imaging confirmed that ETS-GS treatment reduced ROS generation in both the lung and the muscle following crush injury. The administration of ETS-GS could suppress ROS generation, systemic inflammation, and the subsequent organ damage, thus improving survival in a rat model of crush injury. These findings suggest that ETS-GS can become a novel therapeutic agent against crush injury.

  5. Cytosolic glutamine synthetase Gln1;2 is the main isozyme contributing to GS1 activity and can be up-regulated to relieve ammonium toxicity

    DEFF Research Database (Denmark)

    Guan, Miao; de Bang, Thomas Christian; Pedersen, Carsten

    2016-01-01

    Cytosolic GS1 (Gln synthetase) is central for ammonium assimilation in plants. High ammonium treatment enhanced the expression of the GS1 isogene Gln-1;2 encoding a low-affinity high-capacity GS1 protein in Arabidopsis (Arabidopsis thaliana) shoots. Under the same conditions, the expression of th...

  6. Solution structure of the sodium channel antagonist conotoxin GS: a new molecular caliper for probing sodium channel geometry.

    Science.gov (United States)

    Hill, J M; Alewood, P F; Craik, D J

    1997-04-15

    The venoms of Conus snails contain small, disulfide-rich inhibitors of voltage-dependent sodium channels. Conotoxin GS is a 34-residue polypeptide isolated from Conus geographus that interacts with the extracellular entrance of skeletal muscle sodium channels to prevent sodium ion conduction. Although conotoxin GS binds competitively with mu conotoxin GIIIA to the sodium channel surface, the two toxin types have little sequence identity with one another, and conotoxin GS has a four-loop structural framework rather than the characteristic three-loop mu-conotoxin framework. The structural study of conotoxin GS will form the basis for establishing a structure-activity relationship and understanding its interaction with the pore region of sodium channels. The three-dimensional structure of conotoxin GS was determined using two-dimensional NMR spectroscopy. The protein exhibits a compact fold incorporating a beta hairpin and several turns. An unusual feature of conotoxin GS is the exceptionally high proportion (100%) of cis-imide bond geometry for the three proline or hydroxyproline residues. The structure of conotoxin GS bears little resemblance to the three-loop mu conotoxins, consistent with the low sequence identity between the two toxin types and their different structural framework. However, the tertiary structure and cystine-knot motif formed by the three disulfide bonds is similar to that present in several other polypeptide ion channel inhibitors. This is the first three-dimensional structure of a 'four-loop' sodium channel inhibitor, and it represents a valuable new structural probe for the pore region of voltage-dependent sodium channels. The distribution of amino acid sidechains in the structure creates several polar and charged patches, and comparison with the mu conotoxins provides a basis for determining the binding surface of the conotoxin GS polypeptide.

  7. The novel late Na(+) current inhibitor, GS-6615 (eleclazine) and its anti-arrhythmic effects in rabbit isolated heart preparations.

    Science.gov (United States)

    Rajamani, Sridharan; Liu, Gongxin; El-Bizri, Nesrine; Guo, Donglin; Li, Cindy; Chen, Xiao-Liang; Kahlig, Kristopher M; Mollova, Nevena; Elzein, Elfatih; Zablocki, Jeff; Belardinelli, Luiz

    2016-11-01

    Enhanced late Na(+) current (late INa ) in the myocardium is pro-arrhythmic. Inhibition of this current is a promising strategy to stabilize ventricular repolarization and suppress arrhythmias. Here, we describe GS-6615, a selective inhibitor of late INa , already in clinical development for the treatment of long QT syndrome 3 (LQT3). The effects of GS-6615 to inhibit late INa , versus other ion currents to shorten the ventricular action potential duration (APD), monophasic APD (MAPD) and QT interval, and decrease to the incidence of ventricular arrhythmias was determined in rabbit cardiac preparations. To mimic the electrical phenotype of LQT3, late INa was increased using the sea anemone toxin (ATX-II). GS-6615 inhibited ATX-II enhanced late INa in ventricular myocytes (IC50  = 0.7 μM), shortened the ATX-II induced prolongation of APD, MAPD, QT interval, and decreased spatiotemporal dispersion of repolarization and ventricular arrhythmias. Inhibition by GS-6615 of ATX-II enhanced late INa was strongly correlated with shortening of myocyte APD and isolated heart MAPD (R(2)  = 0.94 and 0.98 respectively). In contrast to flecainide, GS-6615 had the minimal effects on peak INa . GS-6615 did not decrease the maximal upstroke velocity of the action potential (Vmax) nor widen QRS intervals. GS-6615 was a selective inhibitor of late INa , stabilizes the ventricular repolarization and suppresses arrhythmias in a model of LQT3. The concentrations at which the electrophysiological effects of GS-6615 were observed are comparable to plasma levels associated with QTc shortening in patients with LQT3, indicating that these effects are clinically relevant. © 2016 The British Pharmacological Society.

  8. Manipulation of Epileptiform Electrocorticograms (ECoGs) and Sleep in Rats and Mice by Acupuncture.

    Science.gov (United States)

    Yi, Pei-Lu; Jou, Shuo-Bin; Wu, Yi-Jou; Chang, Fang-Chia

    2016-12-22

    Ancient Chinese literature has documented that acupuncture possesses efficient therapeutic effects on epilepsy and insomnia. There is, however, little research to reveal the possible mechanisms behind these effects. To investigate the effect of acupuncture on epilepsy and sleep, several issues need to be addressed. The first is to identify the acupoints, which correspond between humans, rats, and mice. Furthermore, the depth of insertion of the acupuncture needle, the degree of needle twist in manual needle acupuncture, and the stimulation parameters for electroacupuncture (EA) need to be determined. To evaluate the effects of acupuncture on epilepsy and sleep, a feasible model of epilepsy in rodents is required. We administer pilocarpine into the left central nucleus of the amygdala (CeA) to simulate focal temporal lobe epilepsy (TLE) in rats. Intraperitoneal (IP) injection of pilocarpine induces generalized epilepsy and status epilepticus (SE) in rats. Five IP injections of pentylenetetrazol (PTZ) with a one-day interval between each injection successfully induces spontaneous generalized epilepsy in mice. Recordings of electrocorticograms (ECoGs), electromyograms (EMGs), brain temperature, and locomotor activity are used for sleep analysis in rats, while ECoGs, EMGs, and locomotor activity are employed for sleep analysis in mice. ECoG electrodes are implanted into the frontal, parietal, and contralateral occipital cortices, and a thermistor is implanted above the cerebral cortex by stereotactic surgery. EMG electrodes are implanted into the neck muscles, and an infrared detector determines locomotor activity. The criteria for categorizing vigilance stages, including wakefulness, rapid eye movement (REM) sleep, and non-REM (NREM) sleep are based on information from ECoGs, EMGs, brain temperature, and locomotor activity. Detailed classification criteria are stated in the text.

  9. Glutathione Preservation during Storage of Rat Lenses in Optisol-GS and Castor Oil

    Science.gov (United States)

    Holm, Thomas; Brøgger-Jensen, Martin Rocho; Johnson, Leif; Kessel, Line

    2013-01-01

    Background Glutathione concentration in the lens decreases in aging and cataractous lenses, providing a marker for tissue condition. Experimental procedures requiring unfrozen lenses from donor banks rely on transportation in storage medium, affecting lens homeostasis and alterations in glutathione levels. The aim of the study was to examine the effects of Optisol-GS and castor oil on lens condition, determined from their ability to maintain glutathione concentrations. Methodology/Principal Findings Rat lenses were stored in the two types of storage media at varying time intervals up to 3 days. Glutathione concentration was afterwards determined in an enzymatic detection assay, specific for both reduced and oxidized forms. Lenses removed immediately after death exhibited a glutathione concentration of 4.70±0.29 mM. In vitro stored lenses in Optisol-GS lost glutathione quickly, ending with a concentration of 0.60±0.34 mM after 3 days while castor oil stored lenses exhibited a slower decline and ended at 3 times the concentration. A group of lenses were additionally stored under post mortem conditions within the host for 6 hours before its removal. Total glutathione after 6 hours was similar to that of lenses removed immediately after death, but with altered GSH and GSSG concentrations. Subsequent storage of these lenses in media showed changes similar to those in the first series of experiments, albeit to a lesser degree. Conclusions/Significance It was determined that storage in Optisol-GS resulted in a higher loss of glutathione than lenses stored in castor oil. Storage for more than 12 hours reduced glutathione to half its original concentration, and was considered unusable after 24 hours. PMID:24260265

  10. Forsøgs- og udviklingsarbejde i grundskolen som transgressiv praksis

    DEFF Research Database (Denmark)

    Ydesen, Christian; Andreasen, Karen Egedal

    2011-01-01

    Den pædagogiske undervisningspraksis i grundskolen er præget af stor stabilitet over tid, og synes vanskelig at forandre. Pædagogiske forsøgs- og udviklingsarbejder i grundskolen har gennem tiden haft som formål netop at udfordre, provokere, overskride og forandre praksis. Især de tidligste forsø....... Med afsæt i blandt andet Chris Jenks teoretiske perspektiver på transgression vil vi diskutere dette i et historisk perspektiv, idet vi inddrager træk fra udviklingen gennem 1900-tallet....

  11. Influence of induction hardening parameters on the GS30Mn5 weld properties

    Directory of Open Access Journals (Sweden)

    V. Marušić

    2016-10-01

    Full Text Available This study examines parameters of post-weld heat treatment on the test specimens made of cast steel GS30Mn5. The welding is performed with shielded metal arc welding (SMAW process. The aim is to obtain the surface without illicit cracks, with hardness ranging from 320 up to 400 HB. After induction heating, the specimens are cooled alternately with air and water. Decreased speed of quenching results in avoiding the occurrence of illicit splashes, while the hardness is maintained within the prescribed limits.

  12. Characterization of the gtfB and gtfC promoters from Streptococcus mutans GS-5.

    Science.gov (United States)

    Goodman, S D; Gao, Q

    2000-01-01

    We have characterized the promoter regions of the gtfB and gtfC genes from Streptococcus mutans GS-5. Using a plasmid-based reporter system, we discovered that the gtfC promoter is an order of magnitude stronger than the gtfB promoter. In addition, we found that a variety of growth conditions failed to affect or discriminate between the expression of the two promoters. Only during the various phases of growth could we demonstrate significant changes in expression. We conclude that gtfB and gtfC promoters are coordinately expressed. Copyright 2000 Academic Press.

  13. Behind the scenes of GS: a long-term urban planning vision

    CERN Multimedia

    Corinne Pralavorio

    2014-01-01

    The GS Department is working on a long-term plan for the urban planning of the CERN sites, ensuring that their development takes place using a coherent approach and keeping in mind the need for harmonious integration in the surrounding area.   Visitors are often bemused by CERN’s buildings, with their 1950s style and a layout that seems to defy all logic. Up until the 90s, buildings were erected as accelerators were built, with no apparent concern for harmony. But now, with a much larger number of users and installations, space is at a premium, getting around the site is difficult and urban planners are needed more than ever. "Over 9,000 people enter the CERN sites every day and we have 7,500 workstations," says Frédéric Magnin, Civil Engineering and Buildings Section Leader in the GS Department. For this reason, specialists in the department have been working on the development of the sites for five years. It is especially important that the...

  14. Sequence analysis of the gtfC gene from Streptococcus mutans GS-5.

    Science.gov (United States)

    Ueda, S; Shiroza, T; Kuramitsu, H K

    1988-09-15

    The nucleotide sequence of the gtfC gene, which codes for glucosyltransferase synthesizing both water-soluble and water-insoluble glucans, and its flanking regions from Streptococcus mutans GS-5, was determined. Although the gtfC gene (4218 bp) is preceded by a Shine-Dalgarno (SD) sequence, a promoter-like sequence for this gene could not be identified. The gtfC gene product composed of 1375 amino acid residues (approx. 153 kDa) is generally hydrophilic with three small hydrophobic domains. Two direct repeating units were found near the C terminus of the peptide. The gtfC gene has extensive homology with the previously sequenced gtfB gene. The homologous regions correspond to the signal sequence, an internal region, and the direct repeating units of the peptide. An open reading frame preceded by an SD sequence and followed by an inverted repeat sequence was found immediately downstream from the gtfC gene. The combined sequences of the gtfB and gtfC genes as well as flanking regions suggest that the two gtf genes and the small downstream coding region could be coordinately expressed within an operon. The possible evolution of the gtfC gene in S. mutans GS-5 is also discussed.

  15. Veselīgs dzīvesveids: 12. klases skolēnu paradumi

    OpenAIRE

    Rodziņa, Inga

    2010-01-01

    Veselīgs dzīvesveids tiek ņemts par pamatu indivīda veselībai. Par tādu vērtību kā veselība, lielākā daļa indivīdi sāk domāt tad, kad jau ir sākušās kādas veselības problēmas un tas visbiežāk ir cilvēkiem gados, tāpēc par veselību ir jāsāk domāt un rūpēties laicīgi. Mana bakalaura darba tēma ir „Veselīgs dzīvesveids- 12. klases skolēnu paradumi”. Mana pētījuma mērķis ir noskaidrot tieši jauniešu- 12. klases skolēnu- veselīga dzīvesveida paradumus. Uzsvars manā pētījumā tiek likts uz trim ...

  16. Overexpression of GsZFP1 enhances salt and drought tolerance in transgenic alfalfa (Medicago sativa L.).

    Science.gov (United States)

    Tang, Lili; Cai, Hua; Ji, Wei; Luo, Xiao; Wang, Zhenyu; Wu, Jing; Wang, Xuedong; Cui, Lin; Wang, Yang; Zhu, Yanming; Bai, Xi

    2013-10-01

    GsZFP1 encodes a Cys2/His2-type zinc-finger protein. In our previous study, when GsZFP1 was heterologously expressed in Arabidopsis, the transgenic Arabidopsis plants exhibited enhanced drought and cold tolerance. However, it is still unknown whether GsZFP1 is also involved in salt stress. GsZFP1 is from the wild legume Glycine soja. Therefore, the aims of this study were to further elucidate the functions of the GsZFP1 gene under salt and drought stress in the forage legume alfalfa and to investigate its biochemical and physiological functions under these stress conditions. Our data showed that overexpression of GsZFP1 in alfalfa resulted in enhanced salt tolerance. Under high salinity stress, greater relative membrane permeability and malondialdehyde (MDA) content were observed and more free proline and soluble sugars accumulated in transgenic alfalfa than in the wild-type (WT) plants; in addition, the transgenic lines accumulated less Na(+) and more K(+) in both the shoots and roots. Overexpression of GsZFP1 also enhanced the drought tolerance of alfalfa. The fold-inductions of stress-responsive marker gene expression, including MtCOR47, MtRAB18, MtP5CS, and MtRD2, were greater in transgenic alfalfa than those of WT under drought stress conditions. In conclusion, the transgenic alfalfa plants generated in this study could be used for farming in salt-affected as well as arid and semi-arid areas. Copyright © 2013 Elsevier Masson SAS. All rights reserved.

  17. Improved Method for Reliable HMW-GS Identification by RP-HPLC and SDS-PAGE in Common Wheat Cultivars.

    Science.gov (United States)

    Jang, You-Ran; Beom, Hye-Rang; Altenbach, Susan B; Lee, Min-Ki; Lim, Sun-Hyung; Lee, Jong-Yeol

    2017-06-24

    The accurate identification of alleles for high-molecular weight glutenins (HMW-GS) is critical for wheat breeding programs targeting end-use quality. RP-HPLC methods were optimized for separation of HMW-GS, resulting in enhanced resolution of 1By and 1Dx subunits. Statistically significant differences in retention times (RTs) for subunits corresponding to HMW-GS alleles were determined using 16 standard wheat cultivars with known HMW-GS compositions. Subunits that were not identified unambiguously by RP-HPLC were distinguished by SDS-PAGE or inferred from association with linked subunits. The method was used to verify the allelic compositions of 32 Korean wheat cultivars previously determined using SDS-PAGE and to assess the compositions of six new Korean cultivars. Three cultivars contained subunits that were identified incorrectly in the earlier analysis. The improved RP-HPLC method combined with conventional SDS-PAGE provides for accurate, efficient and reliable identification of HMW-GS and will contribute to efforts to improve wheat end-use quality.

  18. Draft genome sequencing of giardia intestinalis assemblage B isolate GS: is human giardiasis caused by two different species?

    Directory of Open Access Journals (Sweden)

    Oscar Franzén

    2009-08-01

    Full Text Available Giardia intestinalis is a major cause of diarrheal disease worldwide and two major Giardia genotypes, assemblages A and B, infect humans. The genome of assemblage A parasite WB was recently sequenced, and the structurally compact 11.7 Mbp genome contains simplified basic cellular machineries and metabolism. We here performed 454 sequencing to 16x coverage of the assemblage B isolate GS, the only Giardia isolate successfully used to experimentally infect animals and humans. The two genomes show 77% nucleotide and 78% amino-acid identity in protein coding regions. Comparative analysis identified 28 unique GS and 3 unique WB protein coding genes, and the variable surface protein (VSP repertoires of the two isolates are completely different. The promoters of several enzymes involved in the synthesis of the cyst-wall lack binding sites for encystation-specific transcription factors in GS. Several synteny-breaks were detected and verified. The tetraploid GS genome shows higher levels of overall allelic sequence polymorphism (0.5 versus <0.01% in WB. The genomic differences between WB and GS may explain some of the observed biological and clinical differences between the two isolates, and it suggests that assemblage A and B Giardia can be two different species.

  19. High Temperature Antenna Measurement System with GSG or GS Contact Probing Capability

    Science.gov (United States)

    Jordan, Jennifer L.; Scardelletti, Maximilian C.; Ponchak, George E.

    2009-01-01

    Applications that require data transmission at high temperatures are becoming more common due to growing commercial and military needs. Antennas are an indispensable part of these systems and the ability to characterize them at elevated temperatures is quite complicated with little or no information being reported on the subject [1]. This paper describes a measurement system that can characterize planar antennas up 600 C with ground-signal-ground (GSG) or ground-signal (GS) probe contacts. The return loss and radiation patterns of a folded slot antenna (FSA), designed to operate at 5 GHz (no ground plane on back side) and fabricated on an alumina substrate, are presented at room temperature (RT) and 250 C [2]. All measurements were made with Agilent's Precision Network Analyzer (PNA) E8361. The return loss and radiation patterns were also measured on a Styrofoam chuck to illustrate the effect the high temperature measurement system has on the patterns.

  20. Enhanced transmembrane proton conductance in Streptococcus mutans GS-5 due to ionophores and fluoride.

    Science.gov (United States)

    Eisenberg, A D; Marquis, R E

    1981-01-01

    The uptake of protons by intact cells of Streptococcus mutans GS-5 was measured directly by assessing the pH increase in lightly buffered cell suspensions as protons moved across the plasma membrane after acid pulses. The barrier function of the cell membrane for protons was disrupted completely by 5% (vol/vol) butanol. This function was compromised severely by the ionophores valinomycin and gramicidin and by the uncoupler carbonylcyanide-m-chlorophenyl hydrazone. Proton conduction across the membrane was also enhanced by fluoride. It appeared that HF traversed the membrane and acted as a carrier. Once in the relatively alkaline cytoplasm, HF dissociated to yield F- and H+, which acted to acidify the cytoplasm and reduced the pH difference across the membrane. PMID:6170255

  1. Nonlinear Drift of the Spring Gravimeter Caused by Air Pressure from the Kunming GS15 Gravimeters

    Directory of Open Access Journals (Sweden)

    Wei Jin

    2016-10-01

    Full Text Available In order to monitor and correct the meteorological factors of the spring gravity meter, the characteristics of the time varying gravity changes caused by meteorological factors were analyzed. Kunming GS15 gravity meter from 2007 continuous gravity observation has been carried out with the sampling rate of the pressure observation. In this study, we first compare the effects of 4 types of gravity meter and 3 different types of stations on the gravity observed seasonal gravity signals. It is indicated that the observed seasonal gravity signal of the cave is only 1/10, and there is a constant temperature and constant pressure device. Compared with the same time, the gravity signal of the gravity signal is about 100 times smaller. The influence of the pressure load of the gravity meter is tested by using the theory of pressure. The results show that only the actual value of 2cpd - 3cpd pressure load varies from -0.395 to -0.280×10-8ms-2 , and the 1cpd to 1 cpm periodic partial type gravity meter is also in accordance with the law of gravity and air pressure. And with the characteristics of time lag. In this paper, the nonlinear zero drift parameters of the linear regression model with time lag and the time series of the GS15 gravity meter are used to simulate the nonlinear zero drift parameters of the gravity meter. The results show that the gravity signal contains time lag 35 hours, and the air pressure admittance is 0.8 × 10-8ms-2/mbar. The correlation can reach 79%. The gravity changes signal and satellite gravity as well as the gravity water load signal of the land water model are the same as the gravity water load signal in the autumn as the minimum value, and the seasonal variation of the maximum value of gravity in summer.

  2. Secretion of an endogenous subtilisin by Pichia pastoris strains GS115 and KM71.

    Science.gov (United States)

    Salamin, Karine; Sriranganadane, Dev; Léchenne, Barbara; Jousson, Olivier; Monod, Michel

    2010-07-01

    The methylotrophic yeast Pichia pastoris is widely used for the expression of heterologous enzymes. While the purity of the desired expression product is of major importance for many applications, we found that recombinant enzymes produced in methanol medium were contaminated by a 37-kDa endogenous yeast protease. This enzyme was completely inhibited by phenylmethanesulfonyl fluoride (PMSF) but not by 1,10-phenanthroline, EDTA, and pepstatin A, suggesting the nature of a serine protease. Its secretion was abolished in P. pastoris strains GS115 and KM71 by specific mutagenesis of a subtilisin gene (SUB2) but not by inactivation of the gene encoding vacuolar proteinase B (PRB). Bioinformatic comparisons of Sub2 protein with subtilisins from other fungal genomes and phylogenetic analyses indicated that this enzyme is not an orthologue of the vacuolar protease cerevisin generally present in yeasts but is more closely related to another putative subtilisin found in a small number of yeast genomes. During growth of P. pastoris, Sub2 was produced as a secreted enzyme at a concentration of 10 microg/ml of culture supernatant after overexpression of the full-length SUB2 gene. During fermentative production of recombinant enzymes in methanol medium, 1 ml of P. pastoris culture supernatant was found to contain approximately 3 ng of Sub2, while the enzyme was not detected during growth in a medium containing glycerol as a carbon source. The mutant strain GS115-sub2 was subsequently used as a host for the production of recombinant proteases without endogenous subtilisin contamination.

  3. Secretion of an Endogenous Subtilisin by Pichia pastoris Strains GS115 and KM71 ▿

    Science.gov (United States)

    Salamin, Karine; Sriranganadane, Dev; Léchenne, Barbara; Jousson, Olivier; Monod, Michel

    2010-01-01

    The methylotrophic yeast Pichia pastoris is widely used for the expression of heterologous enzymes. While the purity of the desired expression product is of major importance for many applications, we found that recombinant enzymes produced in methanol medium were contaminated by a 37-kDa endogenous yeast protease. This enzyme was completely inhibited by phenylmethanesulfonyl fluoride (PMSF) but not by 1,10-phenanthroline, EDTA, and pepstatin A, suggesting the nature of a serine protease. Its secretion was abolished in P. pastoris strains GS115 and KM71 by specific mutagenesis of a subtilisin gene (SUB2) but not by inactivation of the gene encoding vacuolar proteinase B (PRB). Bioinformatic comparisons of Sub2 protein with subtilisins from other fungal genomes and phylogenetic analyses indicated that this enzyme is not an orthologue of the vacuolar protease cerevisin generally present in yeasts but is more closely related to another putative subtilisin found in a small number of yeast genomes. During growth of P. pastoris, Sub2 was produced as a secreted enzyme at a concentration of 10 μg/ml of culture supernatant after overexpression of the full-length SUB2 gene. During fermentative production of recombinant enzymes in methanol medium, 1 ml of P. pastoris culture supernatant was found to contain approximately 3 ng of Sub2, while the enzyme was not detected during growth in a medium containing glycerol as a carbon source. The mutant strain GS115-sub2 was subsequently used as a host for the production of recombinant proteases without endogenous subtilisin contamination. PMID:20472730

  4. Interference with Gsα-Coupled Receptor Signaling in Renin-Producing Cells Leads to Renal Endothelial Damage

    DEFF Research Database (Denmark)

    Lachmann, Peter; Hickmann, Linda; Steglich, Anne

    2017-01-01

    Intracellular cAMP, the production of which is catalyzed by the α-subunit of the stimulatory G protein (Gsα), controls renin synthesis and release by juxtaglomerular (JG) cells of the kidney, but may also have relevance for the physiologic integrity of the kidney. To investigate this possibility...... are classic signs of thrombotic microangiopathy. Additionally, we found endothelial damage in peritubular capillaries and vasa recta. Because deficiency of vascular endothelial growth factor (VEGF) results in thrombotic microangiopathy, we addressed the possibility that Gsα knockout may result in impaired...... VEGF production. We detected VEGF expression in JG cells of control mice, and cAMP agonists regulated VEGF expression in cultured renin-producing cells. Our data demonstrate that Gsα deficiency in JG cells of adult mice results in kidney injury, and suggest that JG cells are critically involved...

  5. Anaerobic oxidation of toluene, phenol, and p-cresol by the dissimilatory iron-reducing organism, GS-15

    Science.gov (United States)

    Lovley, D.R.; Lonergan, D.J.

    1990-01-01

    The dissimilatory Fe(III) reducer, GS-15, is the first microorganism known to couple the oxidation of aromatic compounds to the reduction of Fe(III) and the first example of a pure culture of any kind known to anaerobically oxidize an aromatic hydrocarbon, toluene. In this study, the metabolism of toluene, phenol, and p-cresol by GS-15 was investigated in more detail. GS-15 grew in an anaerobic medium with toluene as the sole electron donor and Fe(III) oxide as the electron acceptor. Growth coincided with Fe(III) reduction. [ring-14C]toluene was oxidized to 14CO2, and the stoichiometry of 14CO2 production and Fe(III) reduction indicated that GS-15 completely oxidized toluene to carbon dioxide with Fe(III) as the electron acceptor. Magnetite was the primary iron end product during toluene oxidation. Phenol and p-cresol were also completely oxidized to carbon dioxide with Fe(III) as the sole electron acceptor, and GS-15 could obtain energy to support growth by oxidizing either of these compounds as the sole electron donor. p-Hydroxybenzoate was a transitory extracellular intermediate of phenol and p-cresol metabolism but not of toluene metabolism. GS-15 oxidized potential aromatic intermediates in the oxidation of toluene (benzylalcohol and benzaldehyde) and p-cresol (p-hydroxybenzylalcohol and p-hydroxybenzaldehyde). The metabolism described here provides a model for how aromatic hydrocarbons and phenols may be oxidized with the reduction of Fe(III) in contaminated aquifers and petroleum-containing sediments.

  6. Improved fatigue resistance in Gsα-deficient and aging mouse skeletal muscles due to adaptive increases in slow fibers

    Science.gov (United States)

    Feng, Han-Zhong; Chen, Min; Weinstein, Lee S.

    2011-01-01

    Genetically modified mice with deficiency of the G protein α-subunit (Gsα) in skeletal muscle showed metabolic abnormality with reduced glucose tolerance, low muscle mass, and low contractile force, along with a fast-to-slow-fiber-type switch (Chen M, Feng HZ, Gupta D, Kelleher J, Dickerson KE, Wang J, Hunt D, Jou W, Gavrilova O, Jin JP, Weinstein LS. Am J Physiol Cell Physiol 296: C930–C940, 2009). Here we investigated a hypothesis that the switching to more slow fibers is an adaptive response with specific benefit. The results showed that, corresponding to the switch of myosin isoforms, the thin-filament regulatory proteins troponin T and troponin I both switched to their slow isoforms in the atrophic soleus muscle of 3-mo-old Gsα-deficient mice. This fiber-type switch involving coordinated changes of both thick- and thin-myofilament proteins progressed in the Gsα-deficient soleus muscles of 18- to 24-mo-old mice, as reflected by the expression of solely slow isoforms of myosin and troponin. Compared with age-matched controls, Gsα-deficient soleus muscles with higher proportion of slow fibers exhibited slower contractile and relaxation kinetics and lower developed force, but significantly increased resistance to fatigue, followed by a better recovery. Gsα-deficient soleus muscles of neonatal and 3-wk-old mice did not show the increase in slow fibers. Therefore, the fast-to-slow-fiber-type switch in Gsα deficiency at older ages was likely an adaptive response. The benefit of higher fatigue resistance in adaption to metabolic deficiency and aging provides a mechanism to sustain skeletal muscle function in diabetic patients and elderly individuals. PMID:21680879

  7. Iloprost-induced translocation of a 23-kDa protein that is recognized by a Gs alpha antiserum.

    OpenAIRE

    Molina y Vedia, L; Lapetina, E G

    1989-01-01

    We have observed that iloprost, a prostacyclin analog, causes the translocation of a 23-kDa protein from the membrane to the cytosol of human platelets. This 23-kDa protein is recognized by a Gs alpha (alpha subunit of stimulatory guanine nucleotide binding regulatory protein) antiserum but is not ADP-ribosylated by cholera toxin. The translocation of the Gs alpha-related protein might be an important part of the complex chain of events resulting in agonist-induced desensitization.

  8. The better growth phenotype of DvGS1-transgenic arabidopsis thaliana is attributed to the improved efficiency of nitrogen assimilation

    Directory of Open Access Journals (Sweden)

    Zhu Chenguang

    2015-01-01

    Full Text Available The overexpression of the algal glutamine synthetase (GS gene DvGS1 in Arabidopsis thaliana resulted in higher plant biomass and better growth phenotype. The purpose of this study was to recognize the biological mechanism for the growth improvement of DvGS1-transgenic Arabidopsis. A series of molecular and biochemical investigations related to nitrogen and carbon metabolism in the DvGS1-transgenic line was conducted. Analysis of nitrogen use efficiency (NUE-related gene transcription and enzymatic activity revealed that the transcriptional level and enzymatic activity of the genes encoding GS, glutamate synthase, glutamate dehydrogenase, alanine aminotransferase and aspartate aminotransferase, were significantly upregulated, especially from leaf tissues of the DvGS1-transgenic line under two nitrate conditions. The DvGS1-transgenic line showed increased total nitrogen content and decreased carbon: nitrogen ratio compared to wild-type plants. Significant reduced concentrations of free nitrate, ammonium, sucrose, glucose and starch, together with higher concentrations of total amino acids, individual amino acids (glutamate, aspartate, asparagine, methionine, soluble proteins and fructose in leaf tissues confirmed that the DvGS1-transgenic line demonstrated a higher efficiency of nitrogen assimilation, which subsequently affected carbon metabolism. These improved metabolisms of nitrogen and carbon conferred the DvGS1-transgenic Arabidopsis higher NUE, more biomass and better growth phenotype compared with the wild-type plants.

  9. DNA sequence polymorphisms within the bovine guanine nucleotide-binding protein Gs subunit alpha (Gsα)-encoding (GNAS) genomic imprinting domain are associated with performance traits

    Science.gov (United States)

    2011-01-01

    Background Genes which are epigenetically regulated via genomic imprinting can be potential targets for artificial selection during animal breeding. Indeed, imprinted loci have been shown to underlie some important quantitative traits in domestic mammals, most notably muscle mass and fat deposition. In this candidate gene study, we have identified novel associations between six validated single nucleotide polymorphisms (SNPs) spanning a 97.6 kb region within the bovine guanine nucleotide-binding protein Gs subunit alpha gene (GNAS) domain on bovine chromosome 13 and genetic merit for a range of performance traits in 848 progeny-tested Holstein-Friesian sires. The mammalian GNAS domain consists of a number of reciprocally-imprinted, alternatively-spliced genes which can play a major role in growth, development and disease in mice and humans. Based on the current annotation of the bovine GNAS domain, four of the SNPs analysed (rs43101491, rs43101493, rs43101485 and rs43101486) were located upstream of the GNAS gene, while one SNP (rs41694646) was located in the second intron of the GNAS gene. The final SNP (rs41694656) was located in the first exon of transcripts encoding the putative bovine neuroendocrine-specific protein NESP55, resulting in an aspartic acid-to-asparagine amino acid substitution at amino acid position 192. Results SNP genotype-phenotype association analyses indicate that the single intronic GNAS SNP (rs41694646) is associated (P ≤ 0.05) with a range of performance traits including milk yield, milk protein yield, the content of fat and protein in milk, culled cow carcass weight and progeny carcass conformation, measures of animal body size, direct calving difficulty (i.e. difficulty in calving due to the size of the calf) and gestation length. Association (P ≤ 0.01) with direct calving difficulty (i.e. due to calf size) and maternal calving difficulty (i.e. due to the maternal pelvic width size) was also observed at the rs43101491 SNP. Following

  10. DNA sequence polymorphisms within the bovine guanine nucleotide-binding protein Gs subunit alpha (Gsα-encoding (GNAS genomic imprinting domain are associated with performance traits

    Directory of Open Access Journals (Sweden)

    Mullen Michael P

    2011-01-01

    Full Text Available Abstract Background Genes which are epigenetically regulated via genomic imprinting can be potential targets for artificial selection during animal breeding. Indeed, imprinted loci have been shown to underlie some important quantitative traits in domestic mammals, most notably muscle mass and fat deposition. In this candidate gene study, we have identified novel associations between six validated single nucleotide polymorphisms (SNPs spanning a 97.6 kb region within the bovine guanine nucleotide-binding protein Gs subunit alpha gene (GNAS domain on bovine chromosome 13 and genetic merit for a range of performance traits in 848 progeny-tested Holstein-Friesian sires. The mammalian GNAS domain consists of a number of reciprocally-imprinted, alternatively-spliced genes which can play a major role in growth, development and disease in mice and humans. Based on the current annotation of the bovine GNAS domain, four of the SNPs analysed (rs43101491, rs43101493, rs43101485 and rs43101486 were located upstream of the GNAS gene, while one SNP (rs41694646 was located in the second intron of the GNAS gene. The final SNP (rs41694656 was located in the first exon of transcripts encoding the putative bovine neuroendocrine-specific protein NESP55, resulting in an aspartic acid-to-asparagine amino acid substitution at amino acid position 192. Results SNP genotype-phenotype association analyses indicate that the single intronic GNAS SNP (rs41694646 is associated (P ≤ 0.05 with a range of performance traits including milk yield, milk protein yield, the content of fat and protein in milk, culled cow carcass weight and progeny carcass conformation, measures of animal body size, direct calving difficulty (i.e. difficulty in calving due to the size of the calf and gestation length. Association (P ≤ 0.01 with direct calving difficulty (i.e. due to calf size and maternal calving difficulty (i.e. due to the maternal pelvic width size was also observed at the rs

  11. Procedure for Calculation of Potency and Efficacy for Ligands Acting on G(s)- and G (i)-Coupled Receptors

    DEFF Research Database (Denmark)

    Meier, Eddi; Schousboe, Arne; Belhage, Bo

    2012-01-01

    may lead to significant errors as compounds mediating their effects via G(s) coupled receptors may appear more potent and efficacious than they actually are. Contrary, compounds mediating their effects via G(i) coupled receptors may appear less potent and efficacious than they are in reality. Potency...

  12. Growth hormone-releasing hormone resistance in pseudohypoparathyroidism type ia: new evidence for imprinting of the Gs alpha gene.

    Science.gov (United States)

    Mantovani, Giovanna; Maghnie, Mohamad; Weber, Giovanna; De Menis, Ernesto; Brunelli, Valeria; Cappa, Marco; Loli, Paola; Beck-Peccoz, Paolo; Spada, Anna

    2003-09-01

    Heterozygous inactivating mutations in the Gs alpha gene cause Albright's hereditary osteodystrophy. Consistent with the observation that only maternally inherited mutations lead to resistance to hormone action [pseudohypoparathyroidism type Ia (PHP Ia)], recent studies provided evidence for a predominant maternal origin of Gs alpha transcripts in endocrine organs, such as thyroid, gonad, and pituitary. The aim of this study was to investigate the presence of pituitary resistance to hypothalamic hormones acting via Gs alpha-coupled receptors in patients with PHP Ia. Six of nine patients showed an impaired GH responsiveness to GHRH plus arginine, consistent with a complete GH deficiency (GH peak from 2.6-8.6 microg/liter, normal > 16.5), and partial (GH peak 13.9 and 13.6 microg/liter) and normal responses were found in two and one patient, respectively. Accordingly, IGF-I levels were below and in the low-normal range in seven and two patients. All patients had a normal cortisol response to 1 microg ACTH test, suggesting a normal corticotroph function that was confirmed by a normal ACTH and cortisol response to CRH test in three patients. In conclusion, we report that in addition to PTH and TSH resistance, patients with PHP Ia display variable degrees of GHRH resistance, consistent with Gs alpha imprinting in human pituitary.

  13. Influence of Nitrogen Availability on Growth of Two Transgenic Birch Species Carrying the Pine GS1a Gene

    Directory of Open Access Journals (Sweden)

    Vadim G. Lebedev

    2017-01-01

    Full Text Available An alternative way to increase plant productivity through the use of nitrogen fertilizers is to improve the efficiency of nitrogen utilization via genetic engineering. The effects of overexpression of pine glutamine synthetase (GS gene and nitrogen availability on growth and leaf pigment levels of two Betula species were studied. Untransformed and transgenic plants of downy birch (B. pubescens and silver birch (B. pendula were grown under open-air conditions at three nitrogen regimes (0, 1, or 10 mM for one growing season. The transfer of the GS1a gene led to a significant increase in the height of only two transgenic lines of nine B. pubescens, but three of five B. pendula transgenic lines were higher than the controls. In general, nitrogen supply reduced the positive effect of the GS gene on the growth of transgenic birch plants. No differences in leaf pigment levels between control and transgenic plants were found. Nitrogen fertilization increased leaf chlorophyll content in untransformed plants but its effect on most of the transgenic lines was insignificant. The results suggest that birch plants carrying the GS gene use nitrogen more efficiently, especially when growing in nitrogen deficient soil. Transgenic lines were less responsive to nitrogen supply in comparison to wild-type plants.

  14. On-Job-Training for Contract Specialists (GS-1102) at Fleet and Industrial Supply Center (FISC) Detachment Washington.

    OpenAIRE

    Stansfield, Patrick John.

    1995-01-01

    This thesis focused on the training requirements of GS-1102 Contract Specialists. In June 1995, a survey was taken of thirty-five contract specialists and ten supervisors at the Fleet and Industrial Supply Center, Norfolk, Washington Detachment. An analys U.S. Navy (U.S.N.) author.

  15. The mechano-gated channel inhibitor GsMTx4 reduces the exercise pressor reflex in decerebrate rats.

    Science.gov (United States)

    Copp, Steven W; Kim, Joyce S; Ruiz-Velasco, Victor; Kaufman, Marc P

    2016-02-01

    Mechanical and metabolic stimuli from contracting muscles evoke reflex increases in blood pressure, heart rate and sympathetic nerve activity. Little is known, however, about the nature of the mechano-gated channels on the thin fibre muscle afferents that contribute to evoke this reflex, termed the exercise pressor reflex. We determined the effect of GsMTx4, an inhibitor of mechano-gated Piezo channels, on the exercise pressor reflex evoked by intermittent contraction of the triceps surae muscles in decerebrated, unanaesthetized rats. GsMTx4 reduced the pressor, cardioaccelerator and renal sympathetic nerve responses to intermittent contraction but did not reduce the pressor responses to femoral arterial injection of compounds that stimulate the metabolically-sensitive thin fibre muscle afferents. Expression levels of Piezo2 channels were greater than Piezo1 channels in rat dorsal root ganglia. Our findings suggest that mechanically-sensitive Piezo proteins contribute to the generation of the mechanical component of the exercise pressor reflex in rats. Mechanical and metabolic stimuli within contracting skeletal muscles evoke reflex autonomic and cardiovascular adjustments. In cats and rats, gadolinium has been used to investigate the role played by the mechanical component of this reflex, termed the exercise pressor reflex. Gadolinium, however, has poor selectivity for mechano-gated channels and exerts multiple off-target effects. We tested the hypothesis that GsMTX4, a more selective mechano-gated channel inhibitor than gadolinium and a particularly potent inhibitor of mechano-gated Piezo channels, reduced the exercise pressor reflex in decerebrate rats. Injection of 10 μg of GsMTx4 into the arterial supply of the hindlimb reduced the peak pressor (control: 24 ± 5, GsMTx4: 12 ± 5 mmHg, P decerebrate rats and that the reduction was attributable, at least in part, to its effect on mechano-gated Piezo channels. © 2015 The Authors. The Journal of Physiology

  16. Behind the scenes of GS: Did you say “grey”?

    CERN Multimedia

    Antonella Del Rosso

    2014-01-01

    Walking around the CERN site, what we tend to notice are the buildings, roads, and car parks. At first glance, any “green” seems to be in the minority. The reality is quite different, as developed land takes up only 40 of the almost 650 hectares made available to the Organization by its Host States.   1,300 trees in CERN's enclosed areas, 250 hectares of cultivated fields and meadows, 140 hectares of woodland, and three wetlands: CERN clearly deserves its “green” certification from the Swiss conservation foundation Nature et économie that it has held since 2009. "We maintain every site, but each site is different and has its own conservation criteria," says Mathieu Fontaine, head of Green Spaces in the Civil Engineering and Buildings section of the GS Department. At CERN, an external company takes care of the day-to-day upkeep, but more complex operations are often necessary. The various projects to fell diseased or ...

  17. Behind the scenes of GS: a professional fire and rescue service like no other

    CERN Multimedia

    Anaïs Schaeffer

    2014-01-01

    Meet the professionals at the top of their game working hard for the well-being of the CERN community. Meet the CERN Fire Brigade.   Highly-qualified professional firefighters CERN’s Fire and Rescue Service (FRS, GS-FB Group) currently consists of 58 professionals. These are highly sought-after positions: for just a handful of vacancies, hundreds of applications are submitted from all over Europe. And bear in mind that only professional firefighters with at least five years’ experience at a centre with high levels of operational activity may apply… and they must also have a good command of at least one of the Organization's two official languages. Once the pre-selection process is over, around twenty candidates progress to the next stage, where they are really put through their paces with language tests, theory exams and exercises on real fires. “For the practical part, all candidates are evaluated on their responses to a real fire," ...

  18. Development of a 1 GS/s high-resolution transient recorder

    CERN Document Server

    Bartknecht, S; Herrmann, F; Königsmann, K; Lauser, L; Schill, C; Schopferer, S; Wollny, H

    2009-01-01

    With present-day detectors in high energy physics one is often faced with short analog pulses of a few nanoseconds length which may cover large dynamic ranges. In many experiments both amplitude and timing information have to be measured with high accuracy. Additionally, the data rate per readout channel can reach several MHz, which makes high demands on the separation of pile-up pulses. For such applications we have built the GANDALF transient recorder with a resolution of 12bit@1GS/s and an analog bandwidth of 500 MHz. Signals are digitized and processed by fast algorithms to extract pulse arrival times and amplitudes in real-time and to generate experiment trigger signals. With up to 16 analog channels, deep memories and a high data rate interface, this 6U-VME64x/VXS module is not only a dead-time free digitization unit but also has huge numerical capabilities provided by the implementation of a Virtex5-SXT FPGA. Fast algorithms implemented in the FPGA may be used to disentangle possible pile-up pulses and...

  19. On the model-based optimization of secreting mammalian cell (GS-NS0) cultures.

    Science.gov (United States)

    Kiparissides, A; Pistikopoulos, E N; Mantalaris, A

    2015-03-01

    The global bio-manufacturing industry requires improved process efficiency to satisfy the increasing demands for biochemicals, biofuels, and biologics. The use of model-based techniques can facilitate the reduction of unnecessary experimentation and reduce labor and operating costs by identifying the most informative experiments and providing strategies to optimize the bioprocess at hand. Herein, we investigate the potential of a research methodology that combines model development, parameter estimation, global sensitivity analysis, and selection of optimal feeding policies via dynamic optimization methods to improve the efficiency of an industrially relevant bioprocess. Data from a set of batch experiments was used to estimate values for the parameters of an unstructured model describing monoclonal antibody (mAb) production in GS-NS0 cell cultures. Global Sensitivity Analysis (GSA) highlighted parameters with a strong effect on the model output and data from a fed-batch experiment were used to refine their estimated values. Model-based optimization was used to identify a feeding regime that maximized final mAb titer. An independent fed-batch experiment was conducted to validate both the results of the optimization and the predictive capabilities of the developed model. The successful integration of wet-lab experimentation and mathematical model development, analysis, and optimization represents a unique, novel, and interdisciplinary approach that addresses the complicated research and industrial problem of model-based optimization of cell based processes. © 2014 Wiley Periodicals, Inc.

  20. Measurement of isotope abundance variations in nature by gravimetric spiking isotope dilution analysis (GS-IDA).

    Science.gov (United States)

    Chew, Gina; Walczyk, Thomas

    2013-04-02

    Subtle variations in the isotopic composition of elements carry unique information about physical and chemical processes in nature and are now exploited widely in diverse areas of research. Reliable measurement of natural isotope abundance variations is among the biggest challenges in inorganic mass spectrometry as they are highly sensitive to methodological bias. For decades, double spiking of the sample with a mix of two stable isotopes has been considered the reference technique for measuring such variations both by multicollector-inductively coupled plasma mass spectrometry (MC-ICPMS) and multicollector-thermal ionization mass spectrometry (MC-TIMS). However, this technique can only be applied to elements having at least four stable isotopes. Here we present a novel approach that requires measurement of three isotope signals only and which is more robust than the conventional double spiking technique. This became possible by gravimetric mixing of the sample with an isotopic spike in different proportions and by applying principles of isotope dilution for data analysis (GS-IDA). The potential and principle use of the technique is demonstrated for Mg in human urine using MC-TIMS for isotopic analysis. Mg is an element inaccessible to double spiking methods as it consists of three stable isotopes only and shows great potential for metabolically induced isotope effects waiting to be explored.

  1. Behind the scenes of GS: there’s only one way to go

    CERN Multimedia

    Anaïs Schaeffer

    2014-01-01

    At CERN, all of the Laboratory’s imports and exports are routed in the same way: through the Logistics Service. This GS-IS Group service is responsible for receiving, inspecting and distributing all goods sent to the Organization.   Whether products for the CERN Stores, components for the experiments, tools, machinery and materials for the workshops or equipment for users and members of the personnel, nothing escapes the attention of CERN’s Logistics Service, which every year processes nearly 70,000 incoming deliveries, 7,500 shipments and 160,000 distributed items. “The vast majority of our imports come from CERN Member States,” says imports and customs procedures manager Laurence Planque, “but we are receiving more and more goods for collaborators working at CERN from non-Member States such as China, India and Pakistan. All these imports are entitled to diplomatic exemption, so every day we have to manage the customs clearance procedures wit...

  2. Monoclonal antibodies specific to Streptococcus mutans GS-5 glucosyltransferase-C inhibit bacterial glucosyltransferase.

    Science.gov (United States)

    Kim, Mi-Ah; Lee, Kyung-Yeol; Kim, Jae-Gon

    2013-10-01

    Glucosyltransferase-C (GTFC) is a virulence factor of Streptococcus mutans. Additionally, GTFC represents an essential element required for bacterial cell coherence, allowing for the formation of dental plaque, which leads to dental caries. As such, monoclonal antibodies (MAbs) against S. mutans are believed to offer some protection against dental caries. In the current study, we amplified an approximately 1.5 kb fragment of the N-terminal half of the S. mutans gtfC gene by PCR, then induced expression of this gene. This protein was designated GTFCN. After the expressed protein was purified, it was used as an immunogen and injected into BALB/c mice. We selected and established two MAbs by producing hybridomas (HCN17 and HCN37). The anti-GTFCN antibody isotype was confirmed as IgG2a for HCN17 and IgG2b for HCN37. The anti-GTFCN antibody was found to specifically react with the GTFCN protein. The enzymatic activity of the crude glucosyltransferase of S. mutans GS-5 was significantly inhibited at a concentration of 350 ng of MAb/mL. These results suggest that the monoclonal anti-GTFCN antibodies could represent an alternative modality for passive immunization to prevent S. mutans aggregation and dental plaque.

  3. Análisis estructural e invarianza de medición del MBI-GS en trabajadores peruanos (Structural Analysis and Measurement Invariance of MBI-GS in Peruvian Workers

    Directory of Open Access Journals (Sweden)

    Manuel Fernández-Arata

    2015-06-01

    Full Text Available Resumen La medición del burnout ha evolucionado con la creación de varios instrumentos y modelos. El Maslach Burnout Inventory - General Survey (MBI-GS es uno de estos instrumentos para medir tres constructos definicionales del burnout: (1 agotamiento emocional, (2 eficacia profesional y (3 indiferencia. Fue creado para un amplio rango de ocupaciones, pero pocas veces se ha verificado su estructura latente e invarianza de medición en Latinoamérica. El presente estudio analiza esta estructura latente y la invarianza de medición del MBI-GS en una muestra de 940 trabajadores peruanos de varias ocupaciones. Se aplicó la metodología de ecuaciones estructurales mediante el análisis factorial confirmatorio, así como la invarianza de medición entre varones y mujeres, imponiendo restricciones sucesivamente más estrictas. Los resultados verificaron satisfactoriamente la estructura de tres dimensiones latentes del MBI-GS, y la invarianza de sus parámetros entre hombres y mujeres. Se discute las implicaciones de los resultados. Abstract The measurement of burnout has evolved into the creation of various tools and models. The Maslach Burnout Inventory - General Survey (MBI-GS is one of these instruments used to measure three definitional constructs of burnout: (1 emotional exhaustion, (2 professional efficiency, and (3 indifference. It was created for a wide range of occupations, but its latent structure and invariance of measurement in Latin America has rarely been verified. The present study analyzes the latent structure and the invariance of measurement of MBI-GS in a sample of 940 Peruvian workers in various occupations. The methodology of structural equations was applied through the confirmatory factor analysis, as well as the invariance of measurement between men and women, imposing restrictions successively more strict. The results satisfactorily verified the structure of three-dimensional latent MBI-GS, and the invariance of its

  4. Complex phase dynamics in coupled bursters

    DEFF Research Database (Denmark)

    Postnov, D.E.; Sosnovtseva, Olga; Malova, S.Y.

    2003-01-01

    The phenomenon of phase multistability in the synchronization of two coupled oscillatory systems typically arises when the systems individually display complex wave forms associated, for instance, with the presence of subharmonic components. Alternatively, phase multistability can be caused...... by variations of the phase velocity along the orbit of the individual oscillator. Focusing on the mechanisms underlying the appearance of phase multistability, the paper examines a variety of phase-locked patterns in the bursting behavior of a model of coupled pancreatic cells. In particular, we show how...... the number of spikes per train and the proximity of a neighboring equilibrium point can influence the formation of coexisting regimes....

  5. The 3' untranslated region of the two cytosolic glutamine synthetase (GS(1)) genes in alfalfa (Medicago sativa) regulates transcript stability in response to glutamine.

    Science.gov (United States)

    Simon, Bindu; Sengupta-Gopalan, Champa

    2010-10-01

    Glutamine synthetase (GS) catalyzes the ATP-dependent condensation of ammonia with glutamate to produce glutamine. The GS enzyme is located either in the chloroplast (GS(2)) or in the cytoplasm (GS(1)). GS(1) is encoded by a small gene family and the members exhibit differential expression pattern mostly attributed to transcriptional regulation. Based on our recent finding that a soybean GS(1) gene, Gmglnβ ( 1 ) is subject to its 3'UTR-mediated post-transcriptional regulation as a transgene in alfalfa (Medicago sativa) we have raised the question of whether the 3'UTR-mediated transcript destabilization is a more universal phenomenon. Gene constructs consisting of the CaMV35S promoter driving the reporter gene, GUS, followed by the 3'UTRs of the two alfalfa GS(1) genes, MsGSa and MsGSb, were introduced into alfalfa and tobacco. The analysis of these transformants suggests that while both the 3'UTRs promote transcript turnover, the MsGSb 3'UTR is more effective than the MsGSa 3'UTR. However, both the 3'UTRs along with Gmglnβ ( 1 ) 3'UTR respond to nitrate as a trigger in transcript turnover. More detailed analysis points to glutamine rather than nitrate as the mediator of transcript turnover. Our data suggests that the 3'UTR-mediated regulation of GS(1) genes at the level of transcript turnover is probably universal and is used for fine-tuning the expression in keeping with the availability of the substrates.

  6. GsSKP21, a Glycine soja S-phase kinase-associated protein, mediates the regulation of plant alkaline tolerance and ABA sensitivity.

    Science.gov (United States)

    Liu, Ailin; Yu, Yang; Duan, Xiangbo; Sun, Xiaoli; Duanmu, Huizi; Zhu, Yanming

    2015-01-01

    Plant SKP1-like family proteins, components of the SCF complex E3 ligases, are involved in the regulation of plant development and stress responses. Little is known about the precise function of SKP genes in plant responses to environmental stresses. GsSKP21 was initially identified as a potential stress-responsive gene based on the transcriptome sequencing of Glycine soja. In this study, we found that GsSKP21 protein contains highly conserved SKP domains in its N terminus and an extra unidentified domain in its C terminus. The transcript abundance of GsSKP21, detected by quantitative real-time PCR, was induced under the treatment of alkali and salt stresses. Overexpression of GsSKP21 in Arabidopsis dramatically increased plant tolerance to alkali stress. Furthermore, we found that overexpression of GsSKP21 resulted in decreased ABA sensitivity during both the seed germination and early seedling growth stages. GsSKP21 mediated ABA signaling by altering the expression levels of the ABA signaling-related and ABA-induced genes. We also investigated the tissue expression specificity and subcellular localization of GsSKP21. These results suggest that GsSKP21 is important for plant tolerance to alkali stress and plays a critical regulatory role in the ABA-mediated stress response.

  7. GsLRPK, a novel cold-activated leucine-rich repeat receptor-like protein kinase from Glycine soja, is a positive regulator to cold stress tolerance.

    Science.gov (United States)

    Yang, Liang; Wu, Kangcheng; Gao, Peng; Liu, Xiaojuan; Li, Guangpu; Wu, Zujian

    2014-02-01

    Plant LRR-RLKs serve as protein interaction platforms, and as regulatory modules of protein activation. Here, we report the isolation of a novel plant-specific LRR-RLK from Glycine soja (termed GsLRPK) by differential screening. GsLRPK expression was cold-inducible and shows Ser/Thr protein kinase activity. Subcellular localization studies using GFP fusion protein indicated that GsLRPK is localized in the plasma membrane. Real-time PCR analysis indicated that temperature, salt, drought, and ABA treatment can alter GsLRPK gene transcription in G. soja. However, just protein induced by cold stress not by salinity and ABA treatment in tobacco was found to possess kinase activity. Furthermore, we found that overexpression of GsLRPK in yeast and Arabidopsis can enhance resistance to cold stress and increase the expression of a number of cold responsive gene markers. Copyright © 2013 Elsevier Ireland Ltd. All rights reserved.

  8. A Glycine soja 14-3-3 protein GsGF14o participates in stomatal and root hair development and drought tolerance in Arabidopsis thaliana.

    Science.gov (United States)

    Sun, Xiaoli; Luo, Xiao; Sun, Mingzhe; Chen, Chao; Ding, Xiaodong; Wang, Xuedong; Yang, Shanshan; Yu, Qingyue; Jia, Bowei; Ji, Wei; Cai, Hua; Zhu, Yanming

    2014-01-01

    It is well established that 14-3-3 proteins are key regulators of multiple stress signal transduction cascades. However, the biological functions of soybean 14-3-3 proteins, especially in plant drought response, are not yet known. In this study, we characterized a Glycine soja 14-3-3 gene, GsGF14o, which is involved in plant development and drought response. GsGF14o expression was greatly induced by drought stress, as evidenced by the quantitative real-time PCR and β-glucuronidase (GUS) activity analysis. GsGF14o overexpression in Arabidopsis thaliana resulted in decreased drought tolerance during seed germination and seedling growth. Furthermore, silencing of AtGF14µ, the most homologous 14-3-3 gene of GsGF14o, led to enhanced drought tolerance at both the seed germination and seedling stage. Unexpectedly, GsGF14o transgenic lines showed reduced water loss and transpiration rates compared with wild-type plants, which was demonstrated to be the consequence of the decreased stomatal size. At the same time, the smaller stomata due to GsGF14o overexpression led to a relatively slow net photosynthesis rate, which led to a growth penalty under drought stress. We further demonstrated that GsGF14o overexpression caused deficits in root hair formation and development, and thereby reduced the water intake capacity of the transgenic root system. In addition, GsGF14o overexpression down-regulated the transcript levels of drought-responsive marker genes. Finally, we also investigated the tissue-specific accumulation of GsGF14o by using a GUS activity assay. Collectively, the results presented here confirm that GsGF14o plays a dual role in drought stress responses through its involvement in the regulation of stomatal size and root hair development.

  9. Exploring bacterial diversity in hospital environments by GS-FLX Titanium pyrosequencing.

    Directory of Open Access Journals (Sweden)

    Margarita Poza

    Full Text Available Understanding microbial populations in hospital environments is crucial for improving human health. Hospital-acquired infections are an increasing problem in intensive care units (ICU. In this work we present an exploration of bacterial diversity at inanimate surfaces of the ICU wards of the University Hospital A Coruña (Spain, as an example of confined hospital environment subjected to selective pressure, taking the entrance hall of the hospital, an open and crowded environment, as reference. Surface swab samples were collected from both locations and recovered DNA used as template to amplify a hypervariable region of the bacterial 16S rRNA gene. Sequencing of the amplicons was performed at the Roche 454 Sequencing Center using GS-FLX Titanium procedures. Reads were pre-processed and clustered into OTUs (operational taxonomic units, which were further classified. A total of 16 canonical bacterial phyla were detected in both locations. Members of the phyla Firmicutes (mainly Staphylococcus and Streptococcus and Actinobacteria (mainly Micrococcaceae, Corynebacteriaceae and Brevibacteriaceae were over-represented in the ICU with respect to the Hall. The phyllum Proteobacteria was also well represented in the ICU, mainly by members of the families Enterobacteriaceae, Methylobacteriaceae and Sphingomonadaceae. In the Hall sample, the phyla Proteobacteria, Bacteroidetes, Deinococcus-Thermus and Cyanobacteria were over-represented with respect to the ICU. Over-representation of Proteobacteria was mainly due to the high abundance of Enterobacteriaceae members. The presented results demonstrate that bacterial diversity differs at the ICU and entrance hall locations. Reduced diversity detected at ICU, relative to the entrance hall, can be explained by its confined character and by the existence of antimicrobial selective pressure. This is the first study using deep sequencing techniques made in hospital wards showing substantial hospital microbial

  10. Super 0-brane and GS superstring actions on AdS sub 2 x S sup 2

    CERN Document Server

    Zhou Jian Ge

    1999-01-01

    The super 0-brane and GS superstring actions on AdS sub 2 x S sup 2 background with 2-form flux are constructed by taking a supercoset approach. We find that the super 0-brane action contains two parameters which are interpreted as the electric and magnetic charges of the super 0-brane. The obtained super 0-brane action describes the BPS saturated dyonic superparticle moving on AdS sub 2 x S sup 2 background. The WZ action contains the required coupling with 2-form flux. For GS superstring, we find the string action on AdS sub 2 x S sup 2 takes the same form as those in AdS sub 3 x S sup 3 and AdS sub 5 x S sup 5 with RR field background.

  11. A minimal set of tissue-specific hypomethylated CpGs constitute epigenetic signatures of developmental programming.

    Directory of Open Access Journals (Sweden)

    Alejandro Colaneri

    Full Text Available Cell specific states of the chromatin are programmed during mammalian development. Dynamic DNA methylation across the developing embryo guides a program of repression, switching off genes in most cell types. Thus, the majority of the tissue specific differentially methylated sites (TS-DMS must be un-methylated CpGs.Comparison of expanded Methyl Sensitive Cut Counting data (eMSCC among four tissues (liver, testes, brain and kidney from three C57BL/6J mice, identified 138,052 differentially methylated sites of which 23,270 contain CpGs un-methylated in only one tissue (TS-DMS. Most of these CpGs were located in intergenic regions, outside of promoters, CpG islands or their shores, and up to 20% of them overlapped reported active enhancers. Indeed, tissue-specific enhancers were up to 30 fold enriched in TS-DMS. Testis showed the highest number of TS-DMS, but paradoxically their associated genes do not appear to be specific to the germ cell functions, but rather are involved in organism development. In the other tissues the differentially methylated genes are associated with tissue-specific physiological or anatomical functions. The identified sets of TS-DMS quantify epigenetic distances between tissues, generated during development. We applied this concept to measure the extent of reprogramming in the liver of mice exposed to in utero or early postnatal nutritional stress. Different protocols of food restriction reprogrammed the liver methylome in different but reproducible ways.Thus, each identified set of differentially methylated sites constituted an epigenetic signature that traced the developmental programing or the early nutritional reprogramming of each exposed mouse. We propose that our approach has the potential to outline a number of disease-associated epigenetic states. The composition of differentially methylated CpGs may vary with each situation, behaving as a composite variable, which can be used as a pre-symptomatic marker for

  12. A high-yielding, generic fed-batch process for recombinant antibody production of GS-engineered cell lines

    DEFF Research Database (Denmark)

    Fan, Li; Zhao, Liang; Sun, Yating

    2009-01-01

    . Compared to batch cultures, the fed-batch technology generated the magnitude of the increase in cell yields (5 fold) and final antibody concentrations (4-8 fold). The majority of the increase in final antibody concentration was functions of the increased cell density and the prolonged culture time....... This generic and high-yielding fed-batch process would shorten development time, and ensure process stability, thereby facilitating the manufacture of therapeutic antibodies by GS-engineered cell lines....

  13. Complete Genome Sequence of the Human Herpesvirus 6A Strain AJ from Africa Resembles Strain GS from North America.

    Science.gov (United States)

    Tweedy, J; Spyrou, M A; Donaldson, C D; Depledge, D; Breuer, J; Gompels, U A

    2015-02-12

    The genome sequence of human herpesvirus 6A (HHV-6A) strain AJ was determined in a comparison of target enrichment and long-range PCR using next-generation sequencing methodologies. The analyses show 85 predicted open reading frames (ORFs), conservation with sequenced HHV-6A reference strain U1102, and closest identity to the recently determined GS strain, despite different geographic origins (United States and Gambia). Copyright © 2015 Tweedy et al.

  14. Binding of Griffonia simplicifolia 1 isolectin B4 (GS1 B4) to alpha-galactose antigens.

    Science.gov (United States)

    Kirkeby, S; Moe, D

    2001-04-01

    Glycoconjugates with terminal Galalpha1-3Galbeta1-4GlcNAc sequences (alpha-galactosyl epitopes, natural xenoreactive antigens) are present on various tissues in pigs and are recognized by human anti-alphagalactosyl (alphaGal) antibodies1. Hence xenotransplantation (pig-to-human) would trigger immune reactions involving complement activation and lead to the hyperactute rejection of the graft. Xenoreactive antigens are often studied by using the lectin Griffonia simplicifolia 1 isolectin B4 (GS1 B4), which shows high affinity to galactose. We here estimate the specificity of GS1 B4 for detecting various galactosyl epitopes by measuring lectin binding to neoglycoproteins, thyroglobulin and pig skeletal muscle. Enzyme linked lectin assays confirmed that GS1 B4 was highly specific to alpha-galactosylated neoglycoproteins while the lectin did not detect a beta-galactosylated ligand. The length of the sugar chains influenced the lectin-carbohydrate interaction. A monosaccharide linked to serum albumin showed higher lectin affinity than did neoglycoproteins with di- and tri-alpha-galactosyl epitopes. When the carbohydrate was extended, as in the xenoreactive pentasaccharide (Galalpha1-3Galbeta1-4GlcNAcbeta1-3Galbeta1-4Glc), the carbohydrate- lectin interaction was meagre. Not only the terminal, but also the subterminal sugar affected the lectin binding because the GS1 B4 affinity to Galalpha1-3Gal was much stronger than to Galalpha1-3GalNAc. In bovine and porcine thyroglobulin most alphaGal epitopes appear to be cryptic, but are unmasked by a heat denaturation. In pig skeletal muscle there was lectin reaction not only in the muscle capillaries, but also in the connective tissue and intracellularly in muscle fibres. In Western blots of isolated proteins from pig muscle at least three bands were strongly stained after incubation with lectin.

  15. Effect of transfer of donor corneal tissue from McCarey–Kaufmann medium to Optisol-GS on corneal endothelium

    Directory of Open Access Journals (Sweden)

    Neha Kapur

    2018-01-01

    Full Text Available Purpose: The purpose of this study is to evaluate the effect of transfer of donor corneal tissue from McCarey–Kaufmann (MK medium to Optisol-GS on corneal endothelium. Methods: This was a prospective, randomized comparative study. Twenty paired human donor corneal tissues of optical quality were retrieved. One tissue of the pair was preserved in Optisol-GS preservative medium (Group A and other tissue of the pair in MK medium (Group B at the time of corneoscleral disc excision. Within 12 h of retrieval, each cornea was evaluated using slit-lamp biomicroscopic examination and specular microscopic analysis. Group B corneas were transferred to Optisol-GS medium within 48–53 h of retrieval. Specular analysis of the paired corneas was repeated 3 h after transferring to Optisol-GS. On day 7 of storage, specular analysis of both the tissues was repeated. Results: The average age of the donor at the time of death was 29 years (16–68 years. The reduction in endothelial cell count, from baseline, in Groups A and B was 5.5% and 5.8% (P = 0.938 on the 3rd day and 8.2% and 12.6% (P = 0.025 on the 7th day, respectively, postretrieval. The coefficient of variation (CV increased by 36% (P = 0.021 and hexagonality reduced by 19% (P = 0.007 on day 7. All tissues retained an endothelial cell density higher than the accepted critical level for penetrating keratoplasty. Conclusion: Significant endothelial cell loss was noted while transferring tissues from one medium to another, necessitating the need for reevaluation of transferred tissues before utilization.

  16. Amperometric Immunosensor for Carbofuran Detection Based on MWCNTs/GS-PEI-Au and AuNPs-Antibody Conjugate

    Directory of Open Access Journals (Sweden)

    Xiangyou Wang

    2013-04-01

    Full Text Available In this paper, an amperometric immunosensor for the detection of carbofuran was developed. Firstly, multiwall carbon nanotubes (MWCNTs and graphene sheets-ethyleneimine polymer-Au (GS-PEI-Au nanocomposites were modified onto the surface of a glass carbon electrode (GCE via self-assembly. The nanocomposites can increase the surface area of the GCE to capture a large amount of antibody, as well as produce a synergistic effect in the electrochemical performance. Then the modified electrode was coated with gold nanoparticles-antibody conjugate (AuNPs-Ab and blocked with BSA. The monoclonal antibody against carbofuran was covalently immobilized on the AuNPs with glutathione as a spacer arm. The morphologies of the GS-PEI-Au nanocomposites and the fabrication process of the immunosensor were characterized by X-ray diffraction (XRD, ultraviolet and visible absorption spectroscopy (UV-vis and scanning electron microscopy (SEM, respectively. Under optimal conditions, the immunosensor showed a wide linear range, from 0.5 to 500 ng/mL, with a detection limit of 0.03 ng/mL (S/N = 3. The as-constructed immunosensor exhibited notable performance features such as high specificity, good reproducibility, acceptable stability and regeneration performance. The results are mainly due to the excellent properties of MWCNTs, GS-PEI-Au nanocomposites and the covalent immobilization of Ab with free hapten binding sites for further immunoreaction. It provides a new avenue for amperometric immunosensor fabrication.

  17. Characterization of a de novo 43-bp deletion of the Gs[alpha] gene (GNAS1) in Albright hereditary osteodystrophy

    Energy Technology Data Exchange (ETDEWEB)

    Luttikhuis, M.E.M.O.; Trembath, R.C. (Univ. of Leicester (United Kingdom)); Wilson, L.C. (Univ. of Leicester (United Kingdom) Institute of Child Health, London (United Kingdom)); Leonard, J.V. (Institute of Child Health, London (United Kingdom))

    1994-05-15

    Albright hereditary osteodystrophy (AHO) is an autosomal dominant disorder characterized by short stature, obesity, mental retardation, subcutaneous calcification, and brachy-metaphalangia. Two distinct forms of AHO exist; pseudohypoparathyroidism type I (PHPI) and pseudopseudohypoparathyrodism (PPHP). The classification is dependent upon the presence or absence, respectively, of resistance to parathyroid and other hormones that bind to Gs-protein-coupled membrane receptors stimulating adenylyl cyclase. Gs is a heterotrimeric protein comprising [alpha], [beta], and [gamma]-subunits encoded by separate genes. Genomic DNA was isolated from peripheral leukocytes from 13 unrelated AHO patients. Exon 4 and flanking intronic sequence of GNAS1 were PCR amplified. A single PCR product corresponding to the expected 159-bp fragment was identified in 12 affected individuals with either PHPIa or PPHP. In patient 10285 an additional smaller fragment was detected but was not present in either of the unaffected parents. These two fragments were isolated from a 2% agarose gel. Direct sequencing of the smaller fragment revealed a 43-bp deletion comprising at least 35 hp of the 3[prime] end of exon 4 and the donor splice site of intron 4 and extending into the following intro. The 43-bp deletion would lead to a premature stop codon, 62 codons downstream of the deletion. The de novo mutation reported here is the largest deletion in the Gs[alpha] gene described so far for AHO patients.

  18. Ectopic Expression of a Glycine soja myo-Inositol Oxygenase Gene (GsMIOX1a in Arabidopsis Enhances Tolerance to Alkaline Stress.

    Directory of Open Access Journals (Sweden)

    Chen Chen

    Full Text Available Myo-inositol participates in various aspects of plant physiology, and myo-inositol oxygenase is the key enzyme of the myo-inositol oxygenation pathway. Previous studies indicated that myo-inositol oxygenase may play a role in plant responses to abiotic stresses. In this study, we focused on the functional characterization of GsMIOX1a, a remarkable alkaline stress-responsive gene of Glycine soja 07256, based on RNA-seq data. Using quantitative real-time PCR, we demonstrated that GsMIOX1a is rapidly induced by alkaline stress and expressed predominantly in flowers. We also elucidated the positive function of GsMIOX1a in the alkaline response in the wild type, atmiox1 mutant as well as GsMIOX1a-overexpressing Arabidopsis. We determined that atmiox1 mutant decreased Arabidopsis tolerance to alkaline stress, whereas GsMIOX1a overexpression increased tolerance. Moreover, the expression levels of some alkaline stress-responsive and inducible marker genes, including H+-Ppase, NADP-ME, KIN1 and RD29B, were also up-regulated in GsMIOX1a overexpression lines compared with the wild type and atmiox1 mutant. Together, these results suggest that the GsMIOX1a gene positively regulates plant tolerance to alkaline stress. This is the first report to demonstrate that ectopic expression of myo-inositol oxygenase improves alkaline tolerance in plants.

  19. The new 4-O-methylhonokiol analog GS12021 inhibits inflammation and macrophage chemotaxis: role of AMP-activated protein kinase α activation.

    Directory of Open Access Journals (Sweden)

    Sora Kim

    Full Text Available Preventing pathologic tissue inflammation is key to treating obesity-induced insulin resistance and type 2 diabetes. Previously, we synthesized a series of methylhonokiol analogs and reported that compounds with a carbamate structure had inhibitory function against cyclooxygenase-2 in a cell-free enzyme assay. However, whether these compounds could inhibit the expression of inflammatory genes in macrophages has not been investigated. Here, we found that a new 4-O-methylhonokiol analog, 3',5-diallyl-4'-methoxy-[1,1'-biphenyl]-2-yl morpholine-4-carboxylate (GS12021 inhibited LPS- or TNFα-stimulated inflammation in macrophages and adipocytes, respectively. LPS-induced phosphorylation of nuclear factor-kappa B (NF-κB/p65 was significantly decreased, whereas NF-κB luciferase activities were slightly inhibited, by GS12021 treatment in RAW 264.7 cells. Either mitogen-activated protein kinase phosphorylation or AP-1 luciferase activity was not altered by GS12021. GS12021 increased the phosphorylation of AMP-activated protein kinase (AMPK α and the expression of sirtuin (SIRT 1. Inhibition of mRNA expression of inflammatory genes by GS12021 was abolished in AMPKα1-knockdown cells, but not in SIRT1 knockout cells, demonstrating that GS12021 exerts anti-inflammatory effects through AMPKα activation. The transwell migration assay results showed that GS12021 treatment of macrophages prevented the cell migration promoted by incubation with conditioned medium obtained from adipocytes. GS12021 suppression of p65 phosphorylation and macrophage chemotaxis were preserved in AMPKα1-knockdown cells, indicating AMPK is not required for these functions of GS12021. Identification of this novel methylhonokiol analog could enable studies of the structure-activity relationship of this class of compounds and further evaluation of its in vivo potential for the treatment of insulin-resistant states and other chronic inflammatory diseases.

  20. The mechano‐gated channel inhibitor GsMTx4 reduces the exercise pressor reflex in decerebrate rats

    Science.gov (United States)

    Kim, Joyce S.; Ruiz‐Velasco, Victor; Kaufman, Marc P.

    2016-01-01

    Key points Mechanical and metabolic stimuli from contracting muscles evoke reflex increases in blood pressure, heart rate and sympathetic nerve activity. Little is known, however, about the nature of the mechano‐gated channels on the thin fibre muscle afferents that contribute to evoke this reflex, termed the exercise pressor reflex.We determined the effect of GsMTx4, an inhibitor of mechano‐gated Piezo channels, on the exercise pressor reflex evoked by intermittent contraction of the triceps surae muscles in decerebrated, unanaesthetized rats.GsMTx4 reduced the pressor, cardioaccelerator and renal sympathetic nerve responses to intermittent contraction but did not reduce the pressor responses to femoral arterial injection of compounds that stimulate the metabolically‐sensitive thin fibre muscle afferents.Expression levels of Piezo2 channels were greater than Piezo1 channels in rat dorsal root ganglia.Our findings suggest that mechanically‐sensitive Piezo proteins contribute to the generation of the mechanical component of the exercise pressor reflex in rats. Abstract Mechanical and metabolic stimuli within contracting skeletal muscles evoke reflex autonomic and cardiovascular adjustments. In cats and rats, gadolinium has been used to investigate the role played by the mechanical component of this reflex, termed the exercise pressor reflex. Gadolinium, however, has poor selectivity for mechano‐gated channels and exerts multiple off‐target effects. We tested the hypothesis that GsMTX4, a more selective mechano‐gated channel inhibitor than gadolinium and a particularly potent inhibitor of mechano‐gated Piezo channels, reduced the exercise pressor reflex in decerebrate rats. Injection of 10 μg of GsMTx4 into the arterial supply of the hindlimb reduced the peak pressor (control: 24  ±  5, GsMTx4: 12 ± 5 mmHg, P decerebrate rats and that the reduction was attributable, at least in part, to its effect on mechano‐gated Piezo channels. PMID

  1. Toll-Like Receptor 7 Agonist GS-9620 Induces HIV Expression and HIV-Specific Immunity in Cells from HIV-Infected Individuals on Suppressive Antiretroviral Therapy.

    Science.gov (United States)

    Tsai, Angela; Irrinki, Alivelu; Kaur, Jasmine; Cihlar, Tomas; Kukolj, George; Sloan, Derek D; Murry, Jeffrey P

    2017-04-15

    Antiretroviral therapy can suppress HIV replication to undetectable levels but does not eliminate latent HIV, thus necessitating lifelong therapy. Recent efforts to target this persistent reservoir have focused on inducing the expression of latent HIV so that infected cells may be recognized and eliminated by the immune system. Toll-like receptor (TLR) activation stimulates antiviral immunity and has been shown to induce HIV from latently infected cells. Activation of TLR7 leads to the production of several stimulatory cytokines, including type I interferons (IFNs). In this study, we show that the selective TLR7 agonist GS-9620 induced HIV in peripheral blood mononuclear cells (PBMCs) from HIV-infected individuals on suppressive antiretroviral therapy. GS-9620 increased extracellular HIV RNA 1.5- to 2-fold through a mechanism that required type I IFN signaling. GS-9620 also activated HIV-specific T cells and enhanced antibody-mediated clearance of HIV-infected cells. Activation by GS-9620 in combination with HIV peptide stimulation increased CD8 T cell degranulation, production of intracellular cytokines, and cytolytic activity. T cell activation was again dependent on type I IFNs produced by plasmacytoid dendritic cells. GS-9620 induced phagocytic cell maturation and improved effector-mediated killing of HIV-infected CD4 T cells by the HIV envelope-specific broadly neutralizing antibody PGT121. Collectively, these data show that GS-9620 can activate HIV production and improve the effector functions that target latently infected cells. GS-9620 may effectively complement orthogonal therapies designed to stimulate antiviral immunity, such as therapeutic vaccines or broadly neutralizing antibodies. Clinical studies are under way to determine if GS-9620 can target HIV reservoirs. IMPORTANCE Though antiretroviral therapies effectively suppress viral replication, they do not eliminate integrated proviral DNA. This stable intermediate of viral infection is persistently

  2. An empirically driven data reduction method on the human 450K methylation array to remove tissue specific non-variable CpGs.

    Science.gov (United States)

    Edgar, Rachel D; Jones, Meaghan J; Robinson, Wendy P; Kobor, Michael S

    2017-01-01

    Population based epigenetic association studies of disease and exposures are becoming more common with the availability of economical genome-wide technologies for interrogation of the methylome, such as the Illumina 450K Human Methylation Array (450K). Often, the expected small number of differentially methylated cytosine-guanine pairs (CpGs) in studies of the human methylome presents a statistical challenge, as the large number of CpGs measured on the 450K necessitates careful multiple test correction. While the 450K is a highly useful tool for population epigenetic studies, many of the CpGs tested are not variable and thus of limited information content in the context of the study and tissue. CpGs with observed lack of variability in the tissue under study could be removed to reduce the data dimensionality, limit the severity of multiple test correction and allow for improved detection of differential DNA methylation. Here, we performed a meta-analysis of 450K data from three commonly studied human tissues, namely blood (605 samples), buccal epithelial cells (121 samples) and placenta (157 samples). We developed lists of CpGs that are non-variable in each tissue. These lists are surprisingly large (blood 114,204 CpGs, buccal epithelial cells 120,009 CpGs and placenta 101,367 CpGs) and thus will be valuable filters for epigenetic association studies, considerably reducing the dimensionality of the 450K and subsequently the multiple testing correction severity. We propose this empirically derived method for data reduction to allow for more power in detecting differential DNA methylation associated with exposures in studies on the human methylome.

  3. A Glycine soja ABA-responsive receptor-like cytoplasmic kinase, GsRLCK, positively controls plant tolerance to salt and drought stresses.

    Science.gov (United States)

    Sun, XiaoLi; Sun, Mingzhe; Luo, Xiao; Ding, XiaoDong; Ji, Wei; Cai, Hua; Bai, Xi; Liu, XiaoFei; Zhu, YanMing

    2013-06-01

    Receptor such as protein kinases are proposed to work as sensors to initiate signaling cascades in higher plants. However, little is known about the precise functions of receptor such as protein kinases in abiotic stress response in plants, especially in wild soybean. Here, we focused on characterization of the biological functions of a receptor-like cytoplasmic serine/threonine protein kinase gene, GsRLCK, which was previously identified as a putative salt-alkali stress-related gene from the transcriptome profiles of Glycine soja. Bioinformatic analysis showed that GsRLCK protein contained a conserved kinase catalytic domain and two transmembrane domains at the N-terminus, but no typical extracellular domain. Consistently, GsRLCK-eGFP fusion protein was observed on the plasma membrane, but eGFP alone was distributing throughout the cytoplasm in onion epidermal cells. Quantitative real-time PCR analysis revealed the induced expression of GsRLCK by ABA, salt, alkali, and drought stresses. However, the expression levels of GsRLCK seemed to be similar in different tissues, except soybean pod. Phenotypic assays demonstrated that GsRLCK overexpression decreased ABA sensitivity and altered expression levels of ABA-responsive genes. Furthermore, we also found that GsRLCK conferred increased tolerance to salt and drought stresses and increased expression levels of a handful of stress-responsive genes, when overexpressing in Arabidopsis. In a word, we gave exact evidence that GsRLCK was a novel receptor-like cytoplasmic protein kinase and played a crucial role in plant responses to ABA, salt, and drought stresses.

  4. GsERF6, an ethylene-responsive factor from Glycine soja, mediates the regulation of plant bicarbonate tolerance in Arabidopsis.

    Science.gov (United States)

    Yu, Yang; Liu, Ailin; Duan, Xiangbo; Wang, Sunting; Sun, Xiaoli; Duanmu, Huizi; Zhu, Dan; Chen, Chao; Cao, Lei; Xiao, Jialei; Li, Qiang; Nisa, Zaib Un; Zhu, Yanming; Ding, Xiaodong

    2016-09-01

    This is an original study focus on ERF gene response to alkaline stress. GsERF6 functions as transcription factor and significantly enhanced plant tolerance to bicarbonate (HCO 3 (-) ) in transgenic Arabidopsis . Alkaline stress is one of the most harmful, but little studied environmental factors, which negatively affects plant growth, development and yield. The cause of alkaline stress is mainly due to the damaging consequence of high concentration of the bicarbonate ion, high-pH, and osmotic shock to plants. The AP2/ERF family genes encode plant-specific transcription factors involved in diverse environmental stresses. However, little is known about their physiological functions, especially in alkaline stress responses. In this study, we functionally characterized a novel ERF subfamily gene, GsERF6 from alkaline-tolerant wild soybean (Glycine soja). In wild soybean, GsERF6 was rapidly induced by NaHCO3 treatment, and its overexpression in Arabidopsis enhanced transgenic plant tolerance to NaHCO3 challenge. Interestingly, GsERF6 transgenic lines also displayed increased tolerance to KHCO3 treatment, but not to high pH stress, implicating that GsERF6 may participate specifically in bicarbonate stress responses. We also found that GsERF6 overexpression up-regulated the transcription levels of bicarbonate-stress-inducible genes such as NADP-ME, H (+)-Ppase and H (+)-ATPase, as well as downstream stress-tolerant genes such as RD29A, COR47 and KINI. GsERF6 overexpression and NaHCO3 stress also altered the expression patterns of plant hormone synthesis and hormone-responsive genes. Conjointly, our results suggested that GsERF6 is a positive regulator of plant alkaline stress by increasing bicarbonate ionic resistance specifically, providing a new insight into the regulation of gene expression under alkaline conditions.

  5. Convergence of major physiological stimuli for renin release on the Gs-alpha/cyclic adenosine monophosphate signaling pathway

    Science.gov (United States)

    Kim, Soo Mi; Briggs, Josephine P.

    2012-01-01

    Control of the renin system by physiological mechanisms such as the baroreceptor or the macula densa (MD) is characterized by asymmetry in that the capacity for renin secretion and expression to increase is much larger than the magnitude of the inhibitory response. The large stimulatory reserve of the renin–angiotensin system may be one of the causes for the remarkable salt-conserving power of the mammalian kidney. Physiological stimulation of renin secretion and expression relies on the activation of regulatory pathways that converge on the cyclic adenosine monophosphate/protein kinase A (cAMP/ PKA) pathway. Mice with selective Gs-alpha (Gsα) deficiency in juxtaglomerular granular cells show a marked reduction of basal renin secretion, and an almost complete unresponsiveness of renin release to furosemide, hydralazine, or isoproterenol. Cyclooxygenase-2 generating prostaglandin E2 (PGE2) and prostacyclin (PGI2) in MD and thick ascending limb cells is one of the main effector systems utilizing Gsα-coupled receptors to stimulate the renin–angiotensin system. In addition, β-adrenergic receptors are critical for the expression of high basal levels of renin and for its release response to lowering blood pressure or MD sodium chloride concentration. Nitric oxide generated by nitric oxide synthases in the MD and in endothelial cells enhances cAMP-dependent signaling by stabilizing cAMP through cyclic guanosine monophosphate-dependent inhibition of phosphodiesterase 3. The stimulation of renin secretion by drugs that inhibit angiotensin II formation or action results from the convergent activation of cAMP probably through indirect augmentation of the activity of PGE2 and PGI2 receptors, β-adrenergic receptors, and nitric oxide. PMID:22124804

  6. Purification of Levan Fructotransferase from Arthvobacter nicotinovoram GS-9 and Production of DFA IV from Levan by the Enzyme.

    Science.gov (United States)

    Saito, K; Goto, H; Yokota, A; Tomita, F

    1997-01-01

    A bacterial strain, GS-9, isolated from soil as a levan-degrading microorganism produced an extracellular enzyme that converted levan into DFA IV. This strain was identified as Arthrobacter nicotinovorvans. The DFA IV-producing enzyme was specifically induced by levan. The enzyme was purified 60-fold from culture supernatant to give a single band on SDS-PAGE. The molecular weight of this enzyme was 52,000 by SDS-PAGE and a monomer by gel filtration. The enzyme gave DFA IV as a main product (> 75%), and fructose, levanbiose, and two unidentified oligosaccharides as minor products, and was identified as a novel levan fructotransferase.

  7. Mūzikas mācību grāmatu saturs 1.-4.klasē (19.gs.2.puse – 20.gs.30.gadi)

    OpenAIRE

    Veisa, Alise

    2011-01-01

    Maģistra darba tēma „Mūzika mācību grāmatu saturs 1.-4.klasē (19.gs.2.puse – 20.gs.30.gadi)” tika izvēlēta ar mērķi izpētīt un salīdzināt minētajā laika posmā izdoto mūzikas mācību grāmatu saturu. Maģistra darba 1.nodaļā raksturota dziedāšanas stunda, tās vieta, nozīme un loma latviešu skolās 19.gadsimta 2.pusē. Apskatīts jautājums kā latviešu tautas dziesma no ģimenes tradīcijām un garīgās dziesmas no baznīcas nonāca skolas solā un mūzikas mācību grāmatā. 2.nodaļa veltīta dziedāšanas...

  8. Modelling LAI at a regional scale with ISBA-A-gs: comparison with satellite-derived LAI over southwestern France

    Directory of Open Access Journals (Sweden)

    A. Brut

    2009-08-01

    Full Text Available A CO2-responsive land surface model (the ISBA-A-gs model of Météo-France is used to simulate photosynthesis and Leaf Area Index (LAI in southwestern France for a 3-year period (2001–2003. A domain of about 170 000 km2 is covered at a spatial resolution of 8 km. The capability of ISBA-A-gs to reproduce the seasonal and the interannual variability of LAI at a regional scale, is assessed with satellite-derived LAI products. One originates from the CYCLOPES programme using SPOT/VEGETATION data, and two products are based on MODIS data. The comparison reveals discrepancies between the satellite LAI estimates and between satellite and simulated LAI values, both in their intensity and in the timing of the leaf onset. The model simulates higher LAI values for the C3 crops than the satellite observations, which may be due to a saturation effect within the satellite signal or to uncertainties in model parameters. The simulated leaf onset presents a significant delay for C3 crops and mountainous grasslands. In-situ observations at a mid-altitude grassland site show that the generic temperature response of photosynthesis used in the model is not appropriate for plants adapted to the cold climatic conditions of the mountainous areas. This study demonstrates the potential of LAI remote sensing products for identifying and locating models' shortcomings at a regional scale.

  9. MBI-GS: APLICAÇÃO E VERIFICAÇÃO PSICOMÉTRICA NA REALIDADE BRASILEIRA

    Directory of Open Access Journals (Sweden)

    Marcelo da Silva Schuster

    2015-03-01

    Full Text Available O presente estudo tem por objetivo verificar a aplicação da escala MBI-GS (Maslach Burnout Inventory e suas três dimensões (exaustão, cinismo e eficácia no trabalho em um hospital público brasileiro com uma população de servidores da área médica e administrativa, caracterizando assim o uso da versão General Survey. A amostra considerada para efeito das análises realizadas foi de 173 profissionais, através da aplicação de questionário estruturado. Os dados foram submetidos a análises quantitativas (análise fatorial exploratória, confiabilidade, teste de correlação e regressão. Os resultados apontam para a aplicabilidade da escala, após procedimentos fatoriais, a escala ficou com 15 variáveis permanecendo com três fatores, apresentando uma confiabilidade de 0,87. A síndrome Burnout correlacionou-se a percepção de Saúde dos trabalhadores, confirmando relação causal na saúde dos trabalhadores. O estudo contribui para o estudo de Burnout no Brasil com a aplicação da MBI-GS de forma inédita em um Hospital Público.

  10. A 4.2 GS/sec. Synchronized Vertical Excitation System for SPS Studies - Steps Toward Wideband Feedback

    Energy Technology Data Exchange (ETDEWEB)

    Fox, John

    2012-07-10

    A 4.2 GS/sec. beam excitation system with accelerator synchronization and power stages is described. The system is capable of playing unique samples (32 samples/bunch) for 15,000 turns on selected bunch(es) in the SPS in syn- chronism with the injection and acceleration cycle. The purpose of the system is to excite internal modes of single-bunch vertical motion, and study the bunch dynamics in the presence of developing Electron cloud or TMCI effects. The system includes a synchronized master oscillator, SPS timing functions, an FPGA based arbitrary waveform generator, 4.2 GS/sec. D/A system and four 80W 20-1000 MHz amplifiers driving a tapered stripline pickup/kicker. A software GUI allows specification of various modulation signals, selection of bunches and turns to excite, while a remote control interface allows simple control/monitoring of the RF power stages located in the tunnel. The successful use of this system for SPS MD measurements in 2011 is a vital proof-of-principle for wideband feedback using similar functions to correct the beam motion.

  11. Effectiveness of Analogs of the GS-Nitroxide, JP4-039, as Total Body Irradiation Mitigators.

    Science.gov (United States)

    Epperly, Michael W; Sacher, Joshua R; Krainz, Tanja; Zhang, Xiaolin; Wipf, Peter; Liang, Mary; Fisher, Renee; Li, Song; Wang, Hong; Greenberger, Joel S

    2017-01-02

    Mitochondrial-targeted gramicidin S (GS)-nitroxide, JP4-039, has been demonstrated to be a potent radiation mitigator, and safe over a wide dose range. In addition, JP4-039 has organ-specific effectiveness when locally applied. We tested the effect of another GS-nitroxide, XJB-5-131, which has more effective mitochondrial localization, and compared these results to those for radiation mitigation against the hematopoietic syndrome, and two analogs of JP4-039, which have the same mitochondrial localization signal, but different chemical payloads: JRS527.084 contains a second nitroxide per molecule, and TK649.030 contains an ester group attached to the nitroxide. The results demonstrate the superiority of JP4-039 as a systemic radiation mitigator. Structure-activity relationships and bioassays demonstrate that JP4-039 is an optimized small-molecule radiation mitigator. Copyright© 2017, International Institute of Anticancer Research (Dr. George J. Delinasios), All rights reserved.

  12. The Populus superoxide dismutase gene family and its responses to drought stress in transgenic poplar overexpressing a pine cytosolic glutamine synthetase (GS1a).

    Science.gov (United States)

    Molina-Rueda, Juan Jesús; Tsai, Chung Jui; Kirby, Edward G

    2013-01-01

    Glutamine synthetase (GS) plays a central role in plant nitrogen assimilation, a process intimately linked to soil water availability. We previously showed that hybrid poplar (Populus tremula X alba, INRA 717-1B4) expressing ectopically a pine cytosolic glutamine synthetase gene (GS1a) display enhanced tolerance to drought. Preliminary transcriptome profiling revealed that during drought, members of the superoxide dismutase (SOD) family were reciprocally regulated in GS poplar when compared with the wild-type control, in all tissues examined. SOD was the only gene family found to exhibit such patterns. In silico analysis of the Populus genome identified 12 SOD genes and two genes encoding copper chaperones for SOD (CCSs). The poplar SODs form three phylogenetic clusters in accordance with their distinct metal co-factor requirements and gene structure. Nearly all poplar SODs and CCSs are present in duplicate derived from whole genome duplication, in sharp contrast to their predominantly single-copy Arabidopsis orthologs. Drought stress triggered plant-wide down-regulation of the plastidic copper SODs (CSDs), with concomitant up-regulation of plastidic iron SODs (FSDs) in GS poplar relative to the wild type; this was confirmed at the activity level. We also found evidence for coordinated down-regulation of other copper proteins, including plastidic CCSs and polyphenol oxidases, in GS poplar under drought conditions. Both gene duplication and expression divergence have contributed to the expansion and transcriptional diversity of the Populus SOD/CCS families. Coordinated down-regulation of major copper proteins in drought-tolerant GS poplars supports the copper cofactor economy model where copper supply is preferentially allocated for plastocyanins to sustain photosynthesis during drought. Our results also extend previous findings on the compensatory regulation between chloroplastic CSDs and FSDs, and suggest that this copper-mediated mechanism represents a common

  13. Structural determinants in the second intracellular loop of the human cannabinoid CB1 receptor mediate selective coupling to Gs and Gi

    Science.gov (United States)

    Chen, XP; Yang, W; Fan, Y; Luo, JS; Hong, K; Wang, Z; Yan, JF; Chen, X; Lu, JX; Benovic, JL; Zhou, NM

    2010-01-01

    BACKGROUND AND PURPOSE The cannabinoid CB1 receptor is primarily thought to be functionally coupled to the Gi form of G proteins, through which it negatively regulates cAMP accumulation. Here, we investigated the dual coupling properties of CB1 receptors and characterized the structural determinants that mediate selective coupling to Gs and Gi. EXPERIMENTAL APPROACH A cAMP-response element reporter gene system was employed to quantitatively analyze cAMP change. CB1/CB2 receptor chimeras and site-directed mutagenesis combined with functional assays and computer modelling were used to determine the structural determinants mediating selective coupling to Gs and Gi. KEY RESULTS CB1 receptors could couple to both Gs-mediated cAMP accumulation and Gi-induced activation of ERK1/2 and Ca2+ mobilization, whereas CB2 receptors selectively coupled to Gi and inhibited cAMP production. Using CB1/CB2 chimeric receptors, the second intracellular loop (ICL2) of the CB1 receptor was identified as primarily responsible for mediating Gs and Gi coupling specificity. Furthermore, mutation of Leu-222 in ICL2 to either Ala or Pro switched G protein coupling from Gs to Gi, while to Ile or Val led to balanced coupling of the mutant receptor with Gs and Gi. CONCLUSIONS AND IMPLICATIONS The ICL2 of CB1 receptors and in particular Leu-222, which resides within a highly conserved DRY(X)5PL motif, played a critical role in Gs and Gi protein coupling and specificity. Our studies provide new insight into the mechanisms governing the coupling of CB1 receptors to G proteins and cannabinoid-induced tolerance. PMID:20735408

  14. A Mutational Analysis of Residues in Cholera Toxin A1 Necessary for Interaction with Its Substrate, the Stimulatory G Protein Gsα

    Directory of Open Access Journals (Sweden)

    Michael G. Jobling

    2015-03-01

    Full Text Available Pathogenesis of cholera diarrhea requires cholera toxin (CT-mediated adenosine diphosphate (ADP-ribosylation of stimulatory G protein (Gsα in enterocytes. CT is an AB5 toxin with an inactive CTA1 domain linked via CTA2 to a pentameric receptor-binding B subunit. Allosterically activated CTA1 fragment in complex with NAD+ and GTP-bound ADP-ribosylation factor 6 (ARF6-GTP differs conformationally from the CTA1 domain in holotoxin. A surface-exposed knob and a short α-helix (formed, respectively, by rearranging “active-site” and “activation” loops in inactive CTA1 and an ADP ribosylating turn-turn (ARTT motif, all located near the CTA1 catalytic site, were evaluated for possible roles in recognizing Gsα. CT variants with one, two or three alanine substitutions at surface-exposed residues within these CTA1 motifs were tested for assembly into holotoxin and ADP-ribosylating activity against Gsα and diethylamino-(benzylidineamino-guanidine (DEABAG, a small substrate predicted to fit into the CTA1 active site. Variants with single alanine substitutions at H55, R67, L71, S78, or D109 had nearly wild-type activity with DEABAG but significantly decreased activity with Gsα, suggesting that the corresponding residues in native CTA1 participate in recognizing Gsα. As several variants with multiple substitutions at these positions retained partial activity against Gsα, other residues in CTA1 likely also participate in recognizing Gsα.

  15. The Populus superoxide dismutase gene family and its responses to drought stress in transgenic poplar overexpressing a pine cytosolic glutamine synthetase (GS1a.

    Directory of Open Access Journals (Sweden)

    Juan Jesús Molina-Rueda

    Full Text Available BACKGROUND: Glutamine synthetase (GS plays a central role in plant nitrogen assimilation, a process intimately linked to soil water availability. We previously showed that hybrid poplar (Populus tremula X alba, INRA 717-1B4 expressing ectopically a pine cytosolic glutamine synthetase gene (GS1a display enhanced tolerance to drought. Preliminary transcriptome profiling revealed that during drought, members of the superoxide dismutase (SOD family were reciprocally regulated in GS poplar when compared with the wild-type control, in all tissues examined. SOD was the only gene family found to exhibit such patterns. RESULTS: In silico analysis of the Populus genome identified 12 SOD genes and two genes encoding copper chaperones for SOD (CCSs. The poplar SODs form three phylogenetic clusters in accordance with their distinct metal co-factor requirements and gene structure. Nearly all poplar SODs and CCSs are present in duplicate derived from whole genome duplication, in sharp contrast to their predominantly single-copy Arabidopsis orthologs. Drought stress triggered plant-wide down-regulation of the plastidic copper SODs (CSDs, with concomitant up-regulation of plastidic iron SODs (FSDs in GS poplar relative to the wild type; this was confirmed at the activity level. We also found evidence for coordinated down-regulation of other copper proteins, including plastidic CCSs and polyphenol oxidases, in GS poplar under drought conditions. CONCLUSIONS: Both gene duplication and expression divergence have contributed to the expansion and transcriptional diversity of the Populus SOD/CCS families. Coordinated down-regulation of major copper proteins in drought-tolerant GS poplars supports the copper cofactor economy model where copper supply is preferentially allocated for plastocyanins to sustain photosynthesis during drought. Our results also extend previous findings on the compensatory regulation between chloroplastic CSDs and FSDs, and suggest that this

  16. Impact of concurrent overexpression of cytosolic glutamine synthetase (GS1) and sucrose phosphate synthase (SPS) on growth and development in transgenic tobacco.

    Science.gov (United States)

    Seger, Mark; Gebril, Sayed; Tabilona, Jules; Peel, Amanda; Sengupta-Gopalan, Champa

    2015-01-01

    The outcome of simultaneously increasing SPS and GS activities in transgenic tobacco, suggests that sucrose is the major determinant of growth and development, and is not affected by changes in N assimilation. Carbon (C) and nitrogen (N) are the major components required for plant growth and the metabolic pathways for C and N assimilation are very closely interlinked. Maintaining an appropriate balance or ratio of sugar to nitrogen metabolites in the cell, is important for the regulation of plant growth and development. To understand how C and N metabolism interact, we manipulated the expression of key genes in C and N metabolism individually and concurrently and checked for the repercussions. Transgenic tobacco plants with a cytosolic soybean glutamine synthetase (GS1) gene and a sucrose phosphate synthase (SPS) gene from maize, both driven by the CaMV 35S promoter were produced. Co-transformants, with both the transgenes were produced by sexual crosses. While GS is the key enzyme in N assimilation, involved in the synthesis of glutamine, SPS plays a key role in C metabolism by catalyzing the synthesis of sucrose. Moreover, to check if nitrate has any role in this interaction, the plants were grown under both low and high nitrogen. The SPS enzyme activity in the SPS and SPS/GS1 co-transformants were the same under both nitrogen regimens. However, the GS activity was lower in the co-transformants compared to the GS1 transformants, specifically under low nitrogen conditions. The GS1/SPS transformants showed a phenotype similar to the SPS transformants, suggesting that sucrose is the major determinant of growth and development in tobacco, and its effect is only marginally affected by increased N assimilation. Sucrose may be functioning in a metabolic capacity or as a signaling molecule.

  17. Enhanced expression of glutamine synthetase (GS1a) confers altered fibre and wood chemistry in field grown hybrid poplar (Populus tremula X alba) (717-1B4).

    Science.gov (United States)

    Coleman, Heather D; Cánovas, Francisco M; Man, Huimin; Kirby, Edward G; Mansfield, Shawn D

    2012-09-01

    Hybrid poplar (Populus tremula X P. alba) genetically engineered to express the pine cytosolic glutamine synthetase gene (GS1a) has been previously shown to display desirable field performance characteristics, including enhancements in growth and nitrogen use efficiency. Analysis of wood samples from a 3-year-old field trial of three independently transformed GS1a transgenic hybrid poplar lines revealed that, when compared with wild-type controls, ectopic expression of GS1a resulted in alterations in wood properties and wood chemistry. Included were significant enhancements in wood fibre length, wood density, microfibre angle, per cent syringyl lignin and elevated concentrations of wood sugars, specifically glucose, galactose, mannose and xylose. Total extractive content and acid-insoluble lignin were significantly reduced in wood of GS1a transgenics when compared with wild-type trees. Together, these cell wall characteristics resulted in improved wood pulping attributes, including improved lignin solubilization with no concurrent decrease in yield. Trees with increased GS1a expression have improved characteristics for pulp and paper production and hold potential as a feedstock for biofuels production. © 2012 The Authors. Plant Biotechnology Journal © 2012 Society for Experimental Biology, Association of Applied Biologists and Blackwell Publishing Ltd.

  18. Enhancement of humoral immunity in mice by coupling pUCpGs10 and aluminium to the HCV recombinant immunogen

    Directory of Open Access Journals (Sweden)

    Zhan Na

    2011-11-01

    Full Text Available Abstract Aim To investigate the enhancement of humoral immunity when CpG ODN (cytidine phosphate guanosine oligodeoxynucleotides and aluminium adjuvants are complexed with the HCV (Hepatitis C virus recombinant immunogen in mice. Methods After immunizing Balb/c mice with the recombination HCV antigen adjuvanted with pUCpGs10 and/or aluminium(antigen+CpG+alum, antigen+CpG, antigen+alum, antigen+PBS, enzyme-linked immunosorbent assay (ELISA was used to measure the specific serum antibody titers of IgG, to determine the neutralization response to various peptide genotypes, and to determine the concentration of IL-6 and IL-10 in supernatants of in vitro cultured splenic lymphocytes. Enzyme-linked immunospot assay (ELISPOT was used to quantify the non-specific and specific splenic antibody-secreting cells (ASCs, and flow cytometry (FCM determined the ratio of different splenic lymphocytes. The serum of rabbits immunized with the recombinant pBVGST/HVR1 antigen immunoprecipitated the HCV isolated from 12 patients' serum. Results The sera antibody titers were 1:51200, 1:9051, 1:18102, 1:6400 respectively after the final immunization and demonstrated good neutralization responses to the six gene peptide containing 1a, 1b, 2a, 3a, 4a and 6a. The aluminum adjuvant increased the population of both specific ASCs (P +CD27+ (P +CD38+ splenic lymphocytes with the aluminum and pUCpGs10 adjuvant present compared to the control group(P Conclusions 1. The aluminum adjuvant induces a potent Th2-biased immune response by increasing both the populations of specific and total ASCs and the ratio of CD19+CD27+ cells. 2. The pUCpGs10 complexed with the aluminum adjuvant boosts the population of plasma cells and increase the efficiency of the immune response. 3. The two adjuvants have synergistic effects on humoral immunity. 4. The recombinant HVR1 protein has the possibility of generating broadly reactive anti-HVR1 antibody.

  19. Incorporation of the C-GOLDSTEIN efficient climate model into the GENIE framework: "eb_go_gs" configurations of GENIE

    Directory of Open Access Journals (Sweden)

    R. Marsh

    2011-11-01

    Full Text Available A computationally efficient, intermediate complexity ocean-atmosphere-sea ice model (C-GOLDSTEIN has been incorporated into the Grid ENabled Integrated Earth system modelling (GENIE framework. This involved decoupling of the three component modules that were re-coupled in a modular way, to allow replacement with alternatives and coupling of further components within the framework. The climate model described here (referred to as "eb_go_gs" for short is the most basic version of GENIE in which atmosphere, ocean and sea ice all play an active role. Among improvements on the original C-GOLDSTEIN model, latitudinal grid resolution is generalized to allow a wider range of surface grids to be used. The ocean, atmosphere and sea-ice components of the "eb_go_gs" configuration of GENIE are individually described, along with details of their coupling. The setup and results from simulations using four different meshes are presented. The four alternative meshes comprise the widely-used 36 × 36 equal-area-partitioning of the Earth surface with 16 depth layers in the ocean, a version in which horizontal and vertical resolution are doubled, a setup matching the horizontal resolution of the dynamic atmospheric component available in the GENIE framework, and a setup with enhanced resolution in high-latitude areas. Results are presented for a spin-up experiment with a baseline parameter set and wind forcing typically used for current studies in which "eb_go_gs" is coupled with the ocean biogeochemistry module of GENIE, as well as for an experiment with a modified parameter set, revised wind forcing, and additional cross-basin transport pathways (Indonesian and Bering Strait throughflows. The latter experiment is repeated with the four mesh variants, with common parameter settings throughout, except for time-step length. Selected state variables and diagnostics are compared in two regards: (i between simulations at lowest resolution that are obtained with the

  20. NuSTAR observations of the black holes GS 1354-645: Evidence of rapid black hole spin

    DEFF Research Database (Denmark)

    El-Batal, A. M.; Miller, J. M.; Reynolds, M. T.

    2016-01-01

    We present the results of a NuSTAR study of the dynamically confirmed stellar-mass black hole GS 1354-645. The source was observed during its 2015 "hard" state outburst; we concentrate on spectra from two relatively bright phases. In the higher-flux observation, the broadband NuSTAR spectra reveal...... a clear, strong disk reflection spectrum, blurred by a degree that requires a black hole spin of a = cf/GM(2) >= 0.98 (1 sigma statistical limits only). The fits also require a high inclination: 0 similar or equal to 75 (2)degrees. Strong "dips" are sometimes observed in the X-ray light curves of sources...... in stellar-mass black holes, and inner accretion flow geometries at moderate accretion rates....

  1. NuSTAR detection of 4s Hard X-ray Lags from the Accreting Pulsar GS 0834-430

    DEFF Research Database (Denmark)

    Bachetti, Matteo; Miyasaka, Hiromasa; Harrison, Fiona

    2014-01-01

    The NuSTAR hard X-ray telescope observed the transient Be/X-ray binary GS 0834􀀀430 during its 2012 outburst. The source is detected between 3 – 79 keV with high statistical significance, and we were able to perform very accurate spectral and timing analysis. The phase-averaged spectrum....... The pulse profile can be modeled with a double Gaussian and shows a strong and smooth hard lag of up to 0.3 cycles in phase, or about 4s between the pulse at ∼ 3 and >∼ 30 keV. This is the first report of such a strong lag in high-mass X-ray binary (HMXB) pulsars. Previously reported lags have been...

  2. 18 wavelengths 83.9Gs/s optical sampling clock for photonic A/D converters.

    Science.gov (United States)

    Wu, Guiling; Li, Siqi; Li, Xinwan; Chen, Jianping

    2010-09-27

    In this paper, a simple approach to generate the time-wavelength interleaved sampling clock for photonic A/D converters is proposed using commercially available mode-locked femtosecond fiber laser and optical wavelength/time division multiplexing (WDM/OTDM) techniques with low cost passive optical components. A time and wavelength mapping module is configured using specially designed wavelength division multiplexer and mechanical tunable fiber stretchers. OTDM modules with low optical insertion loss and flexibly configurable multiple factor are implemented with the fused-biconical optical fiber couplers. Experiment is carried out using 18 WDM channels and 128 times OTDM to demonstrate the generation of 83.9Gs/s time-wavelength interleaved sampling clock.

  3. Error de medición alrededor de los puntos de corte en el MBI-GS

    Directory of Open Access Journals (Sweden)

    Manuel Fernández Arata

    2014-12-01

    Full Text Available Resumen En la calificación de los resultados del MBI-GS (Maslach Burnout Inventory - General Survey como de sus antecesores, se usan interpretaciones dimensionales, pero también puntos de corte para clasificar a los sujetos y diferenciarlos con respecto a la presencia del síndrome de burnout. Sin embargo, este uso está orientado al tipo de tests referidos a criterios, por lo que la estimación de la confiabilidad debe converger con este tipo de uso. El objetivo del presente estudio fue estimar la confiabilidad alrededor de varios puntos de corte en el MBI-GS (agotamiento emocional, eficacia profesional y cinismo, mediante el coeficiente K2 de Livingston. Los participantes fueron 741 sujetos de varias ocupaciones, provenientes de instituciones públicas y privadas de Lima y de otras ciudades. Previo a la obtención de la confiabilidad criterial, se verificó la unidimensionalidad, el modelo equivalente tau, la distribución y la bimodalidad de los puntajes. Se halló que los puntos de corte más extremos muestran mayor confiabilidad; que la confiabilidad se incrementa en relación al grado de extremidad de los puntajes; que el puntaje de agotamiento emocional obtiene mayor confiabilidad criterial y que cinismo obtiene la menor, pero todos los puntajes generalmente muestran buenas confiabilidades. Se discute el uso de los puntos de corte en relación a su validez y confiabilidad. Abstract In the rating of the MBI-GS results (Maslach Burnout Inventory - General Survey as its predecessors, we used dimensional interpretations, but also cut-off points for classifying and differentiating the subjects with respect to the presence of the burnout syndrome. However, this use is oriented to the type of tests relating to criteria so that the estimate of the reliability must converge with this type of use. The objective of this study was to estimate the reliability around various cutting points in the MBI-GS (emotional exhaustion, professional

  4. Near-complete genome sequencing of swine vesicular disease virus using the Roche GS FLX sequencing platform

    DEFF Research Database (Denmark)

    Nielsen, Sandra Cathrine Abel; Bruhn, Christian Anders Wathne; Samaniego Castruita, Jose Alfredo

    2014-01-01

    that is suitable for sequencing the complete protein-encoding sequences of SVDV isolates in which the RNA is relatively intact. The approach couples a single PCR amplification reaction, using only a single PCR primer set to amplify the near-complete SVDV genome, with deep-sequencing using a small fraction...... with significant genetic distances within the same species of viruses. All reference mappings used an iterative method to avoid bias. Further verification was achieved through phylogenetic analysis against published SVDV genomes and additional Enterovirus B sequences. This approach allows high confidence...... of the capacity of a Roche GS FLX sequencing platform. Sequences were initially verified through one of two criteria; either a match between a de novo assembly and a reference mapping, or a match between all of five different reference mappings performed against a fixed set of starting reference genomes...

  5. Structural flexibility of the G alpha s alpha-helical domain in the beta2-adrenoceptor Gs complex

    DEFF Research Database (Denmark)

    Westfield, Gerwin H; Rasmussen, Søren Gøgsig Faarup; Su, Min

    2011-01-01

    The active-state complex between an agonist-bound receptor and a guanine nucleotide-free G protein represents the fundamental signaling assembly for the majority of hormone and neurotransmitter signaling. We applied single-particle electron microscopy (EM) analysis to examine the architecture...... of agonist-occupied β(2)-adrenoceptor (β(2)AR) in complex with the heterotrimeric G protein Gs (Gαsβγ). EM 2D averages and 3D reconstructions of the detergent-solubilized complex reveal an overall architecture that is in very good agreement with the crystal structure of the active-state ternary complex....... Strikingly however, the α-helical domain of Gαs appears highly flexible in the absence of nucleotide. In contrast, the presence of the pyrophosphate mimic foscarnet (phosphonoformate), and also the presence of GDP, favor the stabilization of the α-helical domain on the Ras-like domain of Gαs. Molecular...

  6. The GS Protein-coupled A2a Adenosine Receptor Controls T Cell Help in the Germinal Center.

    Science.gov (United States)

    Abbott, Robert K; Silva, Murillo; Labuda, Jasmine; Thayer, Molly; Cain, Derek W; Philbrook, Phaethon; Sethumadhavan, Shalini; Hatfield, Stephen; Ohta, Akio; Sitkovsky, Michail

    2017-01-27

    T follicular helper (TFH) cells have been shown to be critically required for the germinal center (GC) reaction where B cells undergo class switch recombination and clonal selection to generate high affinity neutralizing antibodies. However, detailed knowledge of the physiological cues within the GC microenvironment that regulate T cell help is limited. The cAMP-elevating, Gs protein-coupled A2a adenosine receptor (A2aR) is an evolutionarily conserved receptor that limits and redirects cellular immunity. However, the role of A2aR in humoral immunity and B cell differentiation is unknown. We hypothesized that the hypoxic microenvironment within the GC facilitates an extracellular adenosine-rich milieu, which serves to limit TFH frequency and function, and also promotes immunosuppressive T follicular regulatory cells (TFR). In support of this hypothesis, we found that following immunization, mice lacking A2aR (A2aRKO) exhibited a significant expansion of T follicular cells, as well as increases in TFH to TFR ratio, GC T cell frequency, GC B cell frequency, and class switching of GC B cells to IgG1. Transfer of CD4 T cells from A2aRKO or wild type donors into T cell-deficient hosts revealed that these increases were largely T cell-intrinsic. Finally, injection of A2aR agonist, CGS21680, following immunization suppressed T follicular differentiation, GC B cell frequency, and class switching of GC B cells to IgG1. Taken together, these observations point to a previously unappreciated role of GS protein-coupled A2aR in regulating humoral immunity, which may be pharmacologically targeted during vaccination or pathological states in which GC-derived autoantibodies contribute to the pathology. © 2017 by The American Society for Biochemistry and Molecular Biology, Inc.

  7. Radiographic findings and Gs-alpha bioactivity studies and mutation screening in acrodysostosis indicate a different etiology from pseudohypoparathyroidism

    Energy Technology Data Exchange (ETDEWEB)

    Graham, J.M. Jr.; Krakow, D.; Smith, A.K.; Lachman, R.S. [UCLA, Los Angeles, CA (United States). School of Medicine; Tolo, V.T. [Div. of Orthopedics, Children' s Hospital of Los Angeles, CA (United States)

    2001-01-01

    Acrodysostosis is an uncommon skeletal dysplasia associated with nasal hypoplasia, midface deficiency, severe brachydactyly, and varying degrees of hearing loss and mental retardation. Previous publications have suggested that it may be difficult to distinguish acrodystostosis from pseudohypoparathyroidism on clinical grounds, but acrodysostosis does appear to have distinct clinical and radiologic findings. Spinal stenosis is an underappreciated risk in acrodysostosis, despite the reported loss of normal caudal widening of the lumbar interpediculate distance on AP spine radiographs in the original report of this disorder by Robinow et al., with confirmation of these radiographic findings by Butler et al. We report two sporadic cases of acrodysostosis, one of which required decompressive laminectomy for symptomatic spinal stenosis, and review 11 cases of acrodysostosis from 9 families that were submitted to the International Skeletal Dysplasia Registry. The objective of this report is to determine the frequency and severity of spinal stenosis in patients with acrodysostosis and to summarize the clinical and radiographic findings of acrodysostosis in an effort to distinguish acrodysostosis clearly from pseudohypoparathyroidism. The pattern of brachydactyly differs between these two conditions, and varying degrees of spinal stenosis are characteristic of acrodysostosis. Both our index patients with acrodysostosis had normal bioactivity of the alpha subunit of the Gs protein, therefore indicating that acrodysostosis has a different pathogenesis from pseudohypoparathyroidism. Furthermore, single-strand confirmational polymorphism (SSCP) analysis failed to demonstrate any confirmational alterations in the coding exons of the Gs alpha gene. These radiographic and laboratory findings substantiate that acrodysostosis is clinically different from pseudohypoparathyroidism and that it is necessary to follow patients with acrodysostosis for signs of spinal stenosis. (orig.)

  8. A cAMP Biosensor-Based High-Throughput Screening Assay for Identification of Gs-Coupled GPCR Ligands and Phosphodiesterase Inhibitors

    DEFF Research Database (Denmark)

    Vedel, Line; Bräuner-Osborne, Hans; Mathiesen, Jesper Mosolff

    2015-01-01

    Cyclic adenosine 3',5'-monophosphate (cAMP) is an important second messenger, and quantification of intracellular cAMP levels is essential in studies of G protein-coupled receptors (GPCRs). The intracellular cAMP levels are regulated by the adenylate cyclase (AC) upon activation of either Gs- or Gi......-coupled GPCRs, which leads to increased or decreased cAMP levels, respectively. Here we describe a real-time Förster resonance energy transfer (FRET)-based cAMP high-throughput screening (HTS) assay for identification and characterization of Gs-coupled GPCR ligands and phosphodiesterase (PDE) inhibitors...... also observed for the other representative Gs-coupled GPCRs tested, GLP-1R and GlucagonR. The FRET-based cAMP biosensor assay is robust, reproducible, and inexpensive with good Z factors and is highly applicable for HTS....

  9. Over-expression of a glutathione S-transferase gene, GsGST, from wild soybean (Glycine soja) enhances drought and salt tolerance in transgenic tobacco.

    Science.gov (United States)

    Ji, Wei; Zhu, Yanming; Li, Yong; Yang, Liang; Zhao, Xiaowen; Cai, Hua; Bai, Xi

    2010-08-01

    Glycine soja is a species of soybean that survives in adverse environments including high salt and drought conditions. We constructed a cDNA library from G. soja seedlings treated with NaCl and isolated a glutathione S-transferase gene (GsGST: GQ265911) from the library. The cDNA encoding GsGST contains an open reading frame of 660 bp and the predicted protein belongs to the tau class of GST family proteins. Tobacco plants over-expressing the GsGST gene showed sixfold higher GST activity than wild-type plants. Transgenic tobacco plants exhibited enhanced dehydration tolerance. T(2) transgenic tobacco plants showed higher tolerance at the seedling stage than wild-type plants to salt and mannitol as demonstrated by longer root length and less growth retardation.

  10. Effects of the overexpression of a soybean cytosolic glutamine synthetase gene (GS15) linked to organ-specific promoters on growth and nitrogen accumulation of pea plants supplied with ammonium.

    Science.gov (United States)

    Fei, Houman; Chaillou, Sylvain; Hirel, Bertrand; Polowick, Patricia; Mahon, John D; Vessey, J Kevin

    2006-10-01

    A soybean cytosolic glutamine synthetase gene (GS15) fused to a constitutive promoter (CaMV 35S), a putative nodule-specific promoter (LBC(3)), or a putative root-specific promoter (rolD) was transformed into Pisum sativum L. cv. Greenfeast. Four lines with single copies (Lines 1, 7, 8 and 9) and four lines with two copies each of GS15 (Lines 2, 4, 6 and 11) were compared to the wild-type (WT) parental line for levels of cytosolic glutamine synthetase (GS1), glutamine synthetase (GS) activity, N accumulation, N derived form the atmosphere (NDFA), and biomass of plants grown on 0.0, 0.1, 1.0 or 10.0 mM NH(4)(+). Enhanced levels of GS1 were detected in leaves of one of the two lines transformed with the 35S-GS15 construct, and all three lines containing the rolD-GS15 construct. All three lines containing the LBC(3)-GS15 construct had increased levels of GS1 in nodules. Despite the increased levels of GS1 in many transformants, only the roots of lines containing the rolD-GS15 construct consistently demonstrated enhanced levels of GS activity (up to 12-fold). Positive responses in plant N content, NDFA, and biomass were rare, but increases in plant biomass and N content of up to 17% and 54%, respectively, occurred in some of the rolD-GS15 lines at certain levels of ammonium. In general, GS15 copy number did not seem to differentially affect phenotype of the transformants, and transformants respond to ammonium concentrations in similar patterns to that previously observed with nitrate. Despite the fact that the rolD-GS15 transformants consistently resulted in increased GS activity in roots and resulted in some occurrences of increases in biomass and plant N content, the lack of consistent positive growth effect across all transformants indicates that the generalized overexpression of GS1 in tissues holds little potential for positive growth responses in pea.

  11. GsSNAP33, a novel Glycine soja SNAP25-type protein gene: Improvement of plant salt and drought tolerances in transgenic Arabidopsis thaliana.

    Science.gov (United States)

    Nisa, Zaib-Un; Mallano, Ali Inayat; Yu, Yang; Chen, Chao; Duan, Xiangbo; Amanullah, Sikandar; Kousar, Abida; Baloch, Abdul Wahid; Sun, Xiaoli; Tabys, Dina; Zhu, Yanming

    2017-10-01

    The N-ethylmaleimide-sensitive factor attachment protein receptor (SNARE) superfamily, specifically the SNAP25-type proteins and t-SNAREs, have been proposed to regulate cellular processes and plant resistance mechanisms. However, little is known about the role of SNAP25-type proteins in combating abiotic stresses, specifically in wild soybean. In the current study, the isolation and functional characterization of the putative synaptosomal-associated SNAP25-type protein gene GsSNAP33 from wild soybean (Glycine soja) were performed. GsSNAP33 has a molecular weight of 33,311 Da and comprises 300 amino acid residues along with Qb-Qc SNARE domains. Multiple sequence alignment revealed the highest similarity of the GsSNAP33 protein to GmSNAP33 (91%), VrSNAP33 (89%), PvSNAP33 (86%) and AtSNAP33 (63%). Phylogenetic studies revealed the abundance of SNAP33 proteins mostly in dicotyledons. Quantitative real-time PCR assays confirmed that GsSNAP33 expression can be induced by salt, alkali, ABA and PEG treatments and that GsSNAP33 is highly expressed in the pods, seeds and roots of Glycine soja. Furthermore, the overexpression of the GsSNAP33 gene in WT Arabidopsis thaliana resulted in increased germination rates, greater root lengths, improved photosynthesis, lower electrolyte leakage, higher biomass production and up-regulated expression levels of various stress-responsive marker genes, including KINI, COR15A, P5Cs, RAB18, RD29A and COR47 in transgenic lines compared with those in WT lines. Subcellular localization studies revealed that the GsSNAP33-eGFP fusion protein was localized to the plasma membrane, while eGFP was distributed throughout whole cytoplasm of onion epidermal cells. Collectively, our findings suggest that GsSNAP33, a novel plasma membrane protein gene of Glycine soja, might be involved in improving plant responses to salt and drought stresses in Arabidopsis. Copyright © 2017. Published by Elsevier Masson SAS.

  12. Rhipicephalus microplus dataset of nonredundant raw sequence reads from 454 GS FLX sequencing of Cot-selected (Cot = 660) genomic DNA

    Science.gov (United States)

    A reassociation kinetics-based approach was used to reduce the complexity of genomic DNA from the Deutsch laboratory strain of the cattle tick, Rhipicephalus microplus, to facilitate genome sequencing. Selected genomic DNA (Cot value = 660) was sequenced using 454 GS FLX technology, resulting in 356...

  13. A Novel T55A Variant of Gsα Associated with Impaired cAMP Production, Bone Fragility, and Osteolysis

    Directory of Open Access Journals (Sweden)

    Kelly Wentworth

    2016-01-01

    Full Text Available G-protein coupled receptors (GPCRs mediate a wide spectrum of biological activities. The GNAS complex locus encodes the stimulatory alpha subunit of the guanine nucleotide binding protein (Gsα and regulates production of the second messenger cyclic AMP (cAMP. Loss-of-function GNAS mutations classically lead to Albright’s Hereditary Osteodystrophy (AHO and pseudohypoparathyroidism, often with significant effects on bone formation and mineral metabolism. We present the case of a child who exhibits clinical features of osteolysis, multiple childhood fractures, and neonatal SIADH. Exome sequencing revealed a novel de novo heterozygous missense mutation of GNAS (c.163AGsα GTPase domain. In order to further assess whether this unique mutation resulted in a gain or loss of function of Gsα, we introduced the mutation into a rat GNAS plasmid and performed functional studies to assess the level of cAMP activity associated with this mutation. We identified a 64% decrease in isoproterenol-induced cAMP production in vitro, compared to wild type, consistent with loss of Gsα activity. Despite a significant decrease in isoproterenol-induced cAMP production in vitro, this mutation did not produce a classical AHO phenotype in our patient; however, it may account for her presentation with childhood fractures and osteolysis.

  14. An Interleaving Track & Hold with 7.6 ENOB @ 1.6 GS/s in 0.12 µm CMOS

    NARCIS (Netherlands)

    Louwsma, S.M.; van Tuijl, Adrianus Johannes Maria; Vertregt, Maarten; Scholtens, Peter C.S.; Nauta, Bram

    A 1.6 GS/s Track and Hold circuit that produces 16 interleaving, 100 MS/s voltage buffered output signals is presented. The achieved SFDR for a 950 MHz full scale input signal is 50 dB. Phase alignment is 0.4 ps RMS and aperture uncertainty is 1 ps RMS. The chip includes two Analog to Digital

  15. Swift, Loiano and LCOGT observations of ASASSN-17gs/AT2017egv (Fermi J1544-0649) - awakening of a dormant high-energy peaked blazar?

    Science.gov (United States)

    Sokolovsky, K.; Cusano, F.; Dominik, M.; Hodgkin, S.; Rybicki, K. A.; Wyrzykowski, L.; Gromadzki, M.; Hamanowicz, A.; Holoien, T. W.-S.; Ciprini, S.; Cheung, C. C.

    2017-08-01

    ASASSN-17gs is an extragalactic transient of uncertain nature detected in GeV gamma rays (Fermi LAT), X-rays (Swift, MAXI) and optical bands (ATel #10482, #10491, #10495) near the center of the galaxy 2MASX J15441967-0649156.

  16. Expression and localization of three G protein alpha subunits, Go, Gq, and Gs, in adult antennae of the silkmoth (Bombyx mori).

    Science.gov (United States)

    Miura, Nami; Atsumi, Shogo; Tabunoki, Hiroko; Sato, Ryoichi

    2005-05-02

    In insect olfactory receptor neurons, rapid and transient increases in inositol triphosphate (IP3) and Ca2+ are detected upon stimulation with pheromone or nonpheromonal odorants. This suggests that heterotrimeric guanine nucleotide binding proteins (G proteins) may transduce some odorant responses in insects. We obtained cDNA clones encoding three classes of G protein alpha subunits, Bm Go, Bm Gq, and Bm Gs, from the antennae of the adult male silkmoth (Bombyx mori). RT-PCR experiments showed that the mRNA of these G protein alpha subunits was also present in the various tissues of adult and larval insects. We used immunocytochemistry to localize these G protein alpha subunits in adult male and female antennae. In the adult male antennae, anti-Go antiserum stained the nerve bundles. In contrast, anti-Gq and anti-Gs antisera stained the inner and outer dendritic segments of the putative olfactory receptor neuron. The localizations of Bm Go, Bm Gq, and Bm Gs in the female antennae were the same as in the male antennae. The localizations of Bm Gq and Bm Gs suggest that each subunit mediates a subset of the odorant response. Copyright 2005 Wiley-Liss, Inc.

  17. A Java and XML Application to Support Numerical Model Development within the Geologic Sequestration Software Suite (GS3)

    Science.gov (United States)

    Williams, M. D.; Wurstner, S. K.; Thorne, P. D.; Freedman, V. L.; Litofsky, A.; Huda, S. A.; Gurumoorthi, V.

    2010-12-01

    A Java and XML based application is currently under development as part of the Geologic Sequestration Software Suite (GS3) to support the generation of input files for multiple subsurface multifluid flow and transport simulators. The application will aid in the translation of conceptual models to a numerical modeling framework, and will provide the capability of generating multi-scale (spatial and temporal) numerical models in support of a variety of collaborative geologic sequestration studies. User specifications for numerical models include grids, geology, boundary and initial conditions, source terms, material properties, geochemical reactions, and geomechanics. Some of these inputs are defined as part of the conceptual model, while others are specified during the numerical model development process. To preserve the distinction between the conceptual model and its translation to a numerical modeling framework, the application manages data associated with each specification independently. This facilitates 1) building multi-scale numerical models from a common conceptual model, 2) building numerical models from multiple conceptual models, 3) building numerical models and input files for different simulators from a common conceptual model, 4) ease in re-generating numerical models in response to revisions of the conceptual model, and 5) revising the numerical model specification during the development process (e.g., grid modifications and resulting re-assignment of material property values and distributions). A key aspect of the model definition software is the ability to define features in the numerical model by specifying them as geometric objects, eliminating the need for the user to specify node/element numbers that often change when the grid is revised. The GS3 platform provides the capability of tracking provenance and dependencies for data files used in the numerical model definition. Within this framework, metadata is generated to support configuration

  18. A novel AP2/ERF family transcription factor from Glycine soja, GsERF71, is a DNA binding protein that positively regulates alkaline stress tolerance in Arabidopsis.

    Science.gov (United States)

    Yu, Yang; Duan, Xiangbo; Ding, Xiaodong; Chen, Chao; Zhu, Dan; Yin, Kuide; Cao, Lei; Song, Xuewei; Zhu, Pinghui; Li, Qiang; Nisa, Zaib Un; Yu, Jiyang; Du, Jianying; Song, Yu; Li, Huiqing; Liu, Beidong; Zhu, Yanming

    2017-07-01

    Here we first found that GsERF71, an ERF factor from wild soybean could increase plant alkaline stress tolerance by up-regulating H+-ATPase and by modifing the accumulation of Auxin. Alkaline soils are widely distributed all over the world and greatly limit plant growth and development. In our previous transcriptome analyses, we have identified several ERF (ethylene-responsive factor) genes that responded strongly to bicarbonate stress in the roots of wild soybean G07256 (Glycine soja). In this study, we cloned and functionally characterized one of the genes, GsERF71. When expressed in epidermal cells of onion, GsERF71 localized to the nucleus. It can activate the reporters in yeast cells, and the C-terminus of 170 amino acids is essential for its transactivation activity. Yeast one-hybrid and EMSA assays indicated that GsERF71 specifically binds to the cis-acting elements of the GCC-box, suggesting that GsERF71 may participate in the regulation of transcription of the relevant biotic and abiotic stress-related genes. Furthermore, transgenic Arabidopsis plants overexpressing GsERF71 showed significantly higher tolerance to bicarbonate stress generated by NaHCO3 or KHCO3 than the wild type (WT) plants, i.e., the transgenic plants had greener leaves, longer roots, higher total chlorophyll contents and lower MDA contents. qRT-PCR and rhizosphere acidification assays indicated that the expression level and activity of H+-ATPase (AHA2) were enhanced in the transgenic plants under alkaline stress. Further analysis indicated that the expression of auxin biosynthetic genes and IAA contents were altered to a lower extent in the roots of transgenic plants than WT plants under alkaline stress in a short-term. Together, our data suggest that GsERF71 enhances the tolerance to alkaline stress by up-regulating the expression levels of H+-ATPase and by modifying auxin accumulation in transgenic plants.

  19. Attenuation of Quorum Sensing Regulated Virulence of Pectobacterium carotovorum subsp. carotovorum through an AHL Lactonase Produced by Lysinibacillus sp. Gs50.

    Directory of Open Access Journals (Sweden)

    Sneha S Garge

    Full Text Available Quorum sensing (QS is a mechanism in which Gram negative bacterial pathogens sense their population density through acyl homoserine lactones (AHLs and regulate the expression of virulence factors. Enzymatic degradation of AHLs by lactonases, known as quorum quenching (QQ, is thus a potential strategy for attenuating QS regulated bacterial infections. We characterised the QQ activity of soil isolate Lysinibacillus sp. Gs50 and explored its potential for controlling bacterial soft rot of crop plants. Lysinibacillus sp. Gs50 inactivated AHL, which could be restored upon acidification, suggested that inactivation was due to the lactone ring hydrolysis of AHL. Heterologous expression of cloned gene for putative hydrolase (792 bp designated adeH from Lysinibacillus sp. Gs50 produced a ~29 kDa protein which degraded AHLs of varying chain length. Mass spectrometry analysis of AdeH enzymatic reaction product revealed that AdeH hydrolyses the lactone ring of AHL and hence is an AHL lactonase. Multiple sequence alignment of the amino acid sequence of AdeH showed that it belongs to the metallo- β- lactamase superfamily, has a conserved "HXHXDH" motif typical of AHL lactonases. KM for AdeH for C6HSL was found to be 3.089 μM and the specific activity was 0.8 picomol min-1μg-1. AdeH has not so far been reported from any Lysinibacillus sp. and has less than 40% identity with known AHL lactonases. Finally we found that Lysinibacillus sp. Gs50 can degrade AHL produced by Pectobacterium carotovorum subsp. carotovorum (Pcc, a common cause of soft rot. This QQ activity causes a decrease in production of plant cell wall degrading enzymes of Pcc and attenuates symptoms of soft rot in experimental infection of potato, carrot and cucumber. Our results demonstrate the potential of Lysinibacillus sp. Gs50 as a preventive and curative biocontrol agent.

  20. An efficient procedure for plant organellar genome assembly, based on whole genome data from the 454 GS FLX sequencing platform

    Directory of Open Access Journals (Sweden)

    Zhang Tongwu

    2011-11-01

    Full Text Available Abstract Motivation Complete organellar genome sequences (chloroplasts and mitochondria provide valuable resources and information for studying plant molecular ecology and evolution. As high-throughput sequencing technology advances, it becomes the norm that a shotgun approach is used to obtain complete genome sequences. Therefore, to assemble organellar sequences from the whole genome, shotgun reads are inevitable. However, associated techniques are often cumbersome, time-consuming, and difficult, because true organellar DNA is difficult to separate efficiently from nuclear copies, which have been transferred to the nucleus through the course of evolution. Results We report a new, rapid procedure for plant chloroplast and mitochondrial genome sequencing and assembly using the Roche/454 GS FLX platform. Plant cells can contain multiple copies of the organellar genomes, and there is a significant correlation between the depth of sequence reads in contigs and the number of copies of the genome. Without isolating organellar DNA from the mixture of nuclear and organellar DNA for sequencing, we retrospectively extracted assembled contigs of either chloroplast or mitochondrial sequences from the whole genome shotgun data. Moreover, the contig connection graph property of Newbler (a platform-specific sequence assembler ensures an efficient final assembly. Using this procedure, we assembled both chloroplast and mitochondrial genomes of a resurrection plant, Boea hygrometrica, with high fidelity. We also present information and a minimal sequence dataset as a reference for the assembly of other plant organellar genomes.

  1. Exploring salivary microbiota in AIDS patients with different periodontal statuses using 454 GS-FLX Titanium pyrosequencing

    Directory of Open Access Journals (Sweden)

    Fang eZhang

    2015-07-01

    Full Text Available Patients with acquired immunodeficiency syndrome (AIDS are at high risk of opportunistic infections. Oral manifestations have been associated with the level of immunosuppression, these include periodontal diseases, and understanding the microbial populations in the oral cavity is crucial for clinical management. The aim of this study was to examine the salivary bacterial diversity in patients newly admitted to the AIDS ward of the Public Health Clinical Center (China. Saliva samples were collected from fifteen patients with AIDS who were randomly recruited between December 2013 and March 2014. Extracted DNA was used as template to amplify bacterial 16S rRNA. Sequencing of the amplicon library was performed using a 454 GS-FLX Titanium sequencing platform. Reads were optimized and clustered into operational taxonomic units for further analysis. A total of 10 bacterial phyla (106 genera were detected. Firmicutes, Bacteroidetes and Proteobacteria were preponderant in the salivary microbiota in AIDS patients. The pathogen, Capnocytophaga sp., and others not considered pathogenic such as Neisseria elongata, Streptococcus mitis and Mycoplasma salivarium but which may be opportunistic infective agents were detected. Dialister pneumosintes, Eubacterium infirmum, Rothia mucilaginosa and Treponema parvum were preponderant in AIDS patients with periodontitis. Patients with necrotic periodontitis had a distinct salivary bacterial profile from those with chronic periodontitis. This is the first study using advanced sequencing techniques focused on hospitalized AIDS patients showing the diversity of their salivary microbiota.

  2. NuSTAR Observations of the Black Hole GS 1354-645: Evidence of Rapid Black Hole Spin

    Science.gov (United States)

    El-Batal, A. M.; Miller, J. M.; Reynolds, M. T.; Boggs, S. E.; Christensen, F. E.; Craig, W. W.; Fuerst, F.; Hailey, C. J.; Harrison, F. A.; Stern, D. K.; hide

    2016-01-01

    We present the results of a NuSTAR study of the dynamically confirmed stellar-mass black hole GS 1354-645. The source was observed during its 2015 "hard" state outburst; we concentrate on spectra from two relatively bright phases. In the higher-flux observation, the broadband NuSTAR spectra reveal a clear, strong disk reflection spectrum, blurred by a degree that requires a black hole spin of a = cJ/ GM(sup 2) > or = 0.98 (1(sigma) statistical limits only). The fits also require a high inclination: theta approx. = 75(2)deg. Strong "dips" are sometimes observed in the X-ray light curves of sources viewed at such an angle; these are absent, perhaps indicating that dips correspond to flared disk structures that only manifest at higher accretion rates. In the lower flux observation, there is evidence of radial truncation of the thin accretion disk. We discuss these results in the context of spin in stellar-mass black holes, and inner accretion flow geometries at moderate accretion rates.

  3. Sociālie mediji kā ilgtspējīgs mārketinga instruments.

    OpenAIRE

    Kudlāne, Maija

    2012-01-01

    Ietekme, kādu sociālie mediji atstāj uz patērētāja ikdienas dzīvi ir neiedomājami liela. Tāpēc sociālo mediju mārketings ir attīstījies kā atsevišķa nozare. Pastāv dažādi viedokļi par to vai sociālo mediju mārketings ir ilgtspējīgs vai tā ir tikai mirkļa tendence. Darba mērķis ir izpētīt sociālo mediju mārketinga īpatnības un pielietojumu atkarībā no mārketinga mērķa, mērķa auditorijas iezīmēm, ekonomiskiem un kultūras faktoriem, kā arī izprast tā nākotnes potenciālu. Darba izpētes pro...

  4. Antibacterial and Cytotoxic Actinomycins Y6-Y9 and Zp from Streptomyces sp. Strain Gö-GS12.

    Science.gov (United States)

    Cai, Wenlong; Wang, Xiachang; Elshahawi, Sherif I; Ponomareva, Larissa V; Liu, Xiaodong; McErlean, Matthew R; Cui, Zheng; Arlinghaus, Ashley L; Thorson, Jon S; Van Lanen, Steven G

    2016-10-28

    Four new Y-type actinomycin analogues named Y6-Y9 (1-4) were isolated and characterized from the scale-up fermentation of the Streptomyces sp. strain Gö-GS12, as well as actinomycin Zp (5), which was, for the first time, isolated as a natural product. Structures of the new compounds were elucidated by the cumulative analyses of NMR spectroscopy and HRMS. The 4-hydroxythreonine on the β-ring of 1 uniquely undergoes both a rearrangement by a 2-fold acyl shift and an additional ring closure with the amino group of the phenoxazinone chromophore, and the α-rings of 4 and 5 contain a rare 5-methyl proline. Compounds 2-5 showed potent antibacterial activities against Gram-positive bacteria that correlated with cytotoxicity against representative human cell lines. The combination of a β-ring rearrangement and additional ring closure in 1 rendered this actinomycin significantly less potent relative to the nonrearranged comparator actinomycin Y5 and other actinomycins.

  5. Brain-Machine Interface to Control a Prosthetic Arm with Monkey ECoGs during Periodic Movements

    Directory of Open Access Journals (Sweden)

    Soichiro eMorishita

    2014-12-01

    Full Text Available Brain Machine Interfaces (BMIs are promising technologies to rehabilitate the function of upper limbs in severely paralyzed patients. We succeeded in developing a BMI prosthetic arm for a monkey implanted with electrocorticogram (ECoG electrodes and trained in a reaching task. It had stability in preventing the misclassification of ECoG patterns. However, the latency was about 200 ms as a trade-off for the stability. To improve the response of this BMI prosthetic arm, the generation of a trigger event by decoding muscle activity was adopted. It was performed to predict integrated electromyograms (iEMGs from the ECoGs. Experiments were conducted to verify the availability of this method, and the results confirmed that the proposed method was superior to the conventional one. In addition, a performance test of the proposed method with actually achieved iEMGs instead of predicted iEMGs was performed, and we found that the motor intention is finely expressed through estimated muscle activity from brain activity rather than actual muscle activity.

  6. Brain-machine interface to control a prosthetic arm with monkey ECoGs during periodic movements.

    Science.gov (United States)

    Morishita, Soichiro; Sato, Keita; Watanabe, Hidenori; Nishimura, Yukio; Isa, Tadashi; Kato, Ryu; Nakamura, Tatsuhiro; Yokoi, Hiroshi

    2014-01-01

    Brain-machine interfaces (BMIs) are promising technologies for rehabilitation of upper limb functions in patients with severe paralysis. We previously developed a BMI prosthetic arm for a monkey implanted with electrocorticography (ECoG) electrodes, and trained it in a reaching task. The stability of the BMI prevented incorrect movements due to misclassification of ECoG patterns. As a trade-off for the stability, however, the latency (the time gap between the monkey's actual motion and the prosthetic arm movement) was about 200 ms. Therefore, in this study, we aimed to improve the response time of the BMI prosthetic arm. We focused on the generation of a trigger event by decoding muscle activity in order to predict integrated electromyograms (iEMGs) from the ECoGs. We verified the achievability of our method by conducting a performance test of the proposed method with actual achieved iEMGs instead of predicted iEMGs. Our results confirmed that the proposed method with predicted iEMGs eliminated the time delay. In addition, we found that motor intention is better reflected by muscle activity estimated from brain activity rather than actual muscle activity. Therefore, we propose that using predicted iEMGs to guide prosthetic arm movement results in minimal delay and excellent performance.

  7. Genetic variation in gsα protein as a new indicator in screening test for vasovagal syncope.

    Science.gov (United States)

    Lelonek, Malgorzata; Zelazowska, Monika; Pietrucha, Tadeusz

    2011-01-01

    A quantitative history using Calgary syncope syndrome score (CSSS) is able to define the likely cause of syncope, but there is still a lack of diagnostic screening tests for vasovagal syncope (VVS). The aim of the present study was to develop a screening test for VVS on the basis of CSSS and the relationship between polymorphic variants of the G-system signaling protein genes and tilting results. From 730 syncopal patients, 307 consecutive subjects without structural and electrical abnormalities were genotyped and examined on blood pressure (BP) and tilt testing. Genotyping was performed using polymerase chain reaction-restriction fragment length polymorphism in genes encoding Gsα-protein GNAS1 (rs7121), G-protein β 3 subunit (rs5443) and the cardiac regulator of G-protein signaling RGS2 (rs4606). The control group consisted of 100 healthy volunteers with a negative history of syncope. From multivariate regression analysis, being a carrier of 393T GNAS1 (odds ratio [OR], 2.29) and systolic BP (OR, 0.98) remained as independent factors associated with positive tilt results. The resultant screening test for VVS consisted of the following: carrier of 393T GNAS1; systolic BP vasovagal patients.

  8. GS-9219/VDC-1101--a prodrug of the acyclic nucleotide PMEG has antitumor activity in spontaneous canine multiple myeloma.

    Science.gov (United States)

    Thamm, Douglas H; Vail, David M; Kurzman, Ilene D; Babusis, Darius; Ray, Adrian S; Sousa-Powers, Noel; Tumas, Daniel B

    2014-01-25

    Multiple myeloma (MM) is an important human and canine cancer for which novel therapies remain necessary. VDC-1101 (formerly GS-9219), a novel double prodrug of the anti-proliferative nucleotide analog 9-(2-phosphonylmethoxyethyl) guanine (PMEG), possesses potent cytotoxic activity in vitro in human lymphoblasts and leukemia cell lines and in vivo in spontaneous canine lymphoma. Given the similarity in lineage between lymphoma and MM, we hypothesized that VDC-1101 would be active against MM. We evaluated the in vitro antiproliferative effects of VDC-1101 against 3 human MM cell lines, and we performed a phase-II clinical trial in 14 dogs with spontaneous MM. Each dog was treated with a maximum of 6 doses of VDC-1101 monotherapy over 10-15 weeks. Dose-dependent antiproliferative activity was observed in all evaluated cell lines. Major antitumor responses (reduction of serum paraprotein and resolution of hypercalcemia, peripheral cytopenias and bone marrow plasmacytosis) were observed in 9 of 11 evaluable dogs for a median of 172 days, including a durable stringent complete response (>1047 days) in a dog with melphalan-refractory disease. 2 dogs were euthanized due to presumed pulmonary fibrosis; there were no other dose-limiting toxicities encountered. In conclusion, VDC-1101 has significant anti-tumor activity at well-tolerated doses in spontaneous canine MM.

  9. Generation of optical OFDM signals using 21.4 GS/s real time digital signal processing.

    Science.gov (United States)

    Benlachtar, Yannis; Watts, Philip M; Bouziane, Rachid; Milder, Peter; Rangaraj, Deepak; Cartolano, Anthony; Koutsoyannis, Robert; Hoe, James C; Püschel, Markus; Glick, Madeleine; Killey, Robert I

    2009-09-28

    We demonstrate a field programmable gate array (FPGA) based optical orthogonal frequency division multiplexing (OFDM) transmitter implementing real time digital signal processing at a sample rate of 21.4 GS/s. The QPSK-OFDM signal is generated using an 8 bit, 128 point inverse fast Fourier transform (IFFT) core, performing one transform per clock cycle at a clock speed of 167.2 MHz and can be deployed with either a direct-detection or a coherent receiver. The hardware design and the main digital signal processing functions are described, and we show that the main performance limitation is due to the low (4-bit) resolution of the digital-to-analog converter (DAC) and the 8-bit resolution of the IFFT core used. We analyze the back-to-back performance of the transmitter generating an 8.36 Gb/s optical single sideband (SSB) OFDM signal using digital up-conversion, suitable for direct-detection. Additionally, we use the device to transmit 8.36 Gb/s SSB OFDM signals over 200 km of uncompensated standard single mode fiber achieving an overall BER<10(-3).

  10. Anti-arrhythmic potential of the late sodium current inhibitor GS-458967 in murine Scn5a-1798insD(+/-) and human SCN5A-1795insD(+/-) iPSC-derived cardiomyocytes

    NARCIS (Netherlands)

    Portero, Vincent; Casini, Simona; Hoekstra, Maaike; Verkerk, Arie O.; Mengarelli, Isabella; Belardinelli, Luiz; Rajamani, Sridharan; Wilde, Arthur A. M.; Bezzina, Connie R.; Veldkamp, Marieke W.; Remme, Carol Ann

    2017-01-01

    Aims Selective inhibition of cardiac late sodium current (I-NaL) is an emerging target in the treatment of ventricular arrhythmias. We investigated the electrophysiological effects of GS-458967 (GS967), a potent, selective inhibitor of I-NaL, in an overlap syndrome model of both gain and loss of

  11. Plutonium(IV) Reduction by the Metal-Reducing Bacteria Geobacter metallireducens GS15 and Shewanella oneidensis MR1▿

    Science.gov (United States)

    Boukhalfa, Hakim; Icopini, Gary A.; Reilly, Sean D.; Neu, Mary P.

    2007-01-01

    The bacterial reduction of actinides has been suggested as a possible remedial strategy for actinide-contaminated environments, and the bacterial reduction of Pu(VI/V) has the potential to produce highly insoluble Pu(IV) solid phases. However, the behavior of plutonium with regard to bacterial reduction is more complex than for other actinides because it is possible for Pu(IV) to be further reduced to Pu(III), which is relatively more soluble than Pu(IV). This work investigates the ability of the metal-reducing bacteria Geobacter metallireducens GS15 and Shewanella oneidensis MR1 to enzymatically reduce freshly precipitated amorphous Pu(IV) (OH)4 [Pu(IV)(OH)4(am)] and soluble Pu(IV)(EDTA). In cell suspensions without added complexing ligands, minor Pu(III) production was observed in cultures containing S. oneidensis, but little or no Pu(III) production was observed in cultures containing G. metallireducens. In the presence of EDTA, most of the Pu(IV)(OH)4(am) present was reduced to Pu(III) and remained soluble in cell suspensions of both S. oneidensis and G. metallireducens. When soluble Pu(IV)(EDTA) was provided as the terminal electron acceptor, cell suspensions of both S. oneidensis and G. metallireducens rapidly reduced Pu(IV)(EDTA) to Pu(III)(EDTA) with nearly complete reduction within 20 to 40 min, depending on the initial concentration. Neither bacterium was able to use Pu(IV) (in any of the forms used) as a terminal electron acceptor to support growth. These results have significant implications for the potential remediation of plutonium and suggest that strongly reducing environments where complexing ligands are present may produce soluble forms of reduced Pu species. PMID:17644643

  12. CANGS: a user-friendly utility for processing and analyzing 454 GS-FLX data in biodiversity studies

    Directory of Open Access Journals (Sweden)

    Schlötterer Christian

    2010-01-01

    Full Text Available Abstract Background Next generation sequencing (NGS technologies have substantially increased the sequence output while the costs were dramatically reduced. In addition to the use in whole genome sequencing, the 454 GS-FLX platform is becoming a widely used tool for biodiversity surveys based on amplicon sequencing. In order to use NGS for biodiversity surveys, software tools are required, which perform quality control, trimming of the sequence reads, removal of PCR primers, and generation of input files for downstream analyses. A user-friendly software utility that carries out these steps is still lacking. Findings We developed CANGS (Cleaning and Analyzing Next Generation Sequences a flexible and user-friendly integrated software utility: CANGS is designed for amplicon based biodiversity surveys using the 454 sequencing platform. CANGS filters low quality sequences, removes PCR primers, filters singletons, identifies barcodes, and generates input files for downstream analyses. The downstream analyses rely either on third party software (e.g.: rarefaction analyses or CANGS-specific scripts. The latter include modules linking 454 sequences with the name of the closest taxonomic reference retrieved from the NCBI database and the sequence divergence between them. Our software can be easily adapted to handle sequencing projects with different amplicon sizes, primer sequences, and quality thresholds, which makes this software especially useful for non-bioinformaticians. Conclusion CANGS performs PCR primer clipping, filtering of low quality sequences, links sequences to NCBI taxonomy and provides input files for common rarefaction analysis software programs. CANGS is written in Perl and runs on Mac OS X/Linux and is available at http://i122server.vu-wien.ac.at/pop/software.html

  13. Statistical method evaluation for differentially methylated CpGs in base resolution next-generation DNA sequencing data.

    Science.gov (United States)

    Zhang, Yun; Baheti, Saurabh; Sun, Zhifu

    2016-12-31

    High-throughput bisulfite methylation sequencing such as reduced representation bisulfite sequencing (RRBS), Agilent SureSelect Human Methyl-Seq (Methyl-seq) or whole-genome bisulfite sequencing is commonly used for base resolution methylome research. These data are represented either by the ratio of methylated cytosine versus total coverage at a CpG site or numbers of methylated and unmethylated cytosines. Multiple statistical methods can be used to detect differentially methylated CpGs (DMCs) between conditions, and these methods are often the base for the next step of differentially methylated region identification. The ratio data have a flexibility of fitting to many linear models, but the raw count data take consideration of coverage information. There is an array of options in each datatype for DMC detection; however, it is not clear which is an optimal statistical method. In this study, we systematically evaluated four statistic methods on methylation ratio data and four methods on count-based data and compared their performances with regard to type I error control, sensitivity and specificity of DMC detection and computational resource demands using real RRBS data along with simulation. Our results show that the ratio-based tests are generally more conservative (less sensitive) than the count-based tests. However, some count-based methods have high false-positive rates and should be avoided. The beta-binomial model gives a good balance between sensitivity and specificity and is preferred method. Selection of methods in different settings, signal versus noise and sample size estimation are also discussed. © The Author 2016. Published by Oxford University Press. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  14. Analysis of volatile organic compounds emitted by plant growth-promoting fungus Phoma sp. GS8-3 for growth promotion effects on tobacco.

    Science.gov (United States)

    Naznin, Hushna Ara; Kimura, Minako; Miyazawa, Mitsuo; Hyakumachi, Mitsuro

    2013-01-01

    We extracted volatile organic compounds (VOCs) emitted by a plant growth-promoting fungus (PGPF) Phoma sp. GS8-3 by gas chromatography and identified them by mass spectrometry. All of the identified compounds belonged to C4-C8 hydrocarbons. Volatiles varied in number and quantity by the culture period of the fungus (in days). 2-Methyl-propanol and 3-methyl-butanol formed the main components of the volatile blends for all the culture periods of fungus. Growth-promoting effects of the identified synthetic compounds were analyzed individually and in blends using tobacco plants. We found that the mixture of volatiles extracted from 3-day-old culture showed significant growth promotion in tobacco in vitro. The volatile blend showed better growth promotion at lower than higher concentrations. Our results confirm the potential role of volatile organic compounds in the mechanism of growth enhancement by GS8-3.

  15. The positive impact of simultaneous implementation of the BD FocalPoint GS Imaging System and lean principles on the operation of gynecologic cytology.

    Science.gov (United States)

    Wong, Rebecca; Levi, Angelique W; Harigopal, Malini; Schofield, Kevin; Chhieng, David C

    2012-02-01

    Our cytology laboratory, like many others, is under pressure to improve quality and provide test results faster while decreasing costs. We sought to address these issues by introducing new technology and lean principles. To determine the combined impact of the FocalPoint Guided Screener (GS) Imaging System (BD Diagnostics-TriPath, Burlington, North Carolina) and lean manufacturing principles on the turnaround time (TAT) and productivity of the gynecologic cytology operation. We established a baseline measure of the TAT for Papanicolaou tests. We then compared that to the performance after implementing the FocalPoint GS Imaging System and lean principles. The latter included value-stream mapping, workflow modification, and a first in-first out policy. The mean (SD) TAT for Papanicolaou tests before and after the implementation of FocalPoint GS Imaging System and lean principles was 4.38 (1.28) days and 3.20 (1.32) days, respectively. This represented a 27% improvement in the average TAT, which was statistically significant (P < .001). In addition, the productivity of staff improved 17%, as evidenced by the increase in slides screened from 8.85/h to 10.38/h. The false-negative fraction decreased from 1.4% to 0.9%, representing a 36% improvement. In our laboratory, the implementation of FocalPoint GS Imaging System in conjunction with lean principles resulted in a significant decrease in the average TAT for Papanicolaou tests and a substantial increase in the productivity of cytotechnologists while maintaining the diagnostic quality of gynecologic cytology.

  16. Reassessment of the four yield-related genes Gn1a, DEP1, GS3 and IPA1 in rice using a CRISPR/Cas9 system

    Directory of Open Access Journals (Sweden)

    Meiru eLi

    2016-03-01

    Full Text Available Clustered Regularly Interspaced Short Palindromic Repeats (CRISPR-associated (Cas systems have been successfully used as efficient tools for genome editing in a variety of species. We used the CRISPR/Cas9 system to mutate the Gn1a (Os01g0197700, DEP1 (Os09g0441900, GS3 (Os03g0407400 and IPA1 (Os08g0509600 genes of rice cultivar Zhonghua 11, genes which have been reported to function as regulators of grain number, panicle architecture, grain size and plant architecture, respectively. Analysis of the phenotypes and frequencies of edited genes in the first generation of transformed plants (T0 showed that the CRISPR/Cas9 system was highly efficient in inducing targeted gene editing, with the desired genes being edited in 42.5% (Gn1a, 67.5% (DEP1, 57.5% (GS3 and 27.5% (IPA1 of the transformed plants. The T2 generation of the gn1a, dep1, and gs3 mutants featured enhanced grain number,dense erect panicles and larger grain size, respectively. Furthermore, semi-dwarf, and grain with long awn, phenotypes were observed in dep1 and gs3 mutants, respectively. The ipa1 mutants showed two contrasting phenotypes, having either fewer tillers or more tillers, depending on the changes induced in the OsmiR156 target region. In addition, we found that mutants with deletions occurred more frequently than previous reports had indicated and that off-targeting had taken place in highly similar target sequences. These results proved that multiple regulators of important traits can be modified in a single cultivar by CRISPR/Cas9, and thus facilitate the dissection of complex gene regulatory networks in the same genomic background and the stacking of important traits in cultivated varieties.

  17. Development and analysis of a mathematical model for antibody-producing GS-NS0 cells under normal and hyperosmotic culture conditions.

    Science.gov (United States)

    Ho, Yingswan; Varley, Julie; Mantalaris, Athanasios

    2006-01-01

    The GS-NS0 cell line is industrially important and is currently used for the large-scale production of several therapeutic monoclonal antibodies. A novel hybrid model, consisting of both unstructured and structured elements, has been developed to describe cell growth and death, metabolism, and antibody production in the GS-NS0 system under normal culture conditions. A comparison between the hybrid model and a large-scale single-cell model (SCM) describing detailed metabolic processes verified the predictive ability of the hybrid model (when compared with experimental data) and highlighted the practical difficulties involved in utilizing complex models. Global sensitivity analysis (GSA) on the hybrid model identified the specific transcription and translation rates of heavy and light immunoglobulin chains as parameters with the largest impact on the antibody production process. This information, together with the addition of a 24-h lag phase, resulted in the successful extension of the hybrid model to represent GS-NS0 system behavior under hyperosmotic culture conditions.

  18. Lysine conjugation properties in human IgGs studied by integrating high-resolution native mass spectrometry and bottom-up proteomics.

    Science.gov (United States)

    Gautier, Violette; Boumeester, Anja J; Lössl, Philip; Heck, Albert J R

    2015-08-01

    Antibody-drug conjugates (ADCs) are a novel class of biopharmaceuticals several of which are now being investigated in clinical studies. In ADCs, potent cytotoxic drugs are coupled via a linker to reactive residues in IgG monoclonal antibodies. Linkage to lysine residues in the IgGs, using N-hydroxysuccinimide ester based chemistry, is one of the possible options. To control drug load and specificity, proper knowledge is required about which lysine residues are most accessible and reactive. Here, we combine native MS and bottom-up proteomics to monitor the overall drug load and site-specific lysine reactivity, using N-hydroxysuccinimide-based tandem mass tags. High-resolution Orbitrap native MS enables us to monitor and quantify, due to the achieved baseline resolution, the sequential incorporation of up to 69 tandem mass tag molecules into human IgGs. Complementary, bottom-up proteomics facilitates the identification of some very reactive "hot-spot" conjugation sites. However, we also identify lysine residues that are highly resistant to chemical labeling. Our integrated approach gives insight into the conjugation properties of IgGs at both the intact protein and residue levels, providing fundamental information for controlling drug load and specificity in lysine-linked ADCs. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  19. The lectin Griffonia simplicifolia I-A4 (GS I-A4) specifically recognizes terminal alpha-linked N-acetylgalactosaminyl groups and is cytotoxic to the human colon cancer cell lines LS174t and SW1116.

    Science.gov (United States)

    Chen, Y F; Boland, C R; Kraus, E R; Goldstein, I J

    1994-05-15

    The lectin GS I-A4 binds to terminal alpha-N-acetylgalactosaminyl (GalNAc) groups (which include the Tn antigen), but not to the closely related tumor-associated epitope, sialylated Tn antigen. The lectin also precipitates asialo OSM, but not its native sialylated form. Lectin histochemistry with human colonic tissues showed that GS I-A4 specifically stained specimens of colon cancer and colonic tissues from individuals with FAP; however, normal colonic tissues from patients without colonic disease were rarely stained with this lectin. Glycoconjugates bound by GS I-A4 were observed on the surface membranes of 2 human colon cancer cell lines, LS174t and SW1116, when fluorescein isothiocyanate (FITC)-conjugated GS I-A4 was used. GS I-A4 was toxic to these 2 human colon cancer cell lines in monolayer culture. A dose-response study conducted using 10-160 micrograms/ml, of GS I-A4 demonstrated significant dose-related toxicity against LS174t and SW1116 cells. At concentrations > 80 micrograms/ml, > 99% of LS174t and > 90% of SW1116 cells were killed. Four mM GalNAc specifically inhibited the cytotoxic effect of GS I-A4 (p < 0.001), whereas 4mM N-acetylglucosamine (GlcNAc) had no effect. Two other lectins that recognize terminal alpha-GalNAc residues, DBA and LBL, were significantly less cytotoxic to the colon cancer cells than GS I-A4. In the light of these findings, we speculate that GS I-A4 may have potential use as a diagnostic agent against colorectal cancer.

  20. Anti-tumor efficacy study of the Bruton's tyrosine kinase (BTK) inhibitor, ONO/GS-4059, in combination with the glycoengineered type II anti-CD20 monoclonal antibody obinutuzumab (GA101) demonstrates superior in vivo efficacy compared to ONO/GS-4059 in combination with rituximab.

    Science.gov (United States)

    Yasuhiro, Tomoko; Sawada, Wako; Klein, Christian; Kozaki, Ryohei; Hotta, Shingo; Yoshizawa, Toshio

    2017-03-01

    The activated B-cell diffuse large B-cell-like lymphoma (ABC-DLBCL) correlates with poor prognosis. The B-cell receptor signaling pathway is known to be dysregulated in NHL/CLL and given BTK is a downstream mediator of BCR signaling, BTK constitutes an interesting and obvious therapeutic target. Given the high potency and selectivity of the BTK inhibitor, ONO/GS-4059, it was hypothesized that, the anti-tumor activity of ONO/GS-4059 could be further enhanced by combining it with the anti-CD20 Abs, rituximab (RTX) or obinutuzumab (GA101). ONO/GS-4059 combined with GA101 or RTX was significantly better than the respective monotherapy with tumor growth inhibition (TGI) of 90% for the GA101 combination and 86% for the RTX combination. In contrast, ibrutinib (PCI-32765) combined with RTX did not result in improved efficacy compared with respective monotherapy. Taken together these data indicate that the combination of ONO/GS-4059 with rituximab and particularly obinutuzumab may be an effective treatment for ABC-DLBCL.

  1. INTERACCIÓN DE LA GLUTAMINA SINTETASA (GS Y EL PÉPTIDO β -AMILOIDE COMO UNA ESTRATEGIA DE PURIFICACIÓN

    Directory of Open Access Journals (Sweden)

    Sonia Luz Albarracín

    2013-08-01

    Full Text Available La enfermedad de Alzheimer (EA esla forma de demencia más común en laedad adulta. Se manifiesta con la pérdidaprogresiva de la memoria a medida quelas neuronas en la corteza cerebral y elhipocampo mueren. En todas las formasde EA se evidencia aumento de la expresiónde diferentes proteínas, así comola presencia de agregados insolubles depéptido-β-amiloide (PBA. La glutaminasintetasa (GS es una enzima clave en elmetabolismo del glutamato y en la detoxificaciónde amonio (NH4+. Previamentese ha reportado una posible interacciónGS-PBA que puede estar asociada conEA. En este trabajo se realizó la purificaciónde la enzima cerebral de rata a partirde un extracto sometido a precipitaciónfraccionada con (NH42SO4 del 20-60 %de saturación y posteriormente a travésde cromatografías sucesivas de filtraciónen gel, intercambio iónico y afinidad. Elpeso molecular del complejo fue calculadoen 137 kDa por el orden de eluciónen la columna de filtración. Se identificóinteracción de la enzima con PBA1-40, lográndose la purificación de unasola banda de 45 kDa, correspondiente ala forma monomérica de la GS. En estetrabajo se presenta un nuevo método depurificación de la enzima y se demuestrala interacción de GS con el PBA. Se proponeque esta interacción GS-PBA puedeser uno de los procesos que se presentanen la enfermedad al explicar la reducciónde la actividad de la enzima en pacientes con EA, ya que podría alterar el cicloglutamato-glutamina y generar cambiosen el entorno celular que favorecen excitotoxicidadpor glutamato típica de losprocesos de neurodegeneración.

  2. Anti-EBOV GP IgGs Lacking α1-3-Galactose and Neu5Gc Prolong Survival and Decrease Blood Viral Load in EBOV-Infected Guinea Pigs.

    Directory of Open Access Journals (Sweden)

    Olivier Reynard

    Full Text Available Polyclonal xenogenic IgGs, although having been used in the prevention and cure of severe infectious diseases, are highly immunogenic, which may restrict their usage in new applications such as Ebola hemorrhagic fever. IgG glycans display powerful xenogeneic antigens in humans, for example α1-3 Galactose and the glycolyl form of neuraminic acid Neu5Gc, and IgGs deprived of these key sugar epitopes may represent an advantage for passive immunotherapy. In this paper, we explored whether low immunogenicity IgGs had a protective effect on a guinea pig model of Ebola virus (EBOV infection. For this purpose, a double knock-out pig lacking α1-3 Galactose and Neu5Gc was immunized against virus-like particles displaying surface EBOV glycoprotein GP. Following purification from serum, hyper-immune polyclonal IgGs were obtained, exhibiting an anti-EBOV GP titer of 1:100,000 and a virus neutralizing titer of 1:100. Guinea pigs were injected intramuscularly with purified IgGs on day 0 and day 3 post-EBOV infection. Compared to control animals treated with IgGs from non-immunized double KO pigs, the anti-EBOV IgGs-treated animals exhibited a significantly prolonged survival and a decreased virus load in blood on day 3. The data obtained indicated that IgGs lacking α1-3 Galactose and Neu5Gc, two highly immunogenic epitopes in humans, have a protective effect upon EBOV infection.

  3. Anti-EBOV GP IgGs Lacking α1-3-Galactose and Neu5Gc Prolong Survival and Decrease Blood Viral Load in EBOV-Infected Guinea Pigs.

    Science.gov (United States)

    Reynard, Olivier; Jacquot, Frédéric; Evanno, Gwénaëlle; Mai, Hoa Le; Salama, Apolline; Martinet, Bernard; Duvaux, Odile; Bach, Jean-Marie; Conchon, Sophie; Judor, Jean-Paul; Perota, Andrea; Lagutina, Irina; Duchi, Roberto; Lazzari, Giovanna; Le Berre, Ludmilla; Perreault, Hélène; Lheriteau, Elsa; Raoul, Hervé; Volchkov, Viktor; Galli, Cesare; Soulillou, Jean-Paul

    2016-01-01

    Polyclonal xenogenic IgGs, although having been used in the prevention and cure of severe infectious diseases, are highly immunogenic, which may restrict their usage in new applications such as Ebola hemorrhagic fever. IgG glycans display powerful xenogeneic antigens in humans, for example α1-3 Galactose and the glycolyl form of neuraminic acid Neu5Gc, and IgGs deprived of these key sugar epitopes may represent an advantage for passive immunotherapy. In this paper, we explored whether low immunogenicity IgGs had a protective effect on a guinea pig model of Ebola virus (EBOV) infection. For this purpose, a double knock-out pig lacking α1-3 Galactose and Neu5Gc was immunized against virus-like particles displaying surface EBOV glycoprotein GP. Following purification from serum, hyper-immune polyclonal IgGs were obtained, exhibiting an anti-EBOV GP titer of 1:100,000 and a virus neutralizing titer of 1:100. Guinea pigs were injected intramuscularly with purified IgGs on day 0 and day 3 post-EBOV infection. Compared to control animals treated with IgGs from non-immunized double KO pigs, the anti-EBOV IgGs-treated animals exhibited a significantly prolonged survival and a decreased virus load in blood on day 3. The data obtained indicated that IgGs lacking α1-3 Galactose and Neu5Gc, two highly immunogenic epitopes in humans, have a protective effect upon EBOV infection.

  4. Cross-linking of IgGs bound on circulating neutrophils leads to an activation of endothelial cells: possible role of rheumatoid factors in rheumatoid arthritis-associated vascular dysfunction

    OpenAIRE

    Rollet-Labelle, Emmanuelle; Vaillancourt, Myriam; Marois, Louis; Newkirk, Marianna M; Poubelle, Patrice E; Naccache, Paul H

    2013-01-01

    Background Rheumatoid arthritis is characterized by the presence of circulating auto-antibodies, including rheumatoid factors, which recognize the Fc portion of IgGs. The neutrophil is the most abundant circulating leukocyte and it expresses high levels of Fc?Rs on its surface. The aim of the present study was to examine the capacity of circulating human neutrophils to be activated by rheumatoid factors and the consequences of these events on endothelium. Methods Neutrophil-bound IgGs were cr...

  5. Receptor activity-modifying protein dependent and independent activation mechanisms in the coupling of calcitonin gene-related peptide and adrenomedullin receptors to Gs.

    Science.gov (United States)

    Woolley, Michael J; Reynolds, Christopher A; Simms, John; Walker, Christopher S; Mobarec, Juan Carlos; Garelja, Michael L; Conner, Alex C; Poyner, David R; Hay, Debbie L

    2017-10-15

    Calcitonin gene-related peptide (CGRP) or adrenomedullin (AM) receptors are heteromers of the calcitonin receptor-like receptor (CLR), a class B G protein-coupled receptor, and one of three receptor activity-modifying proteins (RAMPs). How CGRP and AM activate CLR and how this process is modulated by RAMPs is unclear. We have defined how CGRP and AM induce Gs-coupling in CLR-RAMP heteromers by measuring the effect of targeted mutagenesis in the CLR transmembrane domain on cAMP production, modeling the active state conformations of CGRP and AM receptors in complex with the Gs C-terminus and conducting molecular dynamics simulations in an explicitly hydrated lipidic bilayer. The largest effects on receptor signaling were seen with H295A5.40b, I298A5.43b, L302A5.47b, N305A5.50b, L345A6.49b and E348A6.52b, F349A6.53b and H374A7.47b (class B numbering in superscript). Many of these residues are likely to form part of a group in close proximity to the peptide binding site and link to a network of hydrophilic and hydrophobic residues, which undergo rearrangements to facilitate Gs binding. Residues closer to the extracellular loops displayed more pronounced RAMP or ligand-dependent effects. Mutation of H3747.47b to alanine increased AM potency 100-fold in the CGRP receptor. The molecular dynamics simulation showed that TM5 and TM6 pivoted around TM3. The data suggest that hydrophobic interactions are more important for CLR activation than other class B GPCRs, providing new insights into the mechanisms of activation of this class of receptor. Furthermore the data may aid in the understanding of how RAMPs modulate the signaling of other class B GPCRs. Copyright © 2017 The Authors. Published by Elsevier Inc. All rights reserved.

  6. Changes in El Niño - Southern Oscillation (ENSO) conditions during the Greenland Stadial 1 (GS-1) chronozone revealed by New Zealand tree-rings

    Science.gov (United States)

    Palmer, Jonathan G.; Turney, Chris S. M.; Cook, Edward R.; Fenwick, Pavla; Thomas, Zoë; Helle, Gerhard; Jones, Richard; Clement, Amy; Hogg, Alan; Southon, John; Bronk Ramsey, Christopher; Staff, Richard; Muscheler, Raimund; Corrège, Thierry; Hua, Quan

    2016-12-01

    The warming trend at the end of the last glacial was disrupted by rapid cooling clearly identified in Greenland (Greenland Stadial 1 or GS-1) and Europe (Younger Dryas Stadial or YD). This reversal to glacial-like conditions is one of the best known examples of abrupt change but the exact timing and global spatial extent remain uncertain. Whilst the wider Atlantic region has a network of high-resolution proxy records spanning GS-1, the Pacific Ocean suffers from a scarcity of sub-decadally resolved sequences. Here we report the results from an investigation into a tree-ring chronology from northern New Zealand aimed at addressing the paucity of data. The conifer tree species kauri (Agathis australis) is known from contemporary studies to be sensitive to regional climate changes. An analysis of a 'historic' 452-year kauri chronology confirms a tropical-Pacific teleconnection via the El Niño - Southern Oscillation (ENSO). We then focus our study on a 1010-year sub-fossil kauri chronology that has been precisely dated by comprehensive radiocarbon dating and contains a striking ring-width downturn between ∼12,500 and 12,380 cal BP within GS-1. Wavelet analysis shows a marked increase in ENSO-like periodicities occurring after the downturn event. Comparison to low- and mid-latitude Pacific records suggests a coherency with ENSO and Southern Hemisphere atmospheric circulation change during this period. The driver(s) for this climate event remain unclear but may be related to solar changes that subsequently led to establishment and/or increased expression of ENSO across the mid-latitudes of the Pacific, seemingly independent of the Atlantic and polar regions.

  7. Induction of systemic resistance in Arabidopsis thaliana in response to a culture filtrate from a plant growth-promoting fungus, Phoma sp. GS8-3.

    Science.gov (United States)

    Sultana, F; Hossain, Md M; Kubota, M; Hyakumachi, M

    2009-01-01

    The plant growth-promoting fungus (PGPF), Phoma sp. GS8-3, isolated from a zoysia grass rhizosphere, is capable of protecting cucumber plants against virulent pathogens. This fungus was investigated in terms of the underlying mechanisms and ability to elicit systemic resistance in Arabidopsis thaliana. Root treatment of Arabidopsis plants with a culture filtrate (CF) from Phoma sp. GS8-3 elicited systemic resistance against the bacterial speck pathogen Pseudomonas syringae pv. tomato DC3000 (Pst), with restricted disease development and inhibited pathogen proliferation. Pathway-specific mutant plants, such as jar1 (jasmonic acid insensitive) and ein2 (ethylene insensitive), and transgenic NahG plants (impaired in salicylate signalling) were protected after application of the CF, demonstrating that these pathways are dispensable (at least individually) in CF-mediated resistance. Similarly, NPR1 interference in npr1 mutants had no effect on CF-induced resistance. Gene expression studies revealed that CF treatment stimulated the systemic expression of both the SA-inducible PR-1 and JA/ET-inducible PDF1.2 genes. However, pathogenic challenge to CF-treated plants was associated with potentiated expression of the PR-1 gene and down-regulated expression of the PDF1.2 gene. The observed down-regulation of the PDF1.2 gene in CF-treated plants indicates that there may be cross-talk between SA- and JA/ET-dependent signalling pathways during the pathogenic infection process. In conclusion, our data suggest that CF of Phoma sp. GS8-3 induces resistance in Arabidopsis in a manner where SA and JA/ET may play a role in defence signalling.

  8. GsAPK, an ABA-activated and calcium-independent SnRK2-type kinase from G. soja, mediates the regulation of plant tolerance to salinity and ABA stress.

    Science.gov (United States)

    Yang, Liang; Ji, Wei; Gao, Peng; Li, Yong; Cai, Hua; Bai, Xi; Chen, Qin; Zhu, Yanming

    2012-01-01

    Plant Snf1 (sucrose non-fermenting-1) related protein kinase (SnRK), a subfamily of serine/threonine kinases, has been implicated as a crucial upstream regulator of ABA and osmotic signaling as in many other signaling cascades. In this paper, we have isolated a novel plant specific ABA activated calcium independent protein kinase (GsAPK) from a highly salt tolerant plant, Glycine soja (50109), which is a member of the SnRK2 family. Subcellular localization studies using GFP fusion protein indicated that GsAPK is localized in the plasma membrane. We found that autophosphorylation and Myelin Basis Protein phosphorylation activity of GsAPK is only activated by ABA and the kinase activity also was observed when calcium was replaced by EGTA, suggesting its independence of calcium in enzyme activity. We also found that cold, salinity, drought, and ABA stress alter GsAPK gene transcripts and heterogonous overexpression of GsAPK in Arabidopsis alters plant tolerance to high salinity and ABA stress. In summary, we demonstrated that GsAPK is a Glycine soja ABA activated calcium independent SnRK-type kinase presumably involved in ABA mediated stress signal transduction.

  9. GsAPK, an ABA-activated and calcium-independent SnRK2-type kinase from G. soja, mediates the regulation of plant tolerance to salinity and ABA stress.

    Directory of Open Access Journals (Sweden)

    Liang Yang

    Full Text Available Plant Snf1 (sucrose non-fermenting-1 related protein kinase (SnRK, a subfamily of serine/threonine kinases, has been implicated as a crucial upstream regulator of ABA and osmotic signaling as in many other signaling cascades. In this paper, we have isolated a novel plant specific ABA activated calcium independent protein kinase (GsAPK from a highly salt tolerant plant, Glycine soja (50109, which is a member of the SnRK2 family. Subcellular localization studies using GFP fusion protein indicated that GsAPK is localized in the plasma membrane. We found that autophosphorylation and Myelin Basis Protein phosphorylation activity of GsAPK is only activated by ABA and the kinase activity also was observed when calcium was replaced by EGTA, suggesting its independence of calcium in enzyme activity. We also found that cold, salinity, drought, and ABA stress alter GsAPK gene transcripts and heterogonous overexpression of GsAPK in Arabidopsis alters plant tolerance to high salinity and ABA stress. In summary, we demonstrated that GsAPK is a Glycine soja ABA activated calcium independent SnRK-type kinase presumably involved in ABA mediated stress signal transduction.

  10. Low-power 6-bit 1-GS/s two-channel pipeline ADC with open-loop amplification using amplifiers with local-feedback

    OpenAIRE

    Goes, J.; Paulino, N.; Galhardo, A.

    2008-01-01

    IEEE International Symposium on Circuits and Systems, pp. 2258 – 2261, Seattle, EUA A low-power 1.2 V 6-bit 1-GS/s time-interleaved pipeline ADC designed in 130 nm CMOS is described. It is based on a new 2-channel 1.5-bit MDAC that performs openloop residue amplification using a shared amplifier employing local-feedback. Time mismatches between channels are highly attenuated, simply by using two passive front-end Sample-and-Hold circuits, with dedicated switch-linearization control circ...

  11. Insight into partial agonism by observing multiple equilibria for ligand-bound and Gs-mimetic nanobody-bound β1-adrenergic receptor.

    Science.gov (United States)

    Solt, Andras S; Bostock, Mark J; Shrestha, Binesh; Kumar, Prashant; Warne, Tony; Tate, Christopher G; Nietlispach, Daniel

    2017-11-27

    A complex conformational energy landscape determines G-protein-coupled receptor (GPCR) signalling via intracellular binding partners (IBPs), e.g., Gs and β-arrestin. Using 13C methyl methionine NMR for the β1-adrenergic receptor, we identify ligand efficacy-dependent equilibria between an inactive and pre-active state and, in complex with Gs-mimetic nanobody, between more and less active ternary complexes. Formation of a basal activity complex through ligand-free nanobody-receptor interaction reveals structural differences on the cytoplasmic receptor side compared to the full agonist-bound nanobody-coupled form, suggesting that ligand-induced variations in G-protein interaction underpin partial agonism. Significant differences in receptor dynamics are observed ranging from rigid nanobody-coupled states to extensive μs-to-ms timescale dynamics when bound to a full agonist. We suggest that the mobility of the full agonist-bound form primes the GPCR to couple to IBPs. On formation of the ternary complex, ligand efficacy determines the quality of the interaction between the rigidified receptor and an IBP and consequently the signalling level.

  12. PERCEPÇÕES DE SAÚDE E A SÍNDROME DE BURNOUT – APLICABILIDADE DA MBI-GS.

    Directory of Open Access Journals (Sweden)

    Marcelo da Silva Schuster

    2016-01-01

    Full Text Available O objetivo deste estudo é verificar a aplicabilidade da MBI-GS e analisar a existência da relação entre a percepção de saúde dos colaboradores e a síndrome de Burnout. A MBI-GS demonstrou-se aplicável, os níveis de Burnout encontrados foram moderados, porém apresentando colaboradores nos três níveis de Burnout, alertando para a necessidade de uma intervenção por parte da instituição para prevenir os desencadeadores dessa síndrome. O estudo contribui para os estudos de Burnout, confirmando a relação inversa entre a síndrome e a percepção de saúde, e comprova estatisticamente que esta síndrome é uma das causas da diminuição nas percepções de saúde.

  13. A 4 GS/s 4 bit ADC with 3.8 GHz analog bandwidth in GaAs HBT technology

    Science.gov (United States)

    Danyu, Wu; Lei, Zhou; Jiannan, Guo; Xinyu, Liu; Zhi, Jin; Jianwu, Chen

    2011-06-01

    An ultra-wideband 4 GS/s 4 bit analog-to-digital converter (ADC) which is fabricated in 2-level interconnect, 1.4 μm InGaP/GaAs HBT technology is presented. The ADC has a -3 dB analog bandwidth of 3.8 GHz and an effective resolution bandwidth (ERBW) of 2.6 GHz. The ADC adopts folding-interpolating architecture to minimize its size and complexity. A novel bit synchronization circuit is used in the coarse quantizer to eliminate the glitch codes of the ADC. The measurement results show that the chip achieves larger than 3.4 ENOBs with an input frequency band of DC-2.6 GHz and larger than 3.0 ENOBs within DC-4 GHz at 4 GS/s. It has 3.49 ENOBs when increasing input power by 4 dB at 6.001 GHz of input. That indicates that the ADC has the ability of sampling signals from 1st to 3rd Nyquist zones (DC-6 GHz). The measured DNL and INL are both less than ±0.15 LSB. The ADC consumes power of 1.98 Wand occupies a total area of 1.45 × 1.45 mm2.

  14. Sandwich-type electrochemical immunosensor for the detection of AFP based on Pd octahedral and APTES-M-CeO₂-GS as signal labels.

    Science.gov (United States)

    Wei, Yicheng; Li, Yan; Li, Na; Zhang, Yong; Yan, Tao; Ma, Hongmin; Wei, Qin

    2016-05-15

    In the present work, an ultrasensitive sandwich-type electrochemical immunosensor based on a novel signal amplification strategy was designed for quantitative detection of alpha fetoprotein (AFP). Au nanoparticles with biocompatibility were electrodeposited on the surface of glassy carbon electrode (GCE) which can effectively capture and immobilize primary anti-AFP (Ab1) to significantly amplify the electrochemical signal. Graphene Oxide and CeO2 mesoporous nanocomposite functionalized by the 3-aminopropyltriethoxysilane supported Pd octahedral nanoparticles (Pd/APTES-M-CeO2-GS) were utilized as labels of detection anti-AFP (Ab2). Pd octahedral nanoparticles presented good catalytic activity towards the reduction of H2O2. Due to the large specific surface area and good adsorption properties of APTES-CeO2-GS nanocomposite, large amount of Pd octahedral nanoparticles could be immobilized, which could amplify the electrochemical signal and improve the sensitivity of the immunosensor. Under optimal conditions, the immunosensor exhibited wide linear range from 0.1 pg/mL to 50 ng/mL with a low detection limit of 0.033 pg/mL (S/N=3) for AFP detection. In addition, high sensitivity, excellent selectivity, good reproducibility and stability were obtained for the immunosensor, which has a promising application for quantitative detection of other tumor markers in clinical diagnosis. Copyright © 2015 Elsevier B.V. All rights reserved.

  15. Genome sequencing of Giardia lamblia genotypes A2 and B isolates (DH and GS) and comparative analysis with the genomes of genotypes A1 and E (WB and Pig).

    Science.gov (United States)

    Adam, Rodney D; Dahlstrom, Eric W; Martens, Craig A; Bruno, Daniel P; Barbian, Kent D; Ricklefs, Stacy M; Hernandez, Matthew M; Narla, Nirmala P; Patel, Rima B; Porcella, Stephen F; Nash, Theodore E

    2013-01-01

    Giardia lamblia (syn G. intestinalis, G. duodenalis) is the most common pathogenic intestinal parasite of humans worldwide and is a frequent cause of endemic and epidemic diarrhea. G. lamblia is divided into eight genotypes (A-H) which infect a wide range of mammals and humans, but human infections are caused by Genotypes A and B. To unambiguously determine the relationship among genotypes, we sequenced GS and DH (Genotypes B and A2) to high depth coverage and compared the assemblies with the nearly completed WB genome and draft sequencing surveys of Genotypes E (P15; pig isolate) and B (GS; human isolate). Our results identified DH as the smallest Giardia genome sequenced to date, while GS is the largest. Our open reading frame analyses and phylogenetic analyses showed that GS was more distant from the other three genomes than any of the other three were from each other. Whole-genome comparisons of DH_A2 and GS_B with the optically mapped WB_A1 demonstrated substantial synteny across all five chromosomes but also included a number of rearrangements, inversions, and chromosomal translocations that were more common toward the chromosome ends. However, the WB_A1/GS_B alignment demonstrated only about 70% sequence identity across the syntenic regions. Our findings add to information presented in previous reports suggesting that GS is a different species of Giardia as supported by the degree of genomic diversity, coding capacity, heterozygosity, phylogenetic distance, and known biological differences from WB_A1 and other G. lamblia genotypes.

  16. Genome Sequencing of Giardia lamblia Genotypes A2 and B Isolates (DH and GS) and Comparative Analysis with the Genomes of Genotypes A1 and E (WB and Pig)

    Science.gov (United States)

    Adam, Rodney D.; Dahlstrom, Eric W.; Martens, Craig A.; Bruno, Daniel P.; Barbian, Kent D.; Ricklefs, Stacy M.; Hernandez, Matthew M.; Narla, Nirmala P.; Patel, Rima B.; Porcella, Stephen F.; Nash, Theodore E.

    2013-01-01

    Giardia lamblia (syn G. intestinalis, G. duodenalis) is the most common pathogenic intestinal parasite of humans worldwide and is a frequent cause of endemic and epidemic diarrhea. G. lamblia is divided into eight genotypes (A–H) which infect a wide range of mammals and humans, but human infections are caused by Genotypes A and B. To unambiguously determine the relationship among genotypes, we sequenced GS and DH (Genotypes B and A2) to high depth coverage and compared the assemblies with the nearly completed WB genome and draft sequencing surveys of Genotypes E (P15; pig isolate) and B (GS; human isolate). Our results identified DH as the smallest Giardia genome sequenced to date, while GS is the largest. Our open reading frame analyses and phylogenetic analyses showed that GS was more distant from the other three genomes than any of the other three were from each other. Whole-genome comparisons of DH_A2 and GS_B with the optically mapped WB_A1 demonstrated substantial synteny across all five chromosomes but also included a number of rearrangements, inversions, and chromosomal translocations that were more common toward the chromosome ends. However, the WB_A1/GS_B alignment demonstrated only about 70% sequence identity across the syntenic regions. Our findings add to information presented in previous reports suggesting that GS is a different species of Giardia as supported by the degree of genomic diversity, coding capacity, heterozygosity, phylogenetic distance, and known biological differences from WB_A1 and other G. lamblia genotypes. PMID:24307482

  17. Virus-induced gene-silencing in wheat spikes and grains and its application in functional analysis of HMW-GS-encoding genes

    Directory of Open Access Journals (Sweden)

    Ma Meng

    2012-08-01

    Full Text Available Abstract Background The Barley stripe mosaic virus (BSMV-based vector has been developed and used for gene silencing in barley and wheat seedlings to assess gene functions in pathogen- or insect-resistance, but conditions for gene silencing in spikes and grains have not been evaluated. In this study, we explored the feasibility of using BSMV for gene silencing in wheat spikes or grains. Results Apparent photobleaching on the spikes infected with BSMV:PDS at heading stage was observed after13 days post inoculation (dpi, and persisted until 30dpi, while the spikes inoculated with BSMV:00 remained green during the same period. Grains of BSMV:PDS infected spikes also exhibited photobleaching. Molecular analysis indicated that photobleached spikes or grains resulted from the reduction of endogenous PDS transcript abundances, suggesting that BSMV:PDS was able to induce PDS silencing in wheat spikes and grains. Inoculation onto wheat spikes from heading to flowering stage was optimal for efficient silencing of PDS in wheat spikes. Furthermore, we used the BSMV-based system to reduce the transcript level of 1Bx14, a gene encoding for High-molecular-weight glutenin subunit 1Bx14 (HMW-GS 1Bx14, by 97 % in the grains of the BSMV:1Bx14 infected spikes at 15dpi, compared with that in BSMV:00 infected spikes, and the reduction persisted until at least 25 dpi. The amount of the HMW-GS 1Bx14 was also detectably decreased. The percentage of glutenin macropolymeric proteins in total proteins was significantly reduced in the grains of 1Bx14-silenced plants as compared with that in the grains of BSMV:00 infected control plants, indicating that HMW-GS 1Bx14 is one of major components participating in the formation of glutenin macropolymers in wheat grains. Conclusion This is one of the first reports of successful application of BSMV-based virus-induced-gene-silencing (VIGS for gene knockdown in wheat spikes and grains and its application in functional analysis of

  18. Epidemiology and Heritability of Major Depressive Disorder, Stratified by Age of Onset, Sex, and Illness Course in Generation Scotland: Scottish Family Health Study (GS:SFHS.

    Directory of Open Access Journals (Sweden)

    Ana Maria Fernandez-Pujals

    Full Text Available The heritability of Major Depressive Disorder (MDD has been estimated at 37% based largely on twin studies that rely on contested assumptions. More recently, the heritability of MDD has been estimated on large populations from registries such as the Swedish, Finnish, and Chinese cohorts. Family-based designs utilise a number of different relationships and provide an alternative means of estimating heritability. Generation Scotland: Scottish Family Health Study (GS:SFHS is a large (n = 20,198, family-based population study designed to identify the genetic determinants of common diseases, including Major Depressive Disorder. Two thousand seven hundred and six individuals were SCID diagnosed with MDD, 13.5% of the cohort, from which we inferred a population prevalence of 12.2% (95% credible interval: 11.4% to 13.1%. Increased risk of MDD was associated with being female, unemployed due to a disability, current smokers, former drinkers, and living in areas of greater social deprivation. The heritability of MDD in GS:SFHS was between 28% and 44%, estimated from a pedigree model. The genetic correlation of MDD between sexes, age of onset, and illness course were examined and showed strong genetic correlations. The genetic correlation between males and females with MDD was 0.75 (0.43 to 0.99; between earlier (≤ age 40 and later (> age 40 onset was 0.85 (0.66 to 0.98; and between single and recurrent episodic illness course was 0.87 (0.72 to 0.98. We found that the heritability of recurrent MDD illness course was significantly greater than the heritability of single MDD illness course. The study confirms a moderate genetic contribution to depression, with a small contribution of the common family environment (variance proportion = 0.07, CI: 0.01 to 0.15, and supports the relationship of MDD with previously identified risk factors. This study did not find robust support for genetic differences in MDD due to sex, age of onset, or illness course. However

  19. Effects of HMW-GS Ax1 or Dx2 absence on the glutenin polymerization and gluten micro structure of wheat (Triticum aestivum L.).

    Science.gov (United States)

    Gao, Xin; Liu, Tianhong; Ding, Mengyun; Wang, Jun; Li, Chunlian; Wang, Zhonghua; Li, Xuejun

    2018-02-01

    Wheat (Triticum aestivum L.) dough strength and extensibility are mainly determined by the polymerization of glutenin. The number of high-molecular-weight glutenin subunits (HMW-GS) differs in various wheat varieties due to the silencing of some genes. The effects of Ax1 or Dx2 subunit absence on glutenin polymerization, dough mixing properties and gluten micro structure were investigated with two groups of near-isogenic lines. The results showed that Ax1 or Dx2 absence decreased the accumulation rate of glutenin polymers and thus delayed the rapid increase period for glutenin polymerization by at least ten days, which led to lower percentage of polymeric protein in mature grain. Ax1 or Dx2 absence significantly decreased the dough development time and dough stability, but increased the uniformity of micro structure. Lacunarity, derived from quantitative analysis of gluten network, is suggested as a new indicator for wheat quality. Copyright © 2017 Elsevier Ltd. All rights reserved.

  20. Discovery of Dihydrobenzoxazepinone (GS-6615) Late Sodium Current Inhibitor (Late INai), a Phase II Agent with Demonstrated Preclinical Anti-Ischemic and Antiarrhythmic Properties.

    Science.gov (United States)

    Zablocki, Jeff A; Elzein, Elfatih; Li, Xiaofen; Koltun, Dmitry O; Parkhill, Eric Q; Kobayashi, Tetsuya; Martinez, Ruben; Corkey, Britton; Jiang, Haibo; Perry, Thao; Kalla, Rao; Notte, Gregory T; Saunders, Oliver; Graupe, Michael; Lu, Yafan; Venkataramani, Chandru; Guerrero, Juan; Perry, Jason; Osier, Mark; Strickley, Robert; Liu, Gongxin; Wang, Wei-Qun; Hu, Lufei; Li, Xiao-Jun; El-Bizri, Nesrine; Hirakawa, Ryoko; Kahlig, Kris; Xie, Cheng; Li, Cindy Hong; Dhalla, Arvinder K; Rajamani, Sridharan; Mollova, Nevena; Soohoo, Daniel; Lepist, Eve-Irene; Murray, Bernard; Rhodes, Gerry; Belardinelli, Luiz; Desai, Manoj C

    2016-10-03

    Late sodium current (late INa) is enhanced during ischemia by reactive oxygen species (ROS) modifying the Nav 1.5 channel, resulting in incomplete inactivation. Compound 4 (GS-6615, eleclazine) a novel, potent, and selective inhibitor of late INa, is currently in clinical development for treatment of long QT-3 syndrome (LQT-3), hypertrophic cardiomyopathy (HCM), and ventricular tachycardia-ventricular fibrillation (VT-VF). We will describe structure-activity relationship (SAR) leading to the discovery of 4 that is vastly improved from the first generation late INa inhibitor 1 (ranolazine). Compound 4 was 42 times more potent than 1 in reducing ischemic burden in vivo (S-T segment elevation, 15 min left anteriorior descending, LAD, occlusion in rabbits) with EC50 values of 190 and 8000 nM, respectively. Compound 4 represents a new class of potent late INa inhibitors that will be useful in delineating the role of inhibitors of this current in the treatment of patients.

  1. Wind Speed and Sea State Dependencies of Air-Sea Gas Transfer: Results From the High Wind Speed Gas Exchange Study (HiWinGS)

    Science.gov (United States)

    Blomquist, B. W.; Brumer, S. E.; Fairall, C. W.; Huebert, B. J.; Zappa, C. J.; Brooks, I. M.; Yang, M.; Bariteau, L.; Prytherch, J.; Hare, J. E.; Czerski, H.; Matei, A.; Pascal, R. W.

    2017-10-01

    A variety of physical mechanisms are jointly responsible for facilitating air-sea gas transfer through turbulent processes at the atmosphere-ocean interface. The nature and relative importance of these mechanisms evolves with increasing wind speed. Theoretical and modeling approaches are advancing, but the limited quantity of observational data at high wind speeds hinders the assessment of these efforts. The HiWinGS project successfully measured gas transfer coefficients (k660) with coincident wave statistics under conditions with hourly mean wind speeds up to 24 m s-1 and significant wave heights to 8 m. Measurements of k660 for carbon dioxide (CO2) and dimethylsulfide (DMS) show an increasing trend with respect to 10 m neutral wind speed (U10N), following a power law relationship of the form: k660 CO2˜U10N1.68 and k660 dms˜U10N1.33. Among seven high wind speed events, CO2 transfer responded to the intensity of wave breaking, which depended on both wind speed and sea state in a complex manner, with k660 CO2 increasing as the wind sea approaches full development. A similar response is not observed for DMS. These results confirm the importance of breaking waves and bubble injection mechanisms in facilitating CO2 transfer. A modified version of the Coupled Ocean-Atmosphere Response Experiment Gas transfer algorithm (COAREG ver. 3.5), incorporating a sea state-dependent calculation of bubble-mediated transfer, successfully reproduces the mean trend in observed k660 with wind speed for both gases. Significant suppression of gas transfer by large waves was not observed during HiWinGS, in contrast to results from two prior field programs.

  2. The Police Chief N.A. Ridinger of the City of Kaluga and the Decembrist G.S. Batenkov: Unknown Letter

    Directory of Open Access Journals (Sweden)

    Tropin Nikolay Aleksandrovich

    2015-06-01

    Full Text Available The letter of 1860 by the police chief N.A. Ridinger to the decembrist G.S. Batenkov has been published for the first time in the present article. The letter reflects their friendly relations, and the text of the letter lets suggest the influence of G.S. Batenkov on the development of N.A. Ridinger as a researcher of history and statistics in the Kaluga and Orel provinces. In 1859 N.A. Ridinger publishes five articles about the activities of police and firefighters in “Kaluga province news”. It was his first experience in the sphere of journalism. The peculiarities of N.A. Ridinger journalistic style: didactic tone, frequent phrases about the usefulness of the published information, awkward literary style. Nikolay Ridinger was a nobleman (1825-1894. His ancestors were in the military service of the Russian emperors. Grandfather Karl Ridinger was governor of the city of Vyborg in 1797-1799. Father Alexander Ridinger distinguished himself in the wars against Napoleon, and received the rank of Major General. Nikolay Ridinger continued the family tradition and became an officer. He fought in the Caucasus in 1853-1854 as commander of a company of infantry soldiers. He was wounded twice and awarded with the Order. Since 1857, Nikolay Ridinger became chief of police in the city of Kaluga. There he met Gavrila Batenkov. Gavrila Batenkov came from the nobility (1793-1863. He was an active participant in the uprising of nobles – the Decembrists in Saint Petersburg (1825. After the defeat of the uprising he was in the prison fortress and he was exiled to Siberia. Batenkov was pardoned in 1856 and came to live in the city of Kaluga. N. Ridinger perceived G. Batenkov as a father. In August 1859 he started his service as a police chief in the city of Orel. On December 12, 1860 N. Ridinger wrote a letter to G. Batenkov.

  3. Spearfishing regulation benefits artisanal fisheries: the ReGS indicator and its application to a multiple-use Mediterranean marine protected area.

    Directory of Open Access Journals (Sweden)

    Delphine Rocklin

    Full Text Available The development of fishing efficiency coupled with an increase of fishing effort led to the overexploitation of numerous natural marine resources. In addition to this commercial pressure, the impact of recreational activities on fish assemblages remains barely known. Here we examined the impact of spearfishing limitation on resources in a marine protected area (MPA and the benefit it provides for the local artisanal fishery through the use of a novel indicator. We analysed trends in the fish assemblage composition using artisanal fisheries data collected in the Bonifacio Strait Natural Reserve (BSNR, a Mediterranean MPA where the spearfishing activity has been forbidden over 15% of its area. Fish species were pooled into three response groups according to their target level by spearfishing. We developed the new flexible ReGS indicator reflecting shifts in species assemblages according to the relative abundance of each response group facing external pressure. The catch per unit effort (CPUE increased by ca. 60% in the BSNR between 2000 and 2007, while the MPA was established in 1999. The gain of CPUE strongly depended on the considered response group: for the highly targeted group, the CPUE doubled while the CPUE of the untargeted group increased by only 15.5%. The ReGS value significantly increased from 0.31 to 0.45 (on a scale between 0 and 1 in the general perimeter of this MPA while it has reached a threshold of 0.43, considered as a reference point, in the area protected from spearfishing since 1982. Our results demonstrated that limiting recreational fishing by appropriate zoning in multiple-use MPAs represents a real benefit for artisanal fisheries. More generally we showed how our new indicator may reveal a wide range of impacts on coastal ecosystems such as global change or habitat degradation.

  4. A Large Inversion Involving GNAS Exon A/B and All Exons Encoding Gsα Is Associated With Autosomal Dominant Pseudohypoparathyroidism Type Ib (PHP1B).

    Science.gov (United States)

    Grigelioniene, Giedre; Nevalainen, Pasi I; Reyes, Monica; Thiele, Susanne; Tafaj, Olta; Molinaro, Angelo; Takatani, Rieko; Ala-Houhala, Marja; Nilsson, Daniel; Eisfeldt, Jesper; Lindstrand, Anna; Kottler, Marie-Laure; Mäkitie, Outi; Jüppner, Harald

    2017-04-01

    Pseudohypoparathyroidism type Ib (PHP1B) is characterized primarily by resistance to parathyroid hormone (PTH) and thus hypocalcemia and hyperphosphatemia, in most cases without evidence for Albright hereditary osteodystrophy (AHO). PHP1B is associated with epigenetic changes at one or several differentially-methylated regions (DMRs) within GNAS, which encodes the α-subunit of the stimulatory G protein (Gsα) and splice variants thereof. Heterozygous, maternally inherited STX16 or GNAS deletions leading to isolated loss-of-methylation (LOM) at exon A/B alone or at all maternal DMRs are the cause of autosomal dominant PHP1B (AD-PHP1B). In this study, we analyzed three affected individuals, the female proband and her two sons. All three revealed isolated LOM at GNAS exon A/B, whereas the proband's healthy maternal grandmother and uncle showed normal methylation at this locus. Haplotype analysis was consistent with linkage to the STX16/GNAS region, yet no deletion could be identified. Whole-genome sequencing of one of the patients revealed a large heterozygous inversion (1,882,433 bp). The centromeric breakpoint of the inversion is located 7,225 bp downstream of GNAS exon XL, but its DMR showed no methylation abnormality, raising the possibility that the inversion disrupts a regulatory element required only for establishing or maintaining exon A/B methylation. Because our three patients presented phenotypes consistent with PHP1B, and not with PHP1A, the Gsα promoter is probably unaffected by the inversion. Our findings expand the spectrum of genetic mutations that lead to LOM at exon A/B alone and thus biallelic expression of the transcript derived from this alternative first GNAS exon. © 2017 American Society for Bone and Mineral Research. © 2017 American Society for Bone and Mineral Research.

  5. Hypoxia activates a Ca2+-permeable cation conductance sensitive to carbon monoxide and to GsMTx-4 in human and mouse sickle erythrocytes.

    Directory of Open Access Journals (Sweden)

    David H Vandorpe

    2010-01-01

    Full Text Available Deoxygenation of sickle erythrocytes activates a cation permeability of unknown molecular identity (Psickle, leading to elevated intracellular [Ca(2+] ([Ca(2+](i and subsequent activation of K(Ca 3.1. The resulting erythrocyte volume decrease elevates intracellular hemoglobin S (HbSS concentration, accelerates deoxygenation-induced HbSS polymerization, and increases the likelihood of cell sickling. Deoxygenation-induced currents sharing some properties of Psickle have been recorded from sickle erythrocytes in whole cell configuration.We now show by cell-attached and nystatin-permeabilized patch clamp recording from sickle erythrocytes of mouse and human that deoxygenation reversibly activates a Ca(2+- and cation-permeable conductance sensitive to inhibition by Grammastola spatulata mechanotoxin-4 (GsMTx-4; 1 microM, dipyridamole (100 microM, DIDS (100 microM, and carbon monoxide (25 ppm pretreatment. Deoxygenation also elevates sickle erythrocyte [Ca(2+](i, in a manner similarly inhibited by GsMTx-4 and by carbon monoxide. Normal human and mouse erythrocytes do not exhibit these responses to deoxygenation. Deoxygenation-induced elevation of [Ca(2+](i in mouse sickle erythrocytes did not require KCa3.1 activity.The electrophysiological and fluorimetric data provide compelling evidence in sickle erythrocytes of mouse and human for a deoxygenation-induced, reversible, Ca(2+-permeable cation conductance blocked by inhibition of HbSS polymerization and by an inhibitor of strctch-activated cation channels. This cation permeability pathway is likely an important source of intracellular Ca(2+ for pathologic activation of KCa3.1 in sickle erythrocytes. Blockade of this pathway represents a novel therapeutic approach for treatment of sickle disease.

  6. Reseña: Abal Oliú, Alejandro: C.G.P. y conciliación previa en materia laboral, Editorial Universidad Ltda. Montevideo, 1992, 64 págs.

    Directory of Open Access Journals (Sweden)

    o. C. R.

    2015-10-01

    Full Text Available Abal Oliú, Alejandro: C.G.P. y conciliación previa en materia laboral, Editorial Universidad Ltda. Montevideo, 1992, 64 págs. Editorial Universidad Ltda. Montevideo, 1992, 64 págs.El autor, profesor de Derecho Procesal y de Técnica Forense en nuestra Facultad, analiza en la presente obra las distintas fórmulas que es posible estab~ecer en cuanto a la tentativa de conciliación previa a la iniciación de los procesos laborales, luego de la entrada en vigencia del Código General del Proceso. (...

  7. Structural requirements for the flavonoid-mediated modulation of glutathione S-transferase P1-1 and GS-X pump activity in MCF7 breast cancer cells

    NARCIS (Netherlands)

    Zanden, J.J. van; Geraets, L.; Wortelboer, H.M.; Bladeren, P.J. van; Rietjens, I.M.C.M.; Cnubben, N.H.P.

    2004-01-01

    The objective of this study was to investigate the structural requirements necessary for inhibition of glutathione S-transferase P1-1 (GSTP1-1) and GS-X pump (MRP1 and MRP2) activity by structurally related flavonoids, in GSTP1-1 transfected MCF7 cells (pMTG5). The results reveal that GSTP1-1

  8. Cross-linking of IgGs bound on circulating neutrophils leads to an activation of endothelial cells: possible role of rheumatoid factors in rheumatoid arthritis-associated vascular dysfunction.

    Science.gov (United States)

    Rollet-Labelle, Emmanuelle; Vaillancourt, Myriam; Marois, Louis; Newkirk, Marianna M; Poubelle, Patrice E; Naccache, Paul H

    2013-07-31

    Rheumatoid arthritis is characterized by the presence of circulating auto-antibodies, including rheumatoid factors, which recognize the Fc portion of IgGs. The neutrophil is the most abundant circulating leukocyte and it expresses high levels of FcγRs on its surface. The aim of the present study was to examine the capacity of circulating human neutrophils to be activated by rheumatoid factors and the consequences of these events on endothelium. Neutrophil-bound IgGs were cross-linked with anti-human IgGs to mimick the presence of circulating rheumatoid factors and FcγRs-dependent signalling events and functions were examined. The IgG and IgM composition of rheumatoid factors isolated from the serum of RA patients was characterized. Adhesion of neutrophils to endothelial cells was quantified in response to the addition of rheumatoid factors. Cross-linking of IgGs bound on neutrophils leads to FcγRs-dependent tyrosine phosphorylation, mobilisation of intracellular calcium and the extracellular release of superoxide anions and lysozyme. Incubation of endothelial cells with the supernatant of activated neutrophils increases ICAM-1 expression and IL-8 production by endothelial cells. Finally, rheumatoid factors enhance neutrophil adhesion to endothelial cells. Our results show that activation of neutrophils' FcγRs by rheumatoid factors could participate in rheumatoid arthritis-associated vascular damage.

  9. Serrano Cañadas, Enrique: Islas de hielo. Naturaleza, presencia humana y paisaje en las Islas Shetland del Sur, Antártida. Valladolid, Universidad de Valladolid, Secretariado de Publicaciones e Intercambio Editorial, 2008, 248 págs.

    Directory of Open Access Journals (Sweden)

    Jesús Ruiz-Fernández

    2017-06-01

    Full Text Available Reseña de: Serrano Cañadas, Enrique: Islas de hielo. Naturaleza, presencia humana y paisaje en las Islas Shetland del Sur, Antártida. Valladolid, Universidad de Valladolid, Secretariado de Publicaciones e Intercambio Editorial, 2008, 248 págs.

  10. Isolectins I-A and I-B of Griffonia (Bandeiraea) simplicifolia. Crystal structure of metal-free GS I-B(4) and molecular basis for metal binding and monosaccharide specificity.

    Science.gov (United States)

    Lescar, Julien; Loris, Remy; Mitchell, Edward; Gautier, Catherine; Chazalet, Valérie; Cox, Veronica; Wyns, Lode; Pérez, Serge; Breton, Christelle; Imberty, Anne

    2002-02-22

    Seeds from the African legume shrub Griffonia simplicifolia contain several lectins. Among them the tetrameric lectin GS I-B(4) has strict specificity for terminal alpha Gal residues, whereas the closely related lectin GS I-A(4) can also bind to alpha GalNAc. These two lectins are commonly used as markers in histology or for research in xenotransplantation. To elucidate the basis for the fine difference in specificity, the amino acid sequences of both lectins have been determined and show 89% identity. The crystal structure of GS I-B(4), determined at 2.5-A resolution, reveals a new quaternary structure that has never been observed in other legume lectins. An unexpected loss of both Ca(2+) and Mn(2+) ions, which are necessary for carbohydrate binding in legume lectins, may be related to a particular amino acid sequence Pro-Glu-Pro in the metal binding loop. Comparison with demetallized concanavalin A reveals a different process for the loss of metal ions and for the subsequent loss of carbohydrate binding activity. The GS I-A x alpha GalNAc and GS I-B x alpha Gal complexes were constructed using homology modeling and docking approaches. The unusual presence of an aromatic amino acid at position 47 (Tyr in I-A and Trp in I-B) explains the strong preference for alpha-anomeric sugars in both isolectins. Alteration at one amino acid position, Ala(106) in I-A versus Glu(106) in I-B, is the basis for the observed specificities toward alpha GalNAc and alpha Gal.

  11. Osteoblast-specific expression of the fibrous dysplasia (FD)-causing mutation Gsα(R201C) produces a high bone mass phenotype but does not reproduce FD in the mouse.

    Science.gov (United States)

    Remoli, Cristina; Michienzi, Stefano; Sacchetti, Benedetto; Consiglio, Alberto Di; Cersosimo, Stefania; Spica, Emanuela; Robey, Pamela G; Holmbeck, Kenn; Cumano, Ana; Boyde, Alan; Davis, Graham; Saggio, Isabella; Riminucci, Mara; Bianco, Paolo

    2015-06-01

    We recently reported the generation and initial characterization of the first direct model of human fibrous dysplasia (FD; OMIM #174800), obtained through the constitutive systemic expression of one of the disease-causing mutations, Gsα(R201C) , in the mouse. To define the specific pathogenetic role(s) of individual cell types within the stromal/osteogenic system in FD, we generated mice expressing Gsα(R201C) selectively in mature osteoblasts using the 2.3kb Col1a1 promoter. We show here that this results in a striking high bone mass phenotype but not in a mimicry of human FD. The high bone mass phenotype involves specifically a deforming excess of cortical bone and prolonged and ectopic cortical bone remodeling. Expression of genes characteristic of late stages of bone cell differentiation/maturation is profoundly altered as a result of expression of Gsα(R201C) in osteoblasts, and expression of the Wnt inhibitor Sost is reduced. Although high bone mass is, in fact, a feature of some types/stages of FD lesions in humans, it is marrow fibrosis, localized loss of adipocytes and hematopoietic tissue, osteomalacia, and osteolytic changes that together represent the characteristic pathological profile of FD, as well as the sources of specific morbidity. None of these features are reproduced in mice with osteoblast-specific expression of Gsα(R201C) . We further show that hematopoietic progenitor/stem cells, as well as more mature cell compartments, and adipocyte development are normal in these mice. These data demonstrate that effects of Gsα mutations underpinning FD-defining tissue changes and morbidity do not reflect the effects of the mutations on osteoblasts proper. © 2014 American Society for Bone and Mineral Research.

  12. Warm isostatic pressing (WIP'ing) of GS44 Si{sub 3}N{sub 4} FDC parts for defect removal

    Energy Technology Data Exchange (ETDEWEB)

    Wu Suxing; Rangarajan, Sriram; Dai Cheng; McCuiston, Ryan; Langrana, Noshir A.; Safari, Ahmad; Danforth, Stephen C.; Clancy, Richard B.; Whalen, Philip J

    2003-12-15

    Fused deposition of ceramics (FDC) is one of the developing solid freeform fabrication (SFF) techniques. The successful production of high performance ceramics by the FDC process requires that no defects exist in the green parts. However, build defects, such as missing roads, poorly bonded layers or sub-perimeter voids can be encountered in improperly built FDC parts. In this study, a method known as WIP'ing (warm isostatic pressing) was evaluated for its ability to eliminate existing defects in GS44 Si{sub 3}N{sub 4} green FDC parts. Analogous to CIP'ing (cold isostatic pressing), the green FDC parts were rubber bagged and loaded into a pressure chamber filled with water soluble oil at different temperatures, ranging from 30 to 90 deg. C, at pressures of up to 35 MPa. X-Ray radiography results indicated that at temperatures above 70 deg. C, WIP'ing was effective in closing the gaps of the intentionally placed void defects in FDC parts. However, WIP'ing above 70 deg. C was not effective in healing the defects completely. The fracture strengths of FDC parts with intentional added defects, WIP'ed above 70 deg. C were substantially lower than control samples.

  13. Implementation of a 10.24 GS/s 12-bit Optoelectronics Analog-to-Digital Converter Based on a Polyphase Demultiplexing Architecture

    Directory of Open Access Journals (Sweden)

    C. Villa-Angulo

    2013-02-01

    Full Text Available In this paper we present the practical implementation of a high-speed polyphase sampling and demultiplexing architecture for optoelectronics analog-to-digital converters (OADCs. The architecture consists of a one-stage divide-by-eight decimator circuit where optically-triggered samplers are cascaded to sample an analog input signal, and demultiplex different phases of the sampled signal to yield low data rate for electronic quantization. Electrical-in to electrical-out data format is maintained through the sampling, demultiplexing and quantization processes of the architecture thereby avoiding the need for electrical-to-optical and optical-to-electrical signal conversions. We experimentally demonstrate a 10.24 giga samples per second (GS/s, 12-bit resolution OADC system comprising the optically-triggered sampling circuits integrated with commercial electronic quantizers. Measurements performed on the OADC yielded an effective bit resolution (ENOB of 10.3 bits, spurious free dynamic range (SFDR of -32 dB and signal-to-noise and distortion ratio (SNDR of 63.7 dB.

  14. Human anti-Aβ IgGs target conformational epitopes on synthetic dimer assemblies and the AD brain-derived peptide.

    Science.gov (United States)

    Welzel, Alfred T; Williams, Angela D; McWilliams-Koeppen, Helen P; Acero, Luis; Weber, Alfred; Blinder, Veronika; Mably, Alex; Bunk, Sebastian; Hermann, Corinna; Farrell, Michael A; Ehrlich, Hartmut J; Schwarz, Hans P; Walsh, Dominic M; Solomon, Alan; O'Nuallain, Brian

    2012-01-01

    Soluble non-fibrillar assemblies of amyloid-beta (Aβ) and aggregated tau protein are the proximate synaptotoxic species associated with Alzheimer's disease (AD). Anti-Aβ immunotherapy is a promising and advanced therapeutic strategy, but the precise Aβ species to target is not yet known. Previously, we and others have shown that natural human IgGs (NAbs) target diverse Aβ conformers and have therapeutic potential. We now demonstrate that these antibodies bound with nM avidity to conformational epitopes on plate-immobilized synthetic Aβ dimer assemblies, including synaptotoxic protofibrils, and targeted these conformers in solution. Importantly, NAbs also recognized Aβ extracted from the water-soluble phase of human AD brain, including species that migrated on denaturing PAGE as SDS-stable dimers. The critical reliance on Aβ's conformational state for NAb binding, and not a linear sequence epitope, was confirmed by the antibody's nM reactivity with plate-immobilized protofibrills, and weak uM binding to synthetic Aβ monomers and peptide fragments. The antibody's lack of reactivity against a linear sequence epitope was confirmed by our ability to isolate anti-Aβ NAbs from intravenous immunoglobulin using affinity matrices, immunoglobulin light chain fibrils and Cibacron blue, which had no sequence similarity with the peptide. These findings suggest that further investigations on the molecular basis and the therapeutic/diagnostic potential of anti-Aβ NAbs are warranted.

  15. A New Classification of Ficus Subsection Urostigma (Moraceae Based on Four Nuclear DNA Markers (ITS, ETS, G3pdh, and ncpGS, Morphology and Leaf Anatomy.

    Directory of Open Access Journals (Sweden)

    Bhanumas Chantarasuwan

    Full Text Available Ficus subsection Urostigma as currently circumscribed contains 27 species, distributed in Africa, Asia, Australia and the Pacific, and is of key importance to understand the origin and evolution of Ficus and the fig-wasp mutualism. The species of subsection Urostigma are very variable in morphological characters and exhibit a wide range of often partly overlapping distributions, which makes identification often difficult. The systematic classification within and between this subsection and others is problematic, e.g., it is still unclear where to classify F. amplissima and F. rumphii. To clarify the circumscription of subsection Urostigma, a phylogenetic reconstruction based on four nuclear DNA markers (ITS, ETS, G3pdh, and ncpGS combined with morphology and leaf anatomy is conducted. The phylogenetic tree based on the combined datasets shows that F. madagascariensis, a Madagascan species, is sister to the remainder of subsect. Urostigma. Ficus amplissima and F. rumphii, formerly constituting sect. Leucogyne, appear to be imbedded in subsect. Conosycea. The result of the phylogenetic analysis necessitates nomenclatural adjustments. A new classification of Ficus subsection Urostigma is presented along with the morphological and leaf anatomical apomorphies typical for the clades. Two new species are described ─ one in subsect. Urostigma, the other in Conosycea. One variety is raised to species level.

  16. Enhancing production of ergosterol in Pichia pastoris GS115 by over-expression of 3-hydroxy-3-methylglutaryl CoA reductase from Glycyrrhiza uralensis.

    Science.gov (United States)

    Liu, Ying; Zhu, Xiaoqing; Li, Wendong; Wen, Hao; Gao, Ya; Liu, Yong; Liu, Chunsheng

    2014-04-01

    The rate-limiting enzyme in the mevalonic acid (MVA) pathway which can lead to triterpenoid saponin glycyrrhizic acid (GA) is 3-hydroxy-3-methylglutaryl-CoA reductase (HMGR). In order to reveal the effect of copy number variation in the HMGR gene on the MVA pathway, the HMGR gene from Glycyrrhiza uralensis Fisch. (GuHMGR) was cloned and over-expressed in Pichia pastoris GS115. Six recombinant P. pastoris strains containing different copy numbers of the GuHMGR gene were obtained and the content of ergosterol was analyzed by HPLC. The results showed that all the recombinant P. pastoris strains contained more ergosterol than the negative control and the strains with 8 and 44 copies contained significantly more ergosterol than the other strains. However, as the copy number increased, the content of ergosterol showed an increasing-decreasing-increasing pattern. This study provides a rationale for increasing the content of GA through over-expressing the GuHMGR gene in cultivars of G. uralensis.

  17. Use of agricultural statistics to verify the interannual variability in land surface models: a case study over France with ISBA-A-gs

    Directory of Open Access Journals (Sweden)

    J.-C. Calvet

    2012-01-01

    Full Text Available In order to verify the interannual variability of the above-ground biomass of herbaceous vegetation simulated by the ISBA-A-gs land surface model, within the SURFEX modelling platform, French agricultural statistics for C3 crops and grasslands were compared with the simulations for the 1994–2008 period. While excellent correlations are obtained for grasslands, representing the interannual variability of crops is more difficult. It is shown that, the Maximum Available soil Water Capacity (MaxAWC has a large influence on the correlation between the model and the agricultural statistics. In particular, high values of MaxAWC tend to reduce the impact of the climate interannual variability on the simulated biomass. Also, high values of MaxAWC allow the simulation of a negative trend in biomass production, in relation to a marked warming trend, of about 0.12 Kyr−1 on average, affecting the daily maximum air temperature during the growing period (April–June. This trend is particularly acute in Northern France. The estimates of MaxAWC for C3 crops and grasslands, currently used in SURFEX, are about 129 mm and do not vary much. Therefore, more accurate grid-cell values of this parameter are needed.

  18. Structural requirements for the flavonoid-mediated modulation of glutathione S-transferase P1-1 and GS-X pump activity in MCF7 breast cancer cells.

    Science.gov (United States)

    van Zanden, Jelmer J; Geraets, Liesbeth; Wortelboer, Heleen M; van Bladeren, Peter J; Rietjens, Ivonne M C M; Cnubben, Nicole H P

    2004-04-15

    The objective of this study was to investigate the structural requirements necessary for inhibition of glutathione S-transferase P1-1 (GSTP1-1) and GS-X pump (MRP1 and MRP2) activity by structurally related flavonoids, in GSTP1-1 transfected MCF7 cells (pMTG5). The results reveal that GSTP1-1 activity in MCF7 pMTG5 cells can be inhibited by some flavonoids. Especially galangin was able to inhibit almost all cellular GSTP1-1 activity upon exposure of the cells to a concentration of 25microM. Other flavonoids like kaempferol, eriodictyol and quercetin showed a moderate GSTP1-1 inhibitory potential. For GSTP1-1 inhibition, no specific structural requirements necessary for potent inhibition could be defined. Most flavonoids appeared to be potent GS-X transport inhibitors with IC(50) values ranging between 0.8 and 8microM. Luteolin and quercetin were the strongest inhibitors with IC(50) values of 0.8 and 1.3microM, respectively. Flavonoids without a C2-C3 double bond like eriodictyol, taxifolin and catechin did not inhibit GS-X pump activity. The results of this study demonstrate that the structural features necessary for high potency GS-X pump inhibition by flavonoids are (1) the presence of hydroxyl groups, especially two of them generating the 3',4'-catechol moiety; and (2) a planar molecule due to the presence of a C2-C3 double bond. Other factors, like lipophilicity and the total number of hydroxyl groups do not seem to be dominating the flavonoid-mediated GS-X pump inhibition. To identify the GS-X pump responsible for the DNP-SG efflux in MCF7 cells, the effects of three characteristic flavonoids quercetin, flavone and taxifolin on MRP1 and MRP2 activity were studied using transfected MDCKII cells. All three flavonoids as well as the typical MRP inhibitor (MK571) affected MRP1-mediated transport activity in a similar way as observed in the MCF7 cells. In addition, the most potent GS-X pump inhibitor in the MCF7 cells, quercetin, did not affect MRP2-mediated

  19. Solvarmeanlægs energibesparelser

    DEFF Research Database (Denmark)

    Furbo, Simon; Fan, Jianhua

    670 kWh per m² solar collector for these solar heating systems. The energy savings per m² solar collector are not influenced by the solar heating system type, the company marketing the system, the auxiliary energy supply system, the collector area, the collector tilt, the collector azimuth, the energy......Wh per m² solar collector for these solar heating systems. The energy savings per m² solar collector for these systems are also not influenced by the solar heating system type, the company marketing the system, the auxiliary energy supply system, the collector area, the collector tilt, the collector...... have a second auxiliary energy supply system. The collector areas vary from 1.83 m² to 9.28 m². Some of the solar heating systems are based on energy units with a new integrated natural gas boiler and a heat storage for the solar heating system. The existing energy systems in the houses are for most...

  20. Long tails on thermonuclear X-ray bursts from neutron stars : a signature of inward heating?

    NARCIS (Netherlands)

    Zand, J. J. M. in't; Keek, L.; Cumming, A.; Heger, A.; Homan, J.; Mendez, M.

    We report the discovery of one-hour long tails on the few- minutes long X- ray bursts from the " clocked burster" GS 1826- 24. We propose that the tails are due to enduring thermal radiation from the neutron star envelope. The enduring emission can be explained by cooling of deeper neutron star

  1. Evaluation of dried blood spot protocols with the Bio-Rad GS HIV Combo Ag/Ab EIA and Geenius™ HIV 1/2 Supplemental Assay.

    Science.gov (United States)

    Luo, Wei; Davis, Geoff; Li, LiXia; Shriver, M Kathleen; Mei, Joanne; Styer, Linda M; Parker, Monica M; Smith, Amanda; Paz-Bailey, Gabriela; Ethridge, Steve; Wesolowski, Laura; Owen, S Michele; Masciotra, Silvina

    2017-06-01

    FDA-approved antigen/antibody combo and HIV-1/2 differentiation supplemental tests do not have claims for dried blood spot (DBS) use. We compared two DBS-modified protocols, the Bio-Rad GS HIV Combo Ag/Ab (BRC) EIA and Geenius™ HIV-1/2 (Geenius) Supplemental Assay, to plasma protocols and evaluated them in the CDC/APHL HIV diagnostic algorithm. BRC-DBS p24 analytical sensitivity was calculated from serial dilutions of p24. DBS specimens included 11 HIV-1 seroconverters, 151 HIV-1-positive individuals, including 20 on antiretroviral therapy, 31 HIV-2-positive and one HIV-1/HIV-2-positive individuals. BRC-reactive specimens were tested with Geenius using the same DBS eluate. Matched plasma specimens were tested with BRC, an IgG/IgM immunoassay and Geenius. DBS and plasma results were compared using the McNemar's test. A DBS-algorithm applied to 348 DBS from high-risk individuals who participated in surveillance was compared to HIV status based on local testing algorithms. BRC-DBS detects p24 at a concentration 18 times higher than in plasma. In seroconverters, BRC-DBS detected more infections than the IgG/IgM immunoassay in plasma (p=0.0133), but fewer infections than BRC-plasma (p=0.0133). In addition, the BRC/Geenius-plasma algorithm identified more HIV-1 infections than the BRC/Geenius-DBS algorithm (p=0.0455). The DBS protocols correctly identified HIV status for established HIV-1 infections, including those on therapy, HIV-2 infections, and surveillance specimens. The DBS protocols exhibited promising performance and allowed rapid supplemental testing. Although the DBS algorithm missed some early infections, it showed similar results when applied to specimens from a high-risk population. Implementation of a DBS algorithm would benefit testing programs without capacity for venipuncture. Published by Elsevier B.V.

  2. Plutonium(V/VI) Reduction by the Metal-Reducing Bacteria Geobacter metallireducens GS-15 and Shewanella oneidensis MR-1▿

    Science.gov (United States)

    Icopini, Gary A.; Lack, Joe G.; Hersman, Larry E.; Neu, Mary P.; Boukhalfa, Hakim

    2009-01-01

    We examined the ability of the metal-reducing bacteria Geobacter metallireducens GS-15 and Shewanella oneidensis MR-1 to reduce Pu(VI) and Pu(V). Cell suspensions of both bacteria reduced oxidized Pu [a mixture of Pu(VI) and Pu(V)] to Pu(IV). The rate of plutonium reduction was similar to the rate of U(VI) reduction obtained under similar conditions for each bacteria. The rates of Pu(VI) and U(VI) reduction by cell suspensions of S. oneidensis were slightly higher than the rates observed with G. metallireducens. The reduced form of Pu was characterized as aggregates of nanoparticulates of Pu(IV). Transmission electron microscopy images of the solids obtained from the cultures after the reduction of Pu(VI) and Pu(V) by S. oneidensis show that the Pu precipitates have a crystalline structure. The nanoparticulates of Pu(IV) were precipitated on the surface of or within the cell walls of the bacteria. The production of Pu(III) was not observed, which indicates that Pu(IV) was the stable form of reduced Pu under these experimental conditions. Experiments examining the ability of these bacteria to use Pu(VI) as a terminal electron acceptor for growth were inconclusive. A slight increase in cell density was observed for both G. metallireducens and S. oneidensis when Pu(VI) was provided as the sole electron acceptor; however, Pu(VI) concentrations decreased similarly in both the experimental and control cultures. PMID:19363069

  3. Performance of the fourth-generation Bio-Rad GS HIV Combo Ag/Ab enzyme immunoassay for diagnosis of HIV infection in Southern Africa.

    Science.gov (United States)

    Piwowar-Manning, Estelle; Fogel, Jessica M; Richardson, Paul; Wolf, Shauna; Clarke, William; Marzinke, Mark A; Fiamma, Agnès; Donnell, Deborah; Kulich, Michal; Mbwambo, Jessie K K; Richter, Linda; Gray, Glenda; Sweat, Michael; Coates, Thomas J; Eshleman, Susan H

    2015-01-01

    Fourth-generation HIV assays detect both antigen and antibody, facilitating detection of acute/early HIV infection. The Bio-Rad GS HIV Combo Ag/Ab assay (Bio-Rad Combo) is an enzyme immunoassay that simultaneously detects HIV p24 antigen and antibodies to HIV-1 and HIV-2 in serum or plasma. To evaluate the performance of the Bio-Rad Combo assay for detection of HIV infection in adults from Southern Africa. Samples were obtained from adults in Soweto and Vulindlela, South Africa and Dar es Salaam, Tanzania (300 HIV-positive samples; 300 HIV-negative samples; 12 samples from individuals previously classified as having acute/early HIV infection). The samples were tested with the Bio-Rad Combo assay. Additional testing was performed to characterize the 12 acute/early samples. All 300 HIV-positive samples were reactive using the Bio-Rad Combo assay; false positive test results were obtained for 10 (3.3%) of the HIV-negative samples (sensitivity: 100%, 95% confidence interval [CI]: 98.8-100%); specificity: 96.7%, 95% CI: 94.0-98.4%). The assay detected 10 of the 12 infections classified as acute/early. The two infections that were not detected had viral loadsHIV-negative samples were pre-screened using a different fourth-generation test. The assay also had high sensitivity for detection of acute/early infection. False-negative test results may be obtained in individuals who are virally suppressed. Copyright © 2014 Elsevier B.V. All rights reserved.

  4. Simultaneous optical/X-ray study of GS 1354-64 (=BW Cir) during hard outburst: evidence for optical cyclo-synchrotron emission from the hot accretion flow

    Science.gov (United States)

    Pahari, Mayukh; Gandhi, Poshak; Charles, Philip A.; Kotze, Marissa M.; Altamirano, Diego; Misra, Ranjeev

    2017-07-01

    We present results from simultaneous optical [South African Large Telescope (SALT)] and X-ray (Swift and INTEGRAL) observations of GS 1354-64/BW Cir during the 2015 hard state outburst. During the rising phase, optical/X-ray time series shows a strong anti-correlation with X-ray photons lagging optical. Optical and X-ray power spectra show quasi-periodic oscillations (QPOs) at a frequency of ˜18 mHz with a confidence level of at least 99 per cent. Simultaneous fitting of Swift/XRT and INTEGRAL spectra in the range 0.5-1000.0 keV shows non-thermal, power-law-dominated (>90 per cent) spectra with a hard power-law index of 1.48 ± 0.03, inner disc temperature of 0.12 ± 0.01 keV and an inner disc radius of ˜3000 km. All evidence is consistent with cyclo-synchrotron radiation in a non-thermal, hot electron cloud extending to ˜100 Schwarzschild radii being a major physical process for the origin of optical photons. At outburst peak about one month later, when the X-ray flux rises and the optical drops, the apparent features in the optical/X-ray correlation vanish and the optical auto correlation widens. Although ˜0.19 Hz QPO is observed from the X-ray power spectra, the optical variability is dominated by the broad-band noise, and the inner disc temperature increases. These results support a change in the dominant optical emission source between outburst rise and peak, consistent with a weakening of hot flow as the disc moves in.

  5. Adaptive Activation of a Stress Response Pathway Improves Learning and Memory Through Gs and β-Arrestin-1-Regulated Lactate Metabolism.

    Science.gov (United States)

    Dong, Jun-Hong; Wang, Yi-Jing; Cui, Min; Wang, Xiao-Jing; Zheng, Wen-Shuai; Ma, Ming-Liang; Yang, Fan; He, Dong-Fang; Hu, Qiao-Xia; Zhang, Dao-Lai; Ning, Shang-Lei; Liu, Chun-Hua; Wang, Chuan; Wang, Yue; Li, Xiang-Yao; Yi, Fan; Lin, Amy; Kahsai, Alem W; Cahill, Thomas Joseph; Chen, Zhe-Yu; Yu, Xiao; Sun, Jin-Peng

    2017-04-15

    Stress is a conserved physiological response in mammals. Whereas moderate stress strengthens memory to improve reactions to previously experienced difficult situations, too much stress is harmful. We used specific β-adrenergic agonists, as well as β 2 -adrenergic receptor (β2AR) and arrestin knockout models, to study the effects of adaptive β2AR activation on cognitive function using Morris water maze and object recognition experiments. We used molecular and cell biological approaches to elucidate the signaling subnetworks. We observed that the duration of the adaptive β2AR activation determines its consequences on learning and memory. Short-term formoterol treatment, for 3 to 5 days, improved cognitive function; however, prolonged β2AR activation, for more than 6 days, produced harmful effects. We identified the activation of several signaling networks downstream of β2AR, as well as an essential role for arrestin and lactate metabolism in promoting cognitive ability. Whereas Gs-protein kinase A-cyclic adenosine monophosphate response element binding protein signaling modulated monocarboxylate transporter 1 expression, β-arrestin-1 controlled expression levels of monocarboxylate transporter 4 and lactate dehydrogenase A through the formation of a β-arrestin-1/phospho-mitogen-activated protein kinase/hypoxia-inducible factor-1α ternary complex to upregulate lactate metabolism in astrocyte-derived U251 cells. Conversely, long-term treatment with formoterol led to the desensitization of β2ARs, which was responsible for its decreased beneficial effects. Our results not only revealed that β-arrestin-1 regulated lactate metabolism to contribute to β2AR functions in improved memory formation, but also indicated that the appropriate management of one specific stress pathway, such as through the clinical drug formoterol, may exert beneficial effects on cognitive abilities. Copyright © 2016 Society of Biological Psychiatry. All rights reserved.

  6. An optimally tuned ensemble of the "eb_go_gs" configuration of GENIE: parameter sensitivity and bifurcations in the Atlantic overturning circulation

    Directory of Open Access Journals (Sweden)

    R. Marsh

    2013-10-01

    Full Text Available The key physical parameters for the "eb_go_gs" configuration of version 2.7.4 of GENIE, an Earth system model of intermediate complexity (EMIC, are tuned using a multi-objective genetic algorithm. An ensemble of 90 parameter sets is tuned using two ocean and two atmospheric state variables as targets. These are "Pareto-optimal", representing a range of trade-offs between the four tuning targets. For the leading five parameter sets, simulations are evaluated alongside a simulation with untuned "default" parameters, comparing selected variables and diagnostics that describe the state of the atmosphere, ocean and sea ice. Further experiments are undertaken with these selected parameter sets to compare equilibrium climate sensitivities and transient climate responses. The pattern of warming under doubled CO2 is strongly shaped by changes in the Atlantic meridional overturning circulation (AMOC, while the pattern and rate of warming under rising CO2 is closely linked to changing sea ice extent. One of the five tuned parameter sets is identified as marginally optimal, and the objective function (error landscape is further analysed in the vicinity of the tuned values of this parameter set. "Cliffs" along some dimensions motivate closer inspection of corresponding variations in the AMOC. This reveals that bifurcations in the AMOC are highly sensitive to parameters that are not typically associated with MOC stability. Specifically, the state of the AMOC is sensitive to parameters governing the wind-driven circulation and atmospheric heat transport. For the GENIE configuration presented here, the marginally optimal parameter set is recommended for single simulations, although the leading five parameter sets may be used in ensemble mode to admit a constrained degree of parametric uncertainty in climate prediction.

  7. CpG island clusters and pro-epigenetic selection for CpGs in protein-coding exons of HOX and other transcription factors.

    Science.gov (United States)

    Branciamore, Sergio; Chen, Zhao-Xia; Riggs, Arthur D; Rodin, Sergei N

    2010-08-31

    CpG dinucleotides contribute to epigenetic mechanisms by being the only site for DNA methylation in mammalian somatic cells. They are also mutation hotspots and approximately 5-fold depleted genome-wide. We report here a study focused on CpG sites in the coding regions of Hox and other transcription factor genes, comparing methylated genomes of Homo sapiens, Mus musculus, and Danio rerio with nonmethylated genomes of Drosophila melanogaster and Caenorhabditis elegans. We analyzed 4-fold degenerate, synonymous codons with the potential for CpG. That is, we studied "silent" changes that do not affect protein products but could damage epigenetic marking. We find that DNA-binding transcription factors and other developmentally relevant genes show, only in methylated genomes, a bimodal distribution of CpG usage. Several genetic code-based tests indicate, again for methylated genomes only, that the frequency of silent CpGs in Hox genes is much greater than expectation. Also informative are NCG-GNN and NCC-GNN codon doublets, for which an unusually high rate of G to C and C to G transversions was observed at the third (silent) position of the first codon. Together these results are interpreted as evidence for strong "pro-epigenetic" selection acting to preserve CpG sites in coding regions of many genes controlling development. We also report that DNA-binding transcription factors and developmentally important genes are dramatically overrepresented in or near clusters of three or more CpG islands, suggesting a possible relationship between evolutionary preservation of CpG dinucleotides in both coding regions and CpG islands.

  8. Glycyrrhetic acid synergistically enhances β₂-adrenergic receptor-Gs signaling by changing the location of Gαs in lipid rafts.

    Directory of Open Access Journals (Sweden)

    Qian Shi

    Full Text Available Glycyrrhetic acid (GA exerts synergistic anti-asthmatic effects via a β₂-adrenergic receptor (β₂AR-mediated pathway. Cholesterol is an important component of the structure and function of lipid rafts, which play critical roles in the β₂AR-Gs-adenylate cyclase (AC-mediated signaling pathway. Owing to the structural similarities between GA and cholesterol, we investigated the possibility that GA enhances β₂AR signaling by altering cholesterol distribution. Azide-terminal GA (ATGA was synthesized and applied to human embryonic kidney 293 (HEK293 cells expressing fusion β₂AR, and the electron spin resonance (ESR technique was utilized. GA was determined to be localized predominantly on membrane and decreased their cholesterol contents. Thus, the fluidity of the hydrophobic region increased but not the polar surface of the cell membrane. The conformations of membrane proteins were also changed. GA further changed the localization of Gαs from lipid rafts to non-raft regions, resulting the binding of β₂AR and Gαs, as well as in reduced β₂AR internalization. Co-localization of β₂AR, Gαs, and AC increased isoproterenol-induced cAMP production and cholesterol reloading attenuated this effect. A speculation wherein GA enhances beta-adrenergic activity by increasing the functional linkage between the subcomponents of the membrane β₂AR-protein kinase A (PKA signaling pathway was proposed. The enhanced efficacy of β₂AR agonists by this novel mechanism could prevent tachyphylaxis.

  9. Antifungal Volatile Organic Compounds from the Endophyte Nodulisporium sp. Strain GS4d2II1a: a Qualitative Change in the Intraspecific and Interspecific Interactions with Pythium aphanidermatum.

    Science.gov (United States)

    Sánchez-Fernández, Rosa Elvira; Diaz, Daniel; Duarte, Georgina; Lappe-Oliveras, Patricia; Sánchez, Sergio; Macías-Rubalcava, Martha Lydia

    2016-02-01

    This study demonstrates volatile organic compounds (VOCs) production as one of the defense mechanisms of the antagonistic endophyte Nodulisporium sp. GS4d2II1a, and the volatile changes in two times of the fungal growth; and, as result of its intra and interspecific interactions with the plant pathogen Pythium aphanidermatum. The antifungal activity of the volatile and diffusible metabolites was evaluated by means of three types of antagonism bioassays and by organic extract agar dilution. VOCs were obtained by gas chromatography coupled to mass spectrometry from 3- and 5-day Nodulisporium sp. cultures, as well as from its interspecific in vitro antagonistic interaction with the oomycete P. aphanidermatum, and its intraspecific Nodulisporium sp.-Nodulisporium sp. interaction. The GS4d2II1a strain completely inhibited the growth of two fungi and seven oomycetes by replacing their mycelia in simple antagonism bioassays and by producing in vitro volatile and diffusible metabolites that acted synergistically in multiple antagonism bioassays. Additionally, VOCs inhibited the growth of three oomycetes and one fungus in antagonism bioassays using divided plates. A total of 70 VOCs were detected, mainly including mono and sesquiterpenes, especially eucalyptol and limonene. Multiple correspondence analysis revealed four different volatile profiles, showing that volatiles changed with the fungus age and its intra and interspecific interactions. The metabolites produced by Nodulisporium sp. GS4d2II1a could be useful for biological control of fungal and oomycetes plant pathogens of economically important crops.

  10. Guanine nucleotide binding regulatory proteins and adenylate cyclase in livers of streptozotocin- and BB/Wor-diabetic rats. Immunodetection of Gs and Gi with antisera prepared against synthetic peptides.

    Science.gov (United States)

    Lynch, C J; Blackmore, P F; Johnson, E H; Wange, R L; Krone, P K; Exton, J H

    1989-01-01

    Adenylate cyclase in liver plasma membranes from streptozotocin-diabetic (STZ) or BB/Wor spontaneously diabetic rats showed increased responsiveness to GTP, glucagon, fluoroaluminate, and cholera toxin. Basal or forskolin-stimulated activity was unchanged in STZ rats, but increased in BB/Wor rats. No change in the alpha-subunit of Gi (alpha i) was observed in STZ or BB/Wor rats using pertussis toxin-stimulated [32P]ADP-ribosylation. Immunodetection using antibodies against the COOH-terminal decapeptides of alpha T and alpha i-3 showed no change in alpha i in STZ rats and a slight decrease in BB/Wor rats. Angiotensin II inhibition of hepatic adenylate cyclase was not altered in either diabetic rat. In both models of diabetes, Gs alpha-subunits were increased as measured by cholera toxin-stimulated [32P]-ADP-ribosylation of 43-47.5-kD peptides, reconstitution with membranes from S49 cyc- cells or immunoreactivity using antibodies against the COOH-terminal decapeptide of alpha s. These data indicate that STZ-diabetes increases hepatic Gs but does not change Gi or adenylate cyclase catalytic activity. In contrast, BB/Wor rats show increased hepatic Gs and adenylate cyclase. These changes could explain the increase in hepatic cAMP and related dysfunctions observed in diabetes. Images PMID:2498395

  11. Simultaneous Decolorization and Biohydrogen Production from Xylose by Klebsiella oxytoca GS-4-08 in the Presence of Azo Dyes with Sulfonate and Carboxyl Groups.

    Science.gov (United States)

    Yu, Lei; Cao, Ming-Yue; Wang, Peng-Tao; Wang, Shi; Yue, Ying-Rong; Yuan, Wen-Duo; Qiao, Wei-Chuan; Wang, Fei; Song, Xin

    2017-05-15

    Biohydrogen production from the pulp and paper effluent containing rich lignocellulosic material could be achieved by the fermentation process. Xylose, an important hemicellulose hydrolysis product, is used less efficiently as a substrate for biohydrogen production. Moreover, azo dyes are usually added to fabricate anticounterfeiting paper, which further increases the complexity of wastewater. This study reports that xylose could serve as the sole carbon source for a pure culture of Klebsiella oxytoca GS-4-08 to achieve simultaneous decolorization and biohydrogen production. With 2 g liter-1 of xylose as the substrate, a maximum xylose utilization rate (URxyl) and a hydrogen molar yield (HMY) of 93.99% and 0.259 mol of H2 mol of xylose-1, respectively, were obtained. Biohydrogen kinetics and electron equivalent (e- equiv) balance calculations indicated that methyl red (MR) penetrates and intracellularly inhibits both the pentose phosphate pathway and pyruvate fermentation pathway, while methyl orange (MO) acted independently of the glycolysis and biohydrogen pathway. The data demonstrate that biohydrogen pathways in the presence of azo dyes with sulfonate and carboxyl groups were different, but the azo dyes could be completely reduced during the biohydrogen production period in the presence of MO or MR. The feasibility of hydrogen production from industrial pulp and paper effluent by the strain if the xylose is sufficient was also proved and was not affected by toxic substances which usually exist in such wastewater, except for chlorophenol. This study offers a promising energy-recycling strategy for treating pulp and paper wastewaters, especially for those containing azo dyes.IMPORTANCE The pulp and paper industry is a major industry in many developing countries, and the global market of pulp and paper wastewater treatment is expected to increase by 60% between 2012 and 2020. Such wastewater contains large amounts of refractory contaminants, such as lignin, whose

  12. Physiological response of Pichia pastoris GS115 to methanol-induced high level production of the Hepatitis B surface antigen: catabolic adaptation, stress responses, and autophagic processes.

    Science.gov (United States)

    Vanz, Ana Leticia; Lünsdorf, Heinrich; Adnan, Ahmad; Nimtz, Manfred; Gurramkonda, Chandrasekhar; Khanna, Navin; Rinas, Ursula

    2012-08-08

    Pichia pastoris is an established eukaryotic host for the production of recombinant proteins. Most often, protein production is under the control of the strong methanol-inducible aox1 promoter. However, detailed information about the physiological alterations in P. pastoris accompanying the shift from growth on glycerol to methanol-induced protein production under industrial relevant conditions is missing. Here, we provide an analysis of the physiological response of P. pastoris GS115 to methanol-induced high-level production of the Hepatitis B virus surface antigen (HBsAg). High product titers and the retention of the protein in the endoplasmic reticulum (ER) are supposedly of major impact on the host physiology. For a more detailed understanding of the cellular response to methanol-induced HBsAg production, the time-dependent changes in the yeast proteome and ultrastructural cell morphology were analyzed during the production process. The shift from growth on glycerol to growth and HBsAg production on methanol was accompanied by a drastic change in the yeast proteome. In particular, enzymes from the methanol dissimilation pathway started to dominate the proteome while enzymes from the methanol assimilation pathway, e.g. the transketolase DAS1, increased only moderately. The majority of methanol was metabolized via the energy generating dissimilatory pathway leading to a corresponding increase in mitochondrial size and numbers. The methanol-metabolism related generation of reactive oxygen species induced a pronounced oxidative stress response (e.g. strong increase of the peroxiredoxin PMP20). Moreover, the accumulation of HBsAg in the ER resulted in the induction of the unfolded protein response (e.g. strong increase of the ER-resident disulfide isomerase, PDI) and the ER associated degradation (ERAD) pathway (e.g. increase of two cytosolic chaperones and members of the AAA ATPase superfamily) indicating that potential degradation of HBsAg could proceed via the

  13. Physiological response of Pichia pastoris GS115 to methanol-induced high level production of the Hepatitis B surface antigen: catabolic adaptation, stress responses, and autophagic processes

    Science.gov (United States)

    2012-01-01

    Background Pichia pastoris is an established eukaryotic host for the production of recombinant proteins. Most often, protein production is under the control of the strong methanol-inducible aox1 promoter. However, detailed information about the physiological alterations in P. pastoris accompanying the shift from growth on glycerol to methanol-induced protein production under industrial relevant conditions is missing. Here, we provide an analysis of the physiological response of P. pastoris GS115 to methanol-induced high-level production of the Hepatitis B virus surface antigen (HBsAg). High product titers and the retention of the protein in the endoplasmic reticulum (ER) are supposedly of major impact on the host physiology. For a more detailed understanding of the cellular response to methanol-induced HBsAg production, the time-dependent changes in the yeast proteome and ultrastructural cell morphology were analyzed during the production process. Results The shift from growth on glycerol to growth and HBsAg production on methanol was accompanied by a drastic change in the yeast proteome. In particular, enzymes from the methanol dissimilation pathway started to dominate the proteome while enzymes from the methanol assimilation pathway, e.g. the transketolase DAS1, increased only moderately. The majority of methanol was metabolized via the energy generating dissimilatory pathway leading to a corresponding increase in mitochondrial size and numbers. The methanol-metabolism related generation of reactive oxygen species induced a pronounced oxidative stress response (e.g. strong increase of the peroxiredoxin PMP20). Moreover, the accumulation of HBsAg in the ER resulted in the induction of the unfolded protein response (e.g. strong increase of the ER-resident disulfide isomerase, PDI) and the ER associated degradation (ERAD) pathway (e.g. increase of two cytosolic chaperones and members of the AAA ATPase superfamily) indicating that potential degradation of HBsAg could

  14. Physiological response of Pichia pastoris GS115 to methanol-induced high level production of the Hepatitis B surface antigen: catabolic adaptation, stress responses, and autophagic processes

    Directory of Open Access Journals (Sweden)

    Vanz Ana Leticia

    2012-08-01

    Full Text Available Abstract Background Pichia pastoris is an established eukaryotic host for the production of recombinant proteins. Most often, protein production is under the control of the strong methanol-inducible aox1 promoter. However, detailed information about the physiological alterations in P. pastoris accompanying the shift from growth on glycerol to methanol-induced protein production under industrial relevant conditions is missing. Here, we provide an analysis of the physiological response of P. pastoris GS115 to methanol-induced high-level production of the Hepatitis B virus surface antigen (HBsAg. High product titers and the retention of the protein in the endoplasmic reticulum (ER are supposedly of major impact on the host physiology. For a more detailed understanding of the cellular response to methanol-induced HBsAg production, the time-dependent changes in the yeast proteome and ultrastructural cell morphology were analyzed during the production process. Results The shift from growth on glycerol to growth and HBsAg production on methanol was accompanied by a drastic change in the yeast proteome. In particular, enzymes from the methanol dissimilation pathway started to dominate the proteome while enzymes from the methanol assimilation pathway, e.g. the transketolase DAS1, increased only moderately. The majority of methanol was metabolized via the energy generating dissimilatory pathway leading to a corresponding increase in mitochondrial size and numbers. The methanol-metabolism related generation of reactive oxygen species induced a pronounced oxidative stress response (e.g. strong increase of the peroxiredoxin PMP20. Moreover, the accumulation of HBsAg in the ER resulted in the induction of the unfolded protein response (e.g. strong increase of the ER-resident disulfide isomerase, PDI and the ER associated degradation (ERAD pathway (e.g. increase of two cytosolic chaperones and members of the AAA ATPase superfamily indicating that potential

  15. Rediseño e implementación del módulo de facturación del ERP GsBase de una empresa de servicios

    OpenAIRE

    Nieto Olivares, Francisco Moisés

    2015-01-01

    Treball Final de Grau en Enginyeria Informàtica. Codi: EI1054. Curs: 2014/2015 Este documento contiene la especificación, planificación, diseño e implementación del proyecto fin de grado realizado por el alumno Francisco Nieto Olivares en la empresa de servicios software Madisa Tecnología Ibérica durante una estancia de 500 horas. La empresa ClearOne, cliente de Madisa Tecnología Ibérica, requiere un nuevo módulo de facturación para su ERP GsBase que automatice el proceso d...

  16. High-level expression of a bacterial laccase, CueO from Escherichia coli K12 in Pichia pastoris GS115 and its application on the decolorization of synthetic dyes.

    Science.gov (United States)

    Ma, Xiaojian; Liu, Lu; Li, Qingqing; Liu, Yunyun; Yi, Li; Ma, Lixin; Zhai, Chao

    2017-08-01

    Laccases are oxidoreductase catalyze the oxidation of a wide range of substrates with oxygen as the electron acceptor. This report was aimed to the high-level expression of a laccase, CueO from Escherichia coli K12 in Pichia pastoris GS115 and its application on decolorization of synthetic dyes. The yacK gene coding CueO was cloned into an expression vector of Pichia pastoris, pHBM905BDM and expressed in a secretory form with Pichia pastoris GS115 as the host. The yield of the recombinant protein was 556mg/L with high-density fermentation and the enzyme activity was about 41,000U/L. The recombinant laccase was purified and characterized. Its optimum pH and temperature was 3.0 and 55°C with 2, 2'-azino-bis-(3-ethylbenzothazoline-6-sulfonic acid) (ABTS) as the substrate, respectively. This recombinant protein was thermostable and its half life at 70°C was about 60min. In the presence of natural redox mediator acetosyringone, the purified recombinant laccase decolorized 98.1% and 98.5% of Congo red, malachite green, respectively. It also decolorized 90.03% of Remazol brilliant blue R without this mediator. In addition, this enzyme was applied on the decolorization of wastewater from a textile printing factory and showed an obvious bleaching effect. Copyright © 2017. Published by Elsevier Inc.

  17. PRECISÃO E ACURÁCIA PLANIMÉTRICA DO RECEPTOR GPS GSTAR GS-87: APLICABILIDADE EM TECNOLOGIA DE INFORMAÇÃO EMBARCADA PARA SISTEMAS AGRÍCOLAS

    OpenAIRE

    IDOMAR AUGUSTO CERUTTI

    2012-01-01

    O uso de informações georreferenciadas na agricultura de precisão tem crescido muito na última década. Além disso, o decréscimo do custo dos equipamentos de recepção GPS tem tornado possível o seu uso por produtores agrícolas que estavam distantes de tal tecnologia. Esta pesquisa objetiva avaliar a precisão e acurácia de receptor GPS modelo Gstar GS-87, para compreender sua aplicabilidade em sistemas de informação embarcado com sistema agrícolas. A pesquisa é parte do projeto Agrobot, que ...

  18. Validez factorial de la adaptación al español del Maslach Burnout Inventory-General Survey The Factorial Validity of the Maslach Burnout Inventory-General Survey (MBI-GS Spanish Version

    Directory of Open Access Journals (Sweden)

    Pedro R Gil-Monte

    2002-01-01

    Full Text Available Objetivo. Explorar la estructura factorial de una adaptación al castellano del "Maslach Burnout Inventory-General Survey" (MBI-GS. Material y métodos. La muestra la integraron 149 policías municipales de Tenerife, España, a quienes se les aplicó el cuestionario en 1999. Se realizó un análisis factorial mediante Componentes Principales y rotación Varimax. Resultados. Cuatro factores tuvieron eigenvalues mayores que 1. En el Factor I se agruparon los items de Eficacia Profesional, en el Factor II tres items de Cinismo, en el Factor III los items de Agotamiento, y en el Factor IV dos items de Cinismo. Posteriormente se realizó otro análisis ajustando a tres la extracción de factores. La solución factorial reprodujo la distribución de los items del manual. Conclusiones. A la luz de los resultados obtenidos el cuestionario se puede considerar válido y confiable en la versión adaptada al castellano.Objective. To explore the factorial structure of a Spanish version of the "Maslach Burnout Inventory-General Survey" (MBI-GS. Material and Methods. A cross-sectional study was conducted in 1999 among 149 municipal policemen in Tenerife, Spain. A questionnaire was applied to collect data on Professional Efficacy, Cynicism, and Burnout. Data were analyzed using factorial analysis and principal components with Varimax rotation. Results. Four factors had eigenvalues greater than 1; Factor 1 gouped Professional Efficacy items, Factor II grouped three Cynicism items. Further analysis was conducted to limit extraction to three factors. The factorial solution replicated the distribution of items in the questionnaire manual. Conclusions. Study results whow that the Spanish version of the questionnaire is valid and reliable.

  19. Development a validated highly sensitive LC-MS/MS method for simultaneous quantification of Ledipasvir, sofosbuvir and its major metabolite GS-331007 in human plasma: Application to a human pharmacokinetic study.

    Science.gov (United States)

    Abdallah, Ola M; Abdel-Megied, Ahmed M; Gouda, Amira S

    2017-09-05

    A highly sensitive and rapid LC-MS/MS method was developed, fully optimized and validated for the simultaneous determination of Ledipasvir (LED) and Sofosbuvir (SOF) in the presence of its major metabolite GS-331007 in human plasma using Daclatasvir as internal standard (IS). The extraction of analytes and IS from plasma was performed using liquid-liquid extraction with ethyl acetate. The chromatographic separation of these prepared samples was achieved on Xterra MS C 8 column (4.6×50mm,5μm) using gradient elution with a mobile phase of ammonium formate buffer (pH 3.5; 10mM), acetonitrile and methanol pumped at a flow rate 0.7mLmin -1 .The detection was performed on API4000 triple quadrupole tandem mass spectrometer using multiple reaction monitoring (MRM) positive electrospray ionization interface. The method was validated according to FDA guidelines for bio-analytical methods with respect to linearity, accuracy, precision, selectivity, carry-over, stability and dilution integrity. Linearity was obtained over a concentration range of 0.1-1000, 0.3-3000 and 3.0-3000ngmL -1 for LED, SOF and GS-331007; respectively by applying weighted least-squares linear regression method (1/x 2 ). The wider range of quantification in a shorter period of separation time less than 5.0min allowed monitoring the serum concentration of analytes up to 144h. The proposed method can be successfully applied for pharmacokinetic and bioequivalence studies in healthy human volunteers. Copyright © 2017 Elsevier B.V. All rights reserved.

  20. Lab-scale preparations of Candida albicans and dual Candida albicans-Candida glabrata biofilms on the surface of medical-grade polyvinyl chloride (PVC) perfusion tube using a modified gravity-supported free-flow biofilm incubator (GS-FFBI).

    Science.gov (United States)

    Shao, Jing; Lu, KeQiao; Tian, Ge; Cui, YanYan; Yan, YuanYuan; Wang, TianMing; Zhang, XinLong; Wang, ChangZhong

    2015-02-01

    The assembly of a man-made gravity-supported free-flow biofilm incubator (GS-FFBI) was described, which was composed of a gas cushion injector and four incubators. The GS-FFBI had the characteristics of (i) a bottom-up flow direction, and (ii) lab-scale biofilm preparation without the use of a multichannel pump. Two opportunistic fungal strains, namely Candida albicans and Candida glabrata, were employed to incubate C. albicans and dual C. albicans-C. glabrata biofilms on the surface of medical-grade polyvinyl chloride perfusion tube. In terms of the results from {2, 3-bis (2-methoxy-4-nitro-5-sulfo-phenyl)-2H-tetrazolium-5-carboxanilide} (XTT) assay, dry weight measurement, colony-forming unit counting, susceptibility test, and scanning electron microscopy, it was demonstrated that GS-FFBI could form both stable single and dual Candida biofilms with no significant variations among the four incubators or the three daily incubations within 21h, and could operate for at least 96h smoothly with no contamination of stock medium. The results also indicated, for the first time, that C. albicans and C. glabrata might be co-existent competitively and symbiotically in the dual biofilms with flowing media. GS-FFBI would be a useful device to study in vitro morphological and physiological features of microbial biofilms in the medical settings. Copyright © 2014 Elsevier B.V. All rights reserved.

  1. Reseña de: González Mínguez, César, A vueltas con la crisis bajomedieval. El entorno económico del reinado de Fernando IV de Castilla (1295-1312. Almería. Editorial Círculo Rojo, 2016. 329 págs. ISBN: 978-84-9140-120-9.

    Directory of Open Access Journals (Sweden)

    Enrique Cantera Montenegro

    2017-05-01

    Full Text Available González Mínguez, César, A vueltas con la crisis bajomedieval. El entorno económico del reinado de Fernando IV de Castilla (1295-1312. Almería. Editorial Círculo Rojo, 2016. 329 págs. isbn: 978-84-9140-120-9.

  2. [Smoļenskas-Rīgas aktis 13. gs.-14. gs. pirmā puse : kompleksa "Moscowitica-Ruthenica" dokumenti par Smoļenskas un Rīgas attiecībām = Смоленско-рижские акты XIII в.-первая половина XIV в. : документ�

    Index Scriptorium Estoniae

    Levans, Andris, 1968-

    2011-01-01

    Arvustus: Smoļenskas-Rīgas aktis 13. gs.-14. gs. pirmā puse : kompleksa "Moscowitica-Ruthenica" dokumenti par Smoļenskas un Rīgas attiecībām = Смоленско-рижские акты XIII в.-первая половина XIV в. : документы комплекса Moscowitica-Ruthenica об отношениях Смоленска и Риги /koostajad Leksanders Ivanovs, Anatolijs Kuzņcovs. Vēstures avoti ; 6 (Riga: Latvijas Valsts vēstures arcīva izdevniecība, 2009)

  3. Changes in essential oil and morpho-physiological traits of tarragon (Artemisia dracuncalus L. in responses to arbuscular mycorrhizal fungus, AMF (Glomus intraradices N.C. Schenck & G.S. Sm. inoculation under salinity

    Directory of Open Access Journals (Sweden)

    Amin Lamian

    2017-09-01

    Full Text Available This study aimed to evaluate the arbuscular mycorrhizal fungi (AMF (Glomus intraradices N.C. Schenck & G.S. Sm. inoculation and salinity effect on qualitative and quantitative changes in tarragon yield. Treatments included inoculation, and non-inoculation of AMF, and five salinity levels of irrigation water (with the electrical conductivity of 0, 2, 4, 6, and 8 dS m-1. The results showed the plant height, SPAD value, number of leaves, dry mass of leaves and shoot per plant were reduced under salinity condition. The various levels of salinity decreased the content of tarragon essential oil and some its components consist of α-pinene, limonene, Z-ocimene, E-ocimene, and methyl chavicol while, it increased the content of bornyl acetate, eugenol, methyl eugenol, caryophyllene, germacrene, and α-farnesene. AMF inoculation without salinity had the greatest positive effect on the evaluated traits of tarragon. Also, it improved the morpho-physiological traits under salinity due to alleviation of the harmful effects of salinity. Although the essential oil content was reduced with the AMF inoculation, the methyl chavicol amount was increased by the AMF inoculation under salinity condition.

  4. Voltage interval mappings for activity transitions in neuron models for elliptic bursters

    Science.gov (United States)

    Wojcik, Jeremy; Shilnikov, Andrey

    2011-07-01

    We performed a thorough bifurcation analysis of a mathematical elliptic bursting model, using a computer-assisted reduction to equationless, one-dimensional Poincaré mappings for a voltage interval. Using the interval mappings, we were able to examine in detail the bifurcations that underlie the complex activity transitions between: tonic spiking and bursting, bursting and mixed-mode oscillations, and finally mixed-mode oscillations and quiescence in the FitzHugh-Nagumo-Rinzel model. We illustrate the wealth of information, qualitative and quantitative, that was derived from the Poincaré mappings, for the neuronal models and for similar (electro)chemical systems.

  5. Making a Swim Central Pattern Generator Out of Latent Parabolic Bursters

    Science.gov (United States)

    Alaçam, Deniz; Shilnikov, Andrey

    2015-06-01

    We study the rhythmogenesis of oscillatory patterns emerging in network motifs composed of inhibitory coupled tonic spiking neurons represented by the Plant model of R15 nerve cells. Such motifs are argued to be used as building blocks for a larger central pattern generator network controlling swim locomotion of sea slug Melibe leonina.

  6. Swift follow-up of the newly discovered burster millisecond pulsar IGR J17511-3057

    NARCIS (Netherlands)

    Bozzo, E.; Ferrigno, C.; Kuulkers, E.; Falanga, M.; Chenevez, J.; Brandt, S.; Beckmann, V.; Bird, A.; Domingo, A.; Ebisawa, K.; Jonker, P.; Kretschmar, P.; Markwardt, C.; Oosterbroek, T.; Paizis, A.; Risquez, D.; Sanchez-Fernandez, C.; Shaw, S.; Wijnands, R.

    2009-01-01

    Following the discovery of the new hard X-ray transient IGR J17511-3057 by INTEGRAL (Atel #2196) and its classification as a millisecond pulsar by RXTE (Atel #2197), a Swift ToO was performed. Swift/XRT observed IGR J17511-3057 on 2009-09-13 at 19:53:31 for a total exposure time of 4 ks. The first

  7. RXTE confirms persistent activity of burster IGR J17473-2721

    NARCIS (Netherlands)

    Markwardt, C.B.; Altamirano, D.; Swank, J.H.; in 't Zand, J.

    2008-01-01

    Following reports of bursting activity of IGR J17473-2721 (= XTE J1747-274) by the AGILE team (Del Monte et al., ATEL #1445) and from Swift (Altamirano et al., ATEL #1459), we note that RXTE PCA monitoring scans of the source also reveal persistent activity. Scans on 2008-03-28 at 18:50 UT and

  8. Canards in a minimal piecewise-linear square-wave burster

    Energy Technology Data Exchange (ETDEWEB)

    Desroches, M.; Krupa, M. [Inria Sophia-Antipolis Méditerranée Research Centre, MathNeuro Project-Team 2004 route des Lucioles BP 93, 06902 Valbonne Cedex (France); Fernández-García, S., E-mail: soledad@us.es [Departamento EDAN, University of Seville, Facultad de Matemáticas C/ Tarfia, s/n., 41012 Sevilla (Spain)

    2016-07-15

    We construct a piecewise-linear (PWL) approximation of the Hindmarsh-Rose (HR) neuron model that is minimal, in the sense that the vector field has the least number of linearity zones, in order to reproduce all the dynamics present in the original HR model with classical parameter values. This includes square-wave bursting and also special trajectories called canards, which possess long repelling segments and organise the transitions between stable bursting patterns with n and n + 1 spikes, also referred to as spike-adding canard explosions. We propose a first approximation of the smooth HR model, using a continuous PWL system, and show that its fast subsystem cannot possess a homoclinic bifurcation, which is necessary to obtain proper square-wave bursting. We then relax the assumption of continuity of the vector field across all zones, and we show that we can obtain a homoclinic bifurcation in the fast subsystem. We use the recently developed canard theory for PWL systems in order to reproduce the spike-adding canard explosion feature of the HR model as studied, e.g., in Desroches et al., Chaos 23(4), 046106 (2013).

  9. Swift follow-up of the newly discovered burster millisecond pulsar IGR J17511-3057

    DEFF Research Database (Denmark)

    Bozzo, E.; Ferrigno, C.; Kuulkers, E.

    2009-01-01

    Following the discovery of the new hard X-ray transient IGR J17511-3057 by INTEGRAL (Atel #2196) and its classification as a millisecond pulsar by RXTE (Atel #2197), a Swift ToO was performed. Swift/XRT observed IGR J17511-3057 on 2009-09-13 at 19:53:31 for a total exposure time of 4 ks. The first...

  10. & G.S. K. Dzoagbe4

    African Journals Online (AJOL)

    light soup with hot pepper served at some of the drinking bars. Figure 1 shows the frequency of meat consumption. It was clear that majority of the respondents eighty~two percent (82%) consumed meat with drink occasionally. They said that money was the limiting factor. Both meat and alcoholic beverages were expensive ...

  11. Saka, MG, Zarto, ST and Gawaisa, GS

    African Journals Online (AJOL)

    ALBARKA

    becoming extinct as a result of changes in their natural habitats. An environmental organization called Friends of the Earth has identified. Nigeria as one of the areas where tropical rain forest is being lost at the rate of over 402,000 hectares per annum. This is a serious threat to our tropical rain forest wildlife heritage (NEST,.

  12. & G.S. K. Dzoagbe4

    African Journals Online (AJOL)

    energy (Southgate et al., 1990),. In the Tamale Metropolis, like any other towns and cities, the consumption of meat with alcoholic and non~alcoholic beverages is assuming a greater dimension. Thus most drinking bar operators sell meat to attract more customers. This implies that selling meat alongside beverages means ...

  13. Measurement of Absolute Concentrations of Individual Compounds in Metabolite Mixtures by Gradient-Selective Time-Zero 1H-13C HSQC (gsHSQC0) with Two Concentration References and Fast Maximum Likelihood Reconstruction Analysis

    Science.gov (United States)

    Hu, Kaifeng; Ellinger, James J.; Chylla, Roger A.; Markley, John L.

    2011-01-01

    Time-zero 2D 13C HSQC (HSQC0) spectroscopy offers advantages over traditional 2D NMR for quantitative analysis of solutions containing a mixture of compounds because the signal intensities are directly proportional to the concentrations of the constituents. The HSQC0 spectrum is derived from a series of spectra collected with increasing repetition times within the basic HSQC block by extrapolating the repetition time to zero. Here we present an alternative approach to data collection, gradient-selective time-zero 1H-13C HSQC0 in combination with fast maximum likelihood reconstruction (FMLR) data analysis and the use of two concentration references for absolute concentration determination. Gradient-selective data acquisition results in cleaner spectra, and NMR data can be acquired in both constant-time and non-constant time mode. Semi-automatic data analysis is supported by the FMLR approach, which is used to deconvolute the spectra and extract peak volumes. The peak volumes obtained from this analysis are converted to absolute concentrations by reference to the peak volumes of two internal reference compounds of known concentration: DSS (4,4-dimethyl-4-silapentane-1-sulfonic acid) at the low concentration limit (which also serves as chemical shift reference) and MES (2-(N-morpholino)ethanesulfonic acid) at the high concentration limit. The linear relationship between peak volumes and concentration is better defined with two references than with one, and the measured absolute concentrations of individual compounds in the mixture are more accurate. We compare results from semi-automated gsHSQC0 with those obtained by the original manual phase-cycled HSQC0 approach. The new approach is suitable for automatic metabolite profiling by simultaneous quantification of multiple metabolites in a complex mixture. PMID:22029275

  14. Performance evaluation of the Bio-Rad Laboratories GS HIV Combo Ag/Ab EIA, a 4th generation HIV assay for the simultaneous detection of HIV p24 antigen and antibodies to HIV-1 (groups M and O) and HIV-2 in human serum or plasma.

    Science.gov (United States)

    Bentsen, Christopher; McLaughlin, Lisa; Mitchell, Elizabeth; Ferrera, Carol; Liska, Sally; Myers, Robert; Peel, Sheila; Swenson, Paul; Gadelle, Stephane; Shriver, M Kathleen

    2011-12-01

    A multi-center study was conducted to evaluate the Bio-Rad GS HIV Combo Ag/Ab EIA, a 4th generation HIV-1/HIV-2 assay for the simultaneous detection of HIV p24 antigen and antibodies to HIV-1 (groups M and O) and HIV-2 in human serum or plasma in adult and pediatric populations. The objectives of the study were to assess assay performance for the detection of acute HIV infections; sensitivity in known HIV positive samples; percent agreement with HIV status; specificity in low and high risk individuals of unknown HIV status; and to compare assay performance to a 3rd generation HIV assay. The evaluation included testing 9150 samples at four U.S. clinical trial sites, using three kit lots. Unlinked samples were from routine testing, repositories or purchased from vendors. GS HIV Combo Ag/Ab EIA detection in samples from individuals in two separate populations with acute HIV infection was 95.2% (20/21) and 86.4% (38/44). Sensitivity was 100% (1603/1603) in known antibody positive [HIV-1 Groups M and O, and HIV-2] samples. HIV p24 antigen detection was 100% (53/53) in HIV-1 culture supernatants. HIV-1 seroconversion panel detection improved by a range of 0-20 days compared to a 3rd generation HIV test. Specificity was 99.9% (5989/5996) in low risk, 99.9% (959/960) in high risk and 100% (100/100) in pediatric populations. The GS HIV Combo Ag/Ab EIA significantly reduced the diagnostic window when compared to the 3rd generation screening assay, enabling earlier diagnosis of HIV infection. The performance parameters of the Bio-Rad GS HIV Combo Ag/Ab EIA are well suited for use in HIV diagnostic settings. Copyright © 2011 Elsevier B.V. All rights reserved.

  15. Performance comparison of the 4th generation Bio-Rad Laboratories GS HIV Combo Ag/Ab EIA on the EVOLIS™ automated system versus Abbott ARCHITECT HIV Ag/Ab Combo, Ortho Anti-HIV 1+2 EIA on Vitros ECi and Siemens HIV-1/O/2 enhanced on Advia Centaur.

    Science.gov (United States)

    Mitchell, Elizabeth O; Stewart, Greg; Bajzik, Olivier; Ferret, Mathieu; Bentsen, Christopher; Shriver, M Kathleen

    2013-12-01

    A multisite study was conducted to evaluate the performance of the Bio-Rad 4th generation GS HIV Combo Ag/Ab EIA versus Abbott 4th generation ARCHITECT HIV Ag/Ab Combo. The performance of two 3rd generation EIAs, Ortho Diagnostics Anti-HIV 1+2 EIA and Siemens HIV 1/O/2 was also evaluated. Study objective was comparison of analytical HIV-1 p24 antigen detection, sensitivity in HIV-1 seroconversion panels, specificity in blood donors and two HIV false reactive panels. Analytical sensitivity was evaluated with International HIV-1 p24 antigen standards, the AFFSAPS (pg/mL) and WHO 90/636 (IU/mL) standards; sensitivity in acute infection was compared on 55 seroconversion samples, and specificity was evaluated on 1000 negative blood donors and two false reactive panels. GS HIV Combo Ag/Ab demonstrated better analytical HIV antigen sensitivity compared to ARCHITECT HIV Ag/Ab Combo: 0.41 IU/mL versus 1.2 IU/mL (WHO) and 12.7 pg/mL versus 20.1 pg/mL (AFSSAPS); GS HIV Combo Ag/Ab EIA also demonstrated slightly better specificity compared to ARCHITECT HIV Ag/Ab Combo (100% versus 99.7%). The 4th generation HIV Combo tests detected seroconversion 7-11 days earlier than the 3rd generation HIV antibody only EIAs. Both 4th generation immunoassays demonstrated excellent performance in sensitivity, with the reduction of the serological window period (7-11 days earlier detection than the 3rd generation HIV tests). However, GS HIV Combo Ag/Ab demonstrated improved HIV antigen analytical sensitivity and slightly better specificity when compared to ARCHITECT HIV Ag/Ab Combo assay, with higher positive predictive values (PPV) for low prevalence populations. Copyright © 2013 Elsevier B.V. All rights reserved.

  16. Emergence of hepatitis C virus NS5A L31V plus Y93H variant upon treatment failure of daclatasvir and asunaprevir is relatively resistant to ledipasvir and NS5B polymerase nucleotide inhibitor GS-558093 in human hepatocyte chimeric mice.

    Science.gov (United States)

    Kai, Yugo; Hikita, Hayato; Tatsumi, Tomohide; Nakabori, Tasuku; Saito, Yoshinobu; Morishita, Naoki; Tanaka, Satoshi; Nawa, Takatoshi; Oze, Tsugiko; Sakamori, Ryotaro; Yakushijin, Takayuki; Hiramatsu, Naoki; Suemizu, Hiroshi; Takehara, Tetsuo

    2015-11-01

    Resistance-associated variants (RAVs) emerge at multiple positions spanning hepatitis C virus (HCV) NS3/4A and NS5A regions upon failure of asunaprevir/daclatasvir combination therapy. It has not been determined whether the emergence of such RAVs have an impact on re-treatment by a combination of ledipasvir and sofosbuvir, a potent regimen for HCV genotype 1 infection. TK-NOG human hepatocyte chimeric mice were inoculated with sera from a patient with treatment failure of asunaprevir/daclatasvir therapy. They developed persistent HCV infection with triple variants of NS3/4A D168V, NS5A L31V plus Y93H. Administration of ledipasvir/GS-558093 (a NS5B nucleotide analog) in these mice failed to achieve end-of-treatment response or sustained virologic response, which was in sharp contrast to the results in mice with wild-type virus infection. The administration of telaprevir/GS-558093 successfully achieved it in those mice. Treatment failure with asunaprevir/daclatasvir may limit further treatment options. This population may represent a growing unmet medical need.

  17. Noise, transient dynamics, and the generation of realistic interspike interval variation in square-wave burster neurons

    Science.gov (United States)

    Marin, Bóris; Pinto, Reynaldo Daniel; Elson, Robert C.; Colli, Eduardo

    2014-10-01

    First return maps of interspike intervals for biological neurons that generate repetitive bursts of impulses can display stereotyped structures (neuronal signatures). Such structures have been linked to the possibility of multicoding and multifunctionality in neural networks that produce and control rhythmical motor patterns. In some cases, isolating the neurons from their synaptic network reveals irregular, complex signatures that have been regarded as evidence of intrinsic, chaotic behavior. We show that incorporation of dynamical noise into minimal neuron models of square-wave bursting (either conductance-based or abstract) produces signatures akin to those observed in biological examples, without the need for fine tuning of parameters or ad hoc constructions for inducing chaotic activity. The form of the stochastic term is not strongly constrained and can approximate several possible sources of noise, e.g., random channel gating or synaptic bombardment. The cornerstone of this signature generation mechanism is the rich, transient, but deterministic dynamics inherent in the square-wave (saddle-node and homoclinic) mode of neuronal bursting. We show that noise causes the dynamics to populate a complex transient scaffolding or skeleton in state space, even for models that (without added noise) generate only periodic activity (whether in bursting or tonic spiking mode).

  18. Observational evidence for strange matter in compact objects from the x-ray burster 4U 1820-30

    Energy Technology Data Exchange (ETDEWEB)

    Bombaci, I. [Dipartimento di Fisica, Universita di Pisa and INFN Sezione di Pisa, Piazza Torricelli 2, I-56100 Pisa (Italy)

    1997-03-01

    We present systematic calculations of the mass-radius (MR) relation of a neutron star (NS) using a large variety of modern equations of state (EOS) of dense matter. The role of strangeness on the EOS and on the MR relation is particularly emphasized. Theoretical results are then compared with the semiempirical MR relation recently extracted for the x-ray burst source 4U 1820-30. Based on this comparison, we propose that the compact object in 4U 1820-30 is a kaon-condensed nucleon star or a strange star. {copyright} {ital 1997} {ital The American Physical Society}

  19. IGR J17445-2747—Yet another X-ray burster in the galactic bulge

    Science.gov (United States)

    Mereminskiy, I. A.; Grebenev, S. A.; Sunyaev, R. A.

    2017-10-01

    The discovery of a type I X-ray burst from the faint unidentified transient source IGR J17445-2747 in the Galactic bulge by the JEM-X telescope onboard the INTEGRAL observatory is reported. Type I bursts are believed to be associated with thermonuclear explosions of accreted matter on the surface of a neutron star with a weak magnetic field in a low-mass X-ray binary. Thus, this observation allows the nature of this source to be established.

  20. Behind the scenes of GS: CERN’s beating heart

    CERN Multimedia

    Antonella Del Rosso

    2014-01-01

    Founded at the same time as CERN, the library has followed, and sometimes even moved ahead of, the changes in the Organization. Today, far from being a simple book depository, the Scientific Information Service (SIS) that manages CERN's library is increasingly digitising its material and investing in innovative projects, such as Open Access.   Ever since it was set up in Building 52 on 1 September 1957, the library has played a vital role in the Organization.  “Our only official task is to provide a complete list of the publications by CERN researchers, but, in fact, this place is the memory bank of the whole Laboratory,” emphasises Tullio Basaglia, head of the Library Section within SIS.  “The role of the library and archives is to preserve, document and disseminate the knowledge produced at CERN.” Sixty years after its creation, the library today contains 90,000 books, two thirds of which are available in a digital ...

  1. Body Segment Parameters During GS Turn in Recreational Skiers

    Directory of Open Access Journals (Sweden)

    Mijo Curic

    2017-06-01

    Full Text Available Study aim was to analyze the kinematic parameters of the body of the examinees, without competitive experience in skiing, in order to determine the competitive efficiency. The participants in this research were 23 male students from the Faculty of physical education and sport, aged 22±6 months, who attended the classes in the subject alpine skiing. Examinees were divided into two categories, according to duration of the course run, in order to determine whether there is the differences in body segment parameters during giant slalom turn. Using Independent Samples t-test we see that the examinees differ on a statistically significant level in variables duration of the turn p=0.000, duration of the course run p=0.000 and inclination of the body p=0.030, and that the differences are in favor of faster examinees. The analysis of the results in this research has shown that there is a relation between the measured body segment parameters and duration of the course run, or that the technique of skiing has a direct impact on the competition in alpine skiing.

  2. Behind the scenes of GS: Mapping the future of CERN

    CERN Multimedia

    Sophie Louise Hetherton

    2014-01-01

    Focus on the Future Accelerator Studies (FAS) section at CERN who carry out the civil engineering studies for the Laboratory’s future scientific facilities.   The Future Accelerator Studies (FAS) section co-ordinates the civil engineering and infrastructure studies for large-scale future physics projects. These include projects due to complete in a couple of years such as AWAKE, but also projects planned for ten years’ time such as the High Luminosity LHC (HL-LHC) or even longer term projects such as the Future Circular Collider (FCC), for which approval is still pending. “CERN needs to be able to study the feasibility and assess the risks of future projects, even though they are not all fully approved,” explains John Osborne, Head of the FAS section, which also includes two fellows and one technical student. “Our small team works closely with other groups across CERN and with external companies to provide studies from a civil engineering poin...

  3. 606-IJBCS-Article- G.S Bimenya

    African Journals Online (AJOL)

    DR GATSING

    http://indexmedicus.afro.who.int. Does resistance of Anopheles mosquitoes to knock-out effect of DDT deter the ... Africa South of the Sahara, at least six organizations formed a partnership called the African Network on Vector Resistance to insecticides (ANVR). ..... making loudly hostile noise, very different from the soothing ...

  4. Clenbuterol-Stimulated Glucose Uptake Activates both GS and GI ...

    African Journals Online (AJOL)

    In the later, β2-AR induces PKA-catalysed phosphorylation of the receptor, which intends couples to Gi, at high concentration. We proposed that, clenbuterol ... relieved the inhibitory effect. Keywords: PTX, Pertusis toxin, G-proteins, Guanine nucleotide binding proteins, β-AR, beta adrenoceptor, M2, muscarinic receptors ...

  5. Page 1 OMUMŲ OMENALA IGBO NA NGALABA GS NKE ...

    African Journals Online (AJOL)

    JONATHAN

    mma, n'ihi na o mere ka ajq ihe juputa ebe niile qkachas[ n'etiti nd[ ntorob[a, d[ ka izu ohi, itq,. Ka nd[ qcha wetachara agxmakwxkwq n'ala any[, a malitere mxwa ihe qmxmx d[ iche iche. N'oge a hafenyechara qch[ch[ n'aka nd[ ala any[, a gbachapxwa akxkx xfqdx d[ mkpa n'xlq enwez[ n'oge ugbu a ezuchagh[ ezu d[ ka q d[ ...

  6. Innovative approach to replace concrete aqueducts at Kakabeka Falls GS

    Energy Technology Data Exchange (ETDEWEB)

    Chidiac, M. [Stone and Webster Canada, Toronto, ON (Canada); Dunphy, J. [Aker Maritime Kiewit Contractors, St. John' s, NF (Canada); Young, L. [Exebridge Project Services, Toronto, ON (Canada)

    2004-09-01

    The original facilities of the Kakabeka Falls generating station on the Kaministikwia River west of Thunder Bay, Ontario were constructed between 1906 and 1914. They included 3 low pressure, reinforced concrete aqueducts that measured 3.1 meter in diameter and 1980 meters long to carry water to a powerhouse containing 4 generators. In 1994, the aqueducts were deemed to be at the end of their service life and required replacement to avoid a failure which would potentially cause serious environmental damage, pose a threat to public safety and result in a severe loss of generation production. Several alternative water transport systems were considered to replace the aqueducts. One single 5 meter diameter aqueduct made of cast-in-place reinforced concrete was chosen to replace the 3 aging aqueducts. Replacement of the aqueduct began in May 1997 and work was completed on schedule 7 months later. The generating station returned to service in early 1998. The new aqueduct has performed excellently during its 6 years in service and does not show any evidence of concrete deficiencies such as cracks or erosions. Some minor repairs were made to the elastomeric seal membrane at a few joints where some delamination occurred but with no leakage path developing. The new aqueduct is expected to last nearly 100 years. 12 figs.

  7. Behind the scenes of GS: health in the workplace

    CERN Multimedia

    CERN Bulletin

    2014-01-01

    CERN has had its own Medical Service since 1965. Open to members of the personnel, users and visitors, the team offers care and advice with professionalism and commitment.   The Medical Service team, currently consisting of three doctors, four nurses, a lab technician, a psychologist and two administrative assistants, provides an ever-increasing number of consultations. In 2013, around 7800 people were seen by the Medical Service, mainly at walk-in consultations, and more than 6665 further tests were performed (e.g. electrocardiograms, hearing tests, lung function tests, urine tests, blood tests). While its chief objective is to monitor the health of the CERN community in relation to their work through regular medical check-ups, the Medical Service also performs an important primary care function: “More than 10,000 people work in CERN’s offices, workshops, tunnels and worksites every day. As in any community of that size, sometimes certain situations arise that demand imme...

  8. FRENCH LANGUAGE: A BASIC G.S COURSE FOR NNAMDI ...

    African Journals Online (AJOL)

    JONATHAN

    2016-07-01

    Jul 1, 2016 ... French language is an international language and the official language of the four countries that surround ... in French, the language is only taught as a service course to five departments irrespective of the NUC ... man from these countries has a good knowledge of two international languages (English and.

  9. Molecular Characterization of 2-Chlorobiphenyl Degrading Stenotrophomonas maltophilia GS-103

    Digital Repository Service at National Institute of Oceanography (India)

    Somaraja, P.K.; Gayathri, D.; Ramaiah, N.

    ). The injector temperature was programmed from 100 (0.1 min) to 270�C at 200�C/min (3 min), and as carrier gas helium was used. Column head pressure 103 Pa was maintained. The GC– MS was operated in the electron impact ionization mode (70 eV) at the filament... pathway have broad substrate specificity, allowing the bacteria to simultaneously co metabolize PCB. Degradation begins with the attack of biphenyl dioxygenase on an unsubsti- tuted 2,3 position of biphenyl ring and thus formed dihy- droxy metabolites...

  10. Behind the scenes of GS: cross-platform

    CERN Multimedia

    Katarina Anthony

    2014-01-01

    The year was 1989: the dawn of administrative computing. In a laboratory filled to the rafters with paperwork, CERN's then Director-General Carlo Rubbia saw an opportunity for a complete administrative overhaul. He established the Advanced Information Systems (AIS) project to analyse CERN's administration, which in turn suggested the Electronic Document Handling (EDH) system. By 1992, EDH was up and running - the start of a new chapter in CERN history.   If you think you've never come accross EDH, think again. The system is an integral part of CERN life, handling everything from the purchase of materials to leave requests. EDH sees you through your entire CERN life: from your first CERN job application to your final retirement checklist. One platform, sixty-five functions What makes EDH so special is its solitary nature: it is one platform that carries out dozens of varied functions. "Most companies organise their administration in 'vertical' ...

  11. GS Igbo: Better late than the late | Chinagorom | Mgbakoigba ...

    African Journals Online (AJOL)

    The neglect of “Mother tongue” has always been viewed as a dangerous signal in the advancement of scholarship in Africa, since the advent of the Western education. The problem of course-specialization in the Nigerian Universities; ought to be reviewed because every university with a strong scientific bias, tends towards ...

  12. GS IGBO: BETTER LATE THAN THE LATE Longinus Chukwuemeka ...

    African Journals Online (AJOL)

    JONATHAN

    The neglect of “Mother tongue” has always been viewed as a dangerous signal in the advancement of scholarship in Africa, since the advent of the Western education. The problem of course-specialization in the Nigerian Universities; ought to be reviewed because every university with a strong scientific bias, tends towards ...

  13. GS o mirar los cuerpos sociales y emociones desde Georg Simmel

    Directory of Open Access Journals (Sweden)

    Maya Aguiluz Ibargüen

    2005-03-01

    Full Text Available El artículo pone de relieve los vínculos existentes entre las claves de Georg Simmel sobre la constitución de lo social y la socialidad respecto a los cambios tecnológicos, arreglos culturales, campos discursivos y estructuras de percepción que se entretejieron alcanzando la vida social de las ciudades europeas y de los circuitos moderno-capitalistas del siglo XIX.

  14. Latviešu literārā valoda 19. gs. 80.–90. gados

    Directory of Open Access Journals (Sweden)

    Aina Blinkena

    2011-11-01

    Full Text Available LETTISCHE SCHRIFTSPRACHE IN DEN 80.–90. J. DES 20. JHZusammenfassungDie Entwicklung der lettischen Schriftsprache hat sich in ihren verschiedenen Bestehungsetappen nicht gleichartig breit erforscht geworden.Die Sprache den letzten Jahrzehnten des 19. Jh. haben die Sprachwissenschaftler weniger Aufmerksamkeit geschenkt, doch in dieser Zeit vollziehen sich aktive Prozesse, die zur heutige Sprachnorm füren.In diesen Jahren hat sich die nationale Kultur gebildet, es entsteht und entwickelt sich die Literatur verschiedener Genres und Stile, die zur Klassik der lettischen Literatur geworden ist, es entwickelt sich schnell das Buchwesen. In 1886–1900 sind mehr als 3500 Titel von Büchern herausgegeben, es bestehen 100 Verlage.Große Rolle für die Erforschung und Pflege des Lettischen hat die Wissenschaftliche Kommission des Rigaer Lettischen Vereins (gegr. 1868 gespielt, die die orthographischen Prinzipien vervollkommen hat und in den von der Kommission herausgegebenen Schriften wurden die theoretischen Forschungen über die lettischen Sprache veröffentlicht. Es bildete sich die wissenschaftliche Terminologie. Die Arbeit haben die ersten akademisch gebildeten Sprachwissenschaftler der lettischen Nation K. Mühlenbach, J. Kauliņš, J. Endzelīns, P. Šmits begonnen, deren Werke als eine Brücke zum 20. Jahrhundert führt.

  15. A phylogenomic gene cluster resource: The phylogeneticallyinferred groups (PhlGs) database

    Energy Technology Data Exchange (ETDEWEB)

    Dehal, Paramvir S.; Boore, Jeffrey L.

    2005-08-25

    We present here the PhIGs database, a phylogenomic resource for sequenced genomes. Although many methods exist for clustering gene families, very few attempt to create truly orthologous clusters sharing descent from a single ancestral gene across a range of evolutionary depths. Although these non-phylogenetic gene family clusters have been used broadly for gene annotation, errors are known to be introduced by the artifactual association of slowly evolving paralogs and lack of annotation for those more rapidly evolving. A full phylogenetic framework is necessary for accurate inference of function and for many studies that address pattern and mechanism of the evolution of the genome. The automated generation of evolutionary gene clusters, creation of gene trees, determination of orthology and paralogy relationships, and the correlation of this information with gene annotations, expression information, and genomic context is an important resource to the scientific community.

  16. Pharmacokinetics of Long-Acting Tenofovir Alafenamide (GS-7340) Subdermal Implant for HIV Prophylaxis

    Science.gov (United States)

    Gunawardana, Manjula; Remedios-Chan, Mariana; Miller, Christine S.; Fanter, Rob; Yang, Flora; Marzinke, Mark A.; Hendrix, Craig W.; Beliveau, Martin; Moss, John A.; Smith, Thomas J.

    2015-01-01

    Oral or topical daily administration of antiretroviral (ARV) drugs to HIV-1-negative individuals in vulnerable populations is a promising strategy for HIV-1 prevention. Adherence to the dosing regimen has emerged as a critical factor determining efficacy outcomes of clinical trials. Because adherence to therapy is inversely related to the dosing period, sustained release or long-acting ARV formulations hold significant promise for increasing the effectiveness of HIV-1 preexposure prophylaxis (PrEP) by reducing dosing frequency. A novel, subdermal implant delivering the potent prodrug tenofovir alafenamide (TAF) with controlled, sustained, zero-order (linear) release characteristics is described. A candidate device delivering TAF at 0.92 mg day−1 in vitro was evaluated in beagle dogs over 40 days for pharmacokinetics and preliminary safety. No adverse events related to treatment with the test article were noted during the course of the study, and no significant, unusual abnormalities were observed. The implant maintained a low systemic exposure to TAF (median, 0.85 ng ml−1; interquartile range [IQR], 0.60 to 1.50 ng ml−1) and tenofovir (TFV; median, 15.0 ng ml−1; IQR, 8.8 to 23.3 ng ml−1), the product of in vivo TAF hydrolysis. High concentrations (median, 512 fmol/106 cells over the first 35 days) of the pharmacologically active metabolite, TFV diphosphate, were observed in peripheral blood mononuclear cells at levels over 30 times higher than those associated with HIV-1 PrEP efficacy in humans. Our report on the first sustained-release nucleoside reverse transcriptase inhibitor (NRTI) for systemic delivery demonstrates a successful proof of principle and holds significant promise as a candidate for HIV-1 prophylaxis in vulnerable populations. PMID:25896688

  17. Transcriptome sequencing and de novo analysis of the copepod Calanus sinicus using 454 GS FLX.

    Directory of Open Access Journals (Sweden)

    Juan Ning

    Full Text Available BACKGROUND: Despite their species abundance and primary economic importance, genomic information about copepods is still limited. In particular, genomic resources are lacking for the copepod Calanus sinicus, which is a dominant species in the coastal waters of East Asia. In this study, we performed de novo transcriptome sequencing to produce a large number of expressed sequence tags for the copepod C. sinicus. RESULTS: Copepodid larvae and adults were used as the basic material for transcriptome sequencing. Using 454 pyrosequencing, a total of 1,470,799 reads were obtained, which were assembled into 56,809 high quality expressed sequence tags. Based on their sequence similarity to known proteins, about 14,000 different genes were identified, including members of all major conserved signaling pathways. Transcripts that were putatively involved with growth, lipid metabolism, molting, and diapause were also identified among these genes. Differentially expressed genes related to several processes were found in C. sinicus copepodid larvae and adults. We detected 284,154 single nucleotide polymorphisms (SNPs that provide a resource for gene function studies. CONCLUSION: Our data provide the most comprehensive transcriptome resource available for C. sinicus. This resource allowed us to identify genes associated with primary physiological processes and SNPs in coding regions, which facilitated the quantitative analysis of differential gene expression. These data should provide foundation for future genetic and genomic studies of this and related species.

  18. A study of stress in medical students at Seth G.S. Medical College.

    Science.gov (United States)

    Supe, A N

    1998-01-01

    It is usually observed that medical students undergo tremendous stress during various stages of the MBBS course. There is a high rate of suicide among them. To determine incidence of stress and factors controlling stress in medical students at various stages of MBBS course at Seth G S Medical college, 238 students (First year 98, Second 76, Third 64) were asked to complete a questionnaire on personal data (gender, stay at hostel, mode of travel, time spent in travel every day, medium of study in school, place of school education.), Stress inducing factors, Zung's depression scale, ways of coping, stress relievers, perceived social support and personality type. Statistical tests used were ANOVA, critical ratio and Student's 't' test. Majority of medical students (175/238--73%) perceived stress. Stress was found to be significantly more in Second and Third MBBS students rather than First MBBS levels (p students having more than 95% of marks at 12th Standard as compared to others. Academic factors were greater perceived cause of stress in medical students. There was no significant difference in the students at different levels of MBBS regarding academic factors and social factors as a stress inducing factors. Physical factors were found to be significantly more in Second and Third MBBS students as compared to First MBBS students. Emotional factors were found to be significantly more in First MBBS students as compared to Second & Third MBBS students. Stress was more common in medical students who have dominant strategy of coping as positive reappraisal, accepting responsibility and planful problem solving. Stress was less common in medical students at Seth G S Medical College who have dominant strategy of coping as escaping and distancing from difficult situation. Family and Friend as perceived social supports were more in Second MBBS than First MBBS medical students. Stress was not found to be significantly more in students having their personality factor contributing to stress (Type A--52/67) as compared to others (Type B--123/171). This indicates that the stress was not trait oriented but was process oriented (p = NS). Stress in medical students is common and is process oriented. It is more in second and third year. Academic factors are greater perceived cause of stress in medical students at Seth G S medical college. Emotional factors are found to be significantly more in First MBBS. It is dependent on person's ways of coping and social support.

  19. Natural analogue synthesis report, TDR-NBS-GS-000027 rev00 icn02

    Energy Technology Data Exchange (ETDEWEB)

    Simmons, A.; Nieder-Westermann, G.; Stuckless, J.; Dobson, P.; Unger, A.J.A.; Kwicklis, E.; Lichtner, P.; Carey, B.; Wolde, G.; Murrel,M.; Kneafsey, T.J.; Meijer, A.; Faybishenko, B.

    2002-04-01

    The purpose of this report is to present analogue studies and literature reviews designed to provide qualitative and quantitative information to test and provide added confidence in process models abstracted for performance assessment (PA) and model predictions pertinent to PA. This report provides updates to studies presented in the Yucca Mountain Site Description (CRWMS M&O 2000 [151945], Section 13) and new examples gleaned from the literature, along with results of quantitative studies conducted specifically for the Yucca Mountain Site Characterization Project (YMP). The intent of the natural analogue studies was to collect corroborative evidence from analogues to demonstrate additional understanding of processes expected to occur during postclosure at a potential Yucca Mountain repository. The report focuses on key processes by providing observations and analyses of natural and anthropogenic (human-induced) systems to improve understanding and confidence in the operation of these processes under conditions similar to those that could occur in a nuclear waste repository. The process models include those that represent both engineered and natural barrier processes. A second purpose of this report is to document the various applications of natural analogues to geologic repository programs, focusing primarily on the way analogues have been used by the YMP. This report is limited to providing support for PA in a confirmatory manner and to providing corroborative inputs for process modeling activities. Section 1.7 discusses additional limitations of this report. Key topics for this report are analogues to emplacement drift degradation, waste form degradation, waste package degradation, degradation of other materials proposed for the engineered barrier, seepage into drifts, radionuclide flow and transport in the unsaturated zone (UZ), analogues to coupled thermal-hydrologic-mechanical-chemical processes, saturated zone (SZ) transport, impact of radionuclide release on the biosphere, and potentially disruptive events. Results of these studies will be used to corroborate estimates of the magnitude and limitation of operative processes in order to build realism into conceptual and numerical process models used as a foundation for PA in the representative case of postclosure safety.

  20. Constitutive expression, purification and characterization of bovine prochymosin in Pichia pastoris GS115.

    Science.gov (United States)

    Jiang, X P; Yin, M L; Chen, P; Yang, Q

    2012-05-01

    Chymosin can specifically break down the Phe105-Met106 peptide bond of milk κ-casein to form insoluble para-κ-casein, resulting in milk coagulation, a process that is used in making cheese. In this study, in order to obtain an alternative milk coagulant which is safe and efficient, and simultaneously can produce cheese with a good taste, bovine prochymosin B was chosen and constitutively expressed to a high level in Pichia pastoris. The recombinant chymosin was expressed mainly as a secretory form, and it exhibited milk-clotting activity. It was purified by ammonium sulfate fractionation, anion exchange, followed by cation exchange chromatography. A final yield of 24.2% was obtained for the purified enzyme, which appeared as a single band in SDS-PAGE having a molecular mass of approximate 36 kDa. Proteolysis assay showed that it specifically hydrolyzed κ-casein. It was stable at 25-50°C and had optimal activity at 37°C and pH 4.0. The activity of the recombinant chymosin was activated by cations such as Mn(2+), Fe(3+), Mg(2+) and Na(+), but inhibited by K(+), Co(2+), Zn(2+), Ni(2+), and to a lesser extent by Cu(2+). These results suggested that recombinant bovine chymosin is an acid milk coagulant, and it could be considered as a safe and efficient enzyme suitable for use in cheese production.

  1. Cases and Materials on Women and the Law for GS 200: Introduction to Women's Studies.

    Science.gov (United States)

    Knowles, Marjorie Fine, Ed.

    Cases and materials used in an undergraduate course, "Women and the Law," are divided to cover women and the Constitution of the U.S. (including the Equal Rights Amendment), the Supreme Court Abortion Decision, and the contemporary legal status of women including employment, education, and criminal law. Fifteen cases highlight the issues…

  2. Ọmụmụ omenala Igbo na ngalaba GS nke mmahadum ọ ka: Uru ...

    African Journals Online (AJOL)

    It was observed that some tribes in Nigeria such as Igbo people have delegated their cultural way of bringing-up their children to the background because of civilization and this is why corruption and immoral life have become the order of the day. That is, the good morals and values Nigerians in general and Igbo people in ...

  3. Therapeutic Efficacy of the Small Molecule GS-5734 against Ebola virus in Rhesus Monkeys

    Science.gov (United States)

    2016-03-02

    yellow fever virus, dengue virus type 2), parainfluenza type 3, and severe 124 acute respiratory syndrome (SARS) associated coronavirus but little or...Culture Collection. HEp-2 cells were cultured in Eagle’s Minimum Essential Media (MEM) 409 with GlutaMAX TM supplemented with 10% fetal bovine

  4. Review of the stoping problem - GS Review of past work rockbreaking

    CSIR Research Space (South Africa)

    Pickering, RGB

    1988-03-01

    Full Text Available supplemented by studies of work carried out by others, both in South Africa and overseas. The document has been prepared as part of a process of critically reviewing what progress has been made in solving the stoping problem and forms the basis for determining...

  5. A study of stress in medical students at Seth G.S. Medical College.

    Directory of Open Access Journals (Sweden)

    Supe A

    1998-01-01

    Full Text Available BACKGROUND: It is usually observed that medical students undergo tremendous stress during various stages of the MBBS course. There is a high rate of suicide among them. METHODS: To determine incidence of stress and factors controlling stress in medical students at various stages of MBBS course at Seth G S Medical college, 238 students (First year 98, Second 76, Third 64 were asked to complete a questionnaire on personal data (gender, stay at hostel, mode of travel, time spent in travel every day, medium of study in school, place of school education., Stress inducing factors, Zung′s depression scale, ways of coping, stress relievers, perceived social support and personality type. Statistical tests used were ANOVA, critical ratio and Student′s ′t′ test. RESULTS: Majority of medical students (175/238--73% perceived stress. Stress was found to be significantly more in Second and Third MBBS students rather than First MBBS levels (p < 0.05. Stress was not found to differ significantly on the basis of sex, stay at hostel, model of travel, time spent in travel every day, medium of study in school, place of school education. Stress was found to be significantly more in students having more than 95% of marks at 12th Standard as compared to others. Academic factors were greater perceived cause of stress in medical students. There was no significant difference in the students at different levels of MBBS regarding academic factors and social factors as a stress inducing factors. Physical factors were found to be significantly more in Second and Third MBBS students as compared to First MBBS students. Emotional factors were found to be significantly more in First MBBS students as compared to Second & Third MBBS students. Stress was more common in medical students who have dominant strategy of coping as positive reappraisal, accepting responsibility and planful problem solving. Stress was less common in medical students at Seth G S Medical College who have dominant strategy of coping as escaping and distancing from difficult situation. Family and Friend as perceived social supports were more in Second MBBS than First MBBS medical students. Stress was not found to be significantly more in students having their personality factor contributing to stress (Type A--52/67 as compared to others (Type B--123/171. This indicates that the stress was not trait oriented but was process oriented (p = NS. CONCLUSION: Stress in medical students is common and is process oriented. It is more in second and third year. Academic factors are greater perceived cause of stress in medical students at Seth G S medical college. Emotional factors are found to be significantly more in First MBBS. It is dependent on person′s ways of coping and social support.

  6. A validation study of the FocalPoint GS imaging system for gynecologic cytology screening.

    Science.gov (United States)

    Colgan, Terence J; Bon, Nereo; Clipsham, Susan; Gardiner, Geoffrey; Sumner, Jeff; Walley, Virginia; McLachlin, C Meg

    2013-04-01

    Studies of the performance of the automated FocalPoint Guided Screening (FPGS) imaging system in gynecologic cytology screening relative to manual screening have yielded conflicting results. In view of this uncertainty, a validation study of the FPGS was conducted before its potential adoption in 2 large laboratories in Ontario. After an intense period of laboratory training, a cohort of 10,233 current and seeded abnormal slides were classified initially by FPGS. Manual screening and reclassification blinded to the FPGS results were then performed. Any adequacy and/or cytodiagnostic discrepancy between the 2 screening methods subsequently was resolved through a consensus process (truth). The performance of each method's adequacy and cytodiagnosis vis-a-vis the truth was established. The sensitivity and specificity of each method at 4 cytodiagnostic thresholds (atypical squamous cells of undetermined significance or worse [ASC-US+], low-grade squamous intraepithelial lesion or worse [LSIL+], high-grade squamous intraepithelial lesion or worse [HSIL+], and carcinoma) were compared. The false-negative rate for each cytodiagnosis was determined. The performance of FPGS in detecting carcinoma, HSIL+, and LSIL+ was no different from the performance of manual screening, but the false-negative rates for LSIL and ASC-US were higher with FPGS than with manual screening. The results from this validation study in the authors' laboratory environment provided no evidence that FPGS has diagnostic performance that differs from manual screening in detecting LSIL+, HSIL+, or carcinoma. Copyright © 2012 American Cancer Society.

  7. 13"lEK/ 3ESJ>REKI~GS I 3t~ )K REVIE' /S:

    African Journals Online (AJOL)

    C. F. J. Muller: Leiers na die Noorde. Stud"es oar die Groot Trek. Kaapstad, 1976, 165 pp., met foto's, kaarte en register. Reeds jarelank beywer prof e1rC. F. J. Muller hom om, deur deeglike navorsing en insig- gewende beskrywings ons kennis oar die. Groot Trek en die Groot Trek-tydperk te ver- meerder, te verbreed en te ...

  8. A 4 GS/sec Instability Feedback Processing System for Intra-bunch Instabilities

    CERN Document Server

    Dusatko, J; Fox, J D; Pollock, K; Rivetta, C H; Turgut, O; Hofle, W

    2013-01-01

    We present the architecture and implementation overview of a proof-of-principle digital signal processing system developed to study control of Electron-Cloud and Transverse Mode Coupling Instabilities (TMCI) in the CERN SPS. This system is motivated by intensity increases planned as part of the High Luminosity LHC upgrade. It is based on a reconfigurable processing architecture which samples intra-bunch motion and applies correction signals at a 4GSa/s rate, allowing multiple samples across a single 3.2ns SPS bunch. This initial demonstration system is a rapidly developed prototype consisting of both commercial and custom- designed hardware that implements feedback control on a single bunch. It contains a high speed ADC and DAC, capable of sampling at up to 4GSa/s, with a 16-tap FIR control filter for each bunch sample slice. Other system features include a timing subsystem to synchronize the sampling to the injection and the bunch 1 markers, the capability of generating arbitrary time domain signals to drive...

  9. Optimization of a Modified GS Medium for a Probiotic Strain (L. acidophilus ATCC4356

    Directory of Open Access Journals (Sweden)

    N. Pedram

    2014-09-01

    Full Text Available Probiotics are defined as living microorganisms with beneficial effects on the host. Probiotics, according to the least negative effect on the body, are considered as a good alternative to chemical drugs. Lactobacillus acidophilus is used as a probiotic that is able to reduce cholesterol level in the blood. The effect of various concentrations of carbon, nitrogen and phosphorus for enhancing the biomass production of Lactobacillus acidophilus was examined. The response surface methodology based on Box–Wilson CCD was applied to explore the optimal medium composition. Glucose, yeast extract, K2HPO4 and KH2PO4 were selected as dependent variables. All experiments were run at 37°C for 31h under stationary conditions. By solving the regression equation and analyzing the response surface carton, optimal concentrations of the components were determined as glucose (5-8.75 g.l-1, yeast extract (36.75-39 g.l-1, K2HPO4 (0.1-0.2125 g.l-1 and KH2PO4 (0.3925-0.7075 g.l-1. Validation experiment confirmed that the optimized medium was comparable to the MRS medium (the most common medium for Lactobacillus acidophilus strain in biomass production, having the advantages of economy andpracticality.

  10. A study of stress in medical students at Seth G.S. Medical College.

    OpenAIRE

    Supe A

    1998-01-01

    BACKGROUND: It is usually observed that medical students undergo tremendous stress during various stages of the MBBS course. There is a high rate of suicide among them. METHODS: To determine incidence of stress and factors controlling stress in medical students at various stages of MBBS course at Seth G S Medical college, 238 students (First year 98, Second 76, Third 64) were asked to complete a questionnaire on personal data (gender, stay at hostel, mode of travel, time spent in travel every...

  11. SUPPORT OF MSA AND GS SHORT COURSES AND THE COMPANION REVIEWS VOLUMES

    Energy Technology Data Exchange (ETDEWEB)

    J Alex Speer

    2008-01-23

    Report on two short courses: [1] Fluid-fluid Equilibria in the Crust: Petrology - Geochemistry - Economic potential. August 16-17, 2007 preceding the Goldschmidt Conference in Cologne, Germany) and [2] Paleoaltimetry: Geochemical And Thermodynamic Approaches. October 26-27, 2007 (preceding the GSA Annual Meeting in Denver, Colorado)

  12. Development of a monoclonal antibody against glucosyltransferase D of Streptococcus mutans GS 5.

    Science.gov (United States)

    Kim, Mi-Ah; Yang, Yeon-Mi; So, Yu-Ryeo; Ko, Young-Han; Lim, Su-Min; Lee, Kyung-Yeol; Kim, Jae-Gon

    2011-08-01

    Glucosyltransferases GtfB, GtfC, and GtfD of Streptococcus mutans are virulent factors involved in dental caries. Consequently, they are considered to be target molecules in the development of vaccines against dental caries. Among them, GtfD plays a significant role in the sucrose-dependent cellular adhesion of S. mutans, and a number of studies have suggested that the N-terminus of GtfD is an important part of its role in enzymatic activity. In this study, we generated monoclonal antibodies against the N-terminus of GtfD (anti-GtfDN antibody) in an initial attempt to investigate its preventive efficacy against dental caries. To obtain anti-GtfDN monoclonal antibodies, the gene for the N-terminus of gtfD (2 kb) was cloned into an Escherichia coli expression vector, pQE30; then the expressed protein (about 75 kDa) was purified. The purified GtfDN protein was injected into BALB/c mice, and hybridoma clones were established. We obtained three hybridoma clones (HDN9, HDN11, and HDN28) capable of producing anti-GtfDN antibodies. Their binding specificity was characterized by ELISA, dot blot, and Western blot analysis after purification using affinity column chromatography. The isotype of the monoclonal antibodies was confirmed to be IgG2a.

  13. Zemgales arheoloģiskā pētniecība (19. gs. - 2006.)

    OpenAIRE

    Jantons, Krišjānis

    2007-01-01

    Zemgales senvietu arheoloģiska izpēte aizsākās 19. gadsimtā. Līdz Latvijas neatkarības iegūšanai ar arheoloģisko pētniecību galvenokārt nodarbojās vācbaltu profesori, mācītāji un citi aizvēstures entuziasti. Latvijas Republikas laikā arheoloģijas zinātne piedzīvoja strauju attīstību – izrakumi Zemgalē notika daudzos dažādos pieminekļos. Pieauga izrakumu veicēju profesionalitāte. Padomju okupācijas laikā saistībā ar lielo industrializāciju Zemgalē galvenokārt notiek aizsardzības izrakumi. Atja...

  14. X-Ray Transient in Musca (GRS 1121-68 = GS 1124-683)

    DEFF Research Database (Denmark)

    Lund, Niels; Brandt, Søren; Makino, F.

    1991-01-01

    Research Institute, Lyngby; and Space Research Institute, Moscow), report: "A new x-ray source in Musca, GRS 1121-68, has been discovered in data obtained by the WATCH detectors on Jan. 9. The spectrum of the source was harder than that of the Crab nebula, and the flux was about twice that from...

  15. A 12b 1.7GS/s two-times interleaved DAC with

    NARCIS (Netherlands)

    Olieman, E.; Annema, Anne J.; Nauta, Bram; Bal, Ankur; Singh, Pratap Narayan

    2013-01-01

    A two-times interleaved DAC using only a single supply voltage in a standard 65nm CMOS technology is presented. The interleaving architecture suppresses most of the non-idealities commonly found in high-speed DACs. Spurs generated by the interleaved architecture are suppressed by a novel calibration

  16. Cooper, H. (ed. (2013. Teaching History Creatively. Londres: Routledge. 185 págs.

    Directory of Open Access Journals (Sweden)

    Gil de Sola Bellas, Marta

    2015-12-01

    Full Text Available Teaching History Creatively es un libro orientado a los docentes cuya labor se desempeña principalmente durante los primeros años de la educación escolar, más concretamente los últimos años de Educación Infantil y toda la Educación Primaria, aunque también podría adaptarse a los niveles de enseñanza superiores. A través del mismo se pretende introducir a los do centes a la enseñanza de la historia de manera creativa a partir de la realización de investigaciones históricas aptas para el alumnado, de forma que se desarrolle su pensamiento histórico. Esto dotará a los alumnos de una serie de recursos esenciales para el adecuado aprendizaje de la historia, y permitiendo que éstos realicen su propia representación del pasado y analizar los hechos históricos desde un punto de vista crítico.

  17. Sup-Table 1 HMW-GS composition of the 151 wheat varieties in ...

    Indian Academy of Sciences (India)

    gzx

    Hebei Academy of Agricultural and Forestry Sciences. 2*. 6. 8. 2. 12. 4. Jimai 4. 1977b. Cao Village of Zhengding null 7. 8. 2. 12. 5. Jimai 5. 1977b. Baoding Agricultural Research Institute of Hebei. 2*. 7. 8. 2. 12. 6. Jimai 6. 1977b. Hengshui Agricultural Science Institute null 7. 9. 2. 12. 7. Jimai 7. 1977b. Sun Village Farm of ...

  18. Discovery and Synthesis of GS-5734, a Phosphoramidate Prodrug of a Pyrrolo [2,1 f][triazin 4 amino] Adenine C-Nucleoside (GS 5734) for the Treatment of Ebola and Emerging Viruses

    Science.gov (United States)

    2017-03-30

    J.; Furman, P. A. The Mechanism of Action of β-D-2′- Deoxy-2′-Fluoro-2′-C-Methylcytidine Involves a Second Metabolic Pathway Leading to β-D-2′-Deoxy...GlutaMAXTM supplemented with 10% fetal bovine serum (FBS) and 100 units/mL penicillin and streptomycin. HeLa cells were cultured in MEM supplemented...with 10% FBS, 1% l-glutamine, 10 mM HEPES, 1% non-essential amino acids, and 1% penicillin /streptomycin. The MT-4 cell line was obtained from the NIH

  19. Survivability of freeze-dried probiotic Pediococcus pentosaceus strains GS4, GS17 and Lactobacillus gasseri (ATCC 19992 during storage with commonly used pharmaceutical excipients within a period of 120 days

    Directory of Open Access Journals (Sweden)

    Mayur Bagad

    2017-10-01

    Conclusions: Commonly used excipients can be considered as a vehicle for delivering active principle in probiotic formulation and for sustaining the viability and stability of probiotic strains for a period of 120 d.

  20. Operational Data Report C&GS DR-8, Seismic Reflection Profiles Northern Bering Sea (NODC Accession 7000753)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — A series of seismic reflection profiles were taken aboard the USC&GSS SURVEYOR during the summer of 1969 as part of a general continental shelf survey in the...

  1. Evidence of a Black Hole in the X-Ray Transient GS 1354-64 (=BW Circini)

    NARCIS (Netherlands)

    Casares, J.; Zurita, C.; Shahbaz, T.; Charles, P.A.; Fender, R.P.

    2004-01-01

    We present the first radial velocity curve of the companion star to BW Cir that demonstrates the presence of a black hole in this X-ray transient that recorded outbursts in 1987 and 1997 (and possibly 1971-1972). We identify weak absorption features corresponding to a G0-5 III donor star, strongly

  2. An Assessment of Talent Management Practices Targeting GS-12/13 Level Members of the Army Acquisition Corps Workforce

    Science.gov (United States)

    2010-05-01

    organization is its people -- their skills and abilities. This asset is commonly referred to as intellectual capital or talent. Intellectual capital is a...the effectiveness of identifying, managing, sustaining, and retaining intellectual capital . Several research studies have investigated the practices...and effectiveness of managing intellectual capital and talent development in the commercial sector. This research project will conduct a similar study

  3. Maternal blood contamination of collected cord blood can be identified using DNA methylation at three CpGs.

    Science.gov (United States)

    Morin, Alexander M; Gatev, Evan; McEwen, Lisa M; MacIsaac, Julia L; Lin, David T S; Koen, Nastassja; Czamara, Darina; Räikkönen, Katri; Zar, Heather J; Koenen, Karestan; Stein, Dan J; Kobor, Michael S; Jones, Meaghan J

    2017-01-01

    Cord blood is a commonly used tissue in environmental, genetic, and epigenetic population studies due to its ready availability and potential to inform on a sensitive period of human development. However, the introduction of maternal blood during labor or cross-contamination during sample collection may complicate downstream analyses. After discovering maternal contamination of cord blood in a cohort study of 150 neonates using Illumina 450K DNA methylation (DNAm) data, we used a combination of linear regression and random forest machine learning to create a DNAm-based screening method. We identified a panel of DNAm sites that could discriminate between contaminated and non-contaminated samples, then designed pyrosequencing assays to pre-screen DNA prior to being assayed on an array. Maternal contamination of cord blood was initially identified by unusual X chromosome DNA methylation patterns in 17 males. We utilized our DNAm panel to detect contaminated male samples and a proportional amount of female samples in the same cohort. We validated our DNAm screening method on an additional 189 sample cohort using both pyrosequencing and DNAm arrays, as well as 9 publically available cord blood 450K data sets. The rate of contamination varied from 0 to 10% within these studies, likely related to collection specific methods. Maternal blood can contaminate cord blood during sample collection at appreciable levels across multiple studies. We have identified a panel of markers that can be used to identify this contamination, either post hoc after DNAm arrays have been completed, or in advance using a targeted technique like pyrosequencing.

  4. Discovery of Human IgGs against α-Cobratoxin for Development of Recombinant Antibody-based Antivenom

    DEFF Research Database (Denmark)

    Laustsen, Andreas Hougaard; Engmark, Mikael; Redsted Rasmussen, Arne

    More than 5.5 million people are bitten by venomous snakes per year on a global basis. This leads to approx. 125,000 deaths and 3 times as many amputations. Particularly Sub-Saharan Africa is affected by the problem. Current antivenoms are still being produced by a method developed in the 1890’s,...

  5. Pharmacokinetics of Toltrazuril and Its Metabolites, Toltrazuril Sulfoxide and Toltrazuril Sufone, after a Single Oray Administration to P1gs

    National Research Council Canada - National Science Library

    LIM, Jong-Hwan; KIM, Myoung-Seok; HWANG, Youn-Hwan; SONG, In-Bae; PARK, Byung-Kwon; YUN, Hyo-In

    2010-01-01

    Toltrazuril (TZR) is a triazine-based antiprotozoal agent. Following a single oral administration of TZR at 10 and 20 mg/kg to male pigs, the mean TZR concentration in plasma peaked at 4.24 and 8.18 μg/ml at 15.0...

  6. Fabrication, microstructure and persistent current measurement of an intermediate grown superconducting (iGS) joint between REBCO-coated conductors

    Science.gov (United States)

    Ohki, K.; Nagaishi, T.; Kato, T.; Yokoe, D.; Hirayama, T.; Ikuhara, Y.; Ueno, T.; Yamagishi, K.; Takao, T.; Piao, R.; Maeda, H.; Yanagisawa, Y.

    2017-11-01

    A superconducting joint technology used for high-temperature superconductors (HTS) is the key for enabling persistent operation of HTS magnets. In the present work, we have succeeded in developing a superconducting joint between REBCO-coated conductors (CCs) using a joint strap with a microcrystalline GdBCO precursor intermediate layer. Heat treatment and oxygen annealing, with a total processing time of less than 1 d, grows a biaxially-textured intermediate layer to connect the GdBCO layers in the CCs. Microstructure observation of a part of the joint cross-section with SEM and TEM showed that the intermediate layer and the GdBCO layers in the conductors were atomically connected. An electron backscatter diffraction result showed that both the c- and a-axis misorientations among the GdBCO layers of the joined conductor and the GdBCO layer of the joint strap were about less than 5°. This intermediate grown superconducting joint gives a critical current of >100 A at 77 K in a self-field. A critical current of a joint at 4.2 K in a self-field is seven times higher than that at 77 K. The persistent field decay of a small double pancake coil, terminated with this joint, showed a joint resistance in the range of MRI.

  7. Pierre Bourdieu. Sobre la televisión : Editorial Anagrama, Barcelona, 1997, 138 págs.

    OpenAIRE

    Agüero, Luciana; Ferrandi, María Laura

    1999-01-01

    Este libro consta de dos conferencias televisadas dadas por Pierre Bourdieu en el Collège de France en 1996 y retransmitidas por París Première en el mismo año. En los anexos, aparecen dos artículos que presentan de forma más rigurosa los temas desarrollados en las conferencias. Bourdieu enmarca este trabajo Sobre la Televisión en su teoría social, en la que sustituye la noción hueca de sociedad por las de campo y espacio social que no consiste en una totalidad única integrada sino que, más b...

  8. Dölger, F. J. (2015. La luz de Cristo. Madrid: Ediciones Encuentro. 98 págs.

    Directory of Open Access Journals (Sweden)

    Ruiz Sánchez, Alejandro

    2015-12-01

    Full Text Available La luz de Cristo, publicado originalmente en 1936, es el segundo libro de Franz Joseph Dölger traducido al castellano, siendo el anterior una selección de sus trabajos con el título Paganos y cristianos. El debate de la Antigüedad sobre el significado de los símbolos. En esta ocasión se abordan las relaciones entre estos distintos credos a través de la luz. La obra es presentada por Pedro Sabe Andreu, quien realiza una introducción que nos aporta datos claves para poder comprender de forma correcta el texto. Del mismo modo la obra cuenta con un prólogo a cargo de Manuel González López-Corps, profesor de la Universidad eclesiástica San Dámaso de Madrid. El autor de este volumen es Franz Joseph Dolger (1879-1940, un intelectual alemán, sacerdote y profesor en varias universidades de este país como la de Bonn o miembro de instituciones como la Academia Pontificia de Arqueología de Roma. Su ámbito de estudio se centró en el Cristianismo primitivo, abarcando dentro de este un amplio espectro de temas, sin dejar de abordar los nexos de unión de esta religión con los credos paganos.

  9. ƒr isotopes in the yrgueil gs meteoriteX ghronology of e—rly sol—r ...

    Indian Academy of Sciences (India)

    fluids @uerridge IWTVY ‚eid et —l IWUHY uerridge —nd w—™doug—ll IWUTAF st is likely th—t these ... these meteorites formed from different fluids @‚i™iputi et —l IWWRAD —ndD ˜y inferen™eD the s—me m—y ...... isotopi™ geo™hemistry —nd geo™hronology of sndi—n ro™ksF „his ™oll—˜or—tion h—s ˜een fruitfulD ...

  10. Developing Simple Budgets Using the AppleWorks Spreadsheet Subprogram, Apple IIe or GS Computers, and a Single Disk Drive.

    Science.gov (United States)

    Schlenker, Richard M.

    This manual is a "how to" training device for developing spreadsheet files in the AppleWorks program using an Apple IIe or Apple IIGS Computer with a single disk drive. The manual provides step-by-step directions, and includes 36 figures depicting the computer screen at the various stages of the spreadsheet development sequence. (EW)

  11. Developing Data Base Files Using the AppleWorks Data Base Subprogram and Apple IIe or GS Computers.

    Science.gov (United States)

    Schlenker, Richard M.

    Developed around the technology of the Apple duodisk drive, five and one-fourth inch floppy disks, and the 1.3 version of the AppleWorks program, this manual is designed for use as a "how to" training device in developing database files. The guide is meant to be used with Apple IIe or IIGS computers which have a duodisk or two disk…

  12. Building Parts Inventory Files Using the AppleWorks Data Base Subprogram and Apple IIe or GS Computers.

    Science.gov (United States)

    Schlenker, Richard M.

    This manual is a "how to" training device for building database files using the AppleWorks program with an Apple IIe or Apple IIGS Computer with Duodisk or two disk drives and an 80-column card. The manual provides step-by-step directions, and includes 25 figures depicting the computer screen at the various stages of the database file…

  13. Microarray-Based Analysis of Methylation Status of CpGs in Placental DNA and Maternal Blood DNA

    DEFF Research Database (Denmark)

    Hatt, Lotte; Aagaard, Mads M.; Graakjær, Jesper

    2015-01-01

    Epigenetic markers for cell free fetal DNA in the maternal blood circulation are highly interesting in the field of non-invasive prenatal testing since such markers will offer a possibility to quantify the amount of fetal DNA derived from different chromosomes in a maternal blood sample. The aim...... of the present study was to define new fetal specific epigenetic markers present in placental DNA that can be utilized in non-invasive prenatal diagnosis. We have conducted a high-resolution methylation specific beadchip microarray study assessing more than 450.000 CpG sites. We have analyzed the DNA methylation...... with a potential for aneuploidy testing as well as a list of markers for regions harboring sub-microscopic deletion- or duplication syndromes....

  14. Targeted sequence capture and GS-FLX Titanium sequencing of 23 hypertrophic and dilated cardiomyopathy genes: implementation into diagnostics

    NARCIS (Netherlands)

    Mook, Olaf R. F.; Haagmans, Martin A.; Soucy, Jean-François; van de Meerakker, Judith B. A.; Baas, Frank; Jakobs, Marja E.; Hofman, Nynke; Christiaans, Imke; Lekanne Deprez, Ronald H.; Mannens, Marcel M. A. M.

    2013-01-01

    Genetic evaluation of cardiomyopathies poses a challenge. Multiple genes are involved but no clear genotype-phenotype correlations have been found so far. In the past, genetic evaluation for hypertrophic (HCM) and dilated (DCM) cardiomyopathies was performed by sequential screening of a very limited

  15. GS-8374, a Prototype Phosphonate-Containing Inhibitor of HIV-1 Protease, Effectively Inhibits Protease Mutants with Amino Acid Insertions

    Czech Academy of Sciences Publication Activity Database

    Grantz Šašková, Klára; Kožíšek, Milan; Stray, K.; Jong de, D.; Řezáčová, Pavlína; Brynda, Jiří; Maarseveen van, N. M.; Nijhuis, M.; Cihlář, T.; Konvalinka, Jan

    2014-01-01

    Roč. 88, č. 6 (2014), s. 3586-3590 ISSN 0022-538X R&D Projects: GA ČR GAP207/11/1798 Grant - others:OPPC(XE) CZ.2.16/3.1.00/24016 Institutional support: RVO:61388963 ; RVO:68378050 Keywords : virus type-1 protease * antiviral activity * drug resistance Subject RIV: EE - Microbiology, Virology Impact factor: 4.439, year: 2014

  16. Phantom bursting is highly sensitive to noise and unlikely to account for slow bursting in beta-cells

    DEFF Research Database (Denmark)

    Pedersen, Morten Gram

    2007-01-01

    Pancreatic beta-cells show bursting electrical activity with a wide range of burst periods ranging from a few seconds, often seen in isolated cells, over tens of seconds (medium bursting), usually observed in intact islets, to several minutes. The phantom burster model [Bertram, R., Previte, J......., Sherman, A., Kinard, T.A., Satin, L.S., 2000. The phantom burster model for pancreatic beta-cells. Biophys. J. 79, 2880-2892] provided a framework, which covered this span, and gave an explanation of how to obtain medium bursting combining two processes operating on different time scales. However, single...... cells are subjected to stochastic fluctuations in plasma membrane currents, which are likely to disturb the bursting mechanism and transform medium bursters into spikers or very fast bursters. We present a polynomial, minimal, phantom burster model and show that noise modifies the plateau fraction...

  17. Dicty_cDB: Contig-U11970-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available *v*IIEIQNVFLFGLKMMKLNGYYLNHQNI SEVIKNWGILKKRYCNTEENSPSSSTSSPILSGLSSIRGKKSNASSTSNANDGSGSGSGS GS--- --...*v*IIEIQNVFLFGLKMMKLNGYYLNHQNI SEVIKNWGILKKRYCNTEENSPSSSTSSPILSGLSSIRGKKSNASSTSNANDGSGSGSGS GS--- --

  18. Studies on formation of unconfined detonable vapor cloud using explosive means.

    Science.gov (United States)

    Apparao, A; Rao, C R; Tewari, S P

    2013-06-15

    Certain organic liquid fuels like hydrocarbons, hydrocarbon oxides, when dispersed in air in the form of small droplets, mix with surrounding atmosphere forming vapor cloud (aerosol) and acquire explosive properties. This paper describes the studies on establishment of conditions for dispersion of fuels in air using explosive means resulting in formation of detonable aerosols of propylene oxide and ethylene oxide. Burster charges based on different explosives were evaluated for the capability to disperse the fuels without causing ignition. Parameters like design of canister, burster tube, burster charge type, etc. have been studied based on dispersion experiments. The detonability of the aerosol formed by the optimized burster charge system was also tested. Copyright © 2013 Elsevier B.V. All rights reserved.

  19. Gérard Guyon, La Règle de Saint Benoît: aux sources du droit..., DMM, Poitiers Cedex, 2012, 190 págs.

    Directory of Open Access Journals (Sweden)

    Guillermo Hierrezuelo Conde

    2013-03-01

    Full Text Available En esta monografía Guyon estudia ampliamente la Regla de San Benito, fundada por su homónimo, considerado como uno de los "Padres de Europa". Sus reglas, influidas en gran medida por el Derecho Romano, alcanzaron gran predicamento sobre todo a partir del siglo VI. Los dos pilares básicos que conformaban la Regla benedictina eran el oficio divino, de una parte, y la lección divina o el trabajo, de otra. San Benito obligaba a dedicar entre cuatro y ocho horas diarias al oficio divino y siete horas para dormir; y las restantes horas a trabajar, a estudiar o a la lectura religiosa. En caso de incumplimiento de las normas se establecían sanciones, que tenían su fundamento en el Derecho privado romano. Asimismo, diferenciaba entre la culpa y el dolo. Además, la Regla se basaba en los principios de la caridad y el acogimiento, si bien limitaba al máximo la permanencia de extranjeros dentro de la comunidad, para evitar que surgieran conflictos internos. La figura del abad en los monasterios adquiría un papel relevante en la medida en que presentaba como un auténtico Padre, pero como un Padre que juzgaba.

  20. Detection of IgM antibrucella antibody in the absence of IgGs: a challenge for the clinical interpretation of brucella serology.

    Directory of Open Access Journals (Sweden)

    Julián Solís García Del Pozo

    2014-12-01

    Full Text Available The use of enzyme-linked immunosorbent assay (ELISA for the detection of IgG and IgM antibodies antibrucella has become widespread in the diagnosis of human brucellosis. IgM anti-Brucella antibodies are indicative of acute infection. Between 2009-2013, 5307 patients were evaluated for serologic diagnosis at the Microbiology Laboratory of the Albacete General Hospital. A ELISA IgM-positive, IgG-negative anti-Brucella antibody serology pattern was detected in 17 of those patients. Epidemiology data, symptoms, laboratory data, treatment and outcome from these patients were reviewed. Sixteen patients presented with musculoskeletal pain, fatigue and/or fever and 1 was asymptomatic. Five patients received treatment with doxycycline combined with rifampin, gentamycin or streptomycin during 6-12 weeks, with no improvement. None of the 17 patients were finally diagnosed with brucellosis. Our results indicate that anti-Brucella IgM positive serology, per se, is not enough to diagnose acute brucellosis and other methods should be used for confirmation. Brucella serology data should be interpreted taking into account the patient's clinical history and epidemiological context.

  1. Detection of IgM antibrucella antibody in the absence of IgGs: a challenge for the clinical interpretation of brucella serology.

    Science.gov (United States)

    Solís García Del Pozo, Julián; Lorente Ortuño, Santiago; Navarro, Elena; Solera, Javier

    2014-12-01

    The use of enzyme-linked immunosorbent assay (ELISA) for the detection of IgG and IgM antibodies antibrucella has become widespread in the diagnosis of human brucellosis. IgM anti-Brucella antibodies are indicative of acute infection. Between 2009-2013, 5307 patients were evaluated for serologic diagnosis at the Microbiology Laboratory of the Albacete General Hospital. A ELISA IgM-positive, IgG-negative anti-Brucella antibody serology pattern was detected in 17 of those patients. Epidemiology data, symptoms, laboratory data, treatment and outcome from these patients were reviewed. Sixteen patients presented with musculoskeletal pain, fatigue and/or fever and 1 was asymptomatic. Five patients received treatment with doxycycline combined with rifampin, gentamycin or streptomycin during 6-12 weeks, with no improvement. None of the 17 patients were finally diagnosed with brucellosis. Our results indicate that anti-Brucella IgM positive serology, per se, is not enough to diagnose acute brucellosis and other methods should be used for confirmation. Brucella serology data should be interpreted taking into account the patient's clinical history and epidemiological context.

  2. Polymerase recognition of 2-thio-iso-guanine·5-methyl-4-pyrimidinone (iGs·P)--A new DD/AA base pair.

    Science.gov (United States)

    Lee, Dong-Kye; Switzer, Christopher

    2016-02-15

    Polymerase specificity is reported for a previously unknown base pair with a non-standard DD/AA hydrogen bonding pattern: 2-thio-iso-guanine·5-methyl-4-pyrimidinone. Our findings suggest that atomic substitution may provide a solution for low fidelity previously associated with enzymatic copying of iso-guanine. Copyright © 2016 Elsevier Ltd. All rights reserved.

  3. Training and Career Opportunities for School-Leavers before Standard Ten. Report MM-97. Revised Edition. HSRC Guidance Series GS-3.

    Science.gov (United States)

    Coetzee, C. J. S.; And Others

    Intended for early school-leavers of all population groups in South Africa, this publication provides basic information on post-school pre-tertiary training. (This training is outside the normal school context and before a Standard Ten or senior secondary school level has been obtained.) Chapter I describes training institutions and schemes and…

  4. 111 細孔管型消音器の消音特性に関する研究(GS-9 環境工学)

    OpenAIRE

    御法川, 学; 岩原, 光男; 吉田, 国央; 佐瀬, 利次; Minorikawa, Gaku; Iwahara, Mitsuo; Yoshida, Kunihiro; Sase, Toshitsugu

    2004-01-01

    This paper deals with the characteristic of noise reduction of perforated-plug muffler. The perforated-plug muffler is a kind of reactive silencer. Attenuating noise by a pipe with a closed end and a perforated surface inserted into an expansion chamber. This research investigated about the influence the various sizes of thin perforated-plug muffler affect a sound-damping characteristic. And tried to establish the design technique of a thin perforated-plug muffler.

  5. William F. Sater, La imagen heroica de Chile: Arturo Prat, santo secular, Santiago, Centro de Estudios Bicentenario, 2005, 231 págs.

    Directory of Open Access Journals (Sweden)

    SANTIAGO ARÁNGUIZ PINTO

    2011-10-01

    Full Text Available LA PERSONA Y LA FIGURA de Arturo Prat parece que, a simple vista, representan una misma y única unidad. Pero, si profundizamos algo más en la vida de este marino y abogado, nos daremos cuenta de que sus datos biográficos y la percepción que tuvo la sociedad de éste, varían considerablemente, pues, por su misma condición de héroe, está sujeto a los vaivenes interpretativos propios de la sobreabundante mitología nacional. Y es que el héroe, dice Sater, plantea otras problemáticas y disyuntivas cuando se le estudia, diferente a las del hombre público que posee figuración o renombre. En el héroe, por el contrario, confluyen elementos que responden a otro tipo de variables sociales, espirituales y culturales, y que es, por cierto, la preocupación fundamental que se ha propuesto desarrollar en este libro el historiador norteamericano. Analizar, comprender o estudiar la imagen heroica de Prat exige la participación de otros elementos analíticos que, a su vez, se plantean en relación a determinados momentos de la historia de Chile. No hay dudas al respecto: a nadie dejaba indiferente los rasgos y virtudes que desprendía la cautivante personalidad de Prat, considerando que éste era un ejemplo único de abnegación, heroísmo y de entrega hacia su patria, digno de imitar y difundir hacia el resto de la sociedad. Cada vez que ocurría alguna desgracia, el país requería a su vez de un estímulo moral para superar los problemas nacionales. ¿Cómo lograrlo? Recurriendo a Prat, que luego se transformaría en una práctica común, que excedió los límites de la mesura y el entendimiento.

  6. Bourke, Joanna. Los violadores: historia del estupro de 1860 a nuestros días. Barcelona: Crítica, 2009, 702 págs

    Directory of Open Access Journals (Sweden)

    Ingrid Viviana Serrano Ramírez

    2012-07-01

    Full Text Available Joanna Bourke es nacida en Blenheim, Nueva Zelanda en el año de 1963, actualmente es catedrática de Historia en el Birkbeck College, de la Universidad de Londres. se describe a sí misma como una «socialista feminista», ha tratado un amplio abanico de temas en sus investigaciones: la historia de la clase obrera y el trabajo de las mujeres, las experiencias de los hombres y las mujeres durante la guerra, la historia de las emociones, especialmente del miedo y el odio, y la historia de la violencia sexual. Actualmente, dirige una investigación sobre el dolor corporal a lo largo de los dos últimos siglos. Entre sus libros están traducidos La Segunda Guerra Mundial: una historia de las víctimas Empúries, 2003; Paidós, 2002, Sed de sangre: historia íntima del combate cuerpo a cuerpo en las guerras del siglo XX (Crítica, 2008 y Los violadores: historia del estupro de 1860 a nuestros días (Crítica, 2009. Recientemente, ha publicado What it Means to be Human. Reflections from 1791 to the Present (Virago, 2011.

  7. Bourke, Joanna. Los violadores: historia del estupro de 1860 a nuestros días. Barcelona: Crítica, 2009, 702 págs

    OpenAIRE

    Ingrid Viviana Serrano Ramírez

    2012-01-01

    Joanna Bourke es nacida en Blenheim, Nueva Zelanda en el año de 1963, actualmente es catedrática de Historia en el Birkbeck College, de la Universidad de Londres. se describe a sí misma como una «socialista feminista», ha tratado un amplio abanico de temas en sus investigaciones: la historia de la clase obrera y el trabajo de las mujeres, las experiencias de los hombres y las mujeres durante la guerra, la historia de las emociones, especialmente del miedo y el odio, y la historia de la violen...

  8. Biased Gs Versus Gq Proteins and β-Arrestin Signaling in the NK1 Receptor Determined by Interactions in the Water Hydrogen Bond Network

    DEFF Research Database (Denmark)

    Valentin-Hansen, Louise; Frimurer, Thomas M; Mokrosinski, Jacek

    2015-01-01

    of the highly conserved AspII:10 (2.50). Here, we find that this GluII:10 occupies the space of a putative allosteric modulating Na(+) ion and makes direct inter-helical interactions in particular with SerIII:15 (3.39) and AsnVII:16 (7.49) of the NPXXY motif. Mutational changes in the interface between GluII:10......X-ray structures, molecular dynamics simulations, and mutational analysis have previously indicated that an extended water hydrogen bond network between trans-membranes I-III, VI, and VII constitutes an allosteric interface essential for stabilizing different active and inactive helical....... It is concluded that the interface between position II:10 (2.50), III:15 (3.39), and VII:16 (7.49) in the center of the water hydrogen bond network constitutes a focal point for fine-tuning seven trans-membrane receptor conformations activating different signal transduction pathways....

  9. Design and Implementation of Automatic Street Light Control Using Sensors and Solar Panel Sharath Patil G.S1 , Rudresh S.M

    OpenAIRE

    Sharath Patil G.S; Rudresh S.M

    2015-01-01

    Solar Photovoltaic panel based street lighting systems are becoming more common these days. But the limitation with these ordinary street light systems is that it lacks intelligent performance. It is very essential to automate the system so that we can conserve energy as well as to maximize the efficiency of the system. In this paper a new method is suggested so as to maximize the efficiency of the street lighting system and to conserve the energy usage the LED lights sensors. Her...

  10. Industry-wide Inter-organizational Systems and Data Quality : Exploratory findings of the use of GS1 standards in the Dutch retail market

    NARCIS (Netherlands)

    Dalmolen, Simon; Moonen, Hans; van Hillegersberg, Jos

    2015-01-01

    Standards in general promise more efficiency and effectiveness in doing (electronic) business. Lowering the costs of collaboration, achieving these gains depends of the development and adoption of the standard in its business environment. Several studies report on research on electronic data

  11. Modified paired end rapid library preparation protocol for 454 GS Junior 8 kb library preparation using Covaris g-tubes and BluePippin electrophoresis

    OpenAIRE

    sprotocols

    2014-01-01

    Authors: Janet Hill, Bonnie Chaban, Jennifer Town, Matthew Links & Tim Dumonceaux ### Abstract This protocol describes an alternative approach to performing Roche’s Paired End Rapid Library Preparation Method for 8 kb span libraries. This method uses the Corvaris g-tube for DNA fragmentation, eliminating the need for a HydroShear apparatus, and a Sage Science BluePippin electrophoresis platform to size select the 8 kb fragments, eliminating the need for agarose gel electrophoresi...

  12. Antonio María Baggio, Adriana Cosseddu y Antonio Márquez Prieto (Coord., Fraternidad y Justicia, Comares, Granada, 2012, 94 págs.

    Directory of Open Access Journals (Sweden)

    Guillermo Hierrezuelo Conde

    2013-03-01

    Full Text Available Esta obra nos ofrece una visión triádica entre libertad, justicia y fraternidad, destacando el carácter novedoso de esta última. En efecto, únicamente un análisis conjunto de las tres categorías permitiría alcanzar, según sus autores, un significado pleno de la fraternidad. Esta relación queda en evidencia en el art. 1 de la Declaración Universal de los Derechos del hombre. De hecho, se destaca a la fraternidad como el principio olvidado de la revolución francesa (liberté, egalité, fraternité. Diversos autores la analizan como categoría política, lo que permitiría corregir algunos errores e injusticias de los sistemas políticos. Por otro lado, en la fraternidad podemos observar la relacionalidad, entendida como las relaciones entre los hombres. Asimismo, cuando hablamos de justicia se requieren tres elementos: la relacionalidad, la reciprocidad y la socialidad, en la medida en que la relación requiere lugar en el espacio social, donde adquiere sentido.

  13. Texturing concrete pavement for reduced tire/pavement noise using longitudinal tining : designation CPSCP GS 3-11 (rev 3/1/2011).

    Science.gov (United States)

    2011-03-01

    This document provides language that can be used by an Owner-Agency to develop materials and : construction specifications with the objective of reducing tire/pavement noise. While the practices : described herein are largely prescriptive, they have ...

  14. Texturing concrete pavement for reduced tire/pavement noise using transverse tining : designation CPSCP GS 4-11 (rev 3/1/2011).

    Science.gov (United States)

    2011-03-01

    This document provides language that can be used by an Owner-Agency to develop materials and : construction specifications with the objective of reducing tire/pavement noise. While the practices : described herein are largely prescriptive, they have ...

  15. Texturing concrete pavement for reduced tire/pavement noise using diamond grinding : designation CPSCP GS 1-11 (rev 3/1/2011).

    Science.gov (United States)

    2011-03-01

    This document provides language that can be used by an Owner-Agency to develop materials and : construction specifications with the objective of reducing tire/pavement noise. While the practices : described herein are largely prescriptive, they have ...

  16. CpG island clusters and pro-epigenetic selection for CpGs in protein-coding exons of HOX and other transcription factors

    OpenAIRE

    Branciamore, Sergio; Chen, Zhao-Xia; Riggs, Arthur D.; Rodin, Sergei N.

    2010-01-01

    CpG dinucleotides contribute to epigenetic mechanisms by being the only site for DNA methylation in mammalian somatic cells. They are also mutation hotspots and ∼5-fold depleted genome-wide. We report here a study focused on CpG sites in the coding regions of Hox and other transcription factor genes, comparing methylated genomes of Homo sapiens, Mus musculus, and Danio rerio with nonmethylated genomes of Drosophila melanogaster and Caenorhabditis elegans. We analyzed 4-fold degenerate, synony...

  17. A 1.35 GS/s, 10b, 175 mW Time-Interleaved AD Converter in 0.13 µm CMOS

    NARCIS (Netherlands)

    Louwsma, S.M.; van Tuijl, Adrianus Johannes Maria; Vertregt, M.; Nauta, Bram

    2008-01-01

    A time-interleaved ADC is presented with 16 channels, each consisting of a track-and-hold (T&H) and two successive approximation (SA) ADCs in a pipeline configuration to combine a high sample rate with good power efficiency. The single-sided overrange architecture achieves a 25% higher power

  18. Evidence for phase-locked changes in climate between Scotland and Greenland during GS-1 (Younger Dryas) using micromorphology of glaciolacustrine varves from Glen Roy

    DEFF Research Database (Denmark)

    Palmer, Adrian P.; Rose, Jim; Rasmussen, Sune Olander

    2012-01-01

    for understanding environmental change at such a scale. This paper presents the results of microscale analysis of glaciolacustrine varve sediments from Scotland and develops a new index called varve group, which ranks the number of pulses of sediment observed in the summer component of the varve. The varve group...

  19. Unravelling Colletotrichum species associated with Camellia: employing ApMat and GS loci to resolve species in the C. gloeosporioides complex

    NARCIS (Netherlands)

    Liu, F.; Weir, B.S.; Damm, U.; Crous, P.W.; Wang, Y.; Liu, B.; Wang, M.; Zhang, M.; Cai, L.

    2015-01-01

    "We investigated the phylogenetic diversity of 144 Colletotrichum isolates associated with symptomatic and asymptomatic tissues of Camellia sinensis and other Camellia spp. from seven provinces in China (Fujian, Guizhou, Henan, Jiangxi, Sichuan, Yunnan, Zhejiang), and seven isolates obtained from

  20. Unravelling Colletotrichum species associated with Camellia: employing ApMat and GS loci to resolve species in the C. gloeosporioides complex

    NARCIS (Netherlands)

    Liu, F; Weir, B S; Damm, U; Crous, P W; Wang, Y; Liu, B; Wang, M; Zhang, M; Cai, L

    2015-01-01

    We investigated the phylogenetic diversity of 144 Colletotrichum isolates associated with symptomatic and asymptomatic tissues of Camellia sinensis and other Camellia spp. from seven provinces in China (Fujian, Guizhou, Henan, Jiangxi, Sichuan, Yunnan, Zhejiang), and seven isolates obtained from

  1. The PI3-kinase delta inhibitor idelalisib (GS-1101) targets integrin-mediated adhesion of chronic lymphocytic leukemia (CLL) cell to endothelial and marrow stromal cells.

    Science.gov (United States)

    Fiorcari, Stefania; Brown, Wells S; McIntyre, Bradley W; Estrov, Zeev; Maffei, Rossana; O'Brien, Susan; Sivina, Mariela; Hoellenriegel, Julia; Wierda, William G; Keating, Michael J; Ding, Wei; Kay, Neil E; Lannutti, Brian J; Marasca, Roberto; Burger, Jan A

    2013-01-01

    CLL cell trafficking between blood and tissue compartments is an integral part of the disease process. Idelalisib, a phosphoinositide 3-kinase delta (PI3Kδ) inhibitor causes rapid lymph node shrinkage, along with an increase in lymphocytosis, prior to inducing objective responses in CLL patients. This characteristic activity presumably is due to CLL cell redistribution from tissues into the blood, but the underlying mechanisms are not fully understood. We therefore analyzed idelalisib effects on CLL cell adhesion to endothelial and bone marrow stromal cells (EC, BMSC). We found that idelalisib inhibited CLL cell adhesion to EC and BMSC under static and shear flow conditions. TNFα-induced VCAM-1 (CD106) expression in supporting layers increased CLL cell adhesion and accentuated the inhibitory effect of idelalisib. Co-culture with EC and BMSC also protected CLL from undergoing apoptosis, and this EC- and BMSC-mediated protection was antagonized by idelalisib. Furthermore, we demonstrate that CLL cell adhesion to EC and VLA-4 (CD49d) resulted in the phosphorylation of Akt, which was sensitive to inhibition by idelalisib. These findings demonstrate that idelalisib interferes with integrin-mediated CLL cell adhesion to EC and BMSC, providing a novel mechanism to explain idelalisib-induced redistribution of CLL cells from tissues into the blood.

  2. Ariel GUIANCE (Ed., Legendario Cristiano. Creencias y espiritualidad en el pensamiento medieval, Ciudad Autónoma de Buenos Aires, IMHICIHU, 2014, 1ª ed., 352 págs. y pliego de láminas color 14 págs. ISBN 978-987-23978-7-6

    Directory of Open Access Journals (Sweden)

    Belén A. Carreira

    2015-06-01

    Full Text Available La cuestión central del libro gravita en torno a la revalorización de la “leyenda medieval” como conjunto de géneros que permiten observar las fibras más íntimas del desarrollo de una(s identidad(es cristiana(s.

  3. Making the Transition to a Wildlife Refuge: A Strategic Planning Report for the Rocky Mountain Arsenal

    Science.gov (United States)

    1993-09-01

    Interdiscipline Engineer GS-8XX 1 GS 11 - 12 Engineering Technician GS-802 3 GS 9 - 11 Civil Inspector (Structural and Finishirg) WG-3601 I WG 10...for this function. 9 "* Civil Engineer, GS-810 Series: 1 person "* Engineering Management Specialist, GS-801 Series: 1 person "* Interdiscipline

  4. RESEÑA DE ANTHONY GIDDENS, LA TRANSFORMACIÓN DE LA INTIMIDAD. SEXUALIDAD, AMOR Y EROTISMO EN LAS SOCIEDADES MODERNAS, MADRID, EDICIONES CÁTEDRA, 2004, 192 PÁGS., ISBN 978-84-376-1324-6

    National Research Council Canada - National Science Library

    Rodríguez, Alejandro Damián

    2014-01-01

    .... Passionate love, romantic love, confluent love and pure relationship are some of the categories that Giddens proposes and guide us to understand the changes occurring in the innermost level of modern society...

  5. Ruiz-Gálvez Pliego, M. (2013. Con el fenicio en los talones. Los inicios de la Edad del Hierro en la cuenca del Mediterrámeo. Barcelona: Editorial Bellaterra. 377 págs.

    Directory of Open Access Journals (Sweden)

    Sánchez Mondéjar, Celso

    2014-12-01

    Full Text Available El último libro publicado por Marisa Ruíz-Gálvez, profesora titular de la Universidad Complutense de Madrid desde 1989, trata en profundidad el contexto histórico que posibilitó el desarrollo y expansión de la denominada cultura fenicia. Un interesante ejercicio motivado por la necesidad de mantener actualizada su asignatura de “Protohistoria del Mediterráneo”. Este libro nace, en palabras de la autora, de las inquietudes de sus alumnos y de la necesidad de sistematizar una bibliografía que cambia de año en año.

  6. Ruiz-Gálvez Pliego, M. (2013). Con el fenicio en los talones. Los inicios de la Edad del Hierro en la cuenca del Mediterrámeo. Barcelona: Editorial Bellaterra. 377 págs.

    OpenAIRE

    Sánchez Mondéjar, Celso

    2014-01-01

    El último libro publicado por Marisa Ruíz-Gálvez, profesora titular de la Universidad Complutense de Madrid desde 1989, trata en profundidad el contexto histórico que posibilitó el desarrollo y expansión de la denominada cultura fenicia. Un interesante ejercicio motivado por la necesidad de mantener actualizada su asignatura de “Protohistoria del Mediterráneo”. Este libro nace, en palabras de la autora, de las inquietudes de sus alumnos y de la necesidad de sistematizar una bibliografía que c...

  7. Calf thymus histone-conjugated magnetic poly(2-oxoethyl methacrylate) microspheres for affinity isolation of anti-histone IgGs from the blood serum of patients with systemic lupus erythematosus

    Czech Academy of Sciences Publication Activity Database

    Horák, Daniel; Plichta, Zdeněk; Starykovych, M.; Myronovskij, S.; Kit, Y.; Chopyak, V.; Stoika, R.

    2015-01-01

    Roč. 5, č. 77 (2015), s. 63050-63055 ISSN 2046-2069 R&D Projects: GA MŠk(CZ) 7E12053 EU Projects: European Commission(XE) 246513 - NADINE Institutional support: RVO:61389013 Keywords : magnet ic * systemic lupus erythematosis * histone Subject RIV: CD - Macromolecular Chemistry Impact factor: 3.289, year: 2015

  8. Manuel J. Peláez (dir., Diccionario de Canonistas y Eclesiasticistas Europeos y Americanos (Tomo I, AV Akademikerverlag GmbH & Co. KG, EAE, Saarbrücken, 2012, 547 págs.

    Directory of Open Access Journals (Sweden)

    Purificación Alcaide-Pulido

    2013-03-01

    Full Text Available ¿Por qué se otorga escasa atención a los canonistas y eclesiasticistas dentro del Derecho canónico y del Derecho eclesiástico? Esta es la cuestión que surge y el motivo de la aparición de la obra Diccionario de canonistas y eclesiasticistas europeos y americanos. Dicha obra aparece como una necesidad científica emanada de la escasa atención que en el ámbito citado se presta a canonistas y a eclesiasticistas, a través de una recopilación de los pensadores más influyentes en las diversas áreas que comprenden el Derecho Canónico y Eclesiástico, a lo largo del último milenio y, por ende, también de interés para iushistoricistas.

  9. Book review: Peregruznoe I Burial Ground: Results of Interdisciplinary Research : Monograph [Text] / M. A. Balabanova, E. V. Pererva [at al.]. – Volgograd : Izd-vo Volgogradskogo Filiala FGBOU VPO RANHiGS, 2014. – 360 p.

    Directory of Open Access Journals (Sweden)

    Tairov Aleksandr Dmitrievich

    2016-04-01

    Full Text Available The review concerns the monograph “Peregruznoe I Burial Ground: Results of Interdisciplinary Research. The book was prepared by the team of authors including archaeologists, anthropologists, paleosoil specialists, archaeozoologists. The review contains examination of materials and main conclusions for every chapter of the monograph. The monograph is devoted to the analysis of materials from 52 burial mounds dated from the Aeneolith to the Middle Ages. Most of them were erected in the Sarmatian period. In the review, the controversial points concerning the reconstruction of the paleodemographic and physicalgenetic structure of the buried Sarmatian population were pointed out. The authors consider that the gender disharmony of the Early and Middle Sarmatian samples was determined by the peculiarities of mounds formation of nomadic groups localized at the winter and summer nomad camps. This conclusion provokes some objections. As a positive moment, it should be noted that the authors have discovered new trends by means of analysis of cultural and chronological Sarmatian groups according to anthropological data. The monograph presents new interesting data related to reconstruction of the social structure of the Sarmatian societies, burial mound construction, the taxonomic composition of animals from grave pits and mounds. It is necessary to note, that the authors carried out a great deal of investigation and study. The monograph presents abundant scientific data. Interpretation of this material has a great potential which resources are far from being exhausted. The book is going to be a significant event not only for the study of the Volga-Ural steppe antiquities but for all over the Sarmatian archaeology.

  10. LEIVA-AGUILERA, JAVIER. Gestión de la reputación online. Barcelona: UOC, 2012. 100 págs. ISBN 978-84-9788-990-2.

    Directory of Open Access Journals (Sweden)

    Jordi Serrano Muñoz

    2013-03-01

    Full Text Available Se trata del séptimo libro de la joven pero activa y exitosa colección de libros de bolsillo de El Profesional de la Información que publica desde noviembre de 2011 a casi un ritmo de un libro por mes.

  11. Robert Muchembled. El Orgasmo y Occidente. Una Historia del Placer desde el Siglo XVI a nuestros días. Buenos Aires: Fondo de Cultura Económica, 2008, 425 págs.

    Directory of Open Access Journals (Sweden)

    Diana Crucelly González Rey

    2012-07-01

    Full Text Available El orgasmo, la voluptuosidad, el disfrute, solían ser un tema tabú en occidente. Robert Muchembled presenta esta historia social, producto de su estancia académica en el Institute for Advanced Study de Princenton, en un extenso argumento que abarca desde el Renacimiento en los siglos XVI y XVII hasta nuestros días en lo que el autor ha denominado “el triunfo del narcisismo”.

  12. RESEÑA DE: PÉREZ GARZÓN, Juan Sisinio (ed.: Experiencias republicanas en la historia de España, Madrid, Los Libros de la Catarata, 2015, 349 págs.

    Directory of Open Access Journals (Sweden)

    Sergio Sánchez Collantes

    2016-05-01

    Full Text Available Este nuevo libro reúne un conjunto de investigaciones que dirigen su atención a varias de las lagunas que todavía demandan un tratamiento específico por parte de la historiografía. Se trata de uno de los frutos de un proyecto de investigación que, financiado por el Ministerio de Economía y Competitividad, fue dirigido por Juan Sisinio Pérez Garzón en la Universidad de Castilla-La Mancha, con la que se relacionan todos los autores de la obra por formación o por vinculación laboral. Los capítulos no se estructuran en bloques, pero, si nos propusiéramos agruparlos por temas, que es lo que haremos en nuestra exposición, hallamos dos biografías, tres estudios sobre aspiraciones republicanas, un par de análisis que cabría relacionar con las condiciones o fórmulas de acceso al poder y otros dos trabajos que, cronológicamente, vienen a servir de alfa y omega a todos los anteriores. 

  13. Comment on 'Clay mineralogy of the Pelagic sediments: along a west-east transect in the Indian Ocean by G.S. Roonwal and S.K. Srivastava' Journal of the Geological Society of India 38; 1991; 37-54'

    Digital Repository Service at National Institute of Oceanography (India)

    Rao, V.P.

    stream_size 2 stream_content_type text/plain stream_name J_Geol_Soc_India_38_539.pdf.txt stream_source_info J_Geol_Soc_India_38_539.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset=ISO-8859-1 ...

  14. Salustiano de Dios y Eugenia Torijano (coords., Cultura, política y práctica del Derecho. Juristas de Salamanca, Siglos XV-XX, Ediciones Universidad de Salamanca, Salamanca, 2012, 567 págs.

    Directory of Open Access Journals (Sweden)

    Guillermo Hierrezuelo Conde

    2013-03-01

    Full Text Available En esta obra se recogen hasta siete estudios relativos a juristas de Salamanca en el período que comprende desde el s. XV hasta el pasado siglo XX. El primero de ellos está dedicado a distintos juristas salmantinos que vivieron durante el s. XV, destacando la figura de Pedro de Luna, conocido como papa Benedicto XIII; el segundo de los artículos pone de relieve la importancia de los colegios mayores salmantinos, institución en la que se tramitaron numerosos expedientes a los colegiales para la averiguación de la limpieza de sangre, así como otros aspectos, como la honorabilidad de la línea familiar; la tercera de las colaboraciones gira en torno a la figura del oficial de la administración española en el s. XVIII, y a las referencias que sobre ella se recogen en la obra de Jean Pierre Dedieu titulada La muerte del letrado; el cuarto estudia la personalidad del catedrático Vicente Fernández de Ocampo, que vivió entre 1743 y 1815; el quinto al informe realizado al proyecto de Código Civil de 1851 por la Facultad de jurisprudencia de la Universidad de Salamanca, que aunque no llegó a entrar en vigor adquirió gran trascendencia en el ámbito civil; el sexto, a la importancia de las audiencias de lo criminal de Salamanca y Ciudad Rodrigo, hasta la supresión de esta última; y el último de ellos, a aquellos profesores de la Universidad de Salamanca que vivieron los primeros años de la Dictadura franquista, entre los que podemos citar a Teodoro Andrés Marcos y Nicolás Rodríguez Aniceto, entre otros.

  15. Salustiano de Dios y Eugenia Torijano (coords.), Cultura, política y práctica del Derecho. Juristas de Salamanca, Siglos XV-XX, Ediciones Universidad de Salamanca, Salamanca, 2012, 567 págs.

    OpenAIRE

    Guillermo Hierrezuelo Conde

    2013-01-01

    En esta obra se recogen hasta siete estudios relativos a juristas de Salamanca en el período que comprende desde el s. XV hasta el pasado siglo XX. El primero de ellos está dedicado a distintos juristas salmantinos que vivieron durante el s. XV, destacando la figura de Pedro de Luna, conocido como papa Benedicto XIII; el segundo de los artículos pone de relieve la importancia de los colegios mayores salmantinos, institución en la que se tramitaron numerosos expedientes a los colegiales para l...

  16. Viļņas Valsts universitātes Zinātniskās bibliotēkas XVIII. gs. Poļu-latviešu vārdnīcas rokraksts F₁-D₁₁

    Directory of Open Access Journals (Sweden)

    Stanislaw Franciszek Kolbuszewski

    2011-07-01

    Full Text Available DAS MANUSKRIPT DES POLNISCH-LETTISCHEN WÖRTERBUCHES (F₁-D₁₁ AUS DER HANDSCHRIFTENSAMMLUNG DER VILNAER UNIVERSI­TÄTSBIBLIOTHEK (Randbemerkungen zum Aufsatz von A. Breidaks und J. RapšaZusammenfassung1. Das Polnisch-lettische Wörterbuch entstand um das Jahr 1766 (vgl. K. Pakalka 1973 : 137; S. F. Kolbuszewski 1977 : 49, 55, 262ff.Es mag die Kopie des „Lexicon Lothavicum“ von J. Kariger S. J. (1664—1729 sein, dessen Original verschollen zu sein scheint.2. Die Notizen in der 175. — 176. Spalte des Wörterbuches sind folgendermaßen zu lesen:„Mszy Czyt (anych 11Spiew (anych______________________M (szy” usw.3. S.v. „Tkaczownia vid Krośna. Stelles byrde'“. Wb. 13113 wurden die Wörter mit diakritischen Zeichen versehen, die nicht irrelevant sind, vgl. „Krośna“ (=poln. „Webergestell“ und ,,byrde'“ (lett. ds.. — Die Form „Krośna", mit -ś- (vgl. bei A. Mickiewicz n. F. Sławski 1966-1969 : 138, weist u.a. auf die „nördl.-östl. Peripherie“ des Polnischen hin (vgl. L. Bednarczuk 1974 : 328. In der Form „byrde"“, mit –e‘, hat man mit einem diakritischen Zeichen zu tun, das von dem Verf. des „Lexicon Lothavicum“ u.a. für die Bezeichnung der sog. lettgallischen Entpalatalisierung (vgl. A. Breidaks 1974 : 129 ff.; M. Bukšs 1972 : 28f. verwendet wurde.

  17. Discovery and Synthesis of GS-5734, a Phosphoramidate Prodrug of a Pyrrolo[2,1 f][triazin-4-amino] Adenine C-Nucleoside for the Treatment of Ebola and Emerging Viruses

    Science.gov (United States)

    2017-01-26

    disease . The persistence of virus sequelae in survivors in multiple body compartments has now been documented in addition to secondary sexual ...Evidence of Sexual Transmission of Ebola Virus. N. Engl. J. Med. 2015, 373, 2448-2454. 5. Kuhn, J. H. Filoviruses: A Compendium of 40 Years of ...California, USA. 2United States Army Medical Research Institute of Infectious Diseases (USAMRIID), Frederick, Maryland, USA. § USAMRIID Therapeutic

  18. Francisco López Segrera. América Latina: Crisis del posneoliberalismo y ascenso de la nueva derecha. Buenos Aires: CLACSO. Libro digital. 143 págs. 2016

    Directory of Open Access Journals (Sweden)

    Marina Campusano

    2016-07-01

    Full Text Available Centrado en las transformaciones del escenario político latinoamericano que evidencian un cambio de ciclo y lo muestran en un viraje hacia la derecha, Francisco López Segrera nos propone, en este nuevo libro digital de CLACSO, recorrer los procesos que atravesaron los gobiernos posneoliberales para comprender el ascenso actual de grupos que identifica como representativos de “nuevas derechas”. Se detendrá así, a lo largo de los cinco capítulos que componen el libro, en los principales rasgos que los caracterizan para ayudarnos a rearmar el escenario político del continente y sus futuras proyecciones. Es importante destacar la trayectoria del autor, quien, más allá de su formación en Estudios Latinoamericanos e Hispánicos, ha estado involucrado en cargos que implicaron tareas en la diplomacia cubana, como así también en la UNESCO, abocado areflexionar en torno a la tarea y responsabilidad de las ciencias sociales para América Latina y el Caribe (ALC. Esas vivencias resalta el autor como presentes y necesarias al momento de encarar el proyecto del libro.

  19. Guanine nucleotide binding regulatory proteins and adenylate cyclase in livers of streptozotocin- and BB/Wor-diabetic rats. Immunodetection of Gs and Gi with antisera prepared against synthetic peptides.

    OpenAIRE

    Lynch, C J; Blackmore, P F; Johnson, E H; Wange, R L; Krone, P K; Exton, J H

    1989-01-01

    Adenylate cyclase in liver plasma membranes from streptozotocin-diabetic (STZ) or BB/Wor spontaneously diabetic rats showed increased responsiveness to GTP, glucagon, fluoroaluminate, and cholera toxin. Basal or forskolin-stimulated activity was unchanged in STZ rats, but increased in BB/Wor rats. No change in the alpha-subunit of Gi (alpha i) was observed in STZ or BB/Wor rats using pertussis toxin-stimulated [32P]ADP-ribosylation. Immunodetection using antibodies against the COOH-terminal d...

  20. Guanine nucleotide binding regulatory proteins and adenylate cyclase in livers of streptozotocin- and BB/Wor-diabetic rats. Immunodetection of Gs and Gi with antisera prepared against synthetic peptides

    National Research Council Canada - National Science Library

    Lynch, C J; Blackmore, P F; Johnson, E H; Wange, R L; Krone, P K; Exton, J H

    1989-01-01

    Adenylate cyclase in liver plasma membranes from streptozotocin-diabetic (STZ) or BB/Wor spontaneously diabetic rats showed increased responsiveness to GTP, glucagon, fluoroaluminate, and cholera toxin...

  1. Etnoecologia do cipó-titica [Heteropsis flexuosa (H.B.K) G.S. Bunting] e sua relação com os sistemas produtivos do Amapá

    OpenAIRE

    Pereira, Luciano Araujo

    2004-01-01

    Disseratação (mestrado) - Universidade Federal de Santa catarina, Centro de Ciências Agrárias. Programa de Pós-graduação em Agroecossistemas. Estudar comunidades tradicionais e o conhecimento transmitido no dia-a-dia por produtores rurais é uma tarefa que requer muito cuidado e atenção. Estes conhecimentos constituem o corpus e a práxis dos produtores rurais, acumulando-se e transformando-se com o passar do tempo, em práticas que vão passando de pai para filho, definindo regras de manejo e...

  2. GPR40 (FFAR1) – Combined Gs and Gq signaling in vitro is associated with robust incretin secretagogue action ex vivo and in vivo

    DEFF Research Database (Denmark)

    Pedersen, Maria Hauge; Bentsen, Marie Aare; Husted, Anna S

    2015-01-01

    OBJECTIVES: GPR40 (FFAR1), a clinically proven anti-diabetes target, is a Gq-coupled receptor for long chain fatty acids (LCFA) stimulating insulin secretion directly and mediating a major part of the dietary triglyceride-induced secretion of the incretins GLP-1 and GIP. In phase-II studies the G...

  3. Scientific Goals of the IceCube Neutrino Detector at the South Pole

    CERN Document Server

    Goldschmidt, A

    2002-01-01

    IceCube is a proposed ice-Cherenkov kilometer scale neutrino telescope, to be located at the South Pole. Its science potential covers a wide range of topics from Active Galatic Nuclei and Gamma Ray Bursters neutrino emission to WIMP annihilation into neutrinos.

  4. Dance of the double stars

    Energy Technology Data Exchange (ETDEWEB)

    Theokas, A.

    1985-09-19

    The paper concerns pairs of stars orbiting one another. The evolutionary path model for close binary stars, involving a mass transfer of gases between the stars, is described. The life history of a single star; cataclysmic variables; the algol paradox, matter and lagranges' point; x-ray binaries and bursters; and pulsars; are all briefly discussed.

  5. Hubble Space Telescope STIS Observations of GRB 000301C: CCD Imaging and Near-Ultraviolet MAMA Spectroscopy

    NARCIS (Netherlands)

    Smette, A.; Fruchter, A.S.; Gull, Th.R.; Sahu, K.C.; Petro, L.; Ferguson, H.; Rhoads, J.; Lindler, D.J.; Wijers, R.A.M.J.

    2001-01-01

    We present Space Telescope Imaging Spectrograph observations of the optical transient (OT) counterpart of the gamma-ray burster GRB 000301C obtained 5 days after the burst, on 2000 March 6. CCD clear-aperture imaging reveals a R~=21.50+/-0.15 source with no apparent host galaxy. An 8000 s, 1150

  6. INTEGRAL finds renewed X-ray activity of the Neutron star X-ray transient SAX J1750.8-2900

    DEFF Research Database (Denmark)

    Sanchez-Fernandez, Celia; Chenevez, Jérôme; Kuulkers, Erik

    2015-01-01

    INTEGRAL Galactic bulge monitoring observations (ATel #438) on UT 13 September 2015 18:50-22:32 reveal renewed X-ray activity from the low-mass X-ray binary transient and Type I X-ray burster SAX J1750.8-2900 (IAU Circ. #6597). The last outburst from this source was reported in 2011 (ATels #3170,...

  7. Dangerous Substance Advisor: Een Expert Systeem voor het Classificeren van Gevaarlijke Stoffen (Dangerous Substance Advisor: An Expert System for the Classification of Dangerous Substances)

    Science.gov (United States)

    1990-06-01

    voorkomen. Ammunition Contrivances Bomb Detonating Booster Detonator Burster Explosive Cartridge Firework Charged Flare Charges Flash Indien de...00 0 000 00 00 00 00 0 00 Amomonium 00 00 20 00 00 00 00 00 00 00 00 0 Antimony 00 00 00 0 000 00 0 022 00 00 20 0 Boron 0 060 00 0 000 0 00 000 000

  8. Hubble Space Telescope STIS observations of GRB 000301C: CCD imaging and near-ultraviolet MAMA spectroscopy

    DEFF Research Database (Denmark)

    Smette, A.; Fruchter, A.S.; Gull, T.R.

    2001-01-01

    We present Space Telescope Imaging Spectrograph observations of the optical transient (OT) counterpart of the c-ray burster GRB 000301C obtained 5 days after the burst, on 2000 March 6. CCD clear-aperture imaging reveals a R similar or equal to 21.50 +/- 0.15 source with no apparent host galaxy. ...

  9. Astrophysical Applications of Relativistic Shear Flows

    Science.gov (United States)

    Liang, Edison

    2017-10-01

    We review recent PIC simulation results of relativistic collisionless shear flows in both 2D and 3D. We apply these results to spine-sheath jet models of blazars and gamma-ray-bursters, and to shear flows near the horizon of rapidly spinning black holes. We will discuss magnetic field generation, particle energization and radiation processes, and their observational consequences.

  10. Purification and Properties of a Prokaryote Type Glutamine Synthetase from the Bialaphos Producer Streptomyces hygroscopicus SF1293

    NARCIS (Netherlands)

    Kumada, Yoichi; Takano, Eriko; Nagaoka, Kozo

    1990-01-01

    A prokaryote type glutamine synthetase (GS) was purified from a bialaphos (BA)-producing organism, Streptomyces hygroscopicus SF1293 (SF1293). The GS (GS I) consisted of a 55,000 dalton subunit, and its N-terminal amino acid sequence was similar to that of S. coelicolor GS. GS I was highly sensitive

  11. Fourteen new generic and ten new specific synonymies in Pholcidae (Araneae), and transfer of Mystes Bristowe to Filistatidae.

    Science.gov (United States)

    Huber, Bernhard A; Colmenares, Pío A; Ramirez, Martin J

    2014-08-08

    Between 1998 and 2011, the Venezuelan arachnologist Manuel Ángel González-Sponga (GS) published a series of taxonomic papers devoted to the Pholcidae of Venezuela. Of his 22 new genera, 20 were monotypic when described, suggesting a high percentage of synonyms. We studied his descriptions and as far as accessible his type specimens and propose the following new generic synonymies: Autana GS, 2011 = Mesabolivar GS, 1998; Ayomania GS, 2005 and Venezuela Koçak & Kemal, 2008 (new replacement names for Falconia GS, 2003) = Mecolaesthus Simon, 1893; Carbonaria GS, 2009 = Mecolaesthus Simon, 1893; Caruaya GS, 2011 = Mesabolivar GS, 1998; Coroia GS, 2005 = Artema Walckenaer, 1837; Maimire GS, 2009 = Mecolaesthus Simon, 1893; Moraia GS, 2011 = Mecolaesthus Simon, 1893; Nasuta GS, 2009 = Mecolaesthus Simon, 1893; Portena GS, 2011 = Metagonia Simon, 1893; Rioparaguanus GS, 2005 = Mesabolivar GS, 1998; Tonoro GS, 2009 = Litoporus Simon, 1893; Sanluisi GS, 2003 = Mecolaesthus Simon, 1893. Three of the type species are also specific synonyms: Autana autanensis GS, 2011 = Mesabolivar aurantiacus (Mello-Leitão, 1930); Coroia magna GS, 2005 = Artema atlanta Walckenaer, 1837; Tonoro multispinae GS, 2009 = Litoporus uncatus (Simon, 1893). Six species that González-Sponga described under Blechroscelis (a genus previously synonymized with Priscula Simon, 1893) are all synonyms of Mesabolivar eberhardi Huber, 2000 (B. acuoso GS, 2011; B. araguanus GS, 2011; B. blechroscelis GS, 2011; B. copeyensis GS, 2011; B. cordillerano GS, 2011; B. andinensis GS, 2011). In addition, and unrelated to González-Sponga's work, we synonymize the Central Asian monotypic genus Ceratopholcus Spassky, 1934 with Crossopriza Simon, 1893; we synonymize the Chinese species Pholcus acerosus Peng & Zhang, 2011 with Pholcus fragillimus Strand, 1907 and remove the Malaysian monotypic genus Mystes Bristowe, 1938, previously thought to be the only East Asian representative of the subfamily Ninetinae, to the

  12. Some Properties of Glutamate Dehydrogenase from the Marine Red ...

    African Journals Online (AJOL)

    Daisy Ouya

    1) glutamate dehydrogenases (GDH) and (2) glutamine synthetase (GS)/ glutamate synthase (GOGAT). In the GS/ GOGAT route, ammonia is first incorporated into glutamine by the action of GS and subsequently into glutamic acid by GOGAT.

  13. A rapid detection of avian oncovirus group-specific antigens in feather pulp by the enzyme-linked immunosorbent assay.

    Science.gov (United States)

    Korec, E; Hlozánek, I; Benda, V

    1984-01-01

    An ELISA procedure for the detection of avian sarcoma-leukosis gs antigen in feather pulp of adult birds is described. The test can be used for identifying gs+ and gs- chickens in leukosis-free populations. The titres of exogenous and endogenous virus-coded gs antigens overlap and the ELISA can be used only for a preliminary screening of unknown chicken populations.

  14. 76 FR 41993 - Customs and Border Protection Officer Retirement

    Science.gov (United States)

    2011-07-18

    ... Homeland Security (A) who holds a position within the GS-1895 job series (determined applying the criteria... being a ``position within the GS-1895 job series (determined applying the criteria in effect as of... within the GS-1895 job series. Thus, work experience in a position classified within the GS-1895 job...

  15. ORF Alignment: NC_002935 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available GVHAELPVAAEHLQVSGVVNGGVYSALAETAGS 72 ... EQLEEFNEKLEGFSKTLGLRFTQINSEGVHAELPVAAEHLQVSGVVNGGVYSALAETA...GS Sbjct: 1 ... EQLEEFNEKLEGFSKTLGLRFTQINSEGVHAELPVAAEHLQVSGVVNGGVYSALAETAGS 60 ... Quer

  16. 29 CFR 1960.2 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... means the individual who is responsible for the management of the safety and health program within an... Safety and Health Specialist means a person or persons meeting the Office of Personnel Management... GS-602 Occupational Health Nurse GS-610 Safety Technician GS-019 Physical Science Technician GS-1311...

  17. Molecular markers for predicting end-products quality of wheat ...

    African Journals Online (AJOL)

    STORAGESEVER

    2008-07-18

    Jul 18, 2008 ... Wheat (Triticum aestivum) gluten contains both high molecular weight (HMW-GS) and low molecular weight. (LMW-GS) glutenin subunits. The effects of (HMW-GS) on dough properties (strength and elasticity) may be additive or synergistic with significant interactions with. (LMW-GS) subunits (Beasley et al., ...

  18. High-Temperature Spintronic Devices and Circuits in Absence of Magnetic Field

    Science.gov (United States)

    2012-04-23

    balanced ’ Wheatstone bridge ’, leading to a negligible loading effect on Vmeasured due to change in gs° with L0. But the anti-parallel configuration...creates significant imbalance in the bridge , which drives a shunt current through both gs’ and gs°. So an increase in gs° eventually loads down VmeasUred

  19. Intermediate long X-ray bursts from the ultra-compact binary candidate SLX1737-282

    DEFF Research Database (Denmark)

    Falanga, M.; Chenevez, Jérôme; Cumming, A.

    2008-01-01

    Aims. The low persistent flux X-ray burster source SLX 1737-282 is classified as an ultra-compact binary candidate. We compare the data on SLX 1737-282 with the other similar objects and attempt to derive constraints on the physical processes responsible for the formation of intermediate long...... bursts. Methods: Up to now only four bursts, all with duration between ≃15{-}30 min, have been recorded for SLX 1737-282. The properties of three of these intermediate long X-ray bursts observed by INTEGRAL are investigated and compared to other burster sources. The broadband spectrum of the persistent...... emission in the 3-100 keV energy band is studied with the INTEGRAL data. Results: The persistent emission is measured to be 0.5% Eddington luminosity. From the photospheric radius expansion observed during at least one burst we derive the source distance at 7.3 kpc assuming a pure helium atmosphere...

  20. Radiation dynamics in X-ray binaries. I - Type 1 bursts. II - Type 2 bursts. III - Extremely compact objects

    Science.gov (United States)

    Walker, Mark A.

    1992-01-01

    Equations describing the evolution of a thin, axisymmetric, viscous, relativistic, irradiated accretion disk are presented, as well as numerical solutions of these equations in the case where irradiation results from a thermonuclear flash on the surface of the accreting neutron star. These calculations verify the notion that the radiation torque induces a substantial increase in the accretion rate, during a type 1 X-ray burst, and provide insight into the factors which influence the dynamical response of the disk. A new model for the source XBT 1730-335, the rapid burster, is presented. Temporal and spectral properties are calculated. The rapid burster is found to be a nonmagnetic, 'critically compact', slowly rotating neutron star in a highly eccentric binary system with a period of 6 mo. The spectral modifications which arise from the scattering of photons by accretion disks around nonmagnetic neutron stars are calculated. The 'black hole candidates' are interpreted as extremely compact stars.

  1. Long-lasting modification of intrinsic discharge properties in subicular neurons following status epilepticus.

    Science.gov (United States)

    Wellmer, Jörg; Su, Hailing; Beck, Heinz; Yaari, Yoel

    2002-07-01

    A single episode of status epilepticus (SE) induces neuropathological changes in the brain that may lead to the development of a permanent epileptic condition. Most studies of this plasticity have focused on the hippocampus, where both synaptic function and intrinsic neuronal excitability have been shown to be persistently modified by SE. However, many other brain structures are activated during SE and may also be involved in the subsequent epileptogenic process. Here we have investigated whether SE, induced in rats with pilocarpine and terminated after 40 min with diazepam, persistently modifies the intrinsic excitability of pyramidal neurons in the subiculum. Subicular slices were prepared from control and SE-experienced rats (2-5 weeks after SE). In the control group, only 4% of the neurons fired bursts in response to intrasomatic, threshold-straddling depolarizing current pulses (low-threshold bursters). The remaining neurons either fired bursts in response to strong (3x threshold) depolarizations (35%; high-threshold bursters) or fired in a completely regular mode (61%; nonbursters). In the SE-experienced group, the fractions of low- and high-threshold bursters markedly increased to 29% and 53%, respectively. This change in firing behaviour was associated with a marked increase in the size of the spike after depolarization, particularly in low-threshold bursters. Experimental suppression of Ca2+ currents selectively blocked low-threshold bursting but did not affect high-threshold bursting, suggesting that a dual Ca2+- dependent and Ca2+- independent mechanism controls bursting in these neurons. The persistent up-regulation of intrinsic bursting in the subiculum, in concert with similar changes in the hippocampus, undoubtedly contributes to epileptogenesis following pilocarpine-induced SE.

  2. Fermi-GBM detection of a thermonuclear burst from 4U 1608-52

    NARCIS (Netherlands)

    Jenke, P.; Linares, M.; Connaughton, V.; van der Horst, A.J.; Camero-Arranz, A.; Finger, M.; Wilson-Hodge, C.; Kouveliotou, C.

    2012-01-01

    We report the detection with Fermi-GBM (daily CTIME data, 12-25 keV band) of an X-ray burst from a location consistent with the neutron star low-mass X-ray binary and thermonuclear burster 4U 1608-52. The burst peak occurred on May 2, 2012 at 06:47:54 UTC. The Fermi-GBM location of the burst is

  3. Injection of Nucleate-Boiling Slug Flows into a Heat Exchange Chamber in Microgravity

    Science.gov (United States)

    2015-06-01

    alternatives in case of unsatisfactory performance. At the same time we started preparing the software tools for the image processing and for the numerical...gas only) 15b) Burster Typ 8227 16 Pressure regulator valve Festo VPPM-6L-L-1-G18-0L2H-A4N 17 Air filter Festo LF-D-5M-MINI XN43 18 Pressured air

  4. INTEGRAL reports renewed activity from KS 1741-293

    DEFF Research Database (Denmark)

    Chenevez, Jérôme; Kuulkers, E.; Alfonso-Garzón, J.

    2010-01-01

    The low-mass X-ray binary and burster source KS 1741-293 has been detected during recent INTEGRAL Galactic bulge (see ATel #438) observations by the JEM-X instrument. On February 25, 2010, between UTC 13:04 and 14:08, KS 1741-293 was detected at a 3-10 keV flux of 9 +/- 4 mCrab, and an upper limi...

  5. Probes of Lorentz Violation

    CERN Document Server

    Ellis, John

    2013-01-01

    Lorentz invariance is such an important principle of fundamental physics that it should constantly be subjected to experimental scrutiny as well as theoretical questioning. Distant astrophysical sources of energetic photons with rapid time variations, such as active galactic nuclei (AGNs) and gamma-ray bursters (GRBs), provide ideal experimental opportunities for testing Lorentz invariance. The Cherenkov Telescope Array (CTA) is an excellent experimental tool for making such tests with sensitivities exceeding those possible using other detectors.

  6. Simultaneous optical/gamma-ray observations of GRBs

    Science.gov (United States)

    Greiner, J.; Wenzel, W.; Hudec, R.; Moskalenko, E. I.; Metlov, V.; Chernych, N. S.; Getman, V. S.; Ziener, Rainer; Birkle, K.; Bade, N.

    1994-01-01

    Details on the project to search for serendipitous time correlated optical photographic observations of Gamma Ray Bursters (GRB's) are presented. The ongoing photographic observations at nine observatories are used to look for plates which were exposed simultaneously with a gamma ray burst detected by the gamma ray instrument team (BATSE) and contain the burst position. The results for the first two years of the gamma ray instrument team operation are presented.

  7. Inelastic Branch of the Stellar Reaction $^{14}$O$(\\alpha,p)^{17}$F

    CERN Multimedia

    Hass, M; Van duppen, P L E

    2002-01-01

    We propose to use the upgraded REX-ISOLDE beam energy to study the astrophysically important $^{14}$O($\\alpha$, p)$^{17}$F reaction in time reverse kinematics. In particular, we will use the highly efficient miniball + CD detection system to measure the previously undetermined inelastic proton branch of the 1$^-$ state at 6.15 MeV in $^{18}$Ne. This state dominates the reaction rate under X-ray burster conditions.

  8. Purification and Characterization of Griffonia simplicifolia Leaf Lectins.

    Science.gov (United States)

    Lamb, J E; Shibata, S; Goldstein, I J

    1983-04-01

    Leaves from mature Griffonia simplicifolia plants were examined for the presence of leaf lectins possessing sugar binding specificities similar to the four known seed lectins (GS-I, GS-II, GS-III, GS-IV). Three (GS-I, -II, -IV) of the four known G. simplicifolia seed lectins were present in the leaves. Leaf G. simplicifolia lectins I and IV were similar to the respective seed lectins. Leaf GS-II, however, was composed of two types of subunits (M(r) = 33,000 and 19,000), whereas the seed lectin consists of only one type of subunit (M(r) 32,500). Seed and leaf GS-II lectins also had different isoelectric points. All leaf and seed lectins were similar with respect to their hemagglutination and glycoconjugate precipitation properties and all subunits contained covalently bound carbohydrate. Leaf GS-IV appeared slightly under-glycosylated compared to seed GS-IV.The fate of GS-I and GS-II seed lectins in aging cotyledons was investigated. GS-I isolectins usually contain isolectin subtypes associated with each main isolectin. Upon inbibition and germination, these GS-I isolectin subtypes disappeared. Over time, GS-II lectin did not change its disc gel electrophoretic properties.

  9. Purification and Characterization of Griffonia simplicifolia Leaf Lectins 1

    Science.gov (United States)

    Lamb, Jamie E.; Shibata, Satoaki; Goldstein, Irwin J.

    1983-01-01

    Leaves from mature Griffonia simplicifolia plants were examined for the presence of leaf lectins possessing sugar binding specificities similar to the four known seed lectins (GS-I, GS-II, GS-III, GS-IV). Three (GS-I, -II, -IV) of the four known G. simplicifolia seed lectins were present in the leaves. Leaf G. simplicifolia lectins I and IV were similar to the respective seed lectins. Leaf GS-II, however, was composed of two types of subunits (Mr = 33,000 and 19,000), whereas the seed lectin consists of only one type of subunit (Mr 32,500). Seed and leaf GS-II lectins also had different isoelectric points. All leaf and seed lectins were similar with respect to their hemagglutination and glycoconjugate precipitation properties and all subunits contained covalently bound carbohydrate. Leaf GS-IV appeared slightly under-glycosylated compared to seed GS-IV. The fate of GS-I and GS-II seed lectins in aging cotyledons was investigated. GS-I isolectins usually contain isolectin subtypes associated with each main isolectin. Upon inbibition and germination, these GS-I isolectin subtypes disappeared. Over time, GS-II lectin did not change its disc gel electrophoretic properties. Images Fig. 1 Fig. 2 Fig. 3 Fig. 4 Fig. 5 Fig. 6 PMID:16662923

  10. Clinical use of sentinel node (SN) mapping and {sup 18}F-fluorodeoxyglucose (FDG) positron emission tomography (TEP) in the management of cutaneous melanoma; Detection isotopique du ganglion sentinelle (GS) et tomographie d'emission de positons au {sup 18}F-fluorodeoxyglucose (TEP - FDG) proposition d'une strategie d'utilisation dans les melanomes

    Energy Technology Data Exchange (ETDEWEB)

    Courbon, F. [Centre Hospitalier Universitaire, CLCC, Oncologie Nucleaire, Service de Medecine Nucleaire, 31 - Toulouse (France); Chevreau, C. [Institut Claudius Regaud, Service d' Oncologie Medicale, 31 - Toulouse (France)

    2005-07-15

    In France, there is a new case of melanoma for 10.000 inhabitants per year. This incidence has doubled in 10 years. Surgery of the primary site is the main treatment of this disease: however thanks to the concept of sentinel node (SN) the management of melanoma changes, it tends to include adjuvant treatments. Because of the isotopic detection of SN and the use of PET FDG, nuclear medicine plays a key role in melanoma. This paper aims to discuss the place of isotopic SN mapping and TEP FDG in clinical practice. (authors)

  11. Felipe González Vicén, Teoría de la revolución. Sistema e historia, Consejo Superior de Investigaciones Científicas y Plaza y Valdés, Madrid y México, D. F., 2010, 125 págs.

    Directory of Open Access Journals (Sweden)

    Manuel J. Peláez

    2013-03-01

    Full Text Available Nos encontramos ante la reedición de un libro clásico de Felipe González Vicén, catedrático de Derecho Natural y Filosofía del Derecho que lo fue de las Universidades de Sevilla y La Laguna, fallecido en 1991. Su tesis doctoral, que indudablemente está en este libro, fue menospreciada por el tribunal llamado a juzgarla en la Universidad de Madrid, otorgándole la calificación de Aprobado. La figura de González Vicén está acompañada de una leyenda, que conviene ir aclarando poco a poco con el paso del tiempo. Autor de fina pluma y con un gran conocimiento de la doctrina alemana, recoge en el presente libro la evolución de las teorías sobre la revolución, incidiendo en la importancia que tiene el orden jurídico establecido y el derecho de resistencia ante la existencia de poderes injustos. También determina la diferenciación conceptual que puede hacerse entre revolución, golpe de Estado, conquista y reformas de las constituciones vigentes.

  12. RESEñA DEL LIBRO “LA GENERACIóN App. CóMO LOS JóVENES GESTIONAN SU IDENTIDAD, SU PRIVACIDAD y SU IMAGINACIóN EN EL MUNDO DIGITAL” HOWARD GARDNER y kATIE DAVIS (2014. BARCELONA, PAIDóS, 238 PáGS.

    Directory of Open Access Journals (Sweden)

    Carlos Bolívar Bonilla Baquero

    2015-11-01

    Full Text Available os autores logran una crítica equilibrada al sustentar, cualitativa y estadísticamente, las bondades y riesgos de las nuevas tecnologías de la comunicación para la construcción subjetiva de los jóvenes de la "Generación app" (aplicaciones o programas informáticos en los dispositivos móviles. De manera prudente no les asignan a las tecnologías un carácter de causalidad determinante en los actuales comportamientos juveniles, pero admiten que se trata de un poderoso fenómeno tanto imparable como coadyuvante en las concepciones dominantes del mundo y las prácticas de interacción social, fenómeno que debe estudiarse en conexión con múltiples factores familiares, educativos, culturales, económicos y políticos del desarrollo histórico social que vivimos.

  13. Antonio Maria Baggio (ed., Adriana Cossedu, Paolo Giusta, Rodrigo Mardones Z. y Antonio Márquez Prieto, Caino e i suoi fratelli. Il fondamento relazionale nella politica e nel diritto, Città Nuova, Roma, 2012, 247 págs.

    Directory of Open Access Journals (Sweden)

    María Salas Porras

    2013-03-01

    Full Text Available Los estudios recogidos en este volumen intentan reinterpretar los fundamentos de la Política y del Derecho, enmarcados en el horizonte relacional que la fraternidad les abre. Desde esta perspectiva, la fraternidad asume una relevancia política y jurídica en la medida en que se la entienda sustancialmente ligada a la libertad y a la igualdad. Cada una de las tres categorías, en la medida en que sean consideradas conjuntamente, llegan a adquirir su propio significado a través de la relación con las otras. El redescubrimiento de la fraternidad significa por tanto volver a proponer el "tríptico" entero, para recuperar, a través del mismo, el proyecto humanísitico de la modernidad, y liberarnos del destino del conflicto radical al que nuestro tiempo parece condenado: Caín no sólo ha matado a su hermano, sino que también ha fundado la primera ciudad, es decir, el lugar donde la violencia se ve confinada por el gobierno y por las leyes. Abrir el Derecho al horizonte de la fraternidad significa, hoy, llevar la racionalidad jurídica más allá de la mera racionalidad técnica; permitir renovar la relación jurídica, volver a encontrar sus fundamentos humanísticos, redescubriendo una justicia que reconcilia y reconstruye, fortificando el vínculo social. Considerar la fraternidad una categoría política significa poder emitir juicios políticos, capaces de producir un pensamiento político a través de la óptica de la fraternidad; se abandonan así las lógicas de la ideología, para intentar construir una forma de pensamiento en disposición de pasar, de una idea intuitiva de fraternidad, a una definición que la haga operativa, "operacionalizable". Es una tarea que no corresponde hoy a una sola disciplina, sino que interesa a todo el conjunto de los ya numerosos estudiosos que se han enrolado en este frente, interactuando entre sí de manera interdisiciplinar y abriendo un camino en el cual resulte posible, a todos los que han abrazado un humanismo y un ideal político, encontrar las mejores razones de su esperanza.

  14. Borja Gómez, Jaime y Rodríguez Jiménez, Pablo. Historia de la vida privada en Colombia. Tomo I: Las fronteras difusas del siglo XVI a 1880. Bogotá: Taurus, 2011, 396 págs.

    Directory of Open Access Journals (Sweden)

    Didier Francisco Ríos García

    2012-07-01

    Full Text Available Desde mediados de los ochenta cuando Philippe Ariès y George Duby, sacaron a la luz un trabajo sobre la vida privada, se ha generado un nuevo movimiento historiográfico que ha recorrido el mundo, el cual no trata lo que siempre la historia había trabajado, sino que se concentraba en la vida de las vidas secretas de las personas, ya fueran personajes públicos o desconocidas, también se hablo de las situaciones que vivían los sectores marginales de la población, todos visto desde el punto de vista de su vida en los ambientes alejados del escrutinio público, desde su forma de vestir, sus amores, sus aventuras, su alimentación y de las mismos espacios que frecuentaban.

  15. Categorizing renal oncocytic neoplasms on core needle biopsy: a morphologic and immunophenotypic study of 144 cases with clinical follow-up. Alderman MA, Daignault S, Wolf JS Jr, Palapattu GS, Weizer AZ, Hafez KS, Kunju LP, Wu AJ. Hum Pathol.September 2016;55:1-10.

    Science.gov (United States)

    Kryvenko, Oleksandr N

    2017-06-01

    There is limited literature on renal oncocytic neoplasms diagnosed on core biopsy. All renal oncocytic neoplasm core biopsies from 2006 to 2013 were, retrospectively, reviewed. Morphologic features and an immunohistochemical panel of CK7, c-KIT, and S100A1 were assessed. Concordance with resection diagnosis, statistical analysis including a random forest classification, and follow-up were recorded. The postimmunohistochemical diagnoses of 144 renal oncocytic core biopsies were favor oncocytoma (67%), favor renal cell carcinoma (RCC) (12%), and cannot exclude RCC (21%). Diagnosis was revised following immunohistochemistry in 7% of cases. The most common features for oncocytoma (excluding dense granular cytoplasm) were nested architecture, edematous stroma, binucleation and tubular architecture; the most common features for favor RCC were sheet-like architecture, nuclear pleomorphism, papillary architecture, and prominent cell borders. High nuclear grade, necrosis, extensive papillary architecture, raisinoid nuclei, and frequent mitoses were not seen in oncocytomas. Comparing the pathologist and random forest classification, the overall out-of-bag estimate of classification error dropped from 23% to 13% when favor RCC and cannot exclude RCC was combined into 1 category. Resection was performed in 19% (28 cases) with a 94% concordance (100% of favor RCC biopsies and 90% of cannot exclude RCC biopsies confirmed as RCC; 83% of favor oncocytomas confirmed); ablation in 23%; and surveillance in 46%. Follow-up was available in 92% (median follow-up, 33 months) with no adverse outcomes. Renal oncocytic neoplasms comprise a significant subset (16%) of all core biopsies, and the majority (78%) can be classified as favor oncocytoma or favor RCC. Copyright © 2017 Elsevier Inc. All rights reserved.

  16. Lexikon der Romanistischen Linguistik (LRL. Edité par Günter Holtus -Michael Metzeltin - Christian Schmitt. Volume VI,l. Aragones/Navarro, Español, Asturiano/Leonés. Max Niemeyer Verlag, Tübingen 1992, págs. XXXVIII+708

    Directory of Open Access Journals (Sweden)

    Mitja Skubic

    1993-12-01

    Full Text Available El Diccionario enciclopédico de lingüistica románica (LRL es un compendio general de todo el saber romanistico sobre Ia génesis, el desarrollo y el estado actual de las lenguas romanicas. La obra consta de ocho volúmenes, de los cuales han aparecido, hasta ahora, los que tratan de las lenguas románicas desde el Renacimiento basta nuestros dias, con excepción del volumen reservado al gallego y portugués. Esperamos, por tanto, con gran interes la aparición del segundo volumen, dedicado al latín y al desarrollo de las lenguas románicas desde la Edad Media basta el Renacimiento.

  17. PATTE, GENEVIÈVE. ¿Qué los hace leer así? Los niños, la lectura y las bibliotecas. Ciudad de México: Fondo de Cultura Económica, 2011, 270 págs. ISBN: 978-607-16-0792-8.

    Directory of Open Access Journals (Sweden)

    Fermín Ezpeleta Aguilar

    2012-10-01

    Full Text Available El presente trabajo es el último ensayo de Geneviève Patte (1936-, bibliotecaria francesa excepcional que cuenta entre otras distinciones la Orden Nacional de Mérito o la condecoración de Chevelier des Arts et Lettres por la consagración de toda una vida al fomento de la lectura infantil en todos los dominios geográficos. El libro, traducido al español por Lirio Garduño Buono, se estructura en doce capítulos, cada uno de los cuales puede leerse de forma autónoma, si bien tomados en su conjunto refuerzan el objetivo que se propone la autora, que es el de transmitir mediante argumentos de experiencia propia la clave humana en la que se asienta la labor del bibliotecario, y en particular la del bibliotecario infantil de hoy.

  18. André Thibault, Perfecto simple y perfecto compuesto en español preclásico. Estudio de los perfectos de indicativo en "La Celestina", el "Teatro" de Encina y el "Dialogo de Ia lengua". Beihefte zur ZRPh, Band 301, Max Niemeyer Verlag, Tübingen 2000; págs.

    Directory of Open Access Journals (Sweden)

    Mitja Skubic

    2001-12-01

    Full Text Available La suerte del perfectum latino en lenguas románicas no deja de atraer a los investigadores de los problemas sintácticos. Suenan como profecía las palabras con las cuales el Autor concluyó su trabajo diciendo que en este campo queda todavía mucho por hacer; la profecía parece válida no solo para el español, sino para todo el mundo romance. Prof. André Thibault ha restringido su investigación sobre el pretérito simple y compuesto (permítaseme la terminologia a la cual estoy acostumbrado a los tres grandes acontecimientos en la literatura española, indicados en el título, pero antepuso a su trabajo un amplio panorama histórico, incluyendo en ello anotaciones sobre las tendencias en algunos idiomas indoeuropeos que demuestran los usos de las formas simples y las compuestas y no sólo en el campo del pretérito.

  19. Gene expression, cellular localisation and function of glutamine synthetase isozymes in wheat ( Triticum aestivum L.)

    DEFF Research Database (Denmark)

    Bernard, Stéphanie M; Møller, Anders Laurell Blom; Dionisio, Giuseppe

    2008-01-01

    sheath cells. In situ localisation confirmed that GS1 transcripts were present in the perifascicular sheath cells whilst those for GSr were confined to the vascular cells. Studies of the expression and protein profiles showed that all GS sub-families were differentially expressed in the leaves, peduncle......, glumes and roots. Expression of GS genes in leaves was developmentally regulated, with both GS2 and GS1 assimilating or recycling ammonia in leaves during the period of grain development and filling. During leaf senescence the cytosolic isozymes, GS1 and GSr, were the predominant forms, suggesting major...

  20. Regulation of glutamine synthetase isoforms in two differentially drought-tolerant rice (Oryza sativa L.) cultivars under water deficit conditions.

    Science.gov (United States)

    Singh, Kamal Krishna; Ghosh, Shilpi

    2013-02-01

    KEY MESSAGE : The regulation of GS isoforms by WD was organ specific. Two GS isoforms i.e. OsGS1;1 and OsGS2 were differentially regulated in IR-64 (drought-sensitive) and Khitish (drought-tolerant) cultivars of rice. Water deficit (WD) has adverse effect on rice (Oryza sativa L.) and acclimation requires essential reactions of primary metabolism to continue. Rice plants utilize ammonium as major nitrogen source, which is assimilated into glutamine by the reaction of Glutamine synthetase (GS, EC 6.3.1.2). Rice plants possess one gene (OsGS2) for chloroplastic GS2 and three genes (OsGS1;1, OsGS1;2 and OsGS1;3) for cytosolic GS1. Here, we report the effect of WD on regulation of GS isoforms in drought-sensitive (cv. IR-64) and drought-tolerant (cv. Khitish) rice cultivars. Under WD, total GS activity in root and leaf decreased significantly in IR-64 seedlings in comparison to Khitish seedlings. The reduced GS activity in IR-64 leaf was mainly due to decrease in GS2 activity, which correlated with decrease in corresponding transcript and polypeptide contents. GS1 transcript and polypeptide accumulated in leaf during WD, however, GS1 activity was maintained at a constant level. Total GS activity in stem of both the varieties was insensitive to WD. Among GS1 genes, OsGS1;1 expression was differently regulated by WD in the two rice varieties. Its transcript accumulated more abundantly in IR-64 leaf than in Khitish leaf. Following WD, OsGS1;1 mRNA level in stem and root tissues declined in IR-64 and enhanced in Khitish. A steady OsGS1;2 expression patterns were noted in leaf, stem and root of both the cultivars. Results suggest that OsGS2 and OsGS1;1 expression may contribute to drought tolerance of Khitish cultivar under WD conditions.

  1. Comparison of clinical outcomes between upgraded pathologic Gleason score 3 + 4 and non-upgraded 3 + 4 prostate cancer among patients who are candidates for active surveillance.

    Science.gov (United States)

    Jo, Jung Ki; Hong, Sung Kyu; Byun, Seok-Soo; Lee, Sang Eun; Oh, Jong Jin

    2015-11-01

    To clarify differences patients with pathological GS (pGS) 3 + 4 according to biopsy Gleason score (bGS) after radical prostatectomy (RP) among candidates for active surveillance. Between January 2006 and June 2014, 619 patients who met Royal Marsden criteria and had a pGS 3 + 4 after RP were identified. Patients were stratified into two groups according to bGS: Group A (n = 430) with bGS (3 + 3) and Group B (n = 189) with bGS 7 (3 + 4). Pathological outcomes were compared between the two groups, and the impact of bGS on adverse pathological outcomes was analyzed by logistic regression and biochemical recurrence (BCR)-free survival compared by log-rank test and the Cox proportional hazards model. The patients in Group B had a higher rate of extracapsular extension (ECE), seminal vesicle invasion and positive surgical margins than those in Group A (p Cox regression, maximum percentage of core involvement were strongly associated with BCR [hazard ratio (HR) 1.773 (1.248-2.519), p = 0.001]. pGS 3 + 4 was associated with heterogeneous pathologic and biochemical outcomes according to bGS. Patients with pGS 3 + 4 upgraded from bGS 3 + 3 had more favorable pathological outcomes and biochemical survival outcomes than those with bGS 3 + 4.

  2. Simulation insights into thermally conductive graphene-based nanocomposites

    Science.gov (United States)

    Konatham, D.; Bui, K. N. D.; Papavassiliou, D. V.; Striolo, A.

    2011-01-01

    Dispersing nanoparticles in a polymer can enhance both mechanical and transport properties. Nanocomposites with high thermal conductivity could be obtained by using thermally conductive nanoparticles. Carbon-based nanoparticles are extremely promising, although high resistances to heat transfer from the nanoparticles to the polymer matrix could cause significant limitations. This work focuses on graphene sheets (GS) dispersed within n-octane. Although pristine GS agglomerate, equilibrium molecular dynamic simulations suggest that when the GS are functionalized with short branched hydrocarbons along the GS edges, they remain well dispersed. Results are reported from equilibrium and non-equilibrium molecular dynamics simulations to assess the effective interactions between dispersed GS, the self-assembly of GS, and the heat transfer through the GS-octane nanocomposite. Tools are designed to understand the effect of GS size, solvent molecular weight and molecular architecture on GS dispersability and GS-octane thermal conductivity. Evidence is provided for the formation of nematic phases when the GS volume fraction increases within octane. The atomic-level results are input for a coarse-grained Monte Carlo simulation that predicts anisotropic thermal conductivity for GS-based composites when the GS show nematic phases.

  3. ACTIVITIES OF AMMONIA ASSIMILATION ENZYMES AS INDICATORS OF THE RELATIVE SUPPLY OF NITROGEN SUBSTRATES FOR MARINE BACTERIOPLANKTON IN SUB-TROPICAL COASTAL WATER

    Science.gov (United States)

    The supply of nitrogen substrates available for bacterial production in seawater was determined using the activities of ammonia assimilation enzymes, glutamine synthetase (GS) and glutamate dehydrogenase (GDH). Expression of GS and GDH by bacteria in pure culture is generally ind...

  4. 5 CFR 531.610 - Treatment of locality rate as basic pay.

    Science.gov (United States)

    2010-01-01

    ..., relocation, and retention incentives, supervisory differentials, and extended assignment incentives under 5 U... of basic pay; (j) GS pay administration provisions (e.g., GS promotion provisions) to the extent...

  5. 75 FR 35095 - Excepted Service

    Science.gov (United States)

    2010-06-21

    ..., enterprise architecture, intelligence analysis, investigation, investigative analysis and cyber-related... temporary appointments in the following occupational series: Security (GS-0080), intelligence analysts (GS... Assistant of the Navy for Business Operations and Transformation. Effective May 19, 2010. Department of...

  6. Campylobacter concisus Genomospecies 2 Is Better Adapted to the Human Gastrointestinal Tract as Compared with Campylobacter concisus Genomospecies 1

    Directory of Open Access Journals (Sweden)

    Yiming Wang

    2017-08-01

    Full Text Available Campylobacter concisus was previously shown to be associated with inflammatory bowel disease including Crohn's disease (CD and ulcerative colitis (UC. C. concisus has two genomospecies (GS. This study systematically examined the colonization of GS1 and GS2 C. concisus in the human gastrointestinal tract. GS1 and GS2 specific polymorphisms in 23S rRNA gene were identified by comparison of the 23S rRNA genes of 49 C. concisus strains. Two newly designed PCR methods, based on the polymorphisms of 23S rRNA gene, were developed and validated. These PCR methods were used to detect and quantify GS1 and GS2 C. concisus in 56 oral and enteric samples collected from the gastrointestinal tract of patients with IBD and healthy controls. Meta-analysis of the composition of the isolated GS1 and GS2 C. concisus strains in previous studies was also conducted. The quantitative PCR methods revealed that there was more GS2 than GS1 C. concisus in samples collected from the upper and lower gastrointestinal tract of both patients with IBD and healthy controls, showing that GS2 C. concisus is better adapted to the human gastrointestinal tract. Analysis of GS1 and GS2 composition of isolated C. concisus strains in previous studies showed similar findings except that in healthy individuals a significantly lower GS2 than GS1 C. concisus strains were isolated from fecal samples, suggesting a potential difference in the C. concisus strains or the enteric environment between patients with gastrointestinal diseases and healthy controls. This study provides novel information regarding the adaptation of different genomospecies of C. concisus in the human gastrointestinal tract.

  7. Weak mitochondrial targeting sequence determines tissue-specific subcellular localization of glutamine synthetase in liver and brain cells.

    NARCIS (Netherlands)

    Matthews, G.D.; Gur, N.; Koopman, W.J.H.; Pines, O.; Vardimon, L.

    2010-01-01

    Evolution of the uricotelic system for ammonia detoxification required a mechanism for tissue-specific subcellular localization of glutamine synthetase (GS). In uricotelic vertebrates, GS is mitochondrial in liver cells and cytoplasmic in brain. Because these species contain a single copy of the GS

  8. Evolutionary history of the somatostatin and somatostatin receptors

    Indian Academy of Sciences (India)

    iaris (dog) SST (NM 001003307), SSTR1 (AY702069),. SSTR2 (AY702068), SSTR3 (AY643737), SSTR4a. (GS 19578333-19582486), SSTR4b (GS 19578957-. 19579787), SSTR4c (GS 10000450-10001292) and. SSTR5 (XM 547202); H. sapiens SST (NM 001048),. SSTR1 (M81829), SSTR2a (AAF42809), SSTR2a.

  9. Evaluating PVALB as a candidate gene for SLC12A3-negative cases of Gitelman's syndrome.

    NARCIS (Netherlands)

    Riveira-Munoz, E.; Devuyst, O.; Belge, H.; Jeck, N.; Strompf, L.; Vargas-Poussou, R.; Jeunemaitre, X.; Blanchard, A.; Knoers, N.V.A.M.; Konrad, M.; Dahan, K.

    2008-01-01

    BACKGROUND: Loss-of-function mutations in SLC12A3 coding for the thiazide-sensitive NaCl cotransporter (NCC) cause Gitelman's syndrome (GS), a recessively inherited salt-losing tubulopathy. Most GS patients are compound heterozygous. However, up to 30% of GS patients carry only a single mutant

  10. 75 FR 60643 - Customs and Border Protection Officer Retirement

    Science.gov (United States)

    2010-10-01

    ... (A) who holds a position within the GS-1895 job series (determined applying the criteria in effect as... meeting the requirement of being a ``position within the GS-1895 job series (determined applying the... Homeland Security after performing such duties in 1 or more positions within the GS-1895 job series...

  11. Enzymology and Molecular Biology of Cell Wall Biosynthesis. Final Technical Report

    Energy Technology Data Exchange (ETDEWEB)

    Dr. Peter M. Ray

    2000-04-01

    The following aspects of enzymology of cell wall synthesis were pursued under this cited grant: (1) Isolation of plasma membrane-localized glucan synthase II (GS-II) of pea; (2) Cloning of genes for possible plant GS-II components; (3) Golgi glucan synthase-I (GS-I); and (4) Golgi reversibly glycosylated protein 1 (RGP1).

  12. DSTO Landmine Detection Test Targets

    Science.gov (United States)

    2005-06-01

    cm diameter, 10 cm high. x x GS 32D50 Galvanised steel, pipe, hollow, 32 cm diameter, 50 cm long, ends capped x x GS 45D50 Galvanised Steel, pipe...hollow, 45 cm diameter, 50 cm long, ends capped x x GS 75D50 Galvanised Steel, pipe, hollow, 75 cm diameter, 50 cm long, ends capped x x

  13. General surgery workloads and practice patterns in the United States, 2007 to 2009: a 10-year update from the American Board of Surgery.

    Science.gov (United States)

    Valentine, R James; Jones, Andrew; Biester, Thomas W; Cogbill, Thomas H; Borman, Karen R; Rhodes, Robert S

    2011-09-01

    To assess changes in general surgery workloads and practice patterns in the past decade. Nearly 80% of graduating general surgery residents pursue additional training in a surgical subspecialty. This has resulted in a shortage of general surgeons, especially in rural areas. The purpose of this study is to characterize the workloads and practice patterns of general surgeons versus certified surgical subspecialists and to compare these data with those from a previous decade. The surgical operative logs of 4968 individuals recertifying in surgery 2007 to 2009 were reviewed. Data from 3362 (68%) certified only in Surgery (GS) were compared with 1606 (32%) with additional American Board of Medical Specialties certificates (GS+). Data from GS surgeons were also compared with data from GS surgeons recertifying 1995 to 1997. Independent variables were compared using factorial ANOVA. GS surgeons performed a mean of 533 ± 365 procedures annually. Women GS performed far more breast operations and fewer abdomen, alimentary tract and laparoscopic procedures compared to men GS (P surgery procedures. GS practice patterns are heterogeneous; gender, age, and practice setting significantly affect operative caseloads. A substantial portion of general surgery procedures currently are performed by GS+ surgeons, whereas GS surgeons continue to perform considerable numbers of specialty operations. Reduced general surgery operative experience in GS+ residencies may negatively impact access to general surgical care. Similarly, narrowing GS residency operative experience may impair specialty operation access.

  14. Organ-specific activity of the 5' regulatory region of the glutamine synthetase gene in developing mice

    NARCIS (Netherlands)

    Lie-Venema, H.; de Boer, P. A.; Moorman, A. F.; Lamers, W. H.

    1997-01-01

    Glutamine synthetase (GS) converts ammonia and glutamate into glutamine. We assessed the activity of the 5' regulatory region of the GS gene in developing transgenic mice carrying the chloramphenicol acetyltransferase (CAT) gene under the control of 3150 bp of the upstream sequence of the rat GS

  15. Gene-expression analysis of gleason grade 3 tumor glands embedded in low- and high-risk prostate cancer

    NARCIS (Netherlands)

    A.M. Hoogland (Marije); R. Böttcher (René); E.I. Verhoef (Esther); G.W. Jenster (Guido); G.J.H.L. Leenders (Geert)

    2016-01-01

    markdownabstractThe Gleason score (GS) of prostate cancer on diagnostic biopsies is an important parameter for therapeutic decision-making. Biopsy GS under-estimates the actual GS at radical prostatectomy in a significant number of patients due to sampling artifact. The aim of this study was to

  16. Genome size variation in wild and cultivated maize along altitudinal gradients

    Science.gov (United States)

    Díez, Concepción M.; Gaut, Brandon S.; Meca, Esteban; Scheinvar, Enrique; Montes-Hernandez, Salvador; Eguiarte, Luis E.; Tenaillon, Maud I.

    2014-01-01

    Summary • It is still an open question as to whether genome size (GS) variation is shaped by natural selection. One approach to address this question is a population-level survey that assesses both the variation in GS and the relationship of GS to ecological variants. • We assessed GS in Zea mays, a species that includes the cultivated crop, maize, and its closest wild relatives, the teosintes. We measured GS in five plants of each of 22 maize landraces and 21 teosinte populations from Mexico sampled from parallel altitudinal gradients. • GS was significantly smaller in landraces than in teosintes, but the largest component of GS variation was among landraces and among populations. In maize, GS correlated negatively with altitude; more generally, the best GS predictors were linked to geography. By contrast, GS variation in teosintes was best explained by temperature and precipitation. • Overall, our results further document the size flexibility of the Zea genome, but also point to a drastic shift in patterns of GS variation since domestication. We argue that such patterns may reflect the indirect action of selection on GS, through a multiplicity of phenotypes and life-history traits. PMID:23550586

  17. Scaffold Attachment Factor B1: A Novel Chromatin Regulator of Prostate Cancer Metabolism

    Science.gov (United States)

    2016-10-01

    characteristics Sample type Features PCS1 PCS2 PCS3 Patient tumors Proportion 6% 47% 47% Pathology Enriched GS 8 Enriched GS 7 Enriched GS 7 Prognosis Poor...and relaxation in the guinea-pig internal anal sphincter. Br J Pharmacol 1990;100:329–35. 39. Visvader JE. Keeping abreast of the mammary epithelial

  18. 77 FR 2135 - Swap Data Recordkeeping and Reporting Requirements

    Science.gov (United States)

    2012-01-13

    ... from Argentina, Australia, Brazil, Canada, China, Dubai (United Arab Emirates), France, Germany, Hong...''); (48) GS1 US (``GS1'') February 7, 2011 (``CL-GS1''); (49) Intercontinental Exchange, Inc. (``ICE'') February 7, 2011 (``CL-ICE''); (50) International Energy Credit Association (``IECA'') February 7, 2011...

  19. Adsorption of Crystal Violet onto Adsorbents Derived from ...

    African Journals Online (AJOL)

    Suitability of adsorbents derived from groundnut shell (GS) and bean pod (BP) in removing crystal violet from aqueous solution was evaluated in a series of batch experiments. Findings reveal that the points of zero charge (PZC) of GS and BP are 3.50 and 3.00 respectively. Findings also show that GS and BP exhibit ...

  20. Gender-Segregated Schooling: A Problem Disguised as a Solution

    Science.gov (United States)

    Fabes, Richard A.; Martin, Carol Lynn; Hanish, Laura D.; Galligan, Kathrine; Pahlke, Erin

    2015-01-01

    Gender-segregated (GS) schooling has become popular in the United States despite the fact that every major review has concluded that GS schooling is not superior to coeducational schooling. Moreover, concern has been raised that GS schooling leads to negative effects, including increased gender stereotyping. We argue that these negative effects…

  1. Enhancement of glutamine synthetase activity in Paenibacillus ...

    African Journals Online (AJOL)

    Accession No AB727983). High GS activity was recorded in the two strains, in presence of the divalent cations Mg+2 and Mn+2. Western blot analysis confirmed the presence of the GS at approximately ~60 kDa. GS activity was found to be affected by ...

  2. Midday stomatal conductance is more related to stem rather than leaf water status in subtropical deciduous and evergreen broadleaf trees

    Science.gov (United States)

    Yong-Jiang Zhang; Frederick C. Meinzer; Qi Jin-Hua; Guillermo Goldstein; Cao. Kun-Fang

    2012-01-01

    Midday depressions in stomatal conductance (gs/>) and photosynthesis are common in plants. The aim of this study was to understand the hydraulic determinants of midday gs, the coordination between leaf and stem hydraulics and whether regulation of midday gs/> differed between...

  3. Applying Modeling Tools to Ground System Procedures

    Science.gov (United States)

    Di Pasquale, Peter

    2012-01-01

    As part of a long-term effort to revitalize the Ground Systems (GS) Engineering Section practices, Systems Modeling Language (SysML) and Business Process Model and Notation (BPMN) have been used to model existing GS products and the procedures GS engineers use to produce them.

  4. The glutamine synthetase gene family in Populus

    Directory of Open Access Journals (Sweden)

    Cánovas Francisco M

    2011-08-01

    Full Text Available Abstract Background Glutamine synthetase (GS; EC: 6.3.1.2, L-glutamate: ammonia ligase ADP-forming is a key enzyme in ammonium assimilation and metabolism of higher plants. The current work was undertaken to develop a more comprehensive understanding of molecular and biochemical features of GS gene family in poplar, and to characterize the developmental regulation of GS expression in various tissues and at various times during the poplar perennial growth. Results The GS gene family consists of 8 different genes exhibiting all structural and regulatory elements consistent with their roles as functional genes. Our results indicate that the family members are organized in 4 groups of duplicated genes, 3 of which code for cytosolic GS isoforms (GS1 and 1 which codes for the choroplastic GS isoform (GS2. Our analysis shows that Populus trichocarpa is the first plant species in which it was observed the complete GS family duplicated. Detailed expression analyses have revealed specific spatial and seasonal patterns of GS expression in poplar. These data provide insights into the metabolic function of GS isoforms in poplar and pave the way for future functional studies. Conclusions Our data suggest that GS duplicates could have been retained in order to increase the amount of enzyme in a particular cell type. This possibility could contribute to the homeostasis of nitrogen metabolism in functions associated to changes in glutamine-derived metabolic products. The presence of duplicated GS genes in poplar could also contribute to diversification of the enzymatic properties for a particular GS isoform through the assembly of GS polypeptides into homo oligomeric and/or hetero oligomeric holoenzymes in specific cell types.

  5. Gait Speed and Dependence in Activities of Daily Living in Older Adults With Severe Aortic Stenosis

    Science.gov (United States)

    Green, Philip; Woglom, Abigail E.; Genereux, Philippe; Maurer, Mathew S.; Kirtane, Ajay J.; Hawkey, Marian; Schnell, Susan; Sohn, Jeanie; Moses, Jeffrey W.; Leon, Martin B.; Smith, Craig R.; Williams, Mathew; Kodali, Susheel

    2013-01-01

    Background In the transcatheter aortic valve replacement era, characterization of functional status in older adults with aortic stenosis (AS) is essential. Gait speed (GS) is emerging as a marker of frailty and predictor of outcomes in older adults undergoing cardiovascular intervention. The objective of this study was to delineate the prevalence of slow GS, evaluate the association of GS with factors used in standard cardiovascular assessments, and evaluate the association of GS with dependence in activities of daily living (ADLs) in older adults with AS. Hypothesis We hypothesized that gait speed would not be associated with clinical factors, but would be associated with ADLs. Methods We evaluated GS, ADLs dependence, and Society of Thoracic Surgery score along with clinical and functional assessments in 102 older adults with AS being evaluated for transcatheter valve. Gait speed <0.5 m/s was considered slow, and GS ≥0.5 m/s was considered preserved. We assessed the association of covariates with GS as well as with ADLs dependence. Results Median GS was 0.37 m/s (interquartile range, 0.0–0.65 m/s). Sixty-four (63%) subjects had slow GS. Of commonly employed clinical covariates, only prior coronary intervention and serum albumin were weakly associated with GS. However, GS was independently associated with ADLs dependence (Odds ratio: 1.52 [1.21–1.91] for every 0.1 m/s decrease in GS; P = 0.0003). Conclusions Although the prevalence of slow GS in a population of elderly patients with severe AS being screened for transcatheter valve was high, there were only weak associations between GS and other risk stratifying tools. The strong association between GS and dependent functional status suggests that assessment of gait speed is a useful, objectively measurable, risk stratification tool in this population. PMID:22331630

  6. Mixed-mode synchronization between two inhibitory neurons with post-inhibitory rebound

    Science.gov (United States)

    Nagornov, Roman; Osipov, Grigory; Komarov, Maxim; Pikovsky, Arkady; Shilnikov, Andrey

    2016-07-01

    We study an array of activity rhythms generated by a half-center oscillator (HCO), represented by a pair of reciprocally coupled neurons with post-inhibitory rebounds (PIR). Such coupling-induced bursting possesses two time scales, one for fast spiking and another for slow quiescent periods, is shown to exhibit an array of synchronization properties. We discuss several HCO configurations constituted by two endogenous bursters, by tonic-spiking and quiescent neurons, as well as mixed-mode configurations composed of neurons of different type. We demonstrate that burst synchronization can be accompanied by complex, often chaotic, interactions of fast spikes within synchronized bursts.

  7. Beasts in Lambda-CDM zoo

    Science.gov (United States)

    Dolgov, A. D.

    2017-09-01

    Recent astronomical discoveries of supermassive black holes (quasars), gamma-bursters, super-novae, and dust at high redshifts, z = (5-10), are reviewed. Such a dense population of the early universe is at odds with the conventional mechanisms of its possible origin. Similar data from the contemporary universe, which are also in conflict with natural expectations, are considered too. Two possible mechanisms are suggested, at least one of which can potentially solve all these problems. As a by-product of the last model, an abundant cosmological antimatter may be created.

  8. Phase Multistability in Coupled Oscillator Systems

    DEFF Research Database (Denmark)

    Mosekilde, Erik; Postnov, D.E.; Sosnovtseva, Olga

    2003-01-01

    The phenomenon of phase multistability arises in connection with the synchronization of coupled oscillator systems when the systems individually display complex wave forms associated, for instance, with the presence of subharmonic components or with significant variations of the phase velocity...... along the orbit of the individual oscillator. Focusing on the mechanisms underlying the appearance of phase multistability, the paper examines a variety of phase-locked patterns. In particular we demonstrate the nested structure of synchronization regions for oscillations with multicrest wave forms...... and investigate how the number of spikes per train and the proximity of a neighboring equilibrium point can influence the formation of coexisting regimes in coupled bursters....

  9. INTEGRAL monitoring of unusually long X-ray bursts

    DEFF Research Database (Denmark)

    Chenevez, Jérôme; Falanga, M.; Kuulkers, E.

    2008-01-01

    X-ray bursts are thermonuclear explosions on the surface of accreting neutron stars in X-ray binaries. As most of the known X-ray bursters are frequently observed by INTEGRAL, an international collaboration have been taking advantage of its instrumentation to specifically monitor the occurrence...... of exceptional burst events lasting more than ~10 minutes. Half of the dozen so-called intermediate long bursts registered so far have been observed by INTEGRAL. The goal is to derive a comprehensive picture of the relationship between the nuclear ignition processes and the accretion states of the system leading...

  10. First superburst observed by INTEGRAL/JEM-X

    DEFF Research Database (Denmark)

    Chenevez, Jérôme

    X-ray bursters are neutron stars in low mass X-ray binaries where hydrogen and/or helium accretes on the surface, and explodes in recurrent thermonuclear runaways. Such type I X-ray bursts, characterized by a black-body emission, generally display a fast rise time followed by an exponential cooling...... carbon shell flashes in the layers below the surface of the neutron star, while the intermediately long bursts are generally explained by the unstable burning of a thick atmospheric layer of pure helium. On February 13, 2011, the Danish-built X-ray monitor JEM-X onboard the INTEGRAL satellite observed...

  11. Half-life determination of T{sub z} = -1 and T{sub z} = -(1)/(2) proton-rich nuclei and the β decay of {sup 58}Zn

    Energy Technology Data Exchange (ETDEWEB)

    Kucuk, L.; Oktem, Y.; Cakirli, R.B.; Ganioglu, E.; Susoy, G. [Istanbul University, Department of Physics, Istanbul (Turkey); Orrigo, S.E.A.; Montaner-Piza, A.; Rubio, B. [CSIC-Universidad de Valencia, Instituto de Fisica Corpuscular, Valencia (Spain); Fujita, Y. [Osaka University, Department of Physics, Toyonaka, Osaka (Japan); Osaka University, Research Center for Nuclear Physics, Ibaraki, Osaka (Japan); Gelletly, W. [CSIC-Universidad de Valencia, Instituto de Fisica Corpuscular, Valencia (Spain); University of Surrey, Department of Physics, Guildford, Surrey (United Kingdom); Blank, B.; Ascher, P.; Giovinazzo, J.; Grevy, S. [Centre d' Etudes Nucleaires de Bordeaux Gradignan, CNRS/IN2P3 - Universite de Bordeaux, Gradignan (France); Adachi, T.; Fujita, H.; Tamii, A. [Osaka University, Research Center for Nuclear Physics, Ibaraki, Osaka (Japan); Algora, A. [CSIC-Universidad de Valencia, Instituto de Fisica Corpuscular, Valencia (Spain); Inst. of Nuclear Research of the Hung. Acad. of Sciences, Debrecen (Hungary); France, G. de; Oliveira Santos, F. de; Thomas, J.C. [Grand Accelerateur National d' Ions Lourds (GANIL), CEA/DRF-CNRS/IN2P3, Caen (France); Marques, F.M. [Laboratoire de Physique Corpusculaire de Caen, ENSICAEN, UNICAEN, IN2P3/CNRS, Caen (France); Molina, F. [CSIC-Universidad de Valencia, Instituto de Fisica Corpuscular, Valencia (Spain); Comision Chilena de Energia Nuclear, Casilla 188-D, Santiago (Chile); Perrot, L. [IPN Orsay, Orsay (France); Raabe, R. [Grand Accelerateur National d' Ions Lourds (GANIL), CEA/DRF-CNRS/IN2P3, Caen (France); KU Leuven, Instituut voor Kern- en Stralingsfysica, Leuven (Belgium); Srivastava, P.C. [Grand Accelerateur National d' Ions Lourds (GANIL), CEA/DRF-CNRS/IN2P3, Caen (France); Indian Institute of Technology, Department of Physics, Roorkee (India)

    2017-06-15

    We have measured the β-decay half-lives of 16 neutron-deficient nuclei with T{sub z} = -1/2 and -1, ranging from chromium to germanium. They were produced in an experiment carried out at GANIL and optimized for the production of {sup 58}Zn, for which in addition we present the decay scheme and absolute Fermi and Gamow-Teller transition strengths. Since all of these nuclei lie on the rp-process pathway, the T{sub 1/2} values are important ingredients for the rp-process reaction flow calculations and for models of X-ray bursters. (orig.)

  12. Exploding superstars understanding supernovae and gamma-ray bursts

    CERN Document Server

    Mazure, Alain

    2009-01-01

    The exceptional cosmic history and the fabulous destinies of exploding stars – supernovae and gamma-ray bursters – are highly fertile areas of research and are also very special tools to further our understanding of the universe. In this book, cosmologists Dr Alain Mazure and Dr Stéphane Basa throw light on the assemblage of facts, hypotheses and cosmological conclusions and show how these ‘beacons’ illuminate their immediate surroundings and allow us to study the vast cosmos, like searchlights revealing the matter comprising our universe.

  13. New Eyes on the Universe Twelve Cosmic Mysteries and the Tools We Need to Solve Them

    CERN Document Server

    Webb, Stephen

    2012-01-01

    "New Eyes on the Universe -- Twelve Cosmic Mysteries and the Tools We Need to Solve Them" gives an up-to-date broad overview of some of the key issues in modern astronomy and cosmology. It describes the vast amount of observational data that the new generation of observatories and telescopes are currently producing, and how that data might solve some of the outstanding puzzles inherent in our emerging world view. Included are questions such as: What is causing the Universe to blow itself apart? What could be powering the luminous gamma-ray bursters? Where is all the matter in the Uni

  14. A highly prevalent equine glycogen storage disease is explained by constitutive activation of a mutant glycogen synthase

    DEFF Research Database (Denmark)

    Maile, C A; Hingst, Janne Rasmuss; Mahalingan, K K

    2017-01-01

    had significantly higher glycogen content than control horse muscle despite no difference in GS expression. GS activity was significantly higher in muscle from homozygous mutants than from heterozygote and control horses, in the absence and presence of the allosteric regulator, glucose 6 phosphate (G6......P). Muscle from homozygous mutant horses also had significantly increased GS phosphorylation at sites 2+2a and significantly higher AMPKα1 (an upstream kinase) expression than controls, likely reflecting a physiological attempt to reduce GS enzyme activity. Recombinant mutant GS was highly active...

  15. La inútil añoranza de la normalidad

    Directory of Open Access Journals (Sweden)

    Margarita Valencia

    2012-01-01

    Full Text Available Litchis de Madagascar. Aquiles Cuervo. Editorial Elfin de la noche. Buenos Aires, 2011, 91 págs. El ruido de las cosas al caer. Juan Gabriel Vásquez. Premio Alfaguara de novela 2011. Alfaguara. Bogotá. 2011, 259 págs. Tres ataúdes blancos. Antonio Ungar. Premio Herralde de Novela. Editorial Anagrama. Barcelona. 2010, 259 págs. Suicídame. Andrés Arias. Ediciones B. Bogotá, 2010, 261 págs. C.M. no récord. Juan Álvarez. Alfaguara. Bogotá, 2010, 262 págs.

  16. Goldenhar Syndrome with Dextrocardia and Right Pulmonary Hypoplasia: An Unusual Association.

    Science.gov (United States)

    Chaudhary, Nagendra; Shrestha, Sandeep; Halwai, Hemant Kumar

    2017-01-01

    Goldenhar syndrome (GS), a rare condition, occurring due to defect in development of first and second branchial arches, is characterized by a combination of various anomalies involving face, eyes, ears, vertebrae, heart, and lungs. The etiology of GS is not fully known, although various hypotheses have been proposed along with its genetic association and many other causes. Facial asymmetry and hypoplasia of the mandible are characteristic features of GS along with microtia and preauricular appendages and pits. Dextrocardia or pulmonary hypoplasia in GS has previously been reported separately. We report a 7-year-old female child of GS with combination of anomalies, dextrocardia, and pulmonary hypoplasia, which is a rare association.

  17. Glutathione-S-conjugate transport in plants

    Science.gov (United States)

    Rea, Philip A.; Lu, Yu-Ping; Li, Ze-Sheng

    2000-01-01

    The invention includes an isolated DNA encoding a plant GS-X pump polypeptide and an isolated preparation of a plant GS-X pump polypeptide. Also included is an isolated preparation of a nucleic acid which is antisense in orientation to a portion or all of a plant GS-X pump gene. The invention also includes a cells, vectors and transgenic plants having an isolated DNA encoding a plant GS-X pump and methods of use thereof. In addition, the invention relates to plant GS-X pump promoter sequences and the uses thereof.

  18. Characteristics and outcome of Prostate cancer patients with overall biopsy Gleason score 3+4=7 and highest Gleason score 3+4=7 or > 3+4=7.

    Science.gov (United States)

    Verhoef, Esther I; Kweldam, Charlotte F; Kümmerlin, Intan P; Nieboer, Daan; Bangma, Chris H; Incrocci, Luca; van der Kwast, Theodorus H; Roobol, Monique J; van Leenders, Geert J

    2017-11-01

    Prostate cancer heterogeneity and multifocality might result in different Gleason scores (GS) at individual biopsy cores. According to WHO/ISUP guidelines, the GS in each biopsy core should be recorded with optional reporting of overall GS for the entire case. We aimed to compare the clinicopathologic characteristics and outcome of men with overall biopsy GS 3+4=7 with highest GS 3+4=7 (HI=OV) to those with highest GS > 3+4=7 (HI>OV). Prostate cancer biopsies from the European Randomized Study of Screening for Prostate Cancer (ERSPC) were revised according to WHO/ISUP 2014 guidelines (n=1031). In total 370 patients had overall GS 3+4=7, of whom 60 (16%) had at least one biopsy core with GS 4+3=7 or 4+4=8. Men with higher GS than 3+4 (HI>OV) in any of the cores had higher age, Prostate Specific Antigen (PSA) level, number of positive biopsies, percentage tumour involvement, percentage Gleason grade 4 and cribriform or intraductal growth (all P3+4=7 had worse clinicopathologic features, but clinical outcome was not statistically significant. Therefore use of overall GS instead of highest GS for clinical decision-making is justified, potentially preventing overtreatment in prostate cancer patients. This article is protected by copyright. All rights reserved. This article is protected by copyright. All rights reserved.

  19. Tissue-specific changes of glutamine synthetase activity in oats after rhizosphere infestation by Pseudomonas syringae pv. tabaci. Final report

    Energy Technology Data Exchange (ETDEWEB)

    Knight, T.J. [Univ. of Southern Maine, Portland, ME (United States); Temple, S.; Sengupta-Gopalan, C. [New Mexico State Univ., Las Curces, NM (United States)] [and others

    1996-05-15

    Oats (Avena sativa L. lodi) tolerant of rhizosphere infestation by Pseudomonas syringae pv. tabaci when challenged by the pathogen experience tissue-specific alterations of ammonia assimilatory capabilities. Altered ammonia assimilatory potentials between root and leaf tissue result from selective inactivation of glutamine synthetase (GS) by the toxin Tabtoxinine-B-lactam (TBL). Root GS is sensitive and leaf GSs are resistant to TBL inactivation. With prolonged challenge by the pathogen root GS activity decreases but leaf GS specific activity increase. Higher leaf GS activity is due to decreased rates of degradation rather than increased GS synthesis. Higher leaf GS activity and elevated levels of GS polypeptide appear to result from a limited interaction between GS and TBL leading to the accumulation of a less active but more stable GS holoenzyme. Tolerant challenged oats besides surviving rhizosphere infestation, experience enhanced growth. A strong correlation exists between leaf GS activity and whole plant fresh weight, suggesting that tissue-specific changes in ammonia assimilatory capability provides the plant a more efficient mechanism for uptake and utilization of nitrogen.

  20. Los cuentos tristes

    Directory of Open Access Journals (Sweden)

    Alberto Aguirre

    1993-01-01

    Full Text Available La casa del ruego y de la lluvia. Milciades Arévalo. 1992, 119 págs. Esta risa no es de loco. Medardo Arias Satizábal. 1992, 70 págs. La caja de música. Mauricio Peñaranda Castillo. 1992, 69 págs. Mariposas negras sobre la ciudad. Jesús Rincón Murcia. 1992, 167 págs. Acerca y de lejos. Celso Román. 1992, 127 págs. El informe de Galves. Roberto Rubiano Vargas. 1992, 137 págs. El retablo del reposo. Guido Leonardo Tamayo. 1991, 87 págs.

  1. Effect of the expression of an endogenous viral gene on the growth of tumours induced by Rous sarcoma virus in chickens.

    Science.gov (United States)

    Plachý, J; Korec, E; Hlozánek, I; Zdĕnková, E

    1985-01-01

    The endogenous group-specific antigen of avian retroviruses has been detected in feather pulp of chickens of the inbred CB line (WL breed). Expression of the gs antigen has been demonstrated by ELISA, whereas the classical methods have classified the CB line as gs-. The number of gs+ chickens decreased with increasing age after hatching, and all chickens were gs- already at 20 weeks of age. The longer duration of gs antigen expression in line CB chickens had an adverse effect on their ability to regress Rous sarcomas. Chickens from a closed flock of the BL breed that segregated to gs+ and gs- also significantly differed in the ability to regress Rous sarcomas.

  2. Glutamine Synthetase in Legumes: Recent Advances in Enzyme Structure and Functional Genomics

    Directory of Open Access Journals (Sweden)

    Marco Betti

    2012-06-01

    Full Text Available Glutamine synthetase (GS is the key enzyme involved in the assimilation of ammonia derived either from nitrate reduction, N2 fixation, photorespiration or asparagine breakdown. A small gene family is encoding for different cytosolic (GS1 or plastidic (GS2 isoforms in legumes. We summarize here the recent advances carried out concerning the quaternary structure of GS, as well as the functional relationship existing between GS2 and processes such as nodulation, photorespiration and water stress, in this latter case by means of proline production. Functional genomic analysis using GS2-minus mutant reveals the key role of GS2 in the metabolic control of the plants and, more particularly, in carbon metabolism.

  3. The Generalizing Work on History and Culture of the Cossacks (Book Review: Essays on the History and Culture of the Cossacks of Southern Russia: Collective Monograph [Text] / ed. by G. G. Matishov, I. O. Tyumentsev ; Southern Scientic Centre of the Russian Academy of Sciences; Volgograd Branch of Federal State Budgetary Educational Institution of Higher Professional Education “Russian Presidential Academy of National Economy and Public Administration”. – Volgograd : Izd-vo Volgogradskogo Filiala FGBOU VPO RANKhiGS, 2014. – 624 p.

    Directory of Open Access Journals (Sweden)

    Bugay Nikolay F.

    2016-06-01

    Full Text Available This article represents a review of the collective monograph “Essays on the history and culture of the Cossacks of Southern Russia”, published in 2014 under the auspices of the Southern Scientific Centre of the Russian Academy of Sciences and the Volgograd branch of Russian Presidential Academy of National Economy and Public Administration. The review provides a critical analysis of the material in the collective monograph on the problems of studying the history and culture of the Cossacks. The author notes that the revival of Cossacks that began in the 1990s, not only drew attention to the Cossack problem in modern Russia, but also stimulated scientific and public interest in the history and culture of the Cossacks. Russian Cossacks have rich past and its culture is colorful and specific, its role in the history of Russia is significant. Issues of origin and development of the Cossacks, their place among the peoples of Russia, the specificity of cultural practices are constantly causing great interest for researchers. All this has led scientistsspecialists in the history and culture of the Cossacks to the idea of the creation of this scientific work, which has become a generalization of accumulated research experience on the most important issues of the Cossacks’ historical existence. The authors of the monograph limited their research by Southern Russia because of the complexity of creating general work on all Cossack troops which have historically existed in the Russian state and had sometimes very great cultural differences and special historical destiny. The authors made a very successful attempt to highlight the main problematic aspects of the history and culture of the Cossacks. The genre of essay chosen for creating a collective monograph, has allowed not only to identify the most relevant topics of the Cossack history and culture, but also to consider them in relation and development. Each essay contains material that allows to identify the most important problems of different historical periods and various Cossack communities. Together, we get an idea not only about the history of the Cossacks, but also on the results of professional scientific developments in this area. Essays on the history and culture of the Cossacks of Southern Russia – work in which the efforts of its sponsors were systematically analyzed and the main existing today information and research materials on the history and culture of the Cossacks of Southern Russia were compiled into a single concept.

  4. Reformismo, Revolución y Socialismo: aportes y debates sobre la (temprana) radicalización de los jóvenes universitarios entre 1955 y 1966 : Califa, Juan Sebastián. Reforma y Revolución. La radicalización política del movimiento estudiantil de la UBA, 1943-1966. Buenos Aires: Eudeba, 2014. 376 págs.

    OpenAIRE

    Pis Diez, Nayla

    2014-01-01

    No es una novedad afirmar la importancia del movimiento estudiantil universitario en la Argentina del siglo XX, en sus universidades, en su política y en sus coyunturas fundamentales. Sin embargo, el campo de estudios en cuestión muestra una estructuración reciente; con ineludibles avances en los últimos años pero también importantes vacíos que persisten. En este estado de cosas se inscribe la reciente publicación de Juan Sebastián Califa cuyo tema central es la radicalización política hacia ...

  5. Fast X-ray transient, IGR J17464-2811 detected with INTEGRAL

    DEFF Research Database (Denmark)

    Brandt, Søren; Budtz-Jørgensen, Carl; Chenevez, Jérôme

    2006-01-01

    A fast X-ray transient, possibly a Type-I X-ray burster has been discovered in public INTEGRAL data. The burst occurred at 07:55:33 (UTC) on March 22, 2005, and was detected in the JEM-X X-ray monitor. The position of the source, designated IGR J17464-2811, was determined in the 3-30 keV energy...... interval to be RA = 266.810 deg, DEC = -28.185 (J2000), with a 90% error radius of 1 arcmin. In the 3-8 keV band the burst showed a fast rise and an exponential decay with a time constant of about 70 seconds. In the 8-30 keV band the burst showed a gradual rise over 25 seconds followed by an exponential...... decay with a time constant of about 30 seconds, indicating a spectral softening characteristic of Type-I X-ray bursters. The burst reached a peak flux of 1.0 Crab in the JEM-X 3-30 keV band. The outburst was also clearly detected and localized with ISGRI up to 30 keV. 10 weak sources are found within...

  6. Serum lipid concentrations in patients with cholesterol and pigment gallstones.

    Science.gov (United States)

    Weerakoon, Harshi Thilanka Welegedara; Ranasinghe, Shirani; Navaratne, Ayanthi; Sivakanesan, Ramaiah; Galketiya, Kuda Banda; Rosairo, Shanthini

    2014-08-19

    Gallstones (GS) are formed as a result of impaired metabolic regulation of the human body. Abnormal lipid metabolism is partly responsible for the pathogenesis of GS mainly rich in cholesterol. Thus abnormalities of serum lipids would reflect the possibilities of the formation of cholesterol GS. This study aims to identify the significance of serum lipids on the development of GS disease. Serum lipid profiles were estimated in 73 patients with symptomatic GS, admitted to the Teaching Hospital, Peradeniya, Sri Lanka for GS removal surgeries from May 2011 to December 2012. Patients with normal serum bilirubin level and not being on lipid lowering drugs were recruited for the study. Serum lipid profile of each patient was analyzed by enzymatic kit assays and the chemical composition of GS was analyzed by Fourier Transform Infrared spectroscopy. Of the 73 patients, 37 (51%) had cholesterol GS while 36 (49%) had pigment GS. Serum lipid parameters of a majority of patients were within the normal range. Body mass index values of the patients with two types of GS were not significantly different (Two sample t test, p = 0.335). Out of the lipid parameters tested, only serum triglyceride concentration was significantly high in patients with cholesterol GS than that of pigment GS (Two sample t test, p = 0.038). None of the lipid parameters were significantly different between males and females (Two sample t test, p > 0.05). Compared to the patients with pigment GS who were aged below 50 years, mean total cholesterol and triglyceride concentrations were higher in the same age category patients with cholesterol GS. Abnormal serum lipid profiles doesn't seem to be an essential feature in patients with cholesterol GS. However when the two groups of patients with cholesterol and pigment GS with no significant difference of body mass indexes were compared, patients with cholesterol GS are more likely to have serum lipid parameters towards the undesirable cutoff levels

  7. Differential inactivation of alfalfa nodule glutamine synthetases by tabtoxinine-. beta. -lactam. [Pseudomonas syringae

    Energy Technology Data Exchange (ETDEWEB)

    Knight, T.J.; Unkefer, P.J.

    1987-04-01

    The presence of the pathogen Pseudomonas syringae pv. tabaci within the rhizosphere of nodulated alfalfa plants results in an increase in N/sub 2/-fixation potential and growth, but a 40-50% decrease in nodule glutamine synthetase (GS) activity, as compared to nodulated control plants. Tabtoxinine-..beta..-Lactam an exocellular toxin produced by Pseudomonas syringae pv tabaci irreversibly inhibits glutamine synthetase. Partial purification of nodule GS by DEAE-cellulose chromatography reveals two enzyme forms are present (GS/sub n1/ and GS/sub n2/). In vitro inactivation of the two glutamine synthetases associated with the nodule indicates a differential sensitivity to T-..beta..-L. The nodule specific GS/sub n1/ is much less sensitive to T-..beta..-L than the GS/sub n2/ enzyme, which was found to coelute with the root enzyme (GS/sub r/). However, both GS/sub n1/ and GS/sub n2/ are rapidly inactivated by methionine sulfoximine, another irreversible inhibitor of GS.

  8. A Taiwanese Propolis Derivative Induces Apoptosis through Inducing Endoplasmic Reticular Stress and Activating Transcription Factor-3 in Human Hepatoma Cells

    Directory of Open Access Journals (Sweden)

    Fat-Moon Suk

    2013-01-01

    Full Text Available Activating transcription factor-(ATF- 3, a stress-inducible transcription factor, is rapidly upregulated under various stress conditions and plays an important role in inducing cancer cell apoptosis. NBM-TP-007-GS-002 (GS-002 is a Taiwanese propolin G (PPG derivative. In this study, we examined the antitumor effects of GS-002 in human hepatoma Hep3B and HepG2 cells in vitro. First, we found that GS-002 significantly inhibited cell proliferation and induced cell apoptosis in dose-dependent manners. Several main apoptotic indicators were found in GS-002-treated cells, such as the cleaved forms of caspase-3, caspase-9, and poly(ADP-ribose polymerase (PARP. GS-002 also induced endoplasmic reticular (ER stress as evidenced by increases in ER stress-responsive proteins including glucose-regulated protein 78 (GRP78, growth arrest- and DNA damage-inducible gene 153 (GADD153, phosphorylated eukaryotic initiation factor 2α (eIF2α, phosphorylated protein endoplasmic-reticular-resident kinase (PERK, and ATF-3. The induction of ATF-3 expression was mediated by mitogen-activated protein kinase (MAPK signaling pathways in GS-002-treated cells. Furthermore, we found that GS-002 induced more cell apoptosis in ATF-3-overexpressing cells. These results suggest that the induction of apoptosis by the propolis derivative, GS-002, is partially mediated through ER stress and ATF-3-dependent pathways, and GS-002 has the potential for development as an antitumor drug.

  9. Molecular imaging of cholinergic processes in prostate cancer using {sup 11}C-donepezil and {sup 18}F-FEOBV

    Energy Technology Data Exchange (ETDEWEB)

    Stokholm, Morten Gersel; Bender, Dirk; Jakobsen, Steen; Froekiaer, Joergen; Borghammer, Per [Aarhus University Hospital, Department of Nuclear Medicine and PET Centre, Aarhus C (Denmark); Hoeyer, Soeren [Aarhus University Hospital, Department of Histopathology, Aarhus C (Denmark); Borre, Michael [Aarhus University Hospital, Department of Urology, Aarhus C (Denmark)

    2016-05-15

    High-grade prostate cancer (PC) displays parasympathetic neoneurogenesis. We investigated the binding of two PET tracers that visualize cholinergic nerves in PC tissue using autoradiography. Prostatectomy tissue was subjected to autoradiography with {sup 11}C-donepezil and {sup 18}F-FEOBV and correlated with Gleason scores (GS). Regions of interest on the autoradiograms were defined and quantified. Tracer binding in cancer tissue regions was compared with that in normal tissue. We included 13 patients with biopsy-verified PC. In particular, {sup 11}C-donepezil uptake was higher in ''high-grade'' PC (GS ≥4 + 3) than in ''low-grade'' PC and benign hyperplasia. {sup 11}C-donepezil uptake ranged from a mean of 56 % higher (GS 3 + 3) to 409 % higher (GS 4 + 4), and {sup 18}F-FEOBV uptake ranged from 67 % higher (GS 3 + 3) to 194 % higher (GS 4 + 5). The uptake of both tracers was higher in PC with a high GS than in PC with a low GS, but the difference was significant only for {sup 11}C-donepezil (p = 0.003). Uptake of PET tracers binding to cholinergic nerves was markedly higher in PC with a high GS than in PC with a low GS. This finding implies that {sup 11}C-donepezil PET/CT may be able to differentiate between low-grade and high-grade PC. (orig.)

  10. Prognostic Discrimination Using a 70-Gene Signature among Patients with Estrogen Receptor-Positive Breast Cancer and an Intermediate 21-Gene Recurrence Score

    Directory of Open Access Journals (Sweden)

    Sung Gwe Ahn

    2013-12-01

    Full Text Available The Oncotype DX® recurrence score (RS predictor has been clinically utilized to appropriately select adjuvant chemotherapy for patients with estrogen receptor (ER-positive early breast cancer. However, the selection of chemotherapy for patients with intermediate RSs remains controversial. We assessed the prognostic value of a 70-gene signature (70GS among patients with ER-positive breast cancer and intermediate RSs. In addition, we sought to identify genes associated with poor 70GS scores based on gene expression profiling (GEP. GEP was performed using gene expression data from 186 patients with ER-positive breast cancer. The RS and 70GS score were calculated on the basis of GEP. Among 186 patients, 82 ER-positive patients with intermediate RSs were identified. These patients were stratified by 70GS, overall survival (OS significantly differed according to 70GS (p = 0.013. In a supervised hierarchical analysis according to 70GS, the expression of several representative genes for cell proliferation was significantly higher in the poor 70GS cluster than in the good 70GS cluster. Furthermore, among these patients, FOXM1, AURKA, AURKB, and BIRC5 displayed prognostic significance for OS. In conclusion, 70GS can help to discriminate survival differences among ER-positive patients with intermediate RSs. FOXM1, AURKA, AURKB, and BIRC5, are associated with poor 70GS scores.

  11. Gilbert\\'s Syndrome

    Directory of Open Access Journals (Sweden)

    Erkan Cure

    2014-04-01

    Full Text Available Gilbert\\'s syndrome (GS is a benign condition that does not progress to chronic liver disease or fibrosis. GS diagnosis should be considered in patients with chronic elevation of unconjugated bilirubin. In these patients the presence of hemolysis and other diseases of the liver should be excluded. GS is an autosomal recessive disease. The mutation of UDP-glucuronyl transferase is seen in 10-16% of the population. There is a 70-80% decrease in bilirubin glucuronidation. In cases of unexplained indirect hyperbilirubinemia with no history of drugs, smoking or alcohol use, GS should be considered. Firstly, hemolysis should be excluded. It has been reported that having increased levels of indirect bilirubin lowers the incidence of carotid plaque and coronary artery disease in patients of GS. The antioxidation and resistance to oxidative stress status of patients with GS is known to be high. However, GS is associated with breast and colon cancer. Several studies have reported that liver transplantation from a patient with GS had no harm to himself or to the recipient. An exact relationship between schizophrenia and GS has not been demonstrated. GS patients have a risk of breast and colon cancer so frequent follow up may be recommended.

  12. Glucosylsphingosine Activates Serotonin Receptor 2a and 2b: Implication of a Novel Itch Signaling Pathway.

    Science.gov (United States)

    Afzal, Ramsha; Shim, Won-Sik

    2017-09-01

    Recent reports claimed that glucosylsphingosine (GS) is highly accumulated and specifically evoking itch-scratch responses in the skins of atopic dermatitis (AD) patients. However, it was unclear how GS can trigger itch-scratch responses, since there were no known molecular singling pathways revealed yet. In the present study, it was verified for the first time that GS can activate mouse serotonin receptor 2a (mHtr2a) and 2b (mHtr2b), but not 2c (mHtr2c) that are expressed in HEK293T cells. Specifically, effects of GS on all mouse serotonin receptor 2 subfamily were evaluated by calcium imaging techniques. The GS-induced intracellular calcium increase was dose-dependent, and antagonists such as ketanserin (Htr2a antagonist) and RS-127445 (Htr2b antagonist) significantly blocked the GS-induced responses. Moreover, the proposed GS-induced responses appear to be mediated by phospholipase C (PLC), since pretreatment of a PLC inhibitor U-73122 abolished the GS-induced responses. Additionally, the GS-induced calcium influx is probably mediated by endogenous TRPC ion channels in HEK293T cells, since pretreatment of SKF-96365, an inhibitor for TRPC, significantly suppressed GS-induced response. In conclusion, the present study revealed for the first time that GS can stimulate mHtr2a and mHtr2b to induce calcium influx, by utilizing PLC-dependent pathway afterwards. Considering that GS is regarded as a pruritogen in AD, the present study implicates a novel GS-induced itch signaling pathway.

  13. The Impact of Group Size on Welfare Indicators of Ewes during Pregnancy.

    Directory of Open Access Journals (Sweden)

    Xavier Averós

    Full Text Available Group size (GS and space allowance have major implications for the welfare of production species, however their effects are often confounded. In a previous study we investigated the impact of varying space allowance at constant GS. In the present work we report the consequences of varying GS on pregnant ewes while controlling space allowance. We housed ewes at 6 (GS6 or 12 ewes/enclosure (GS12, while controlling space allowance to 1.5 m2/ewe (3 enclosures/treatment, and necessarily varying enclosure size. Therefore, when indicating GS effects we implicitly reflect a confounding effect with that of enclosure size. Movement, use of space, behaviour, serum cortisol concentration and body condition score (BCS were collected during the last 12 gestation weeks. Movement, use of space, and behaviour were collected every other week, during 2 days/week, using 10 minute continuous scan samplings. Blood was collected during weeks 10, 13, 17, and 21 of gestation, and BCS during weeks 15 and 21. Data were analysed using repeated measures, generalized linear mixed models, with GS, week, and their interaction as fixed effects, and enclosure as random effect. GS mainly affected movement and use of space. GS12 ewes walked longer distances using longer steps (P<0.001. An interaction GS by week was observed for angular dispersion (P<0.0001, which was smaller for GS12 from week 10 onwards. Initial restlessness levels were lower for GS12, as shown by the reduced frequency of location changes (P<0.0001. Furthest and mean neighbour distances increased with GS (P<0.0001. The effect of GS on behaviour was only evident for eating behaviour as an interaction with gestation week (P<0.05. Changes in behaviour, movement and use of space along the study indicated an activity peak during weeks 3 to 5. Cortisol changes during gestation (P<0.01 also reflected this activity peak, while BCS (P<0.001 reflected normal physical condition changes during pregnancy. Although the

  14. Libros que son eso, libros, y no son, ni remotamente, productos literarios

    Directory of Open Access Journals (Sweden)

    Julio Daniel Chaparro H.

    1990-01-01

    Full Text Available La tragedia de Armero. Augusto Cardona Agudelo. Ediciones Pijao, Bogotá, 1988, 127 págs. El último mártir de las bananeras. Miguel Madrid García. Ediciones Pijao, Bogotá, 1988, 55 págs. La muerte no respeta banderas. Antonio Echeverry Gil. Ediciones Pijao, Bogotá, 1988, 126 págs. Los oficios del hambre. Miguel Torres. Editorial Tiempo Presente, Bogotá, 1988, 126 págs. Los duros de la salsa también bailan bolero. Laureano Alba. Secretaría de Educación, Cultura y Recreación de Cali, Cali, 1987, 154 págs. Jepira. José Soto. Arango Editoriales, Bogotá, 1989, 169 págs.

  15. Genome Editing in Mouse Spermatogonial Stem Cell Lines Using TALEN and Double-Nicking CRISPR/Cas9

    Directory of Open Access Journals (Sweden)

    Takuya Sato

    2015-07-01

    Full Text Available Mouse spermatogonial stem cells (SSCs can be cultured for multiplication and maintained for long periods while preserving their spermatogenic ability. Although the cultured SSCs, named germline stem (GS cells, are targets of genome modification, this process remains technically difficult. In the present study, we tested TALEN and double-nicking CRISPR/Cas9 on GS cells, targeting Rosa26 and Stra8 loci as representative genes dispensable and indispensable in spermatogenesis, respectively. Harvested GS cell colonies showed a high targeting efficiency with both TALEN and CRISPR/Cas9. The Rosa26-targeted GS cells differentiated into fertility-competent sperm following transplantation. On the other hand, Stra8-targeted GS cells showed defective spermatogenesis following transplantation, confirming its prime role in the initiation of meiosis. TALEN and CRISPR/Cas9, when applied in GS cells, will be valuable tools in the study of spermatogenesis and for revealing the genetic mechanism of spermatogenic failure.

  16. One-step synthesis of graphene/SnO{sub 2} nanocomposites and its application in electrochemical supercapacitors

    Energy Technology Data Exchange (ETDEWEB)

    Li Fenghua; Song Jiangfeng; Yang Huafeng; Gan Shiyu; Zhang Qixian; Han Dongxue; Niu Li [State Key Laboratory of Electroanalytical Chemistry, Changchun Institute of Applied Chemistry, Chinese Academy of Sciences, Changchun 130022 (China); Ivaska, Ari, E-mail: lniu@ciac.jl.c [Laboratory of Analytical Chemistry, Process Chemistry Centre, Abo Akademi University, FI-20500 Abo-Turku (Finland)

    2009-11-11

    A one-step method was developed to fabricate conductive graphene/SnO{sub 2} (GS) nanocomposites in acidic solution. Graphite oxides were reduced by SnCl{sub 2} to graphene sheets in the presence of HCl and urea. The reducing process was accompanied by generation of SnO{sub 2} nanoparticles. The structure and composition of GS nanocomposites were confirmed by means of transmission electron microscopy, x-ray photoelectron and Raman spectroscopy. Moreover, the ultracapacitor characteristics of GS nanocomposites were studied by cyclic voltammograms (CVs) and electrical impedance spectroscopy (EIS). The CVs of GS nanocomposites are nearly rectangular in shape and the specific capacitance degrades slightly as the voltage scan rate is increased. The EIS of GS nanocomposites presents a phase angle close to {pi}/2 at low frequency, indicating a good capacitive behavior. In addition, the GS nanocomposites could be promisingly applied in many fields such as nanoelectronics, ultracapacitors, sensors, nanocomposites, batteries and gas storage.

  17. Pharmacokinetic, tissue distribution and excretion of ginsenoside-Rd in rodents.

    Science.gov (United States)

    Sun, Dong; Wang, Bing; Shi, Ming; Zhang, Yun-Xia; Zhou, Lin-Fu; Liu, Zhi-Rong; Wu, Zhong-Liang; Jiang, Wen; Han, Jun-Liang; Xiong, Li-Ze; Zhao, Gang

    2012-02-15

    Ginsenoside-Rd (GS-Rd) is one of the major active components of Panax ginseng, and was shown to have the protective effects against several insults. However, we still lack some basic knowledge of GS-Rd, including its pharmacokinetic, tissue distribution and excretion in vivo in experimental animal, such as mice and rats. In this study, HPLC and radioactive tracer assays were performed to determine pharmacokinetic, tissue distribution and excretion of GS-Rd in rodents. After intravascular administration with 20, 50 or 150 mg/kg GS-Rd, the dynamic changes of GS-Rd concentrations in plasma were consistent with a two-compartment model while the concentration of ³H-labeled GS-Rd was rapidly reached the peak in plasma, and distributed to various tissues, among which the highest concentration was observed in the lung. Copyright © 2011 Elsevier GmbH. All rights reserved.

  18. Optimal cut-off value of perfusion parameters for diagnosing prostate cancer and for assessing aggressiveness associated with Gleason score.

    Science.gov (United States)

    Cho, Eunkyung; Chung, Dong Jin; Yeo, Dong Myung; Sohn, Dongwan; Son, Yohan; Kim, Taejung; Hahn, Sung-Tae

    2015-01-01

    To determine cut-off value of dynamic contrast-enhanced (DCE) magnetic resonance imaging (MRI) parameters for differentiation of prostate malignant from benign and cancer with high-grade Gleason score (GS) (GS>7) from low-grade GS (GS≤7), 35 patients (24 malignant and 11 benign) who underwent DCE-MRI were included. Difference between malignant and benign was statistically significant for all magnetic resonance parameters except Ve. The cut-off values were K(trans)=0.184min(-1), Kep=0.695min(-1), iAUC=4.219mmol/l/min, and ADC=1340.5mm(2)/s. A significant difference in mean values of K(trans) and Kep between cancer with high-grade GS and low-grade GS was also observed. K(trans) and Kep showed a significant correlation with GS. Copyright © 2015 Elsevier Inc. All rights reserved.

  19. Genome Size Is a Strong Predictor of Root Meristem Growth Rate

    Directory of Open Access Journals (Sweden)

    Adam Gruner

    2010-01-01

    Full Text Available Variation in genome size (GS has been linked to several facets of the plant phenotype. Recently it was shown that GS is significantly correlated with cell size and the duration of the cell cycle. Here we test the hypothesis that GS might also be a predictor of apical root meristem growth rate (RMGR. We studied eight species of eudicots with varying GS using time-lapse microscopic image analysis. A significant negative exponential relationship was observed between GS and RMGR. Our results show significantly decreased RMGR for large genome species. This relationship represents a significant consequence of GS expansion in plants and may partly explain why genome sizes tend to be small in eudicots. Interestingly, parasitic plants, which do not rely on root growth as much, often have large genomes.

  20. One-step synthesis of graphene/SnO2 nanocomposites and its application in electrochemical supercapacitors.

    Science.gov (United States)

    Li, Fenghua; Song, Jiangfeng; Yang, Huafeng; Gan, Shiyu; Zhang, Qixian; Han, Dongxue; Ivaska, Ari; Niu, Li

    2009-11-11

    A one-step method was developed to fabricate conductive graphene/SnO2 (GS) nanocomposites in acidic solution. Graphite oxides were reduced by SnCl2 to graphene sheets in the presence of HCl and urea. The reducing process was accompanied by generation of SnO2 nanoparticles. The structure and composition of GS nanocomposites were confirmed by means of transmission electron microscopy, x-ray photoelectron and Raman spectroscopy. Moreover, the ultracapacitor characteristics of GS nanocomposites were studied by cyclic voltammograms (CVs) and electrical impedance spectroscopy (EIS). The CVs of GS nanocomposites are nearly rectangular in shape and the specific capacitance degrades slightly as the voltage scan rate is increased. The EIS of GS nanocomposites presents a phase angle close to pi/2 at low frequency, indicating a good capacitive behavior. In addition, the GS nanocomposites could be promisingly applied in many fields such as nanoelectronics, ultracapacitors, sensors, nanocomposites, batteries and gas storage.

  1. Genome Size Diversity in Lilium (Liliaceae Is Correlated with Karyotype and Environmental Traits

    Directory of Open Access Journals (Sweden)

    Yun-peng Du

    2017-07-01

    Full Text Available Genome size (GS diversity is of fundamental biological importance. The occurrence of giant genomes in angiosperms is restricted to just a few lineages in the analyzed genome size of plant species so far. It is still an open question whether GS diversity is shaped by neutral or natural selection. The genus Lilium, with giant genomes, is phylogenetically and horticulturally important and is distributed throughout the northern hemisphere. GS diversity in Lilium and the underlying evolutionary mechanisms are poorly understood. We performed a comprehensive study involving phylogenetically independent analysis on 71 species to explore the diversity and evolution of GS and its correlation with karyological and environmental traits within Lilium (including Nomocharis. The strong phylogenetic signal detected for GS in the genus provides evidence consistent with that the repetitive DNA may be the primary contributors to the GS diversity, while the significant positive relationships detected between GS and the haploid chromosome length (HCL provide insights into patterns of genome evolution. The relationships between GS and karyotypes indicate that ancestral karyotypes of Lilium are likely to have exhibited small genomes, low diversity in centromeric index (CVCI values and relatively high relative variation in chromosome length (CVCL values. Significant relationships identified between GS and annual temperature and between GS and annual precipitation suggest that adaptation to habitat strongly influences GS diversity. We conclude that GS in Lilium is shaped by both neutral (genetic drift and adaptive evolution. These findings will have important consequences for understanding the evolution of giant plant genomes, and exploring the role of repetitive DNA fraction and chromosome changes in a plant group with large genomes and conservation of chromosome number.

  2. 32 CFR 701.53 - FOIA fee schedule.

    Science.gov (United States)

    2010-07-01

    ... monitoring by a human, that human time may be also assessed as computer search. The terms “programmer... below $12.00 Professional O1-O6/GS9-GS15 25.00 Executive O7/GS16/ES1 and above 45.00 (b) Computer search. Fee assessments for computer search consist of two parts; individual time (hereafter referred to as...

  3. Structures of new secofriedelane and friedelane acids from Calophyllum inophyllum of French Polynesia.

    Science.gov (United States)

    Laure, F; Herbette, G; Faure, R; Bianchini, J P; Raharivelomanana, P; Fogliani, B

    2005-01-01

    Three new friedelane-type triterpenoids, 3,4-secofriedelan-3,28-dioic acid (1), 27-hydroxyacetate canophyllic acid (2) and 3-oxo-27-hydroxyacetate friedelan-28-oic acid (3), were isolated from the leaves of Calophyllum inophyllum (Clusiaceae) grown in French Polynesia. Their structures were established by the concerted application of 2D NMR techniques including gs-COSY, gs-HMQC and gs-HMBC. Copyright 2004 John Wiley & Sons, Ltd.

  4. Increasing stomatal conductance in response to rising atmospheric CO2.

    Science.gov (United States)

    Purcell, C; Batke, S P; Yiotis, C; Caballero, R; Soh, W K; Murray, M; McElwain, J C

    2018-01-31

    Studies have indicated that plant stomatal conductance (gs) decreases in response to elevated atmospheric CO2, a phenomenon of significance for the global hydrological cycle. However, gs increases across certain CO2 ranges have been predicted by optimization models. The aim of this work was to demonstrate that under certain environmental conditions, gs can increase in response to elevated CO2. Using (1) an extensive, up-to-date synthesis of gs responses in free air CO2 enrichment (FACE)experiments, (2) in situ measurements across four biomes showing dynamic gs responses to a CO2 rise of ~50 ppm (characterizing the change in this greenhouse gas over the past three decades) and (3) a photosynthesis-stomatal conductance model, it is demonstrated that gs can in some cases increase in response to increasing atmospheric CO2. Field observations are corroborated by an extensive synthesis of gs responses in FACE experiments showing that 11.8 % of gs responses under experimentally elevated CO2 are positive. They are further supported by a strong data-model fit (r2 = 0.607) using a stomatal optimization model applied to the field gs dataset. A parameter space identified in the Farquhar-Ball-Berry photosynthesis-stomatal conductance model confirms field observations of increasing gs under elevated CO2 in hot dry conditions. Contrary to the general assumption, positive gs responses to elevated CO2, although relatively rare, are a feature of woody taxa adapted to warm, low-humidity conditions, and this response is also demonstrated in global simulations using the Community Land Model (CLM4). The results contradict the over-simplistic notion that global vegetation always responds with decreasing gs to elevated CO2, a finding that has important implications for predicting future vegetation feedbacks on the hydrological cycle at the regional level.

  5. Correlates of gambling on high-school grounds.

    Science.gov (United States)

    Foster, Dawn W; Hoff, Rani A; Pilver, Corey E; Yau, Yvonne H C; Steinberg, Marvin A; Wampler, Jeremy; Krishnan-Sarin, Suchitra; Potenza, Marc N

    2015-12-01

    This study examined adolescent gambling on school grounds (GS+) and how such behavior was associated with gambling-related attitudes. Further, we examined whether GS+ moderated associations between at-risk problem-gambling (ARPG) and gambling behaviors related to gambling partners. Participants were 1988 high-school students who completed survey materials. Demographic, perceptions, attitudes, and gambling variables were stratified by problem-gambling severity (ARPG versus recreational gambling) and GS+ status. Chi-square and adjusted logistic regression models were used to examine relationships among study variables. Nearly 40% (39.58%) of students reported past-year GS+, with 12.91% of GS+ students, relative to 2.63% of those who did not report gambling on school grounds (GS-), meeting DSM-IV criteria for pathological gambling (pgambling behaviors. Weaker links in GS+ students, in comparison with GS-, students, were observed between problem-gambling severity and gambling with family members (interaction odds ratio (IOR)=0.60; 95% CI=0.39-0.92) and gambling with friends (IOR=0.21; 95% CI=0.11-0.39). GS+ is common and associated with pathological gambling and more permissive attitudes towards gambling. The finding that GS+ (relative to GS-) youth show differences in how problem-gambling is related to gambling partners (friends and family) warrants further investigation regarding whether and how peer and familial interactions might be improved to diminish youth problem-gambling severity. The high frequency of GS+ and its relationship with ARPG highlights a need for school administrators and personnel to consider interventions that target school-based gambling. Copyright © 2015. Published by Elsevier Ltd.

  6. Para dejar que la luz siga bebiéndome

    Directory of Open Access Journals (Sweden)

    Jorge H. Cadavid

    1992-09-01

    Full Text Available La casa. Víctor López Rache. Editorial Retina, Bogotá, 1992, 64 págs. Noche y sol. Augusto Rincón Castro. Editorial Retina, Bogotá, 1992, 60 págs. Libro de alquimia y soledad. Gabriel Arturo Castro Morales. Editorial Retina, Bogotá, 1992, 64 págs. Travesia del ojo. Carlos Jiménez. Universidad del Valle, Cali, 1992, 95 pags.

  7. ¿Cómo se concibe la aventura?

    Directory of Open Access Journals (Sweden)

    Alicia Fajardo M.

    1989-01-01

    Full Text Available La tortuga desdentada. Alfonso Lobo Amaya. Edilux, Medellín, 1988, 16 págs. (Ilustraciones de Pilar Pabón Z .. El maravilloso viaje de Rosendo Bucurú. Celso Román. Carlos Valencia Editores, Bogotá, 96 págs. (Ilustraciones de Diana Castellanos. Una a ventura en el papel. Roberto Rubiano Vargas. Carlos Valencia. Editores, Bogotá, 1988, 104 págs. (Ilustraciones de Diana Castellanos

  8. Optical loss and residual stress measurement of infrared chalcogenide glasses and analysis on its influencing factors

    Science.gov (United States)

    Song, Baoan; Yang, Yan; Jia, Zhitai; Chen, Feifei; Lin, Changgui; Dai, Shixun; Wang, Xunsi; Shen, Xiang; Xu, Tiefeng; Nie, Qiuhua

    2013-06-01

    Chalcogenide glasses (ChGs) have a relatively small temperature coefficient of refractive index, broad transmission range from almost visible to mid-infrared. It is suitable for precision molding. With the help of above mentioned merits, ChGs have a vast reservoir of value in the field of military and civilian infrared imaging. However, the internal defects of ChGs are caused by melting, cool-demoulding and annealing in a high vacuumed ampoule. The defects include the optical inhomogeneity, chemical inhomogeneity and built-in stress which trouble the homogeneity of ChGs and directly affect the imaging quality of infrared imaging devices. The detection and control of internal defects is a key technique. In this paper the platform for testing, characterization and evaluation of the inhomogeneity of ChGs will be designed and built. The appropriate testing and evaluation criteria of inhomogeneity during the preparation procedure of ChGs in the vacuumed ampoule will be studied. The transmittance of ChGs sample is measured repeatedly. The factor of internal multple reflection in ChGs sample is analysed and discussed. Analysis shows that the mean transmissivity of ChGs sample (Ge28Sb12Se60) with thick of 1 cm is approximately 66% in 8 to 11 microns. The loss is less than 2.40%/cm. The optical path difference (OPD) caused by residual stress in ChGs sample is less than 5.2 nm/cm. The results will provide a technical support to optimize the ChGs preparation process and improve the ChGs homogeneity.

  9. Genetic characteristic of high molecular weight glutenin subunits in somatic hybrid wheat lines -- potential application to wheat breeding.

    Science.gov (United States)

    Heng, Liu; Lei, Shi; Junsheng, Zhao; Guangmin, Xia

    2006-07-12

    Analysis of 17 derivatives from a somatic fusion between common wheat (Triticum aestivum) and tall wheat grass (Thinopyrum ponticum) showed a diversity of high molecular weight glutenin subunit (HMW-GS) compositions. On the basis of the inheritance of HMW-GS patterns, the derivatives were either (i) bred true over four successive generations, (ii) generated a few novel HMW-GS combinations at each generation, or (iii) showed highly unstable HMW-GS compositions. HMW-GS analysis of F(5) seed and each single seed-generated F(6) progenies further revealed that most of the HMW-GS had genetic stability. The variations of HMW-GS were inferred to occur in early generations and were maintained thereafter. Low molecular weight glutenin subunits (LMW-GS) in hybrid lines with high or low bread-making quality, classified into the first pattern, were compared. The result showed that hybrid lines with the uniform HMW-GS patterns also have identical LMW-GS patterns. The Glu-1 quality score was inferred to be relatively significant to the sodium dodecyl dulfate sedimentation value, as well as to correlate with the gluten exponent and contents of dry gluten and proteins. Sexual hybridization between high-quality somatic hybrid progeny II-12 and Chinese Spring (CS) showed that these high-quality HMW-GS genes could entail progenies. There was not subunit variation in the progenies of II-12 x CS. Therefore, sexual hybridization between somatic hybrid line and cultivars can transfer novel high-quality HMW-GS of somatic hybrids and benefit wheat breeding.

  10. 77 FR 76106 - Order Granting Limited Exemptions From Exchange Act Rule 10b-17 and Rules 101 and 102 of...

    Science.gov (United States)

    2012-12-26

    ... Regulation M to ALPS ETF Trust, ALPS/GS Momentum Builder Growth Markets Equities and U.S. Treasuries Index ETF, ALPS/GS Momentum Builder Multi-Asset Index ETF, and ALPS/GS Momentum Builder Asia ex-Japan Equities and U.S. Treasuries Index ETF Pursuant to Exchange Act Rule 10b-17(b)(2) and Rules 101(d) and 102...

  11. Phenylethanoid Glycosides: Research Advances in Their Phytochemistry, Pharmacological Activity and Pharmacokinetics

    OpenAIRE

    Zhenzhen Xue; Bin Yang

    2016-01-01

    Phenylethanoid glycosides (PhGs) are widely distributed in traditional Chinese medicines as well as in other medicinal plants, and they were characterized by a phenethyl alcohol (C6-C2) moiety attached to a β-glucopyranose/β-allopyranose via a glycosidic bond. The outstanding activity of PhGs in diverse diseases proves their importance in medicinal chemistry research. This review summarizes new findings on PhGs over the past 10 years, concerning the new structures, their bioactivities, includ...

  12. Ginsenoside Rd promotes non-amyloidogenic pathway of amyloid precursor protein processing by regulating phosphorylation of estrogen receptor alpha.

    Science.gov (United States)

    Yan, Xiaodong; Hu, Gengyao; Yan, Weiming; Chen, Tao; Yang, Feng; Zhang, Xiao; Zhao, Gang; Liu, Juanfang

    2017-01-01

    Previous study demonstrated that Ginsenoside Rd. (GS-Rd) could improve cognitive and memory function in animal model of Alzheimer's disease. This study was aimed to investigate whether GS-Rd could improve non-amyloidogenic pathway by activating estrogen receptor (ER). 10mg/kg GS-Rd in ovariectomy (OVX)+GS-Rd group and equivalent volume of saline in sham operated group and OVX group were administrated intraperitoneally for two months, respectively. The Morris Water Maze was used to examine cognitive function of rats, with sAPPα and Aβ levels in the hippocampi measured. The culture medium of HT22 hippocampal neuronal cells were incubated with GS-Rd, ER antagonist ICI182.780, MAPK inhibitor PD98059, or PI3Kinhibitor LY294002, respectively. sAPPα levels was measured, and expression of α-secretase, sAPPα, β-secretase, Aβ, phosphorylation form of AKT (p-AKT), total AKT, p-ERK, total ERK, p-ERα, total ERα, p-ERβ and total ERβ were examined by Western blot to explore the estrogenic-like activity of GS-Rd. GS-Rd attenuate cognitive and memory impairment, increased levels of sAPPα and reduced extracellular Aβ of OVX rats. In HT22, GS-Rd could upregulate sAPPα level, which can be inhibited by inhibitor of MAPK and PI3K pathway. In addition, inhibitor of estrogen receptor prevented GS-Rd triggered release of sAPPα and activation of MAPK and PI3K pathways. GS-Rd could increase expression of α-secretase and sAPPα, while decrease expression of β-secretase and Aβ. Besides, GS-Rd promoted phosphorylation of estrogen receptor alpha at Ser118 residue. Our findings show that GS-Rd enhances learning and memory function of OVX rats by activating estrogen-like activity. Copyright © 2016 Elsevier Inc. All rights reserved.

  13. [Transrectal biopsy scheme can predict incorrect histological grading in prostate cancer].

    Science.gov (United States)

    Nieto-Morales, M L; Fernández-Ramos, J; Pérez-Méndez, L; Alventosa-Fernández, E; Pastor-Santoveña, M S; Aguirre-Jaime, A

    2014-01-01

    To identify factors that might explain why a prostate with a Gleason score (GS) <7 in the biopsy specimen can turn out to have a GS ≥7 in the surgical specimen. We compared the GS of biopsy specimens with the GS of surgical specimens in 185 patients who underwent surgery for prostate cancer. We calculated the sensitivity, specificity, and predictive values for the GS of the biopsy specimens. We used Cohen's kappa to determine the degree of concordance between a GS of <7 and ≥7 for the biopsy specimen and the surgical specimen. Age, a family history of prostate cancer, total prostate-specific antigen (tPSA), digital rectal examination, prostate structure and volume, and the number of biopsy cores (biopsy scheme) were analyzed using multivariable logistic regression. Histological study of biopsy specimens yielded high sensitivity (98%) but low specificity (49%) for GS ≤6 and low sensitivity (35, 26%) and high specificity (93, 99%) for GS=7 and GS ≥7, respectively. Cohen's kappa for the GS from the biopsy and surgical specimens was 0.43 (95% CI=30-56%). The biopsy scheme was the only predictor of discordance in the GS between the two techniques. Among the other variables included in the model, only tPSA showed a slightly significant association. Taking a scheme with less than 7 cores as a reference, we found no difference with 8 to 9 cores but we did find a difference with 10 to 11 cores and with 12 or more cores, with a prevalence ratio of 0.138 (95% CI=0.030-0.513) and 0.277 (95% CI=0.091-0.806), respectively. The GS of the biopsy depends on the scheme. This factor must be taken into account when choosing a treatment option in patients with low tumor grade in biopsy specimens. Copyright © 2011 SERAM. Published by Elsevier Espana. All rights reserved.

  14. CERN Shuttles - Enlarged Regular Shuttle Services as from 8/02/2010

    CERN Multimedia

    2010-01-01

    As of Monday 8 February 2010, please note the enhancement of the regular shuttle services: - with now two shuttles dedicated to the transportation within and between both CERN sites, Meyrin and Prevessin with bus stop at more buildings - To and from the Geneva airport every hour (from building 500) to complement the TPG bus Y For timetable details, please click here: http://gs-dep.web.cern.ch/gs-dep/groups/sem/ls/RegularShuttleTimetable_Feb2010.htm GS-SEM

  15. Effects of Gilbert's Syndrome on Lipid Profile, Levels of Serum Uric Acid, Glucose and Insulin Resistance

    Directory of Open Access Journals (Sweden)

    Medine Cumhur Cure

    2014-06-01

    Results: Even insignificantly, GS patients had lower levels of total cholesterol whereas high-density lipoprotein was found to be higher. Conclusion: Our results shown that in GS patients, increased bilirubin levels are associated with decrease in UA, insulin, LDL, TG, and increased HDL. In GS patients, low level of UA, insulin and lipid profile may be contributed to cardioprotective effect. [Cukurova Med J 2014; 39(3.000: 443-450

  16. Identification, replication and characterization of epigenetic remodelling in the aging genome: a cross population analysis

    OpenAIRE

    Li, Shuxia; Christiansen, Lene; Christensen, Kaare; Kruse, Torben A.; Redmond, Paul; Marioni, Riccardo E.; Deary, Ian J.; Tan, Qihua

    2017-01-01

    Aging is a complex biological process regulated by multiple cellular pathways and molecular mechanisms including epigenetics. Using genome-wide DNA methylation data measured in a large collection of Scottish old individuals, we performed discovery association analysis to identify age-methylated CpGs and replicated them in two independent Danish cohorts. The double-replicated CpGs were characterized by distribution over gene regions and location in relation to CpG islands. The replicated CpGs ...

  17. Al rescate de tecnologías tradicionales

    Directory of Open Access Journals (Sweden)

    Emilia Cortés Moreno

    1989-01-01

    Full Text Available Tintes naturales para fique. Cristina Echavarría U. Corporación Murundua, Medellín, 1987, 72 págs. De la mano con la naturaleza. Beatriz Devia. Centrap-Ises. Bogotá, 1986, 27 págs. Vida y muerte del algodón y los tejidos santandereanos. Pierre Raymond. Beatriz Bayona. Ecoe, Bogotá, 1987, 95 págs.

  18. Correlates of gambling on high-school grounds

    Science.gov (United States)

    Foster, Dawn W.; Hoff, Rani A.; Pilver, Corey E.; Yau, Yvonne H. C.; Steinberg, Marvin A.; Wampler, Jeremy; Krishnan-Sarin, Suchitra; Potenza, Marc N.

    2015-01-01

    Objective This study examined adolescent gambling on school grounds (GS+) and how such behavior was associated with gambling-related attitudes. Further, we examined whether GS+ moderated associations between at-risk problem-gambling (ARPG) and gambling behaviors related to gambling partners. Method Participants were 1988 high-school students who completed survey materials. Demographic, perceptions, attitudes, and gambling variables were stratified by problem-gambling severity (ARPG versus recreational gambling) and GS+ status. Chi-square and adjusted logistic regression models were used to examine relationships among study variables. Results Nearly 40% (39.58%) of students reported past-year GS+, with 12.91% of GS+ students, relative to 2.63% of those who did not report gambling on school grounds (GS), meeting DSM-IV criteria for pathological gambling (pgambling behaviors. Weaker links in GS+ students, in comparison with GS-, students, were observed between problem-gambling severity and gambling with family members (interaction odds ratio (IOR)=0.60; 95%CI=0.39–0.92) and gambling with friends (IOR=0.21; 95%CI=0.11–0.39). Conclusions GS+ is common and associated with pathological gambling and more permissive attitudes towards gambling. The finding that GS+ (relative to GS-) youth show differences in how problem-gambling is related to gambling partners (friends and family) warrants further investigation regarding whether and how peer and familial interactions might be improved to diminish youth problem-gambling severity. The high frequency of GS+ and its relationship with ARPG highlight a need for school administrators and personnel to consider interventions that target school-based gambling. PMID:26232102

  19. Brachium Pontis Gliosarcoma With Well-Differentiated Cartilaginous Tissue

    OpenAIRE

    Wang, Lei; Xie,Yuanyang; Liu, Yan; Tan, Jun; Chen, Zhongliang; Xiao, Yu; Xia, Ying; Peng, Zefeng

    2015-01-01

    Abstract Gliosarcoma (GS) belongs to World Health Organization grade IV neoplasm and displaying glial and mesenchymal differentiation. Only rare cases of GS have been reported in the brachium pontis and 4th ventricle region. Here, we report a rare case of GS located on brachium pontis region and extending into the 4th ventricle with well-differentiated cartilaginous metaplasia. A 28-year-old male patient experienced intermittent headache, vomiting, and gait disorders for 3 months. Magnetic re...

  20. Synthesis and phototoxicity of isomeric 7,9-diglutathione pyrrole adducts: Formation of reactive oxygen species and induction of lipid peroxidation.

    Science.gov (United States)

    Ma, Liang; Zhao, Hengqiang; Xia, Qingsu; Cai, Lining; Fu, Peter P

    2015-09-01

    Pyrrolizidine alkaloids (PAs) are hepatotoxic, genotoxic, and carcinogenic in experimental animals. Because of their widespread distribution in the world, PA-containing plants are probably the most common poisonous plants affecting livestock, wildlife, and humans. Upon metabolism, PAs generate reactive dehydro-PAs and other pyrrolic metabolites that lead to toxicity. Dehydro-PAs are known to react with glutathione (GSH) to form 7-GSH-(+/-)-6,7-dihydro-7-hydroxy-1-hydroxymethyl-5H-pyrrolizine (7-GS-DHP) in vivo and in vitro and 7,9-diGS-DHP in vitro. To date, the phototoxicity of GS-DHP adducts has not been well studied. In this study, we synthesized 7-GS-DHP, a tentatively assigned 9-GS-DHP, and two enantiomeric 7,9-diGS-DHP adducts by reaction of dehydromonocrotaline with GSH. The two 7,9-diGS-DHPs were separated by high performance liquid chromatography (HPLC) and their structures were characterized by 1H nuclear magnetic resonance (NMR) and 1H-1H correlation spectroscopy (COSY) NMR spectral analysis. Photoirradiation of 7-GS-DHP, 9-GS-DHP, and the two 7,9-diGS-DHPs as well as dehydromonocrotaline, dehydroheliotrine, and the 7-R enantiomer of DHP (DHR), by UVA light at 0 J/cm2, 14 J/cm2, and 35 J/cm2 in the presence of a lipid, methyl linoleate, all resulted in lipid peroxidation in a light dose-responsive manner. The levels of lipid peroxidation induced by the two isomeric 7,9-diGS-DHPs were significantly higher than that by 7-GS-DHP and 9-GS-DHP. When 7,9-diGS-DHP was irradiated in the presence of sodium azide (NaN3), the level of lipid peroxidation decreased; lipid peroxidation was enhanced when methanol was replaced by deuterated methanol. These results suggest that singlet oxygen is a product induced by the irradiation of 7,9-diGS-DHP. When irradiated in the presence of superoxide dismutase (SOD), the level of lipid peroxidation decreased, indicating that lipid peroxidation is also mediated by superoxide. These results indicate that lipid peroxidation