WorldWideScience

Sample records for bullet cluster 1e

  1. Sunyaev-Zel'dovich Effect Observations of the Bullet Cluster (1E 0657-56) with APEX-SZ

    CERN Document Server

    Halverson, N W; Ade, P A R; Basu, K; Bender, A N; Benson, B A; Bertoldi, F; Cho, H -M; Chon, G; Clarke, J; Dobbs, M; Ferrusca, D; Guesten, R; Holzapfel, W L; Kovács, A; Kennedy, J; Kermish, Z; Kneissl, R; Lee, A T; Lueker, M; Mehl, J; Menten, K M; Muders, D; Nord, M; Pacaud, F; Plagge, T; Reichardt, C; Richards, P L; Schaaf, R; Schilke, P; Schuller, F; Schwan, D; Spieler, H; Tucker, C; Weiss, A; Zahn, O

    2008-01-01

    We present observations of the Sunyaev-Zel'dovich effect (SZE) in the Bullet cluster (1E 0657-56) using the APEX-SZ instrument at 150 GHz with a resolution of 1 arcmin. The main results are maps of the SZE in this massive, merging galaxy cluster. The cluster is detected with 23 sigma significance within the central 1 arcmin radius of the source position. The SZE map has a broadly similar morphology to that in existing X-ray maps of this system, and we find no evidence for significant contamination of the SZE emission by radio or IR sources. In order to make simple quantitative comparisons with cluster gas models derived from X-ray observations, we fit our data to an isothermal elliptical beta model, despite the inadequacy of such a model for this complex merging system. With an X-ray derived prior on the power-law index, beta = 1.04 +0.16/-0.10, we find a core radius r_c =144 +/- 19 arcsec, an axial ratio of 0.881 +/- 0.086, and a central temperature decrement of -880 +/- 80 micro-K_CMB, including a +/- 6% fl...

  2. Sunyaev-Zel'Dovich effect observations of the bullet cluster (1E 0657-56) with APEX-SZ

    Energy Technology Data Exchange (ETDEWEB)

    Halverson, N.W.; Lanting, T.; Ade, P.A.R.; Basu, K.; Bender, A.N.; Benson, B.A.; Bertoldi, F.; Cho, H.-M.; Chon, G.; Clarke, J.; Dobbs, M.; Ferrusca, D.; Gusten, R.; Holzapfel, W.L.; Kovacs, A.; Kennedy, J.; Kermish, Z.; Kneissl, R.; Lee, A.T.; Lueker, M.; Mehl, J.; Menten, K.M.; Muders, D.; Nord, M.; Pacaud, F.; Plagge, T.; Reichardt, C.; Richards, P.L.; Schaaf, R.; Schilke, P.; Schuller, F.; Schwan, D.; Spieler, H.; Tucker, C.; Weiss, A.; Zahn, O.

    2008-07-25

    We present observations of the Sunyaev-Zel'dovich effect (SZE) in the Bullet cluster (1E 0657-56) using the APEX-SZ instrument at 150 GHz with a resolution of 1'. The main results are maps of the SZE in this massive, merging galaxy cluster. The cluster is detected with 23 sigma significance within the central 1' radius of the source position. The SZE map has a broadly similar morphology to that in existing X-ray maps of this system, and we find no evidence for significant contamination of the SZE emission by radio or IR sources. In order to make simple quantitative comparisons with cluster gas models derived from X-ray observations, we fit our data to an isothermal elliptical beta model, despite the inadequacy of such a model for this complex merging system. With an X-ray derived prior on the power-law index, beta = 1.04+0.16-0.10, we find a core radius rc = 142" +- 18", an axial ratio of 0.889 +- 0.072, and a central temperature decrement of -771 +- 71 muKCMB, including a +-5.5percent flux calibration uncertainty. Combining the APEX-SZ map with a map of projected electron surface density from Chandra X-ray observations, we determine the mass-weighted temperature of the cluster gas to be Tmg = 10.8 +- 0.9 keV, significantly lower than some previously reported X-ray spectroscopic temperatures. Under the assumption of an isothermal cluster gas distribution in hydrostatic equilibrium, we compute the gas mass fraction for prolate and oblate spheroidal geometries and find it to be consistent with previous results from X-ray and weak-lensing observations. This work is the first result from the APEX-SZ experiment and represents the first reported scientific result from observations with a large array of multiplexed superconducting transition-edge sensor bolometers.

  3. Modified Rindler Potential in Randers-Finslerian Spacetime and the Convergence $\\kappa$-Map of Bullet Cluster 1E0657-558

    CERN Document Server

    Chang, Zhe; Li, Xin; Wang, Sai

    2011-01-01

    The data of the Bullet Cluster 1E0657-558 released on November 15, 2006 reveal that the strong and weak gravitational lensing convergence $\\kappa$-map, which is a "photograph" of the curvature of the space, shows an $8\\sigma$ offset from the $\\Sigma$-map. The $\\Sigma$-map is a direct measurement of the surface mass density of the ICM gas, which accounts for 83% of the averaged mass-fraction of the system. This suggests a modified gravity theory at large distances different from Newton's inverse-square gravitational law. In this paper, we construct a modified gravity model in Randers-Finslerian spacetime with a modified Rindler potential, a linear potential with an exponential cutoff, without invoking any non-baryonic dark matter. We use the model to calculate the convergence $\\kappa$ of the Bullet Cluster. The surface mass density $\\Sigma$-map of the ICM gas of the main cluster is described by the King $\\beta$-model. It is shown that the predicted convergence $\\kappa$ in a Finslerian spacetime background shar...

  4. Constrained Simulation of the Bullet Cluster

    CERN Document Server

    Lage, Craig

    2013-01-01

    In this work, we report on a detailed simulation of the Bullet Cluster (1E0657-56) merger, including magnetohydrodynamics, plasma cooling, and adaptive mesh refinement. We constrain the simulation with data from gravitational lensing reconstructions and 0.5 - 2 keV Chandra X-ray flux map, then compare the resulting model to higher energy X-ray fluxes, the extracted plasma temperature map, Sunyaev-Zel'dovich effect measurements, and cluster halo radio emission. We constrain the initial conditions by minimizing the chi-squared figure of merit between the full 2D observational data sets and the simulation, rather than comparing only a few features such as the location of subcluster centroids, as in previous studies. A simple initial configuration of two triaxial clusters with NFW dark matter profiles and physically reasonable plasma profiles gives a good fit to the current observational morphology and X-ray emissions of the merging clusters. There is no need for unconventional physics or extreme infall velocitie...

  5. Constrained simulation of the Bullet Cluster

    Energy Technology Data Exchange (ETDEWEB)

    Lage, Craig; Farrar, Glennys, E-mail: csl336@nyu.edu [Center for Cosmology and Particle Physics, Department of Physics, New York University, New York, NY 10003 (United States)

    2014-06-01

    In this work, we report on a detailed simulation of the Bullet Cluster (1E0657-56) merger, including magnetohydrodynamics, plasma cooling, and adaptive mesh refinement. We constrain the simulation with data from gravitational lensing reconstructions and the 0.5-2 keV Chandra X-ray flux map, then compare the resulting model to higher energy X-ray fluxes, the extracted plasma temperature map, Sunyaev-Zel'dovich effect measurements, and cluster halo radio emission. We constrain the initial conditions by minimizing the chi-squared figure of merit between the full two-dimensional (2D) observational data sets and the simulation, rather than comparing only a few features such as the location of subcluster centroids, as in previous studies. A simple initial configuration of two triaxial clusters with Navarro-Frenk-White dark matter profiles and physically reasonable plasma profiles gives a good fit to the current observational morphology and X-ray emissions of the merging clusters. There is no need for unconventional physics or extreme infall velocities. The study gives insight into the astrophysical processes at play during a galaxy cluster merger, and constrains the strength and coherence length of the magnetic fields. The techniques developed here to create realistic, stable, triaxial clusters, and to utilize the totality of the 2D image data, will be applicable to future simulation studies of other merging clusters. This approach of constrained simulation, when applied to well-measured systems, should be a powerful complement to present tools for understanding X-ray clusters and their magnetic fields, and the processes governing their formation.

  6. 18 GHz SZ Measurements of the Bullet Cluster

    Indian Academy of Sciences (India)

    Siddharth S. Malu; Ravi Subrahmanyan

    2011-12-01

    We present 18 GHz observations of the Bullet cluster using the Austalia Telescope Compact Array (ATCA), which show structure in the Sunyaev–Zeldovich effect; in particular, a deep, compact feature which does not correspond to any bright feature in X-ray, optical or lensing maps. In general, the relatively deeper SZE features appear to avoid the regions with the most intense X-ray emission. SZE displaced from X-ray centres implies that modeling cluster dynamics is non-trivial. The SZE distribution in the western parts of the cluster are co-spatial with the radio halo indicative of a common origin for the hot and relativistic electrons in the turbulent wake of the Bullet.

  7. What does the Bullet Cluster tell us about self-interacting dark matter?

    Science.gov (United States)

    Robertson, Andrew; Massey, Richard; Eke, Vincent

    2017-02-01

    We perform numerical simulations of the merging galaxy cluster 1E 0657-56 (the Bullet Cluster), including the effects of elastic dark matter scattering. In a similar manner to the stripping of gas by ram pressure, dark matter self-interactions would transfer momentum between the two galaxy-cluster dark matter haloes, causing them to lag behind the collisionless galaxies. The absence of an observed separation between the dark matter and stellar components in the Bullet Cluster has been used to place upper limits on the cross-section for dark matter scattering. We emphasize the importance of analysing simulations in an observationally motivated manner, finding that the way in which the positions of the various components are measured can have a larger impact on derived constraints on dark matter's self-interaction cross-section than reasonable changes to the initial conditions for the merger. In particular, we find that the methods used in previous studies to place some of the tightest constraints on this cross-section do not reflect what is done observationally, and overstate the Bullet Cluster's ability to constrain the particle properties of dark matter. We introduce the first simulations of the Bullet Cluster including both self-interacting dark matter and gas. We find that as the gas is stripped it introduces radially dependent asymmetries into the stellar and dark matter distributions. As the techniques used to determine the positions of the dark matter and galaxies are sensitive to different radial scales, these asymmetries can lead to erroneously measured offsets between dark matter and galaxies even when they are spatially coincident.

  8. Tangential Velocity of the Dark Matter in the Bullet Cluster from Precise Lensed Image Redshifts

    Science.gov (United States)

    Molnar, Sandor M.; Broadhurst, Tom; Umetsu, Keiichi; Zitrin, Adi; Rephaeli, Yoel; Shimon, Meir

    2013-09-01

    We show that the fast-moving component of the "Bullet Cluster" (1E0657-56) can induce potentially resolvable redshift differences between multiply lensed images of background galaxies. This moving cluster effect, due to the tangential peculiar velocity of the lens, can be expressed as the scalar product of the lensing deflection angle with the tangential velocity of the mass components; the effect is maximal for clusters colliding in the plane of the sky with velocities boosted by their mutual gravity. The Bullet Cluster is likely to be the best candidate for the first measurement of this effect due to the large collision velocity and because the lensing deflection and the cluster fields can be calculated in advance. We derive the deflection field using multiply lensed background galaxies detected with the Hubble Space Telescope. The velocity field is modeled using self-consistent N-body/hydrodynamical simulations constrained by the observed X-ray and gravitational lensing features of this system. We predict that the triply lensed images of systems "G" and "H" straddling the critical curve of the bullet component will show the largest frequency shifts up to ~0.5 km s-1. These shifts are within the range of the Atacama Large Millimeter/Submillimeter Array for molecular emission, and are near the resolution limit of the new generation high-throughput optical-IR spectrographs. The detection of this effect measures the tangential motion of the subclusters directly, thereby clarifying the tension with ΛCDM, which is inferred from the gas motion less directly. This method may be extended to smaller redshift differences using the Lyα forest toward QSOs lensed by more typical clusters of galaxies. More generally, the tangential component of the peculiar velocities of clusters derived by our method complements the radial component determined by the kinematic Sunyaev-Zel'dovich effect, providing a full three-dimensional description of velocities.

  9. Tangential Velocity of the Dark Matter in the Bullet Cluster from Precise Lensed Image Redshifts

    CERN Document Server

    Molnar, Sandor M; Umetsu, Keiichi; Zitrin, Adi; Rephaeli, Yoel; Shimon, Meir

    2013-01-01

    We show that the fast moving component of the "bullet cluster" (1E0657-56) can induce potentially resolvable redshift differences between multiply-lensed images of background galaxies. The moving cluster effect can be expressed as the scalar product of the lensing deflection angle with the tangential velocity of the mass components, and it is maximal for clusters colliding in the plane of the sky with velocities boosted by their mutual gravity. The bullet cluster is likely to be the best candidate for the first measurement of this effect due to the large collision velocity and because the lensing deflection and the cluster fields can be calculated in advance. We derive the deflection field using multiply-lensed background galaxies detected with the Hubble Space Telescope. The velocity field is modeled using self-consistent N-body/hydrodynamical simulations constrained by the observed X-ray and gravitational lensing features of this system. We predict that the triply-lensed images of systems "G" and "H" stradd...

  10. Another Shock for the Bullet Cluster, and the Source of Seed Electrons for Radio Relics

    Science.gov (United States)

    Shimwell, Timothy W,; Markevitch, Maxim; Brown, Shea; Feretti, Luigina; Gaensler, B. M.; Johnston-Hollitt, M.; Lage, Craig; Srinivasan, Raghav

    2015-01-01

    With Australia Telescope Compact Array observations, we detect a highly elongated Mpc-scale diffuse radio source on the eastern periphery of the Bullet cluster 1E 0657-55.8, which we argue has the positional, spectral and polarimetric characteristics of a radio relic. This powerful relic (2:30:11025 WHz(exp -1) consists of a bright northern bulb and a faint linear tail. The bulb emits 94% of the observed radio flux and has the highest surface brightness of any known relic. Exactly coincident with the linear tail we find a sharp X-ray surface brightness edge in the deep Chandra image of the cluster - a signature of a shock front in the hot intracluster medium (ICM), located on the opposite side of the cluster to the famous bow shock. This new example of an X-ray shock coincident with a relic further supports the hypothesis that shocks in the outer regions of clusters can form relics via diffusive shock (re- )acceleration. Intriguingly, our new relic suggests that seed electrons for reacceleration are coming from a local remnant of a radio galaxy, which we are lucky to catch before its complete disruption. If this scenario, in which a relic forms when a shock crosses a well-defined region of the ICM polluted with aged relativistic plasma - as opposed to the usual assumption that seeds are uniformly mixed in the ICM - is also the case for other relics, this may explain a number of peculiar properties of peripheral relics.

  11. Gravity in the Crossfire: Revealing the Properties of Dark Matter in Bullet-like Clusters

    Science.gov (United States)

    Clowe, Douglas

    2010-09-01

    We propose to study the physical nature of dark matter by using massive, merging clusters of galaxies. As shown with the Bullet Cluster {1E0657-56}, such massive well-measured systems are critical for our understanding of dark matter. By more than doubling the number of clusters in the sample and obtaining systems at different observation angles, impact parameters, geometrical arrangements, and merger velocities, the systematic uncertainties in the dark matter cross section calculations can be improved substantially, allowing us to move from rough order of magnitude estimates to measurements with quantifiable uncertainties that can be compared usefully with the predictions from numerical simulations, and the constraints on alternate gravity models become unambiguous. Our proposed targets are three extraordinary, merging galaxy clusters with X-ray and optical offsets that are placed at ideal redshifts for such a study; A520, A1758N, and A2163. To pin down the position of the dark matter component we require high resolution, absolutely calibrated mass maps. High resolution gravitational lensing data is needed to attain this goal, which can only be achieved with the excellent resolving power of the HST.

  12. Another shock for the Bullet cluster, and the source of seed electrons for radio relics

    CERN Document Server

    Shimwell, Timothy W; Brown, Shea; Feretti, Luigina; Gaensler, B M; Johnston-Hollitt, M; Lage, Craig; Srinivasan, Raghav

    2015-01-01

    With Australia Telescope Compact Array observations, we detect a highly elongated Mpc-scale diffuse radio source on the eastern periphery of the Bullet cluster 1E0657-55.8, which we argue has the positional, spectral and polarimetric characteristics of a radio relic. This powerful relic (2.3+/-0.1 x 10^25 W Hz^-1) consists of a bright northern bulb and a faint linear tail. The bulb emits 94% of the observed radio flux and has the highest surface brightness of any known relic. Exactly coincident with the linear tail we find a sharp X-ray surface brightness edge in the deep Chandra image of the cluster -- a signature of a shock front in the hot intracluster medium (ICM), located on the opposite side of the cluster to the famous bow shock. This new example of an X-ray shock coincident with a relic further supports the hypothesis that shocks in the outer regions of clusters can form relics via diffusive shock (re-)acceleration. Intriguingly, our new relic suggests that seed electrons for reacceleration are coming...

  13. The Bullet cluster at its best: weighing stars, gas, and dark matter

    Science.gov (United States)

    Paraficz, D.; Kneib, J.-P.; Richard, J.; Morandi, A.; Limousin, M.; Jullo, E.; Martinez, J.

    2016-10-01

    Aims: We present a new strong lensing mass reconstruction of the Bullet cluster (1E 0657-56) at z = 0.296, based on WFC3 and ACS HST imaging and VLT/FORS2 spectroscopy. The strong lensing constraints underwent substantial revision compared to previously published analysis, there are now 14 (six new and eight previously known) multiply-imaged systems, of which three have spectroscopically confirmed redshifts (including one newly measured from this work). Methods: The reconstructed mass distribution explicitly included the combination of three mass components: (i) the intra-cluster gas mass derived from X-ray observation; (ii) the cluster galaxies modeled by their fundamental plane scaling relations and (iii) dark matter. Results: The model that includes the intra-cluster gas is the one with the best Bayesian evidence. This model has a total rms value of 0.158″ between the predicted and measured image positions for the 14 multiple images considered. The proximity of the total rms to resolution of HST/WFC3 and ACS (0.07-0.15''FWHM) demonstrates the excellent precision of our mass model. The derived mass model confirms the spatial offset between the X-ray gas and dark matter peaks. The fraction of the galaxy halos mass to total mass is found to be fs = 11 ± 5% for a total mass of 2.5 ± 0.1 × 1014M⊙ within a 250 kpc radial aperture.

  14. The Bullet Cluster revisited: New results from new constraints and improved strong lensing modeling technique

    CERN Document Server

    Paraficz, D; Richard, J; Morandi, A; Limousin, M; Jullo, E

    2012-01-01

    We present a new detailed parametric strong lensing mass reconstruction of the Bullet Cluster (1E 0657-56) at z=0.296, based on new WFC3 and ACS HST imaging and VLT/FORS2 spectroscopy. The strong lensing constraints undergone deep revision, there are 14 (6 new and 8 previously known) multiply imaged systems, of which 3 have spectroscopically confirmed redshifts (including 2 newly measured). The reconstructed mass distribution includes explicitly for the first time the combination of 3 mass components: i) the intra-cluster gas mass derived from X-ray observation, ii) the cluster galaxies modeled by their Fundamental Plane (elliptical) and Tully-Fisher (spiral) scaling relations and iii) dark matter. The best model has an average rms value of 0.158" between the predicted and measured image positions for the 14 multiple images considered. The derived mass model confirms the spacial offset between the X-ray gas and dark matter peaks. The galaxy halos to total mass fraction is found to be f_s=11+/-5% for a total m...

  15. Witnessing a merging bullet being stripped in the galaxy cluster, RXCJ2359.3-6042

    CERN Document Server

    Chon, Gayoung

    2015-01-01

    We report the discovery of the merging cluster, RXCJ2359.3-6042, from the REFLEX II cluster survey and present our results from all three detectors combined in the imaging and spectral analysis of the XMM-Newton data. Also known as Abell 4067, this is a unique system, where a compact bullet penetrates an extended, low density cluster at redshift z=0.099 clearly seen from our follow-up XMM-Newton observation. The bullet goes right through the central region of the cluster without being disrupted and we can clearly watch the process how the bullet component is stripped of its layers outside the core. There is an indication of a shock heated region in the East of the cluster with a higher temperature. The bulk temperature of the cluster is about 3.12 keV implying a lower mass system. Spearheading the bullet is a cool core centred by a massive early type galaxy. The temperatures and metallicities of a few regions in the cluster derived from the spectral analysis supports our conjecture based on the surface bright...

  16. NuSTAR observations of the bullet cluster: constraints on inverse Compton emission

    Energy Technology Data Exchange (ETDEWEB)

    Wik, Daniel R.; Zhang, W. W. [Astrophysics Science Division, NASA/Goddard Space Flight Center, Greenbelt, MD 20771 (United States); Hornstrup, A.; Westergaard, N. J.; Ferreira, D. D. M.; Pedersen, K.; Christensen, F. E. [DTU Space, National Space Institute, Technical University of Denmark, Elektrovej 327, DK-2800 Lyngby (Denmark); Molendi, S.; Gastaldello, F. [IASF-Milano, INAF, Via Bassini 15, I-20133 Milano (Italy); Madejski, G. [Kavli Institute for Particle Astrophysics and Cosmology, SLAC National Accelerator Laboratory, Menlo Park, CA 94025 (United States); Harrison, F. A.; Grefenstette, B. W.; Madsen, K. K. [Cahill Center for Astronomy and Astrophysics, California Institute of Technology, Pasadena, CA 91125 (United States); Zoglauer, A.; Boggs, S. E.; Craig, W. W. [Space Sciences Laboratory, University of California, Berkeley, CA 94720 (United States); Kitaguchi, T. [RIKEN Nishina Center, 2-1 Hirosawa, Wako, Saitama 351-0198 (Japan); Hailey, C. J. [Columbia Astrophysics Laboratory, Columbia University, New York, NY 10027 (United States); Stern, D., E-mail: daniel.r.wik@nasa.gov [Jet Propulsion Laboratory, California Institute of Technology, Pasadena, CA 91109 (United States)

    2014-09-01

    The search for diffuse non-thermal inverse Compton (IC) emission from galaxy clusters at hard X-ray energies has been undertaken with many instruments, with most detections being either of low significance or controversial. Because all prior telescopes sensitive at E > 10 keV do not focus light and have degree-scale fields of view, their backgrounds are both high and difficult to characterize. The associated uncertainties result in lower sensitivity to IC emission and a greater chance of false detection. In this work, we present 266 ks NuSTAR observations of the Bullet cluster, which is detected in the energy range 3-30 keV. NuSTAR's unprecedented hard X-ray focusing capability largely eliminates confusion between diffuse IC and point sources; however, at the highest energies, the background still dominates and must be well understood. To this end, we have developed a complete background model constructed of physically inspired components constrained by extragalactic survey field observations, the specific parameters of which are derived locally from data in non-source regions of target observations. Applying the background model to the Bullet cluster data, we find that the spectrum is well—but not perfectly—described as an isothermal plasma with kT = 14.2 ± 0.2 keV. To slightly improve the fit, a second temperature component is added, which appears to account for lower temperature emission from the cool core, pushing the primary component to kT ∼ 15.3 keV. We see no convincing need to invoke an IC component to describe the spectrum of the Bullet cluster, and instead argue that it is dominated at all energies by emission from purely thermal gas. The conservatively derived 90% upper limit on the IC flux of 1.1 × 10{sup –12} erg s{sup –1} cm{sup –2} (50-100 keV), implying a lower limit on B ≳ 0.2 μG, is barely consistent with detected fluxes previously reported. In addition to discussing the possible origin of this discrepancy, we remark on the

  17. A method to search for bulk motions in the ICM with {\\sl Chandra} CCD spectra: application to the Bullet cluster

    CERN Document Server

    Liu, Ang; Tozzi, Paolo; Zhu, Zong-Hong

    2015-01-01

    We propose a strategy to search for bulk motions in the intracluster medium (ICM) of merging clusters based on {\\sl Chandra} CCD data. Our goal is to derive robust measurements of the average redshift of projected ICM regions obtained from the centroid of the $K_\\alpha$ line emission. We thoroughly explore the effect of the unknown temperature structure along the line of sight to accurately evaluate the systematic uncertainties on the ICM redshift. We apply our method to the "Bullet cluster" (1E~0657-56). We directly identify 23 independent regions on the basis of the surface brightness contours, and measure the redshift of the ICM averaged along the line of sight in each. We find that the redshift distribution across these regions is marginally inconsistent with the null hypothesis of a constant redshift or no bulk motion in the ICM, at a confidence level of about $2\\, \\sigma$. We tentatively identify the regions most likely affected by bulk motions and find a maximum velocity gradient of about $(46\\pm 13)$ ...

  18. First detection at 5.5 and 9 GHz of the radio relics in bullet cluster with ATCA

    CERN Document Server

    Malu, Siddharth; Sandhu, Pritpal

    2016-01-01

    We present here results from observations at 5.5 and 9 GHz of the Bullet cluster 1E 0657-55.8 with the Australia Telescope Compact Array (ATCA). Our results show detection of diffuse emission in the cluster. Our findings are consistent with the previous observations by Shimwell et al. (2014) and Shimwell et al. (2015) at 1.1-3.1 GHz. Morphology of diffuse structures (relic regions A and B and the radio halo) are consistent with those reported by the previous study. Our results indicate steepening in the spectral index at higher frequencies (at and greater than 5.0 GHz) for region A. The spectrum can be fit well by a broken power law. We discuss the possibility of a few recent theoretical models explaining this break in the power law spectrum, and find that a modified Diffusive Shock Acceleration (DSA) model or a turbulent reacceleration model may be relevant. Deep radio observations at high frequencies (at and greater than 5 GHz) are required for a detailed comparison with this model.

  19. Dark matter line emission constraints from NuSTAR observations of the Bullet Cluster

    DEFF Research Database (Denmark)

    Riemer-Sørensen, S.; Wik, D.; Madejski, G.

    2015-01-01

    Some dark matter candidates, e.g., sterile neutrinos, provide observable signatures in the form of mono-energetic line emission. We present the first search for dark matter line emission in the range in a pointed observation of the Bullet Cluster with NuSTAR. We do not detect any significant line...

  20. SPECTROSCOPIC CONFIRMATION OF A z = 6.740 GALAXY BEHIND THE BULLET CLUSTER

    Energy Technology Data Exchange (ETDEWEB)

    Bradac, Marusa; Hall, Nicholas [Department of Physics, University of California, Davis, CA 95616 (United States); Vanzella, Eros [INAF, Osservatorio Astronomico di Trieste, via G.B. Tiepolo 11, 34131 Trieste (Italy); Treu, Tommaso [Department of Physics, University of California, Santa Barbara, CA 93106 (United States); Fontana, Adriano [INAF, Osservatorio Astronomico di Roma, via Frascati 33, 00040 Monteporzio (Italy); Gonzalez, Anthony H. [Department of Astronomy, University of Florida, 211 Bryant Space Science Center, Gainesville, FL 32611 (United States); Clowe, Douglas [Department of Physics and Astronomy, Ohio University, Clippinger Labs 251B, Athens, OH 45701 (United States); Zaritsky, Dennis; Clement, Benjamin [Steward Observatory, University of Arizona, 933 N Cherry Ave., Tucson, AZ 85721 (United States); Stiavelli, Massimo, E-mail: marusa@physics.ucdavis.edu [Space Telescope Science Institute, 3700 San Martin Drive, Baltimore, MD 21218 (United States)

    2012-08-10

    We present the first results of our spectroscopic follow-up of 6.5 < z < 10 candidate galaxies behind clusters of galaxies. We report the spectroscopic confirmation of an intrinsically faint Lyman break galaxy (LBG) identified as a z{sub 850LP}-band dropout behind the Bullet Cluster. We detect an emission line at {lambda} = 9412 A at >5{sigma} significance using a 16 hr long exposure with FORS2 VLT. Based on the absence of flux in bluer broadband filters, the blue color of the source, and the absence of additional lines, we identify the line as Ly{alpha} at z = 6.740 {+-} 0.003. The integrated line flux is f = (0.7 {+-} 0.1 {+-} 0.3) Multiplication-Sign 10{sup -17} erg{sup -1} s{sup -1} cm{sup -2} (the uncertainties are due to random and flux calibration errors, respectively) making it the faintest Ly{alpha} flux detected at these redshifts. Given the magnification of {mu} = 3.0 {+-} 0.2 the intrinsic (corrected for lensing) flux is f {sup int} = (0.23 {+-} 0.03 {+-} 0.10 {+-} 0.02) Multiplication-Sign 10{sup -17} erg{sup -1} s{sup -1} cm{sup -2} (additional uncertainty due to magnification), which is {approx}2-3 times fainter than other such measurements in z {approx} 7 galaxies. The intrinsic H{sub 160W}-band magnitude of the object is m{sup int}{sub H{sub 1{sub 6{sub 0{sub W}}}}}=27.57{+-}0.17, corresponding to 0.5 L* for LBGs at these redshifts. The galaxy is one of the two sub-L* LBG galaxies spectroscopically confirmed at these high redshifts (the other is also a lensed z = 7.045 galaxy), making it a valuable probe for the neutral hydrogen fraction in the early universe.

  1. Molecular gas and dust in the highly magnified z = 2.8 galaxy behind the Bullet Cluster

    CERN Document Server

    Johansson, Daniel; Lopez-Cruz, Omar; Muller, Sebastien; Birkinshaw, Mark; Black, John H; Bremer, Malcolm N; Wall, William F; Bertoldi, Frank; Castillo, Edgar; Ibarra-Medel, Hector Javier; 10.1051/0004-6361/201117918

    2012-01-01

    The gravitational magnification provided by massive galaxy clusters makes it possible to probe the physical conditions in distant galaxies that are of lower luminosity than those in blank fields and likely more representative of the bulk of the high-redshift galaxy population. We aim to constrain the basic properties of molecular gas in a strongly magnified submm galaxy located behind the massive Bullet Cluster. This galaxy (SMM J0658) is split into three images, with a total magnification factor of almost 100. We used the Australia Telescope Compact Array (ATCA) to search for {12}CO(1--0) and {12}CO(3--2) line emission from SMM J0658. We also used the SABOCA bolometer camera on the Atacama Pathfinder EXperiment (APEX) telescope to measure the continuum emission at 350 micron. CO(1--0) and CO(3--2) are detected at 6.8 sigma and 7.5 sigma significance when the spectra toward the two brightest images of the galaxy are combined. From the CO(1-0) luminosity we derive a mass of cold molecular gas of (1.8 \\pm 0.3) ...

  2. NuSTAR observations of the bullet cluster: constraints on inverse compton emission

    DEFF Research Database (Denmark)

    Wik, Daniel R.; Hornstrup, Allan; Molendi, S.;

    2014-01-01

    The search for diffuse non-thermal inverse Compton (IC) emission from galaxy clusters at hard X-ray energies has been undertaken with many instruments, with most detections being either of low significance or controversial. Because all prior telescopes sensitive at E > 10 keV do not focus light a...

  3. Ghosts of Milky Way's past: the globular cluster ESO 37-1 (E 3)

    CERN Document Server

    Marcos, R de la Fuente; Bidin, C Moni; Ortolani, S; Carraro, G

    2015-01-01

    Context. In the Milky Way, most globular clusters are highly conspicuous objects that were found centuries ago. However, a few dozen of them are faint, sparsely populated systems identified largely during the second half of the past century. One of the faintest is ESO 37-1 (E 3) and as such it remains poorly studied, with no spectroscopic observations published so far, although it was discovered in 1976. Aims. We investigate the globular cluster E 3 in an attempt to better constrain its fundamental parameters. Spectroscopy of stars in the field of E 3 is shown here for the first time. Methods. Deep, precise VI CCD photometry of E 3 down to V=26 mag is presented and analyzed. Low resolution, medium signal-to-noise ratio spectra of 9 candidate members are studied to derive radial velocity and metallicity. Proper motions from the UCAC4 catalogue are used to explore the kinematics of the bright members of E 3. Results. Isochrone fitting indicates that E 3 is probably very old, with an age of about 13 Gyr; its dis...

  4. OBSERVING CASCADES OF SOLAR BULLETS AT HIGH RESOLUTION. II

    Energy Technology Data Exchange (ETDEWEB)

    Scullion, E.; Engvold, O.; Lin, Y.; Voort, L. Rouppe van der, E-mail: scullie@tcd.ie [Institute of Theoretical Astrophysics, University of Oslo, P.O. Box 1029, Blindern, NO-0315 Oslo (Norway)

    2015-12-01

    High resolution observations from the Swedish 1-m Solar Telescope revealed bright, discrete, blob-like structures (which we refer to as solar bullets) in the Hα 656.28 nm line core that appear to propagate laterally across the solar atmosphere as clusters in active regions (ARs). These small-scale structures appear to be field aligned and many bullets become triggered simultaneously and traverse collectively as a cluster. Here, we conduct a follow-up study on these rapidly evolving structures with coincident observations from the Solar Dynamics Observatory/Atmospheric Imaging Assembly. With the co-aligned data sets, we reveal (a) an evolving multithermal structure in the bullet cluster ranging from chromospheric to at least transition region temperatures, (b) evidence for cascade-like behavior and corresponding bidirectional motions in bullets within the cluster, which indicate that there is a common source of the initial instability leading to bullet formation, and (c) a direct relationship between co-incident bullet velocities observed in Hα and He ii 30.4 nm and an inverse relationship with respect to bullet intensity in these channels. We find evidence supporting that bullets are typically composed of a cooler, higher density core detectable in Hα with a less dense, hotter, and fainter co-moving outer sheath. Bullets unequivocally demonstrate the finely structured nature of the AR corona. We have no clear evidence for bullets being associated with locally heated (or cooled), fast flowing plasma. Fast MHD pulses (such as solitons) could best describe the dynamic properties of bullets whereas the presence of a multithermal structure is new.

  5. $Suzaku$ and $XMM-Newton$ observations of a newly-discovered early-stage cluster merger 1E2216.0-0401 and 1E2215.7-0404

    CERN Document Server

    Akamatsu, H; Shimwell, T W; Mernier, F; Mao, J; Urdampilleta, I; de Plaa, J; Röttgering, H J A; Kaastra, J S

    2016-01-01

    We present the results of $Suzaku$ and $XMM-Newton$ X-ray observations of the cluster pair 1E2216.0-0401 and 1E2215.7-0404. We discover an X-ray bridge between the clusters. $Suzaku$ and $XMM-Newton$ observations revealed that each cluster hosts gas with moderate temperature of $kT_{1E2216.0-0401}=$4.8$\\pm$0.1 keV and $kT_{1E2215.7-0404}=$5.8$\\pm$0.2 keV, respectively. On the other hand, the bridge region shows a remarkably high temperature ({\\it kT}=6.6$\\pm$0.5 keV). Furthermore, at the position of the bridge, we detected an enhancement in the wavelet-decomposed soft-band (0.5-4.0 keV) $XMM-Newton$ image at 3 sigma significance, this is most likely due to a compression of the intracluster medium (ICM) as a consequence of the merging activity. This X-ray intensity and temperature enhancement are not consistent with those expected from a late phase, but are in agreement with the predictions by numerical simulations of an early phase merger. From the temperature jump at the location of the bridge, the Mach numb...

  6. Suzaku and XMM-Newton observations of the newly discovered early-stage cluster merger of 1E2216.0-0401 and 1E2215.7-0404

    Science.gov (United States)

    Akamatsu, H.; Gu, L.; Shimwell, T. W.; Mernier, F.; Mao, J.; Urdampilleta, I.; de Plaa, J.; Röttgering, H. J. A.; Kaastra, J. S.

    2016-09-01

    We present the results of Suzaku and XMM-Newton X-ray observations of the cluster pair 1E2216.0-0401 and 1E2215.7-0404. We discover an X-ray bridge between the clusters. Suzaku and XMM-Newton observations revealed that each cluster hosts gas with moderate temperature of kT0401 = 4.8 ± 0.1 keV and kT0404 = 5.8 ± 0.2 keV, respectively. On the other hand, the bridge region shows a remarkably high temperature (kT = 6.6 ± 0.5 keV). Furthermore, at the position of the bridge, we detected an enhancement in the wavelet-decomposed soft-band (0.5-4.0 keV) XMM-Newton image at 3 sigma significance, this is most likely due to a compression of the intracluster medium (ICM) as a consequence of the merging activity. This X-ray intensity and temperature enhancement are not consistent with those expected from a late phase, but are in agreement with the predictions by numerical simulations of an early phase merger. From the temperature jump at the location of the bridge, the Mach number is estimated to be ℳ = 1.4 ± 0.1, which corresponds to a shock propagation velocity of about 1570 km s-1. From the shock properties, we estimate that core-passage will occur in 0.3-0.6 Gyr and that the age of the shock structure is 50-100 Myr. Based on the measured properties of the ICM at the bridge and estimation of timescales, we find indications for non-equilibrium ionization. We also discover possible diffuse radio emission located between the merging clusters. Combining the radio, X-ray, and optical image data, we speculate that the detected radio sources are most likely related to the merger event. Thus, 1E2216.0-0401 and 1E2215.7-0404 is a new example of an early phase cluster merger with remarkable characteristics.

  7. Going Ballistic: Bullet Trajectories

    Directory of Open Access Journals (Sweden)

    Amanda Wade

    2011-01-01

    Full Text Available This project seeks to answer at what angle does a gun marksman have to aim in order to hit the center of a target one meter off the ground and 1000 meters away? We begin by modeling the bullet's trajectory using Euler's method with the help of a Microsoft Excel spreadsheet solver, and then systematically search for the angle corresponding to the center of the target. It was found that a marksman shooting a target 1000 meters away and 1 meter off the ground has to aim the rifle 0.436° above horizontal to hit the center.

  8. Standards for bullets and casings

    Directory of Open Access Journals (Sweden)

    J.F Song

    2002-11-01

    The Office of Law Enforcement Standards (OLES at the National Institute of Standards and Technology (NIST manages research in many different disciplines of forensic science. One of these projects supports the National Integrated Ballistics Information Network (NIBIN. NIST digitized six bullet signatures from samples provided by the Bureau of Alcohol, Tobacco, and Firearms (ATF and the Federal Bureau of Investigation (FBI. Using these signatures as a virtual standard, NIST’s Instrument Shop manufactured 20 reference materials (RM 8240 standard bullets using a numerically-controlled diamond turning machine. Test results show high reproducibility of the bullet signatures on standard bullets. NIST has also developed a new parameter for bullet signature comparisons, using autocorrelation functions, and proposed a diagram for tracing local ballistics measurements to the National Laboratory Center of the ATF and to the FBI. Using an electro-forming process, NIST has manufactured prototype standard casings and test results show high reproducibility for the casing signatures.

  9. Experimental investigations of plasma bullets

    Energy Technology Data Exchange (ETDEWEB)

    Mericam-Bourdet, N; Laroussi, M; Begum, A; Karakas, E, E-mail: mlarouss@odu.ed [Laser and Plasma Engineering Institute, Old Dominion University, Norfolk, VA 23529 (United States)

    2009-03-07

    Recently several investigators reported on various means of generating cold plasma jets at atmospheric pressure. More interestingly, these jets turned out to be not continuous plasmas but trains of small high velocity plasma packets/bullets. However, until now little is known of the nature of these 'bullets'. Here we present experimental insights into the physical and chemical characteristics of bullets. We show that their time of initiation, their velocity and the distance they travel are directly dependent on the value of the applied voltage. We also show that these bullets can be controlled by the application of an external electric field. Using an intensified charge coupled device camera we report on their geometrical shape, which was revealed to be 'donut' shaped, therefore giving an indication that solitary surface ionization waves may be responsible for the creation of these bullets. In addition, using emission spectroscopy, we follow the evolution of various species along the trajectory of the bullets, in this way correlating the bullet propagation with the evolution of their chemical activity.

  10. Comparing Measured Bullet Weight with Manufacturer Specifications

    Science.gov (United States)

    2012-02-01

    Remington . Figure 3: Bullet weights for 62 grain Berger Flat Base Varmint. Berger 115 grain VLD (0.257) The weight tolerance claimed by Berger...the smallest variation among the .257 inch bullets considered here, and is the most accurate bullet ever tested in the 25-06 Remington 700 Sendero

  11. Measuring Bullet Velocity with a PC Soundcard

    CERN Document Server

    Courtney, M; Courtney, Michael; Edwards, Brian

    2006-01-01

    This article describes a simple method for using a PC soundcard to accurately measure bullet velocity. The method involves placing the microphone within a foot of the muzzle and firing at a steel target between 50 and 100 yards away. The time of flight for the bullet is simply the recorded time between muzzle blast and sound of the bullet hitting the target minus the time it takes the sound to return from the target to the microphone. The average bullet velocity is simply the distance from the muzzle to the target divided by the time of flight of the bullet. This method can also be applied to measurement of paintball velocities.

  12. A Coning Theory of Bullet Motions

    CERN Document Server

    Boatright, James A

    2012-01-01

    Each observable ballistic phenomenon of a spin-stabilized rifle bullet can be explained in terms of the acceleration of gravity and the total aerodynamic force acting on that bullet. In addition to the coning motion itself, Coning Theory explains the spinning bullet's aerodynamic jump and its steadily increasing yaw of repose together with its resulting spin-drift. The total aerodynamic force on the bullet comprises its drag and lift rectangular components and produces an associated overturning moment acting upon the rigid bullet. The coning motion of the bullet includes two distinct but synchronized aspects: 1) the well-known gyroscopic precession of the spin-axis of the bullet, and 2) the previously little-known orbiting of the center of gravity of the bullet around its mean trajectory with the nose of the bullet angled inward toward that trajectory. New equations are developed governing the orbital motion of the CG as a circular, isotropic harmonic oscillation driven by the lift and drag forces as they rev...

  13. The Math Emporium: Higher Education's Silver Bullet

    Science.gov (United States)

    Twigg, Carol A.

    2011-01-01

    Throughout the 1990's, many people saw information technology as a silver bullet that could solve many of higher education's problems, among them the need to improve learning outcomes and control the ever-upward trajectory of higher education costs. The term "silver bullet" connotes a direct and effortless solution to a problem.…

  14. On $bullet$-lict signed graphs $L_{bullet_c}(S$ and $bullet$-line signed graphs $L_bullet(S$

    Directory of Open Access Journals (Sweden)

    Mukti Acharya

    2016-03-01

    Full Text Available A emph{signed graph} (or, in short, emph{sigraph} $S=(S^u,sigma$ consists of an underlying graph $S^u :=G=(V,E$ and a function $sigma:E(S^ulongrightarrow {+,-}$, called the signature of $S$. A emph{marking} of $S$ is a function $mu:V(Slongrightarrow {+,-}$. The emph{canonical marking} of a signed graph $S$, denoted $mu_sigma$, is given as $$mu_sigma(v := prod_{vwin E(S}sigma(vw.$$The line-cut graph (or, in short, emph{lict graph} of a graph $G=(V,E$, denoted by $L_c(G$, is the graph with vertex set $E(Gcup C(G$, where $C(G$ is the set of cut-vertices of $G$, in which two vertices are adjacent if and only if they correspond to adjacent edges of $G$ or one vertex corresponds to an edge $e$ of $G$ and the other vertex corresponds to a cut-vertex $c$ of $G$ such that $e$ is incident with $c$.In this paper, we introduce emph{Dot-lict signed graph} (or emph{$bullet$-lict signed graph} $L_{bullet_c}(S$, which has $L_c(S^u$ as its underlying graph. Every edge $uv$ in $L_{bullet_c}(S$ has the sign $mu_sigma(p$, if $u, v in E(S$ and $pin V(S$ is a common vertex of these edges, and it has the sign $mu_sigma(v$, if $uin E(S$ and $vin C(S$.we characterize signed graphs on $K_p$, $pgeq2$, on cycle $C_n$ and on $K_{m,n}$ which are $bullet$-lict signed graphs or $bullet$-line signed graphs, characterize signed graphs $S$ so that $L_{bullet_c}(S$ and $L_bullet(S$ are balanced. We also establish the characterization of signed graphs $S$ for which $Ssim L_{bullet_c}(S$, $Ssim L_bullet(S$, $eta(Ssim L_{bullet_c}(S$ and $eta(Ssim L_bullet(S$, here $eta(S$ is negation of $S$ and $sim$ stands for switching equivalence.

  15. Rotating Bullets from A Variable Protostar

    CERN Document Server

    Chen, Xuepeng; Zhang, Qizhou; Launhardt, Ralf; Henning, Thomas

    2016-01-01

    We present SMA CO(2-1) observations toward the protostellar jet driven by SVS13A, a variable protostar in the NGC1333 star-forming region. The SMA CO(2-1) images show an extremely high-velocity jet composed of a series of molecular 'bullets'. Based on the SMA CO observations, we discover clear and large systematic velocity gradients, perpendicular to the jet axis, in the blueshifted and redshifted bullets. After discussing several alternative interpretations, such as twin-jets, jet precession, warped disk, and internal helical shock, we suggest that the systematic velocity gradients observed in the bullets result from the rotation of the SVS13A jet. From the SMA CO images, the measured rotation velocities are 11.7-13.7 km/s for the blueshifted bullet and 4.7+/-0.5 km/s for the redshifted bullet. The estimated specific angular momenta of the two bullets are comparable to those of dense cores, about 10 times larger than those of protostellar envelopes, and about 20 times larger than those of circumstellar disks...

  16. Ballistic Reconstruction of a Migrating Bullet in the Parapharyngeal Space

    Directory of Open Access Journals (Sweden)

    David Bächinger

    2015-01-01

    Full Text Available A 21-year-old male suffering from severe throat pain after being hit by a bullet in Syria claimed that he was shot through his eye and that the bullet subsequently descended behind his throat. Even though the first medical report stated that this course is implausible, meticulous workup provided evidence that the bullet might have entered the parapharyngeal space in a more cranial position than the one it was found eight months later. Our case highlights that bullets are able to move within the body, rendering ballistic reconstruction difficult. However, after removal of the bullet the patient’s symptoms completely resolved.

  17. Gyroscopic Stability of Open Tipped Match Style Rifle Bullets

    CERN Document Server

    Courtney, Elya R

    2014-01-01

    Earlier work has produced formulas for predicting stability of rifle bullets of near uniform density and also for plastic-tipped rifle bullets. These formulas have been shown to be accurate to within 5%. However, the original Miller twist formula for metal bullets of near uniform density underestimates the stability of match style open tipped rifle bullets having a significant empty volume in the tip. This paper presents a new formula for accurately estimating the stability of these open tipped match style rifle bullets from parameters easily obtained such as the bullet mass, length, and depth of the empty space in the tip. The formula is tested by measuring the aerodynamic drag vs. predicted stability of several bullets over a range of stabilities.

  18. Probability 1/e

    Science.gov (United States)

    Koo, Reginald; Jones, Martin L.

    2011-01-01

    Quite a number of interesting problems in probability feature an event with probability equal to 1/e. This article discusses three such problems and attempts to explain why this probability occurs with such frequency.

  19. Possible influences on bullet trajectory deflection in ballistic gelatine.

    Science.gov (United States)

    Riva, Fabiano; Kerkhoff, Wim; Bolck, Annabel; Mattijssen, Erwin J A T

    2017-02-01

    The influence of the distance to the top and bottom of a gelatine block and to bullet tracks from previously fired shots on a bullet's trajectory, when passing through ballistic gelatine, was studied. No significant difference in deflection was found when trajectories of 9mm Luger bullets, fired at a 3.5cm distance to the top and bottom of a gelatine block and to bullet tracks from previously fired shots, were compared to trajectories of bullets fired 7cm or more away from any of the aforementioned aspects. A surprisingly consistent 6.5° absolute deflection angle was found when these bullets passed through 22.5 to 23.5cm of ballistic gelatine. The projection angle, determined by the direction of the deflection, appeared to be random. The consistent absolute angle, in combination with the random projection angle, resulted in a cone-like deflection pattern.

  20. Paul Ehrlich: From magic bullets to chemotherapy

    Directory of Open Access Journals (Sweden)

    Juan Fernando Cediel

    2008-09-01

    Full Text Available Paul Ehrlich is one of the most notable figures in the world of science. Considered by many as the father of chemotherapy, he was awarded the Nobel Prize in Physiology and Medicine in 1908 for his contributions to immunology. This document outlines some of his most important findings, including those who led him to create his famous «magic bullets», precursors of current chemotherapeutic agents.

  1. Topological light bullets supported by spatio-temporal gain

    CERN Document Server

    Lobanov, Valery E; Kartashov, Yaroslav V; Vysloukh, Victor A; Torner, Lluis

    2012-01-01

    We reveal that the competition between diffraction, cubic nonlinearity, two-photon absorption, and gain localized in both space and time results in arrest of collapse, suppression of azimuthal modula-tion instabilities for spatiotemporal wavepackets, and formation of stable three-dimensional light bul-lets. We show that Gaussian spatiotemporal gain landscapes support bright, fundamental light bullets, while gain landscapes featuring a ring-like spatial and a Gaussian temporal shapes may support stable vortex bullets carrying topological phase dislocations.

  2. Main: 1E1E [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E1E トウモロコシ Corn Zea mays L. Beta-Glucosidase, Chloroplast Precursor Name=Glu1; Zea...TDDAYASQEVNGPDGKPIGPPMGNPWIYMYPEGLKDLLMIMKNKYGNPPIYITENGIGDVDTKETPLPMEAALNDYKRLDYIQRHIATLKESIDLGSNVQGYFAWSLLDNFEWFAGFTERYGIVYVDRNNNCTRYMKESAKWLKEFNTAKKPSKKILTPA corn_1E1E.jpg ...

  3. Simulations of Galaxy Cluster Collisions with a Dark Plasma Component

    CERN Document Server

    Sepp, Tiit; Heikinheimo, Matti; Hektor, Andi; Raidal, Martti; Spethmann, Christian; Tempel, Elmo; Veermäe, Hardi

    2016-01-01

    We present the results of N-body/smoothed particle hydrodynamics simulations of galaxy cluster collisions with a two component model of dark matter, which is assumed to consist of a predominant non-interacting dark matter component and a 20 percent mass fraction of dark plasma. Dark plasma is an intriguing form of interacting dark matter with an effective fluid-like behavior, which is well motivated by various theoretical particle physics models. We find that by choosing suitable simulation parameters, the observed distributions of dark matter in both the Bullet Cluster (1E 0657-558) and Abell 520 (MS 0451.5+0250) can be qualitatively reproduced. In particular, it is found that dark plasma forms an isolated mass clump in the Abell 520 system which cannot be explained by traditional models of dark matter, but has been detected in weak lensing observations.

  4. Spontaneously generated X-shaped light bullets

    CERN Document Server

    Trapani, P D; Piskarskas, A; Jedrkiewicz, O; Trull, J; Conti, C; Trillo, S

    2003-01-01

    We observe the formation of an intense optical wavepacket fully localized in all dimensions, i.e. both longitudinally (in time) and in the transverse plane, with an extension of a few tens of fsec and microns, respectively. Our measurements show that the self-trapped wave is a X-shaped light bullet spontaneously generated from a standard laser wavepacket via the nonlinear material response (i.e., second-harmonic generation), which extend the soliton concept to a new realm, where the main hump coexists with conical tails which reflect the symmetry of linear dispersion relationship.

  5. The Influence of Cluster Mergers on Galaxy Evolution

    Science.gov (United States)

    Rawle, T. D.; Altieri, B.; Bouy, H.; Egami, E.; Pérez-González, P. G.; Richard, J.; Valtchanov, I.; Walth, G.

    2016-06-01

    The rich environment of galaxy clusters is understood to have a profound effect on the evolution of constituent galaxies. However, even clusters of a similar mass and at fixed redshift are not homogeneous, displaying a range in structural complexity. Here we concentrate on the effect of cluster merging, the most massive dynamic process in the Universe. Two spectacular cluster mergers at z~0.3 are explored: the archetypal Bullet cluster (1E0657-558; Rawle et al. 2012), and the HST Frontier Field, Pandora's cluster (Abell 2744; Rawle et al. 2014, 2016). We present detailed analysis of their total star formation, derived from multi-wavelength observations of both dusty and unobscured activity from Herschel, Spitzer, WISE and GALEX. Examination of the morphologies of individual cluster galaxies reveals striking evidence for transformation and enhanced star formation, triggered by the merger-induced shock front. This includes several galaxies identified as having "jellyfish" morphologies caused by the passing shock. We discuss the implications, and preview future work exploring a large sample of clusters covering a range of dynamic states and redshifts.

  6. Cell adhesion during bullet motion in capillaries.

    Science.gov (United States)

    Takeishi, Naoki; Imai, Yohsuke; Ishida, Shunichi; Omori, Toshihiro; Kamm, Roger D; Ishikawa, Takuji

    2016-08-01

    A numerical analysis is presented of cell adhesion in capillaries whose diameter is comparable to or smaller than that of the cell. In contrast to a large number of previous efforts on leukocyte and tumor cell rolling, much is still unknown about cell motion in capillaries. The solid and fluid mechanics of a cell in flow was coupled with a slip bond model of ligand-receptor interactions. When the size of a capillary was reduced, the cell always transitioned to "bullet-like" motion, with a consequent decrease in the velocity of the cell. A state diagram was obtained for various values of capillary diameter and receptor density. We found that bullet motion enables firm adhesion of a cell to the capillary wall even for a weak ligand-receptor binding. We also quantified effects of various parameters, including the dissociation rate constant, the spring constant, and the reactive compliance on the characteristics of cell motion. Our results suggest that even under the interaction between P-selectin glycoprotein ligand-1 (PSGL-1) and P-selectin, which is mainly responsible for leukocyte rolling, a cell is able to show firm adhesion in a small capillary. These findings may help in understanding such phenomena as leukocyte plugging and cancer metastasis.

  7. Bullet embolism in a case of homicide: Case report

    Directory of Open Access Journals (Sweden)

    Živković Vladimir

    2013-01-01

    Full Text Available Introduction. Bullet embolism is a special form of embolism, where embolus is either a bullet or its fragment. Bullet penetrates through the injured part of the body into circulation and then travels to a distant part of the body, until it gets blocked in a vessel of the same diameter as the bullet. Case Outline. We are presenting a case of gunshot injury in a 26­year­old male, found unconscious on the passenger seat, with the gunshot injury of the right hand and hemithorax, who died two hours after admission to hospital. Post­mortem X­ray revealed the presence of a metallic foreign body - a bullet, in the level of the left femoral neck. The autopsy revealed entrance and exit gunshot wounds of the upper third of the right upper arm. There was a second entrance gunshot wound, and the bullet passed through the right hemithorax and the right lung, and then through the intervertebral disc between the eighth and ninth thoracic vertebrae, and also making a complete laceration of the wall of the thoracic aorta, in the right posterior semicircumference. The slightly deformed bul­ let, caliber 7.65 mm, was found embedded in the lumen of the vessel at the bifurcation of the deep femoral artery from the left femoral artery. Conclusion. Bullet embolism is a rare complication of gunshot wounds. It should be suspected in any gunshot wound victim without an exit wound, or the lack of a missile in the bullet pathway, or if there are premortem signs or symptoms unexpected for the presumed pathway of the bullet, such as distant ischemia or infection. In these cases, some of postmortem imaging techniques should be used to save time in diagnosis, treatment and at autopsy.

  8. Does Polishing a Rifle Bore Reduce Bullet Drag?

    Science.gov (United States)

    2012-01-17

    thus lower drag. A Remington 700 5R Mil-Spec chambered in 300 Winchester Magnum was used. The bullets used were a 155.5 grain Berger Fullbore Boat...drag on the bullets. 15. SUBJECT TERMS Ballistic coefficient, aerodynamic drag, rifle bore, bore polishing, Remington 700 5R 16. SECURITY...A Remington 700 5R Mil-Spec chambered in 300 Winchester Magnum was used. The bullets used were a 155.5 grain Berger Fullbore Boat Tail and a 125

  9. Destabilization and intracranial fragmentation of a full metal jacket bullet.

    Science.gov (United States)

    Farrugia, A; Raul, J S; Geraut, A; Tortel, M C; Ludes, B

    2009-10-01

    We report a case with an atypical entrance wound as a result of a destabilized full metal jacket bullet penetration. The destabilized bullet by an impact with the dorsal hand experiences a yawing to tumbling motion in flight. The large angle of yaw induces a larger presenting profile upon impact that contributes, associated to a rapid deceleration, to a greater mechanical force on the projectile structure and a fragmentation into core and jacket. Forensic pathologists have to be aware that the metal jacket bullet could tend to break up outside or inside the body particularly after a shooting through a target. This phenomenon induces atypical entrance wounds and atypical X-ray presentation.

  10. Physicomathematical Simulation Analysis for Small Bullets

    Directory of Open Access Journals (Sweden)

    D. P. Margaris

    2008-01-01

    Full Text Available A full six degrees of freedom (6-DOF flight dynamics model is proposed for the accurate prediction of short and long-range trajectories of small bullets via atmospheric flight to final impact point. The mathematical model is based on the full equations of motion set up in the no-roll body reference frame and is integrated numerically from given initial conditions at the firing site. The projectile maneuvering motion depends on the most significant force and moment variations, in addition to gravity and Magnus effect. The computational flight analysis takes into consideration the Mach number and total angle of attack effects by means of the variable aerodynamic coefficients. For the purposes of the present work, linear interpolation has been applied for aerodynamic coefficients from the official tabulated database. The developed computational method gives satisfactory agreement with published data of verified experiments and computational codes on atmospheric projectile trajectory analysis for various initial firing flight conditions.

  11. Ballistics Modeling for Non-Axisymmetric Hypervelocity Smart Bullets

    Science.gov (United States)

    2014-06-03

    rapidly spinning rifle bullet [2]. However, the Magnus moment can be important in terms of stability. The Magnus moment is the one effect we consider...is the result when the magnus moment is neglected. Although the magnus effect is small, the effect of neglecting it is discernable. The solution 19...11 2. Spin and Pitch Damping 11 3. Magnus Moment 12 IV. CFD Simulations and Ballistic Trajectories 12 A. CFD Modeling of a Standard Bullet 12 B

  12. Experimental Investigation of the Plasma Bullet and Its Applications

    Science.gov (United States)

    2012-08-01

    as well as fast photography diagnostic results that shed new light on the mechanisms of creation and propagation of the plasma bullets. We then...generates the plasma bullets. Then we presented spectroscopic as well as fast photography diagnostic results that shed new light on the mechanisms of...The fact that amyloid fibrils are the cause behind such debilitating disease as Parkinson and probably also Alzheimer’s makes these results of even

  13. Elastic collision and molecule formation of spatiotemporal light bullets in a cubic-quintic nonlinear medium

    Science.gov (United States)

    Adhikari, S. K.

    2016-09-01

    We consider the statics and dynamics of a stable, mobile three-dimensional (3D) spatiotemporal light bullet in a cubic-quintic nonlinear medium with a focusing cubic nonlinearity above a critical value and any defocusing quintic nonlinearity. The 3D light bullet can propagate with a constant velocity in any direction. Stability of the light bullet under a small perturbation is established numerically. We consider frontal collision between two light bullets with different relative velocities. At large velocities the collision is elastic with the bullets emerge after collision with practically no distortion. At small velocities two bullets coalesce to form a bullet molecule. At a small range of intermediate velocities the localized bullets could form a single entity which expands indefinitely, leading to a destruction of the bullets after collision. The present study is based on an analytic Lagrange variational approximation and a full numerical solution of the 3D nonlinear Schrödinger equation.

  14. Gunshot wounds: bullet caliber is increasing, 1998-2003.

    Science.gov (United States)

    Adibe, Obinna O; Caruso, Robert P; Swan, Kenneth G

    2004-04-01

    In 1999, Caruso reported data from the level 1 trauma center in Newark, New Jersey, documenting "...an ominous trend toward the use of larger caliber firearms in accidents, homicides and suicides." Those data were derived from measurements of bullets removed from our trauma patients and submitted to the Surgical Pathology laboratory from 1981 through 1997. We further document this trend with measurements of similar source bullets from 1998 through 2002. During the same time, we recorded mortality among gunshot wound victims treated at our trauma center. Bullets submitted to surgical pathology during the years 1998 through 2002 were measured with a millimeter rule to determine caliber or transverse diameter. A total of 367 bullets were studied in this 5-year period. Bullets deformed beyond measurability (approximately 22%) and shotgun pellets (records concerning the outcomes all victims of gunshot wounds (E 922, E 965) treated at our hospital during the years studied and expressed as percentages. Linear regression of mean bullet caliber over time was performed, and analysis of variance was used to assess statistical significance of apparent differences in mortality. Bullet caliber continued to increase from 8.47 +/- 0.22 to 9.16 +/- 0.15 mm during the 5-year observation period. Linear regression reveals R = 0.9649, P 0.20). These data support a continued trend toward the use of larger caliber firearms in accidents, homicides, and suicides. Mortality does not change during this time and presumably because of improvements in treatment, from resuscitation to definitive surgery and its convalescence.

  15. Estimating the shooting distance of a 9-mm Parabellum bullet via ballistic experiment.

    Science.gov (United States)

    Bresson, F; Franck, O

    2009-11-20

    We demonstrate here how the shooting distance of a 9-mm Parabellum FMJ bullet (115gr) has been estimated via shooting experiments. Such a bullet was found by investigators near a concrete wall, fairly distorted at its tip. The bullet carries no evidence of multiple impact and no evidence of ballistic impact on the wall has been reported. We estimated the impact velocity by comparing the questioned bullet with a set of comparison bullets hitting a wall (rigid target) with different velocities. The shooting distance was recovered from the impact velocity by studying the typical behavior of a manufactured 9 mm bullet weighting 115g (7.45g), shot in pistol or a sub-machine gun. The results demonstrated that the questioned bullet was a lost bullet. The shooting distance also helped the investigators, narrowing the range of the estimated positions of the shooter.

  16. Bullet migration from the knee to the heart after a gunshot injury: a case report

    Institute of Scientific and Technical Information of China (English)

    LU Xiao-hui; LU Zhi-jun; HU Jun; SONG Jian-xin; CHEN Shun-liang

    2011-01-01

    @@ Migration of a bullet to a distant part of the body after a gunshot is rarely observed in the clinical setting, and migration to the heart is even rarer.There are usually no clear symptoms or signs from migration of a bullet.The bullet can be easily missed and sometimes identified in a review examination.A case of bullet migration to the heart 2 months after a gunshot to the left knee was reported.

  17. EDITORIAL: Plasma jets and plasma bullets Plasma jets and plasma bullets

    Science.gov (United States)

    Kong, M. G.; Ganguly, B. N.; Hicks, R. F.

    2012-06-01

    -mentioned early studies has witnessed a considerable and exciting growth in terms of new phenomena observed, new physics and chemistry uncovered, new plasma jet sources conceived, and new applications developed. Examples include the observations of plasma bullets on a nanosecond scale [16], the similarity of plasma bullets to streamers [17], arrays of plasma jets as metamaterials [18], and a rapid increase of applications in biomedicine [19]. However the considerable growth in the research of plasma jets has not been adequately supported, so far, by a sound fundamental underpinning, partly resulting from a somewhat underdevelopment of effective diagnostics and modelling tools. Recognizing the critical importance of basic science for future growth of low-temperature plasma jet technology, this special issue on plasma jets and bullets aims to address some of the most important fundamental questions. Many of the special issue papers continue the established line of investigation to characterize the formation of plasma bullets, using typically ultrafast imaging, electrical detection including electric field and plasma conductivity measurement, and optical emission spectrometry [20]-[26]. These offer strong experimental evidence for the well-known hypothesis that a plasma jet is a form of streamer, and that the ionization wave plays a critical role in their formation. The interaction of two parallel plasma jets [27] and manipulation of plasma jet characteristics [28, 29] are also reported using a similar combination of experimental techniques. Some of the common characteristics of plasma jets are summarized in a review paper in this special issue [30]. A somewhat different line of investigation is employed in a detailed experimental characterization of deterministic chaos in atmospheric plasma jets [31], one of the few non-bullet modes of plasma jets. Although chaos in ionized gases have been observed in other types of discharge plasmas, their applications have not so far been linked

  18. An Elusive Bullet in the Gastrointestinal Tract: A Rare Case of Bullet Embolism in the Gastrointestinal Tract and a Review of Relevant Literature

    Directory of Open Access Journals (Sweden)

    Saptarshi Biswas

    2014-01-01

    Full Text Available Bullet embolism within the gastrointestinal system is extremely rare. Such bullet injuries are infrequently covered in the general literature, but the surgeon should be aware of the phenomenon. Smaller caliber bullets are more common in civilian gunshot wound (GSW events. These bullets are able to tumble through the gastrointestinal tract and cause perforation of the intestinal lumen which is small enough to be easily missed. Bullets retained in the abdominal cavity should not be dismissed as fixed and should be carefully monitored to ensure that they do not embolize within the bowel and cause occult lesions during their migration. We present a unique case wherein a bullet caused a minute perforation in the small bowel, before migrating to the distal colon, which resulted in late presentation of sepsis secondary to peritonitis.

  19. Bullet Points, New Writing, and the Marketization of Public Discourse

    DEFF Research Database (Denmark)

    van Leeuwen, Theo; Djonov, Emilia

    2014-01-01

    Bullet lists epitomize both new writing practices, which are promoted through ubiquitous software such as Microsoft's PowerPoint, and the marketization of public discourse. The argument is illustrated with an analysis of the recontextualization of the Australian Treasurer's Budget speech...

  20. Atypical gunshot wound: Bullet trajectory analyzed by computed tomography

    Directory of Open Access Journals (Sweden)

    Tae Ro

    2015-01-01

    Conclusion: If an abnormal trajectory is maintained, it is possible for a bullet to traverse half the length of the body without the patient realizing it. Accurate CT analysis and quick decisions in surgical and medical management are critical takeaways to provide quality care to patients with these injuries.

  1. Are lead-free hunting rifle bullets as effective at killing wildlife as conventional lead bullets? A comparison based on wound size and morphology

    Energy Technology Data Exchange (ETDEWEB)

    Trinogga, Anna, E-mail: anna_trinogga@gmx.de; Fritsch, Guido; Hofer, Heribert; Krone, Oliver

    2013-01-15

    Fragmentation of the lead core of conventional wildlife hunting rifle bullets causes contamination of the target with lead. The community of scavenger species which feed on carcasses or viscera discarded by hunters are regularly exposed to these lead fragments and may die by acute or chronic lead intoxication, as demonstrated for numerous species such as white-tailed eagles (Haliaeetus albicilla) where it is among the most important sources of mortality. Not only does hunting with conventional ammunition deposit lead in considerable quantities in the environment, it also significantly delays or threatens the recovery of endangered raptor populations. Although lead-free bullets might be considered a suitable alternative that addresses the source of these problems, serious reservations have been expressed as to their ability to quickly and effectively kill a hunted animal. To assess the suitability of lead-free projectiles for hunting practice, the wounding potential of conventional bullets was compared with lead-free bullets under real life hunting conditions. Wound dimensions were regarded as good markers of the projectiles' killing potential. Wound channels in 34 killed wild ungulates were evaluated using computed tomography and post-mortem macroscopical examination. Wound diameters caused by conventional bullets did not differ significantly to those created by lead-free bullets. Similarly, the size of the maximum cross-sectional area of the wound was similar for both bullet types. Injury patterns suggested that all animals died by exsanguination. This study demonstrates that lead-free bullets are equal to conventional hunting bullets in terms of killing effectiveness and thus equally meet the welfare requirements of killing wildlife as painlessly as possible. The widespread introduction and use of lead-free bullets should be encouraged as it prevents environmental contamination with a seriously toxic pollutant and contributes to the conservation of a wide

  2. Chandra measurements of non-thermal X-ray emission from massive, merging, radio-halo clusters

    CERN Document Server

    Million, E T

    2008-01-01

    We report the discovery of spatially-extended, non-thermal or hot, quasi-thermal emission components in Chandra X-ray spectra for five of a sample of seven massive, merging galaxy clusters with powerful radio halos: Abell 665, 2163, 2255, 2319, and 1E0657-56. The emission components can be fitted by power-law models with mean photon indices in the range 1.4 20 keV. A control sample of regular, dynamically relaxed clusters without radio halos but with comparable thermal temperatures and luminosities shows no evidence for similar components in their Chandra spectra. Detailed X-ray spectral mapping reveals the complex thermodynamic states of the radio halo clusters. We report the discovery of a clear, large-scale shock front in Abell 2219. Our deepest observations, of the Bullet Cluster 1E0657-56, demonstrate a spatial correlation between the strongest power law X-ray emission, highest thermal pressure, and brightest 1.34GHz radio halo emission in this cluster. The integrated flux and mean spectral index of the...

  3. Measurement of Damage Velocities in Bullet Impacts of Transparent Armor

    Science.gov (United States)

    Anderson, Charles; Bigger, Rory; Weiss, Carl

    2013-06-01

    A series of impact experiments have been conducted to examine the response of transparent material to ballistic impact. The experiments consisted of impacting 15 mm of borosilicate glass back by 9.5 mm of Lexan. The projectile was a 0.30-cal hard steel bullet designed specifically for the experiments. Residual velocities and the residual length of the bullets (which were soft-recovered in a catch box) were measured as a function of impact velocity. High-speed imaging of the impact event and post-test analysis has permitted quantification of damage propagation and the rate of propagation. The results of several experiments are presented and compared to edge-on impact experiments that have been conducted by Strassburger et al..

  4. Galaxy Clusters in the Swift/BAT era II: 10 more Clusters detected above 15 keV

    Energy Technology Data Exchange (ETDEWEB)

    Ajello, M.; /SLAC /KIPAC, Menlo Park; Rebusco, P.; /KIPAC, Menlo Park; Cappelluti, N.; /Garching, Max Planck Inst., MPE /Maryland U., Baltimore County; Reimer, O.; /SLAC /Palermo Observ.; Boehringer, H.; /Garching, Max Planck Inst., MPE; La Parola, V.; Cusumano, G.; /Palermo Observ.

    2010-10-27

    We report on the discovery of 10 additional galaxy clusters detected in the ongoing Swift/BAT all-sky survey. Among the newly BAT-discovered clusters there are: Bullet, Abell 85, Norma, and PKS 0745-19. Norma is the only cluster, among those presented here, which is resolved by BAT. For all the clusters we perform a detailed spectral analysis using XMM-Newton and Swift/BAT data to investigate the presence of a hard (non-thermal) X-ray excess. We find that in most cases the clusters emission in the 0.3-200 keV band can be explained by a multi-temperature thermal model confirming our previous results. For two clusters (Bullet and Abell 3667) we find evidence for the presence of a hard X-ray excess. In the case of the Bullet cluster, our analysis confirms the presence of a non-thermal, power-law like, component with a 20-100 keV flux of 3.4 x 10{sup -12} erg cm{sup -2} s{sup -1} as detected in previous studies. For Abell 3667 the excess emission can be successfully modeled as a hot component (kT = {approx}13 keV). We thus conclude that the hard X-ray emission from galaxy clusters (except the Bullet) has most likely thermal origin.

  5. Janus "nano-bullets" for magnetic targeting liver cancer chemotherapy.

    Science.gov (United States)

    Shao, Dan; Li, Jing; Zheng, Xiao; Pan, Yue; Wang, Zheng; Zhang, Ming; Chen, Qi-Xian; Dong, Wen-Fei; Chen, Li

    2016-09-01

    Tumor-targeted delivery of anti-cancer drugs with controlled drug release function has been recognized as a promising strategy for pursuit of increased chemotherapeutic efficacy and reduced adverse effects. Development of magnetic nanoparticulates as delivery carriers to accommodate cytotoxic drugs for liver cancer treatment has evoked immense interest with respect to their convenience in biomedical application. Herein, we engineered multifunctional Janus nanocomposites, characterized by a head of magnetic Fe3O4 and a body of mesoporous SiO2 containing doxorubicin (DOX) as "nano-bullets" (M-MSNs-DOX). This nanodrug formulation possessed nanosize with controlled aspect-ratio, defined abundance in pore structures, and superior magnetic properties. M-MSN-DOX was determined to induce selective growth inhibition to the cancer cell under magnetic field rather than human normal cells due to its preferable endocytosis by the tumor cells and pH-promoted DOX release in the interior of cancer cells. Ultimately, both subcutaneous and orthotropic liver tumor models in mice have demonstrated that the proposed Janus nano-bullets imposed remarkable suppression of the tumor growth and significantly reduced systematic toxicity. Taken together, this study demonstrates an intriguing targeting strategy for liver cancer treatment based on a novel Janus nano-bullet, aiming for utilization of nanotechnology to obtain safe and efficient treatment of liver cancer.

  6. Explosion Production of Fullerenes from Carbonaceous Bullet in Vacuum Using Rail Gun

    Science.gov (United States)

    Mieno, Tetsu; Yamori, Akira

    2006-04-01

    A carbonaceous bullet is accelerated using a rail gun in vacuum and collides with a metal or carbon target at a speed of approximately 6 km/s, at which the bullet explodes and the high-temperature reaction of carbon particles takes place. As a result, C60 and higher fullerenes are produced. Using a carbonaceous bullet containing metal-oxide powder, endohedral metallofullerenes are also produced by this method.

  7. A Stability Formula for Plastic-Tipped Bullets Part 2: Experimental Testing

    CERN Document Server

    Courtney, Michael W

    2014-01-01

    Part 1 of this paper describes a modification of the original Miller twist rule for computing gyroscopic bullet stability that is better suited to plastic-tipped bullets. The original Miller twist rule assumes a bullet of constant density, but it also works well for conventional copper (or gilding metal) jacketed lead bullets because the density of copper and lead are sufficiently close. However, the original Miller twist rule significantly underestimates the gyroscopic stability of plastic-tipped bullets, because the density of plastic is much lower than the density of copper and lead. Here, a new amended formula is developed for the gyroscopic stability of plastic-tipped bullets by substituting the length of just the metal portion for the total length in the (1 + L2) term of the original Miller twist rule. Part 2 describes experimental testing of this new formula on three plastic-tipped bullets. The new formula is relatively accurate for plastic-tipped bullets whose metal portion has nearly uniform density,...

  8. A Stability Formula for Plastic-Tipped Bullets Part 1: Motivation and Development of New Formula

    CERN Document Server

    Courtney, Michael W

    2014-01-01

    Part 1 of this paper describes a modification of the original Miller twist rule for computing gyroscopic bullet stability that is better suited to plastic-tipped bullets. The original Miller twist rule assumes a bullet of constant density, but it also works well for conventional copper (or gilding metal) jacketed lead bullets because the density of copper and lead are sufficiently close. However, the original Miller twist rule significantly underestimates the gyroscopic stability of plastic-tipped bullets, because the density of plastic is much lower than the density of copper and lead. Here, a new amended formula is developed for the gyroscopic stability of plastic-tipped bullets by substituting the length of just the metal portion for the total length in the $(1 + L^2)$ term of the original Miller twist rule. Part 2 describes experimental testing of this new formula on three plastic-tipped bullets. The new formula is relatively accurate for plastic-tipped bullets whose metal portion has nearly uniform densi...

  9. The density and velocity of plasma bullets propagating along one dielectric tube

    Directory of Open Access Journals (Sweden)

    Longfei Ji

    2015-08-01

    Full Text Available This study shows that the propagation of plasma bullets along one dielectric tube is strongly affected by many discharge parameters, such as the waveform of applied voltage (AC or pulsed DC, peak voltage, He flow rate, and the frequency of AC voltage. Analysis indicates that the density and velocity of plasma bullets are mainly determined by the electric field at the front of plasma bullets. These discharge parameters may significantly influence the distribution of plasma potential along the tube, thus control the electric field at the front of plasma bullets and their propagation. An increase in the pulsed DC voltage with its rise time of <40-50 ns can lead to an obvious improvement in the electric field at the front of plasma bullets, resulting in generation of a plasma in the high density gas and a fast propagation of plasma bullets. He flowing through the tube can contribute to the surface diffusion of charged species, and greatly increase the electric field at the front of plasma bullets. During the propagation of plasma bullets, their density is decreased due to the surface recombination of charged species, such as electrons and ions.

  10. Firearm bullet settling into the lumbar spinal canal without causing neurological deficit: A report of two cases

    Directory of Open Access Journals (Sweden)

    Tayfun Hakan

    2016-01-01

    Conclusion: Bullet settling into the lumbar spinal canal without causing neurological deficit may require surgical intervention. Removal of bullets provided not only pain relief in both the cases but also prevented future complications such as migration of the bullets, plumbism, and neuropathic pain and instability.

  11. Learning game physics with Bullet Physics and OpenGL

    CERN Document Server

    Dickinson, Chris

    2013-01-01

    A comprehensive set of straight-forward, easy-to-follow tutorials in OpenGL and Bullet Physics that will teach you how modern game physics and 3D graphics work.If you're a beginner or intermediate programmer with a basic understanding of 3D mathematics, and you want a stronger foundation in 3D graphics and physics, then this book is perfect for you! You'll even learn some of the fundamental concepts in 3D mathematics and software design that lies beneath them both, discovering some techniques and tricks in graphics and physics that you can use in any game development project.

  12. Visible supercontinuum radiation of light bullets in the femtosecond filamentation of IR pulses in fused silica

    Science.gov (United States)

    Chekalin, S. V.; Kompanets, V. O.; Dokukina, A. E.; Dormidonov, A. E.; Smetanina, E. O.; Kandidov, V. P.

    2015-05-01

    We report experimental and theoretical investigations of visible supercontinuum generation in the formation of light bullets in a filament produced by IR pulses. In the filamentation of a 1700 - 2200 nm pulse in fused silica, bright tracks are recorded resulting from the recombination glow of carriers in the laser plasma produced by a sequence of light bullets and from the scattering in silica of the visible supercontinuum generated by the light bullets. It is found that the formation of a light bullet is attended with an outburst of a certain portion of supercontinuum energy in the visible range. The energy outburst is the same for all bullets in the sequence and becomes smaller with increasing pulse wavelength.

  13. Evolution of live training by the implementation of an electronic bullet

    Science.gov (United States)

    Fisher, David; Mann, John; Sherrill, Todd; Kraus, Matt; Lyons, Jeff; York, Allen

    2007-04-01

    In live force-on-force direct fire training, simulated munitions are used instead of live munitions. Simulated munitions are typically modeled using laser systems such as the Multiple Integrated Laser Engagement System (MILES). Replacing the laser with an electronic message (also known as an electronic bullet or e-bullet) sent over a network is becoming feasible due to advances in sensors, communications, and computing. The e-bullet engagement methodology uses weapon location, orientation, and adjudication algorithms. Technical challenges in implementation include having accurate weapon and target location and orientation, network bandwidth, and terrain database resolution. This paper discusses issues and challenges using an e-bullet and laser/e-bullet hybrids for delivery accuracy and damage assessment. We will also present an engagement methodology robust enough to evolve with advances in technology.

  14. Cluster-cluster clustering

    Science.gov (United States)

    Barnes, J.; Dekel, A.; Efstathiou, G.; Frenk, C. S.

    1985-01-01

    The cluster correlation function xi sub c(r) is compared with the particle correlation function, xi(r) in cosmological N-body simulations with a wide range of initial conditions. The experiments include scale-free initial conditions, pancake models with a coherence length in the initial density field, and hybrid models. Three N-body techniques and two cluster-finding algorithms are used. In scale-free models with white noise initial conditions, xi sub c and xi are essentially identical. In scale-free models with more power on large scales, it is found that the amplitude of xi sub c increases with cluster richness; in this case the clusters give a biased estimate of the particle correlations. In the pancake and hybrid models (with n = 0 or 1), xi sub c is steeper than xi, but the cluster correlation length exceeds that of the points by less than a factor of 2, independent of cluster richness. Thus the high amplitude of xi sub c found in studies of rich clusters of galaxies is inconsistent with white noise and pancake models and may indicate a primordial fluctuation spectrum with substantial power on large scales.

  15. Cluster-cluster clustering

    Energy Technology Data Exchange (ETDEWEB)

    Barnes, J.; Dekel, A.; Efstathiou, G.; Frenk, C.S.

    1985-08-01

    The cluster correlation function xi sub c(r) is compared with the particle correlation function, xi(r) in cosmological N-body simulations with a wide range of initial conditions. The experiments include scale-free initial conditions, pancake models with a coherence length in the initial density field, and hybrid models. Three N-body techniques and two cluster-finding algorithms are used. In scale-free models with white noise initial conditions, xi sub c and xi are essentially identical. In scale-free models with more power on large scales, it is found that the amplitude of xi sub c increases with cluster richness; in this case the clusters give a biased estimate of the particle correlations. In the pancake and hybrid models (with n = 0 or 1), xi sub c is steeper than xi, but the cluster correlation length exceeds that of the points by less than a factor of 2, independent of cluster richness. Thus the high amplitude of xi sub c found in studies of rich clusters of galaxies is inconsistent with white noise and pancake models and may indicate a primordial fluctuation spectrum with substantial power on large scales. 30 references.

  16. The Ballistic Pressure Wave Theory of Handgun Bullet Incapacitation

    CERN Document Server

    Courtney, Michael

    2008-01-01

    This paper presents a summary of seven distinct chains of evidence, which, taken together, provide compelling support for the theory that a ballistic pressure wave radiating outward from the penetrating projectile can contribute to wounding and incapacitating effects of handgun bullets. These chains of evidence include the fluid percussion model of traumatic brain injury, observations of remote ballistic pressure wave injury in animal models, observations of rapid incapacitation highly correlated with pressure magnitude in animal models, epidemiological data from human shootings showing that the probability of incapacitation increases with peak pressure magnitude, case studies in humans showing remote pressure wave damage in the brain and spinal cord, and observations of blast waves causing remote brain injury.

  17. Type Ia Supernova Remnants: Shaping by Iron Bullets

    CERN Document Server

    Tsebrenko, Danny

    2015-01-01

    Using 2D numerical hydrodynamical simulations of type Ia supernova remnants (SNR Ia) we show that iron clumps few times denser than the rest of the SN ejecta might form protrusions in an otherwise spherical SNR. Such protrusions exist in some SNR Ia, e.g., SNR 1885 and Tycho. Iron clumps are expected to form in the deflagration to detonation explosion model. In SNR Ia where there are two opposite protrusions, termed ears, such as Kepler's SNR and SNR G1.9+0.3, our scenario implies that the dense clumps, or iron bullets, were formed along an axis. Such a preferred axis can result from a rotating white dwarf progenitor. If our claim holds, this offers an important clue to the SN Ia explosion scenario.

  18. Does the prior application of the field kit bullet hole testing kit 3 on a suspected bullet hole bias the analysis of atomic absorption spectrophotometry?

    Science.gov (United States)

    Seltenhammer, Monika H; Fitzl, Christine; Wieser, Ingo; Binder, Reinhard; Paula, Pia; Risser, Daniele U

    2014-09-01

    Forensic ballistics is the study of bullet trajectory and consists of determining gunshot residue (GSR) to identify bullet holes. Among several highly sensitive methods, atomic absorption spectrophotometry (AAS) is employed to analyze GSR in the laboratory. However, it is sometimes necessary to identify bullet holes immediately at a crime scene. The purpose of this examination was to determine whether the use of the field test Bullet Hole Testing Kit 3 (BTK3) on a suspected bullet hole would influence the outcome of AAS-analysis: Three commonly encountered firearms (Glock17, Tokarev, and Colt) were fired at skin, wood, and cloth. AAS-analysis was performed with and without previous BTK3 application. The results clearly indicate that there is no significant interaction on the grounds of BTK3 use (BTK3 vs. no-BTK3 [kit_nokit] [Pb: p = 0.1309; Sb: p = 0.9111], material*kit_nokit [Pb: p = 0.5960; Sb: p = 0.9930], distance*kit_nokit [Pb: p = 0.4014; Sb: p = 0.9184], and firearm type*kit_nokit [Pb: p = 0.9662; Sb: p = 0.9885]); hence, applying this field kit does not falsify later AAS outcomes.

  19. Effects of human decomposition on test fired bullet – An experimental research

    Directory of Open Access Journals (Sweden)

    Dinesh Rao

    2016-03-01

    The observations through comparison microscope indicated that the individual characteristic (microscopic markings on the bullet in the form of microstriae showed complete corrosion or obscuring by the 10th day. The surface appeared smooth, onset of corrosion process was noted on the 2nd day and by the 4th day 50% obscuring of the marks was noted. This change in the markings of the metal surface of the bullet was uniform to all the ammunitions used in this study. The control bullets showed no such changes during the period of study. The study confirms the existence of a potential danger in dealing with crime bullets retrieved from putrefied bodies. It also highlights the importance of early retrieval of dead bodies in firearm deaths and the importance of proper storage facilities to deal with cases of firearm deaths.

  20. Pure air-plasma bullets propagating inside microcapillaries and in ambient air

    KAUST Repository

    Lacoste, Deanna

    2014-11-04

    This paper reports on the characterization of air-plasma bullets in microcapillary tubes and in ambient air, obtained without the use of inert or noble gases. The bullets were produced by nanosecond repetitively pulsed discharges, applied in a dielectric barrier discharge configuration. The anode was a tungsten wire with a diameter of 50 μm, centered in the microcapillary, while the cathode was a silver ring, fixed on the outer surface of the fused silica tube. The effects of the applied voltage and the inner diameter of the microcapillary tube on the plasma behavior were investigated. Inside the tubes, while the topology of the bullets seems to be strongly dependent on the diameter, their velocity is only a function of the amplitude of the applied voltage. In ambient air, the propagation of air bullets with a velocity of about 1.25 ×105 m s-1 is observed.

  1. Pure air-plasma bullets propagating inside microcapillaries and in ambient air

    Science.gov (United States)

    Lacoste, Deanna A.; Bourdon, Anne; Kuribara, Koichi; Urabe, Keiichiro; Stauss, Sven; Terashima, Kazuo

    2014-12-01

    This paper reports on the characterization of air-plasma bullets in microcapillary tubes and in ambient air, obtained without the use of inert or noble gases. The bullets were produced by nanosecond repetitively pulsed discharges, applied in a dielectric barrier discharge configuration. The anode was a tungsten wire with a diameter of 50 µm, centered in the microcapillary, while the cathode was a silver ring, fixed on the outer surface of the fused silica tube. The effects of the applied voltage and the inner diameter of the microcapillary tube on the plasma behavior were investigated. Inside the tubes, while the topology of the bullets seems to be strongly dependent on the diameter, their velocity is only a function of the amplitude of the applied voltage. In ambient air, the propagation of air bullets with a velocity of about 1.25 × 105 m s-1 is observed.

  2. THE SHAPING OF THE MULTIPOLAR PRE-PLANETARY NEBULA CRL 618 BY MULTIDIRECTIONAL BULLETS

    Energy Technology Data Exchange (ETDEWEB)

    Huang, Po-Sheng; Lee, Chin-Fei; Moraghan, Anthony [Academia Sinica Institute of Astronomy and Astrophysics, P.O. Box 23-141, Taipei 106, Taiwan (China); Smith, Michael, E-mail: posheng@asiaa.sinica.edu.tw [Centre for Astrophysics and Space Science, University of Kent, Canterbury CT2 7NH (United Kingdom)

    2016-04-01

    In order to understand the formation of the multipolar structures of the pre-planetary nebula CRL 618, we perform 3D simulations using a multidirectional bullet model. The optical lobes of CRL 618 and fast molecular outflows at the tips of the lobes have been found to have similar expansion ages of ∼100 yr. Additional fast molecular outflows were found near the source along the outflow axes with ages of ∼45 yr, suggesting a second episode of bullet ejections. Thus, in our simulations, two episodes of bullet ejections are assumed. The shaping process is simulated using the ZEUS-3D hydrodynamics code that includes molecular and atomic cooling. In addition, molecular chemistry is also included to calculate the CO intensity maps. Our results show the following: (1) Multiepoch bullets interacting with the toroidal dense core can produce the collimated multiple lobes as seen in CRL 618. The total mass of the bullets is ∼0.034 M{sub ⊙}, consistent with the observed high-velocity (HV) CO emission in fast molecular outflows. (2) The simulated CO J = 3–2 intensity maps show that the low-velocity cavity wall and the HV outflows along the lobes are reasonably consistent with the observations. The position–velocity diagram of the outflows along the outflow axes shows a linear increase of velocity with distance, similar to the observations. The ejections of these bullets could be due to magnetorotational explosions or nova-like explosions around a binary companion.

  3. Comparing Terminal Performance of .357 SIG and 9mm Bullets in Ballistic Gelatin Using Retarding Force Analysis from High Speed Video

    CERN Document Server

    Keys, Elizabeth; Courtney, Michael

    2015-01-01

    High-speed video has emerged as an valuable tool for quantifying bullet performance in ballistic gelatin. This paper presents the results of testing four .357 SIG bullets using high-speed video of bullet impacts in ballistic gelatin to determine retarding force curves, permanent cavities, temporary cavities, and energy deposit vs. penetration depth. Since the methods are identical, results are meaningfully compared with four 9mm NATO bullets studied in an earlier project. Though .357 SIG bullets perform slightly better due to higher impact energy, the principal finding is that there is a much bigger difference in performance between the best and worst performing bullets in each cartridge than there is between bullets of similar design in the two cartridges. In each cartridge, higher performing expanding bullets (jacketed hollow points) outperform non-expanding bullets (full metal jacket) by a wide margin, showing a much higher probability of rapid incapacitation according to an Army Research Laboratory model ...

  4. Galaxy Clusters in the Swift/BAT era II: 10 more Clusters detected above 15 keV

    CERN Document Server

    Ajello, M; Cappelluti, N; Reimer, O; Boehringer, H; La Parola, V; Cusumano, G

    2010-01-01

    We report on the discovery of 10 additional galaxy clusters detected in the ongoing Swift/BAT all-sky survey. Among the newly BAT-discovered clusters there are: Bullet, Abell 85, Norma, and PKS 0745-19. Norma is the only cluster, among those presented here, which is resolved by BAT. For all the clusters we perform a detailed spectral analysis using XMM-Newton and Swift/BAT data to investigate the presence of a hard (non-thermal) X-ray excess. We find that in most cases the clusters' emission in the 0.3-200keV band can be explained by a multi-temperature thermal model confirming our previous results. For two clusters (Bullet and Abell 3667) we find evidence for the presence of a hard X-ray excess. In the case of the Bullet cluster, our analysis confirms the presence of a non-thermal, power-law like, component with a 20-100 keV flux of 3.4 \\times 10-12 erg cm-2 s-1 as detected in previous studies. For Abell 3667 the excess emission can be successfully modeled as a hot component (kT=~13keV). We thus conclude tha...

  5. Quantitative/Statistical Approach to Bullet-to-Firearm Identification with Consecutively Manufactured Barrels

    Energy Technology Data Exchange (ETDEWEB)

    Peter Striupaitis; R.E. Gaensslen

    2005-01-30

    Efforts to use objective image comparison and bullet scanning technologies to distinguish bullets from consecutively manufactured handgun barrels from two manufacturers gave mixed results. The ability of a technology to reliably distinguish between matching and non-matching bullets, where the non-matching bullets were as close in pattern to the matching ones as is probably possible, would provide evidence that the distinctions could be made ''objectively'', and independently of human eyes. That evidence is identical or very close to what seems to be needed to satisfy Daubert standards. It is fair to say that the FTI IBIS image comparison technology correctly distinguished between all the Springfield barrel bullets, and between most but not all of the HiPoint barrel bullets. In the HiPoint cases that were not distinguished 100% of the time, they would he distinguished correctly at least 83% of the time. These results, although obviously limited to the materials used in the comparisons, provide strong evidence that barrel-to-bullet matching is objectively reliable. The results with SciClops were less compelling. The results do not mean that bullet-to-barrel matching is not objectively reliable--rather, they mean that this version of the particular technology could not quite distinguish between these extremely similar yet different bullets as well as the image comparison technology did. In a number of cases, the numerical results made the correct distinctions, although they were close to one another. It is hard to say from this data that this technology differs in its ability to make distinctions between the manufacturers, because the results are very similar with both. The human examiner results were as expected. We did not expect any misidentifications, and there were not any. It would have been preferable to have a higher return rate, and thus more comparisons in the overall sample. As noted, the ''consecutively manufactured barrel

  6. China's bullet trains facilitate market integration and mitigate the cost of megacity growth.

    Science.gov (United States)

    Zheng, Siqi; Kahn, Matthew E

    2013-04-02

    Megacity growth in the developing world is fueled by a desire to access their large local labor markets. Growing megacities suffer from high levels of traffic congestion and pollution, which degrade local quality of life. Transportation technology that allows individuals to access the megacity without living within its boundaries offers potentially large social benefits, because individuals can enjoy the benefits of urban agglomeration while not paying megacity real estate rents and suffering from the city's social costs. This paper presents evidence supporting the claim that China's bullet trains are playing this role. The bullet train is regarded as one of the most significant technological breakthroughs in passenger transportation developed in the second half of the 20th century. Starting in 2007, China has introduced several new bullet trains that connect megacities such as Beijing, Shanghai, and Guangzhou with nearby cities. Through facilitating market integration, bullet trains will stimulate the development of second- and third-tier cities. By offering households and firms a larger menu of location alternatives, bullet trains help to protect the quality of life of the growing urban population. We document that this transport innovation is associated with rising real estate prices in the nearby secondary cities.

  7. Proper Assessment of the JFK Assassination Bullet Lead Evidence from Metallurgical and Statistical Perspectives

    Energy Technology Data Exchange (ETDEWEB)

    Randich, E; Grant, P M

    2006-08-29

    The bullet evidence in the JFK assassination investigation was reexamined from metallurgical and statistical standpoints. The questioned specimens are comprised of soft lead, possibly from full-metal-jacketed Mannlicher-Carcano, 6.5-mm ammunition. During lead refining, contaminant elements are removed to specified levels for a desired alloy or composition. Microsegregation of trace and minor elements during lead casting and processing can account for the experimental variabilities measured in various evidentiary and comparison samples by laboratory analysts. Thus, elevated concentrations of antimony and copper at crystallographic grain boundaries, the widely varying sizes of grains in Mannlicher-Carcano bullet lead, and the 5-60 mg bullet samples analyzed for assassination intelligence effectively resulted in operational sampling error for the analyses. This deficiency was not considered in the original data interpretation and resulted in an invalid conclusion in favor of the single-bullet theory of the assassination. Alternate statistical calculations, based on the historic analytical data, incorporating weighted averaging and propagation of experimental uncertainties also considerably weaken support for the single-bullet theory. In effect, this assessment of the material composition of the lead specimens from the assassination concludes that the extant evidence is consistent with any number between two and five rounds fired in Dealey Plaza during the shooting.

  8. Ultraslow Helical Optical Bullets and Their Acceleration in Magneto-Optically Controlled Coherent Atomic Media

    CERN Document Server

    Hang, Chao

    2014-01-01

    We propose a scheme to produce ultraslow (3+1)-dimensional helical optical solitons, alias helical optical bullets, in a resonant three-level $\\Lambda$-type atomic system via quantum coherence. We show that, due to the effect of electromagnetically induced transparency, the helical optical bullets can propagate with an ultraslow velocity up to $10^{-5}$ $c$ ($c$ is the light speed in vacuum) in longitudinal direction and a slow rotational motion (with velocity $10^{-7}$ $c$) in transverse directions. The generation power of such optical bullets can be lowered to microwatt, and their stability can be achieved by using a Bessel optical lattice potential formed by a far-detuned laser field. We also show that the transverse rotational motion of the optical bullets can be accelerated by applying a time-dependent Stern-Gerlach magnetic field. Because of the untraslow velocity in the longitudinal direction, a significant acceleration of the rotational motion of optical bullets may be observed for a very short medium...

  9. Proper assessment of the JFK assassination bullet lead evidence from metallurgical and statistical perspectives.

    Science.gov (United States)

    Randich, Erik; Grant, Patrick M

    2006-07-01

    The bullet evidence in the JFK assassination investigation was reexamined from metallurgical and statistical standpoints. The questioned specimens are comprised of soft lead, possibly from full-metal-jacketed Mannlicher-Carcano (MC), 6.5-mm ammunition. During lead refining, contaminant elements are removed to specified levels for a desired alloy or composition. Microsegregation of trace and minor elements during lead casting and processing can account for the experimental variabilities measured in various evidentiary and comparison samples by laboratory analysts. Thus, elevated concentrations of antimony and copper at crystallographic grain boundaries, the widely varying sizes of grains in MC bullet lead, and the 5-60 mg bullet samples analyzed for assassination intelligence effectively resulted in operational sampling error for the analyses. This deficiency was not considered in the original data interpretation and resulted in an invalid conclusion in favor of the single-bullet theory of the assassination. Alternate statistical calculations, based on the historic analytical data, incorporating weighted averaging and propagation of experimental uncertainties also considerably weaken support for the single-bullet theory. In effect, this assessment of the material composition of the lead specimens from the assassination concludes that the extant evidence is consistent with any number between two and five rounds fired in Dealey Plaza during the shooting.

  10. Pain from a Bullet Lingers on: An Uncommon Case of Lead Toxicity

    Directory of Open Access Journals (Sweden)

    Albin Abraham

    2012-05-01

    Full Text Available Lead toxicity from a retained bullet as a cause for abdominal pain is rarely considered. Given its unpredictable latent period and nonspecific clinical symptoms, such cases are difficult to diagnose but may be fatal if unrecognized. We present the case of a 48-year-old man who presented with complaints of abdominal pain, weight loss and constipation. His past history was significant for a gunshot wound to the left hip about 20 years before. Radiographic studies confirmed the same with the presence of numerous intra-articular bullet fragments and a calcified hemarthrosis surrounding the left femoral head. Blood lead levels were elevated following which the patient was started on chelation therapy with succimer which resulted in symptomatic improvement. The aim of this paper is to highlight the importance of considering lead toxicity from a retained bullet as a cause of abdominal pain and to review the relevant literature.

  11. A bullet fired in dry water: an investigative activity to learn hydrodynamics concepts

    Science.gov (United States)

    Azevedo Leitão, Ulisses; dos Anjos Pinheiro da Silva, Antonio; Trindade do Nascimento, Natália Cristina; Mara Benedita da Cruz Gervásio, Lilian

    2017-01-01

    In this paper we report an investigative activity on hydrodynamics, in the context of an inquiry-based learning project. The aim is to analyse the experiment of a bullet shot underwater. Using Tracker, a video analysing and modelling software, the displacement of the bullet was measured as function of time, processing a slow motion video from YouTube. It was found that the displacement of the bullet is well described in the first 20 ms by the inviscid flow regime, where the Newtonian drag force overcomes the viscous drag. This behaviour is discussed in the context of what Richard Feynman’s famous Lectures on Physics describes as ‘The Flow of Dry Water’.

  12. Regular "Breathing" of Single-Cycle Light Bullets in Mid-IR Filament

    CERN Document Server

    Chekalin, S V; Kuznetzov, A V; Dormidonov, A E; Shlenov, S A; Kandidov, V P

    2015-01-01

    Experimental and numerical studies of a temporal evolution of a light bullet formed in isotropic LiF by Mid IR femtosecond pulse (2500 to 3250 nm) of power, slightly exceeding the critical power for self-focusing, are presented. For the first time regular oscillations of the light bullet intensity during its propagation in a filament were registered by investigation of induced color centers in LiF. It was revealed that color centers in a single laser pulse filament have a strictly periodic structure with a length of separate sections about 30 mcm, which increases with a laser pulse wavelength decreasing. It was shown that the origin of light bullet modulation is a periodical change of the light field amplitude of an extremely compressed single cycle wave packet in a filament, due to the difference of the wave packet group velocity and the carrier wave phase velocity.

  13. Gunshot Wound in Lumbar Spine with Intradural Location of a Bullet

    Directory of Open Access Journals (Sweden)

    G. Bordon

    2014-01-01

    Full Text Available The presence of a migratory bullet in the spinal canal after a gunshot injury is a rare finding, specially without causing permanent neurologic damage. We present the case of a patient who suffered a gunshot wound with an entry point in the posterior arc of L2-L3 and a migratory bullet detected at the level of L5-S1 in the CT scan. The patient complained about intense headache, dizziness, and variable sensitive impairment in lower legs apparently depending on the patient’s position in bed. We decided to remove the bullet in order to prevent the delayed neurological damage and lead toxicity. We discuss technical details of this surgery.

  14. Galaxy Cluster Bulk Flows and Collision Velocities in QUMOND

    CERN Document Server

    Katz, Harley; Teuben, Peter; Angus, G W

    2013-01-01

    We examine the formation of clusters of galaxies in numerical simulations of a QUMOND cosmogony with massive sterile neutrinos. Clusters formed in these exploratory simulations develop higher velocities than those found in {\\Lambda}CDM simulations. The bulk motions of clusters attain about 1000 km/s by low redshift, comparable to observations whereas {\\Lambda}CDM simulated clusters tend to fall short. Similarly, high pairwise velocities are common in cluster-cluster collisions like the Bullet cluster. There is also a propensity for the most massive clusters to be larger in QUMOND and to appear earlier than in {\\Lambda}CDM, potentially providing an explanation for 'pink elephants' like El Gordo. However, it is not obvious that the cluster mass function can be recovered.

  15. GALAXY CLUSTER BULK FLOWS AND COLLISION VELOCITIES IN QUMOND

    Energy Technology Data Exchange (ETDEWEB)

    Katz, Harley; McGaugh, Stacy; Teuben, Peter [Department of Astronomy, University of Maryland, College Park, MD 20742 (United States); Angus, G. W., E-mail: hkatz@astro.umd.edu, E-mail: stacy.mcgaugh@case.edu, E-mail: teuben@astro.umd.edu, E-mail: angus.gz@gmail.com [Astrophysics, Cosmology and Gravity Centre, University of Cape Town, Private Bag X3, Rondebosch 7700 (South Africa)

    2013-07-20

    We examine the formation of clusters of galaxies in numerical simulations of a QUMOND cosmogony with massive sterile neutrinos. Clusters formed in these exploratory simulations develop higher velocities than those found in {Lambda}CDM simulations. The bulk motions of clusters attain {approx}1000 km s{sup -1} by low redshift, comparable to observations whereas {Lambda}CDM simulated clusters tend to fall short. Similarly, high pairwise velocities are common in cluster-cluster collisions like the Bullet Cluster. There is also a propensity for the most massive clusters to be larger in QUMOND and to appear earlier than in {Lambda}CDM, potentially providing an explanation for ''pink elephants'' like El Gordo. However, it is not obvious that the cluster mass function can be recovered.

  16. A Rare Case of a Gunshot Injury: No Urinary Symptoms with a Voided Bullet

    Directory of Open Access Journals (Sweden)

    Yasin Ceylan

    2016-06-01

    Full Text Available Gunshot injuries to the abdominal cavity are cases of emergency which can be life-threatening depending on the organ/s affected. High-velocity penetrating injuries can cause both a penetrating injury to the organs on its’ route or can cause blast injury nearby. In most of the cases, the bullet can be found and the defect can be repaired intraoperatively. Here, we present a rare case of a patient with an intrabdominal penetrating gunshot wound with no organ injury, including the bladder, who voided the bullet spontaneously 30 days after the injury.

  17. Characteristics of behind armor blunt trauma produced by bullets with different structural materials: an experimental study

    Directory of Open Access Journals (Sweden)

    Ling-qing WANG

    2013-07-01

    Full Text Available Objective To investigate the effect of structural materials of bullets on behind armor blunt trauma (BABT. Methods Ten healthy male Landraces were randomly divided into two groups (5 each: 56 type 7.62-mm rifle bullet group and SS109 5.56-mm rifle bullet group. The kinetic energy of two types of bullets was adjusted to the same level (about 1880J by the way of grow downwards gunpowder. Then the animals as protected with both grade NIJ Ⅲ ceramic hard armor and grade Ⅱ police soft body armor, were shot at the left midclavicular line of fourth intercostal space (shooting distance was 25m. The damage to the animals was observed. Other 2 healthy male Landraces were selected, and biomechanical sensor was subcutaneously implanted into the soft tissue in precordium and intracalvarium to detect the pressure at the time point of bullet contact under the protection of armor, and the relationship between pressure and damage was analyzed. Results Respiration, heart rate and systolic arterial pressure of animals in two groups were all elevated after injury, but there was no significant difference between the two groups. No obvious change was found on blood oxygen saturation of both groups. Gross anatomy showed the predominant local injury was cardiac and pulmonary contusions. The area of pulmonary hemorrhage of 7.62mm group was 6.00%±3.18%, significantly higher than that of 5.56mm group (3.59%±2.11%, P<0.05. Histopathological examination revealed acute injuries of lung tissues, myocardial tissue and cerebral cortical neurons. The contents of cardiac troponin T (TnT, creatine kinase (CK and creatine kinase-MB (CK-MB isoenzyme were all increased 3 hours after injury, and the rise was higher in 7.62mm group than in 5.56mm group (P<0.05. Biomechanical testing showed the pressure of precordium and intracalvarium was elevated at the moment of bullet contact, and the rise was higher in 7.62mm group than in 5.56mm group (P<0.05. Conclusions

  18. Full-Scale Schlieren Imaging of Firearms Discharge and Bullets in Flight

    Science.gov (United States)

    Grumstrup, Torben; Settles, Gary; Dodson-Dreibelbis, Lori

    2003-11-01

    A lens-and-grid-type schlieren system using a very large grid as a light source, thus having a 2x3m field-of-view, was described at previous APS/DFD meetings. The implementation of high-speed still imaging and cinematography of shock waves with this system has also been described. Schlieren methods and external ballistics have been closely related since Mach and Salcher first photographed shock waves about a bullet in 1887. The reason to revisit the topic here is that a large field of view allows imaging not only of the bullet and muzzle blast, but also of shock wave interactions with the surroundings and with the person firing the gun. Microsecond still images reveal various stages of these phenomena for both transonic and supersonic (pistol and rifle) bullets. High-speed movies at 30,000 frames/s are also presented. Some implications of these results for hearing protection while using firearms, the improvement of gun and ammunition design and safety, and forensic investigations of close-range bullet wounds are discussed.

  19. Science Fair Projects. LC Science Tracer Bullet. TB 07-6

    Science.gov (United States)

    Howland, Joyce, Comp.

    2007-01-01

    Selected sources in this bibliography provide guidance to students, parents, and teachers throughout the process of planning, developing, implementing and competing in science fair activities. Sources range in suitability from elementary to high school levels. This guide updates "Library of Congress Science Tracer Bullet" 01-4. More specialized…

  20. Use of a metal detector in the search for bullets during autopsy.

    Science.gov (United States)

    Turletti, M; Tappero, P

    1993-12-01

    The paper reports the results obtained from the use of a CEIA PD 140 S metal detector to search for bullets during the course of medicolegal tests. The instrument was found to be of value in identifying their presence up to a distance of 5-7.5 cm from the sensitive detection area.

  1. Nonlinear dynamics of high-power ultrashort laser pulses: exaflop computations on a laboratory computer station and subcycle light bullets

    Science.gov (United States)

    Voronin, A. A.; Zheltikov, A. M.

    2016-09-01

    The propagation of high-power ultrashort light pulses involves intricate nonlinear spatio-temporal dynamics where various spectral-temporal field transformation effects are strongly coupled to the beam dynamics, which, in turn, varies from the leading to the trailing edge of the pulse. Analysis of this nonlinear dynamics, accompanied by spatial instabilities, beam breakup into multiple filaments, and unique phenomena leading to the generation of extremely short optical field waveforms, is equivalent in its computational complexity to a simulation of the time evolution of a few billion-dimensional physical system. Such an analysis requires exaflops of computational operations and is usually performed on high-performance supercomputers. Here, we present methods of physical modeling and numerical analysis that allow problems of this class to be solved on a laboratory computer boosted by a cluster of graphic accelerators. Exaflop computations performed with the application of these methods reveal new unique phenomena in the spatio-temporal dynamics of high-power ultrashort laser pulses. We demonstrate that unprecedentedly short light bullets can be generated as a part of that dynamics, providing optical field localization in both space and time through a delicate balance between dispersion and nonlinearity with simultaneous suppression of diffraction-induced beam divergence due to the joint effect of Kerr and ionization nonlinearities.

  2. Terminal Performance of Lead-Free Pistol Bullets in Ballistic Gelatin Using Retarding Force Analysis from High Speed Video

    CERN Document Server

    Courtney, Elijah; Andrusiv, Lubov; Courtney, Michael

    2016-01-01

    Due to concerns about environmental and industrial hazards of lead, a number of military, law enforcement, and wildlife management agencies are giving careful consideration to lead-free ammunition. The goal of lead-free bullets is to gain the advantages of reduced lead use in the environment while maintaining equal or better terminal performance. Accepting reduced terminal performance would foolishly risk the lives of military and law enforcement personnel. This paper uses the established technique of studying bullet impacts in ballistic gelatin to characterize the terminal performance of eight commercial off-the- shelf lead-free handgun bullets for comparison with earlier analysis of jacketed lead bullets. Peak retarding force and energy deposit in calibrated ballistic gelatin are quantified using high speed video. The temporary stretch cavities and permanent wound cavities are also characterized. Two factors tend to reduce the terminal performance of these lead-free projectiles compared to similar jacketed ...

  3. Terminal Performance of Lead Free Pistol Bullets in Ballistic Gelatin Using Retarding Force Analysis from High Speed Video

    Science.gov (United States)

    2016-04-04

    Terminal Performance of Lead-Free Pistol Bullets in Ballistic Gelatin Using Retarding Force Analysis from High Speed Video ELIJAH COURTNEY, AMY...quantified using high speed video. The temporary stretch cavities and permanent wound cavities are also characterized. Two factors tend to re- duce the...which reduces muzzle velocity and energy, and thus reduces the ability of the bullet to exert damaging forces in tissue simulant. Second, the lower

  4. Generation of Ultrashort Light Bullets in Dispersive Kerr Media Using the Fourth-Order Dispersion-Dependent Spatiotemporal Instability

    Institute of Scientific and Technical Information of China (English)

    文双春; 钱列加; 范滇元

    2003-01-01

    A new method for generation of a train of ultrashort pulses or a sequence of ultrashort light bullets is proposed.This method is based on the fourth-order dispersion-dependent spatiotemporal instability in dispersive Kerr media. The repetition-rate of the generated bullets can be made quite large by increasing the corresponding spatial modulation frequency locating in the new instability region resulted from fourth-order dispersion.

  5. Base deformation of full metal-jacketed rifle bullets as a measure of impact velocity and range of fire.

    Science.gov (United States)

    Haag, Lucien C

    2015-03-01

    Full metal-jacketed rifle bullets with lead cores and open bases can experience deformation of their cylindrical shapes as they yaw during the penetration of soft tissues. The amount of deformation depends upon the strength of the bullet and the velocity in soft tissue when they go into yaw. The yaw behavior of a bullet in soft tissue depends upon its design (length, ogive shape, ogive length, center of gravity, and pre-impact stability) as it penetrates soft tissue. The yaw characteristics of common spitzer-type military rifle bullets are relatively well known and quite reproducible when fired into suitable soft tissue simulants. This, in turn, results in a relationship between the amount of deformation of the bullet's shank and impact velocity with soft tissue. The specific relationship between impact velocity and bullet deformation must be worked out through empirical testing, but this relationship can be of critical importance in determining impact velocity, which, in turn, relates to range of fire.

  6. Mechanism of bullet-to-streamer transition in water surface incident helium atmospheric pressure plasma jet (APPJ)

    Science.gov (United States)

    Yoon, Sung-Young; Kim, Gon-Ho; Kim, Su-Jeong; Bae, Byeongjun; Kim, Seong Bong; Ryu, Seungmin; Yoo, Suk Jae

    2016-09-01

    The mechanism of bullet to streamer transition of helium-APPJ bullet on the electrolyte surface was investigated. The APPJ was discharged in pin-to-ring DBD reactor system with helium gas by applying the ac-driven voltage at a frequency of 10 kHz. The water evaporation was controlled via saline temperature. The temporal- and 2-dimensional spatially- resolved plasma properties are monitored by optical diagnostics. During the APPJ bullet propagation from reactor to electrolyte surface, the transition of bullet from streamer was recognized from the high speed image, hydrogen beta emission line, and bullet propagation speed. The He metastable species density profiles from the tunable diode laser absorption spectroscopy (TDLAS) showed the metastable lost the energy near electrolyte surface. It is found that the bullet transited to streamer when the water fraction reached to 29%. This can be fascinating result to study the plasma physics liquid surface, non-fixed boundary. Acknowledgements: This work was partly supported by R&D Program of `Plasma Advanced Technology for Agriculture and Food (Plasma Farming)' through the National Fusion Research Institute of Korea (NFRI) funded by the Government fund was carried out as part.

  7. Class 1E digital systems studies

    Energy Technology Data Exchange (ETDEWEB)

    Hecht, H.; Tai, A.T.; Tso, K.S. [SoHaR, Inc., Beverly Hills, CA (United States)

    1993-10-01

    This document is furnished as part of the effort to develop NRC Class 1E Digital Computer Systems Guidelines which is Task 8 of USAF Rome Laboratories Contract F30602-89-D-0100. The report addresses four major topics, namely, computer programming languages, software design and development, software testing and fault tolerance and fault avoidance. The topics are intended as stepping stones leading to a Draft Regulatory Guide document. As part of this task a small scale survey of software fault avoidance and fault tolerance practices was conducted among vendors of nuclear safety related systems and among agencies that develop software for other applications demanding very high reliability. The findings of the present report are in part based on the survey and in part on review of software literature relating to nuclear and other critical installations, as well as on the authors` experience in these areas.

  8. Linear and Nonlinear Bullets of the Bogoliubov-de Gennes Excitations

    Science.gov (United States)

    Kumar, S.; Perego, A. M.; Staliunas, K.

    2017-01-01

    We report on the focalization of Bogoliubov-de Gennes excitations of the nonlinear Schrödinger equation in the defocusing regime (Gross-Pitaevskii equation for repulsive Bose-Einstein condensates) with a spatially modulated periodic potential. Exploiting the modification of the dispersion relation induced by the modulation, we demonstrate the existence of localized structures of the Bogoliubov-de Gennes excitations, in both the linear and nonlinear regimes (linear and nonlinear "bullets"). These traveling Bogoliubov-de Gennes bullets, localized both spatially and temporally in the comoving reference frame, are robust and propagate remaining stable, without spreading or filamentation. The phenomena reported in this Letter could be observed in atomic Bose-Einstein condensates in the presence of a spatially periodic potential induced by an optical lattice.

  9. Automatic identification of bullet signatures based on consecutive matching striae (CMS) criteria.

    Science.gov (United States)

    Chu, Wei; Thompson, Robert M; Song, John; Vorburger, Theodore V

    2013-09-10

    The consecutive matching striae (CMS) numeric criteria for firearm and toolmark identifications have been widely accepted by forensic examiners, although there have been questions concerning its observer subjectivity and limited statistical support. In this paper, based on signal processing and extraction, a model for the automatic and objective counting of CMS is proposed. The position and shape information of the striae on the bullet land is represented by a feature profile, which is used for determining the CMS number automatically. Rapid counting of CMS number provides a basis for ballistics correlations with large databases and further statistical and probability analysis. Experimental results in this report using bullets fired from ten consecutively manufactured barrels support this developed model.

  10. Wallets, ballots, or bullets: does wealth, democracy, or military capabilities determine war outcomes?

    OpenAIRE

    Bayer, Reşat; Henderson, Errol A.

    2013-01-01

    Abstract Henderson, Errol A. and Reat Bayer. (2013) Wallets, Ballots, or Bullets: Does Wealth, Democracy, or Military Capabilities Determine War Outcomes? International Studies Quarterly, doi: 10.1111/isqu.12026 (c) 2013 International Studies Association We examine the extent to which wealth, democracy, and/or relative military capabilities contribute to victory in interstate war. Examining contingency tables, we find that states with greater military capabilities are more likely to win th...

  11. Pattern of rubber bullet injuries in the lower limbs: A report from Kashmir

    Institute of Scientific and Technical Information of China (English)

    Shabir Ahmed Dhar; Tahir Ahmed Dar; Sharief Ahmed Wani; Saheel Maajid; Jawed Ahmed Bhat; Naseer Ahmed Mir; Imtiyaz Hussain Dar

    2016-01-01

    Purpose:Rubber bullets are considered a non-lethal method of crowd control and are being used over the world.However the literature regarding the pattern and management of these injuries is scarce for the forensic pathologist as well as for the traumatologist.The objective of this report was to add our experience to the existing literature.Methods:From June 2008 to August 2010 the Government Hospital for Bone and Joint Surgery Barzulla and the Department of Orthopaedics,SKIMS Medical College/Hospital Bemina Srinagar received 28 patients for management of their orthopaedic injuries caused by rubber bullets.We documented all injuries and also recorded the management issues and complications that we encountered.Results:All patients were males with an age range of 11-32 years and were civilians who had been hit by rubber bullets fired by the police and the paramilitary forces.Among them,19 patients had injuries of the lower limbs and 9 patients had injuries of the upper limbs.All patients were received within 5 h of being shot.Conclusion:Our findings suggest that these weapons are capable of causing significant injuries including fractures and it is important for the surgeon to be well versed with the management of such injuries especially in areas of unrest.The report is also supportive of the opinion that these weapons are lethal and should hence be reclassified.

  12. Three-dimensional reconstitution of bullet trajectory in gunshot wounds: a case report.

    Science.gov (United States)

    Puentes, Katerina; Taveira, Francisco; Madureira, António J; Santos, Agostinho; Magalhães, Teresa

    2009-10-01

    In the medico-legal assessment of cases of aggression with firearms, imaging techniques have a particularly important role, especially in the study of a bullet's path through the victim's body. The analysis of these trajectories can be performed by the use of three-dimensional reconstitution techniques, namely Three-Dimensional Multi-Slice Computed Tomography (3D-MSCT). This imaging technique has been widely used in fatal cases, as a very important complement of the classical autopsy procedures, becoming known as "virtual autopsy" or "Virtopsy". To our knowledge, no reports describing the use of 3D-MSCT in non-fatal cases have been described in the medico-legal literature. The authors present a case of a man with a gunshot injury, in the context of a multiple aggressor situation, in which it was not possible to extract the bullet. To accurately determine the bullet's trajectory, 3D-MSCT was performed, thus contributing to a more reliable reconstruction of the crime scene in which the victim and the suspects were located.

  13. Adaptive Generation and Diagnostics of Linear Few-Cycle Light Bullets

    Directory of Open Access Journals (Sweden)

    Martin Bock

    2013-02-01

    Full Text Available Recently we introduced the class of highly localized wavepackets (HLWs as a generalization of optical Bessel-like needle beams. Here we report on the progress in this field. In contrast to pulsed Bessel beams and Airy beams, ultrashort-pulsed HLWs propagate with high stability in both spatial and temporal domain, are nearly paraxial (supercollimated, have fringe-less spatial profiles and thus represent the best possible approximation to linear “light bullets”. Like Bessel beams and Airy beams, HLWs show self-reconstructing behavior. Adaptive HLWs can be shaped by ultraflat three-dimensional phase profiles (generalized axicons which are programmed via calibrated grayscale maps of liquid-crystal-on-silicon spatial light modulators (LCoS-SLMs. Light bullets of even higher complexity can either be freely formed from quasi-continuous phase maps or discretely composed from addressable arrays of identical nondiffracting beams. The characterization of few-cycle light bullets requires spatially resolved measuring techniques. In our experiments, wavefront, pulse and phase were detected with a Shack-Hartmann wavefront sensor, 2D-autocorrelation and spectral phase interferometry for direct electric-field reconstruction (SPIDER. The combination of the unique propagation properties of light bullets with the flexibility of adaptive optics opens new prospects for applications of structured light like optical tweezers, microscopy, data transfer and storage, laser fusion, plasmon control or nonlinear spectroscopy.

  14. Main: 1E4N [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E4N トウモロコシ Corn Zea mays L. Beta-Glucosidase, Chloroplast Precursor Name=Glu1; Zea...EVNGPDGKPIGPPMGNPWIYMYPEGLKDLLMIMKNKYGNPPIYITENGIGDVDTKETPLPMEAALNDYKRLDYIQRHIATLKESIDLGSNVQGYFAWSLLDNFEWFAGFTERYGIVYVDRNNNCTRYMKESAKWLKEFNTAKKPSKKILTPA corn_1E4N.jpg ...

  15. Main: 1E1F [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E1F トウモロコシ Corn Zea mays L. Beta-Glucosidase, Chloroplast Precursor Name=Glu1; Zea...QRHIATLKESIDLGSNVQGYFAWSLLDNFEWFAGFTERYGIVYVDRNNNCTRYMKESAKWLKEFNTAKKPSKKILTPA corn_1E1F.jpg ...

  16. Main: 1E4L [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E4L トウモロコシ Corn Zea mays L. Beta-Glucosidase, Chloroplast Precursor Name=Glu1; Zea...MKNKYGNPPIYITENGIGDVDTKETPLPMEAALNDYKRLDYIQRHIATLKESIDLGSNVQGYFAWSLLDNFEWFAGFTERYGIVYVDRNNNCTRYMKESAKWLKEFNTAKKPSKKILTPA corn_1E4L.jpg ...

  17. 3D-MSCT imaging of bullet trajectory in 3D crime scene reconstruction: two case reports.

    Science.gov (United States)

    Colard, T; Delannoy, Y; Bresson, F; Marechal, C; Raul, J S; Hedouin, V

    2013-11-01

    Postmortem investigations are increasingly assisted by three-dimensional multi-slice computed tomography (3D-MSCT) and have become more available to forensic pathologists over the past 20years. In cases of ballistic wounds, 3D-MSCT can provide an accurate description of the bullet location, bone fractures and, more interestingly, a clear visual of the intracorporeal trajectory (bullet track). These forensic medical examinations can be combined with tridimensional bullet trajectory reconstructions created by forensic ballistic experts. These case reports present the implementation of tridimensional methods and the results of 3D crime scene reconstruction in two cases. The authors highlight the value of collaborations between police forensic experts and forensic medicine institutes through the incorporation of 3D-MSCT data in a crime scene reconstruction, which is of great interest in forensic science as a clear visual communication tool between experts and the court.

  18. Regular ‘breathing’ of a near-single-cycle light bullet in mid-IR filament

    Science.gov (United States)

    Chekalin, S. V.; Kompanets, V. O.; Kuznetsov, A. V.; Dormidonov, A. E.; Kandidov, V. P.

    2016-06-01

    Experimental and numerical studies of a temporal evolution of a light bullet formed in isotropic LiF by mid-IR femtosecond pulse (2600-3350 nm) of power, slightly exceeding the critical power for self-focusing, are presented. For the first time regular oscillations of the light bullet field peak amplitude during its propagation in a filament were registered by investigation of induced color centers in LiF. It was revealed that color centers in a single laser pulse filament have the strictly periodic structure with a length of separate sections about 30 μm, which increases with a laser pulse wavelength decreasing. It was shown that the origin of a light bullet modulation is a periodical change of the light field amplitude of a near single-cycle wave packet in a filament, due to a difference of the wave packet group velocity and the carrier wave phase velocity.

  19. A Bullet Entered through the Open Mouth and Ended Up in the Parapharyngeal Space and Skull Base

    Directory of Open Access Journals (Sweden)

    Saileswar Goswami

    2015-01-01

    Full Text Available Shot from a revolver from a close range, a bullet pierced the chest of a policeman and entered through the open mouth of a young male person standing behind. The entry wound was found in the cheek mucosa adjacent to the left lower third molar. After hitting and fracturing the body and the ramus of the mandible, the bullet was deflected and was finally lodged in the parapharyngeal space and skull base, anterolateral to the transverse process of the atlas. The great vessels of the neck were not injured. The patient’s condition was very critical but his life could be saved. The bullet was approached through a modified Blair’s incision and was found to be lying over the carotid sheath. It was removed safely and the patient recovered completely.

  20. Lodox/Statscan provides rapid identification of bullets in multiple gunshot wounds.

    Science.gov (United States)

    Fu, Chih-Yuan; Wu, Shih-Chi; Chen, Ray-Jade

    2008-10-01

    Lodox/Statscan is a new digital radiograph machine with low-dose radiation exposure. It provides rapid and whole-body scans. In multiple gunshot trauma, the conventional radiograph or computed tomography scan might be time consuming, and the resuscitation might be paused temporarily. We applied the Lodox/Statscan to search bullets within a short period, and the resuscitation was nonstop during imaging study. As a result, it serves as a valuable adjunct in providing rapid identification of metal projectiles in multiple gunshot wounds.

  1. Lipossomas: a bala mágica acertou? Liposomes: has the magic bullet hit the target?

    Directory of Open Access Journals (Sweden)

    Nuno C. Santos

    2002-12-01

    Full Text Available Efficient drug delivery systems are as important as drug themselves. A powerful drug unable to reach the target cell is useless in practice. Ehrlich's Magic Bullet was the first carrier system to be proposed. The evolution in this domain has been quite slow as the natural mechanisms of mammals against foreign products are hard to overcome. However, lipid-based systems (liposomes and related vesicles have attained reasonable success. The basic preparations and structural features of liposomes and related vesicles as well as their applications are addressed from the chemist's and biochemist's point of view.

  2. Bullet-to-streamer transition on the liquid surface of a plasma jet in atmospheric pressure

    Science.gov (United States)

    Yoon, S.-Y.; Kim, G.-H.; Kim, S.-J.; Bae, B.; Kim, N.-K.; Lee, H.; Bae, N.; Ryu, S.; Yoo, S. J.; Kim, S. B.

    2017-01-01

    This study investigated the transition of the plasma shape from a ring-shaped bullet to a pin-like streamer adjacent to the electrolyte surface in a kHz-driven helium atmospheric pressure plasma jet. The transition was observed by synchronized fast images, plasma propagation speed, time-resolved emission profile of Hβ, and spatially and temporally resolved helium metastable density. The transition height increased when electrolyte evaporation was enhanced. The plasma continued to discharge on the electrolyte surface even in the absence of metastable species, i.e., the discharge mechanism changed from Penning ionization between helium metastable and ambient nitrogen to electron collision on evaporated water.

  3. General-Purpose Heat Source development: Safety Verification Test Program. Bullet/fragment test series

    Energy Technology Data Exchange (ETDEWEB)

    George, T.G.; Tate, R.E.; Axler, K.M.

    1985-05-01

    The radioisotope thermoelectric generator (RTG) that will provide power for space missions contains 18 General-Purpose Heat Source (GPHS) modules. Each module contains four /sup 238/PuO/sub 2/-fueled clads and generates 250 W/sub (t)/. Because a launch-pad or post-launch explosion is always possible, we need to determine the ability of GPHS fueled clads within a module to survive fragment impact. The bullet/fragment test series, part of the Safety Verification Test Plan, was designed to provide information on clad response to impact by a compact, high-energy, aluminum-alloy fragment and to establish a threshold value of fragment energy required to breach the iridium cladding. Test results show that a velocity of 555 m/s (1820 ft/s) with an 18-g bullet is at or near the threshold value of fragment velocity that will cause a clad breach. Results also show that an exothermic Ir/Al reaction occurs if aluminum and hot iridium are in contact, a contact that is possible and most damaging to the clad within a narrow velocity range. The observed reactions between the iridium and the aluminum were studied in the laboratory and are reported in the Appendix.

  4. The removal of intravascular bullets by interventional radiology: the prevention of central migration by balloon occlusion--case report.

    Science.gov (United States)

    Sclafani, S J; Shatzkes, D; Scalea, T

    1991-10-01

    A migratory intravascular bullet fragment located within the hypogastric vein was removed successfully with the aid of interventional radiologic techniques. The authors describe the use of the technique of balloon trapping as part of this procedure. A balloon should be inflated between the foreign body and the heart before retrieval is attempted in order to prevent migration back to the heart during the manipulation.

  5. Bullet embolism of pulmonary artery: a case report; Embolia pulmonar por projetil de arma de fogo: relato de caso

    Energy Technology Data Exchange (ETDEWEB)

    Yamanari, Mauricio Gustavo Ieiri; Mansur, Maria Clara Dias; Kay, Fernando Uliana; Silverio, Paulo Rogerio Barboza; Jayanthi, Shri Krishna; Funari, Marcelo Buarque de Gusmao, E-mail: mauriciogustavo91@yahoo.com.br [Universidade de Sao Paulo (IHC-FMUSP), SP (Brazil). Faculdade de Medicina. Hospital das Clinicas

    2014-03-15

    The authors report the case of a patient victim of gunshots, with a very rare complication: venous bullet embolism from the left external iliac vein to the lingular segment of the left pulmonary artery. Diagnosis is made with whole-body radiography or computed tomography. Digital angiography is reserved for supplementary diagnosis or to be used as a therapeutic procedure. (author)

  6. Entrance and exit wounds of high velocity bullet: An autopsy analysis in the event of dispersing the mass rally in Bangkok Thailand, May 2010.

    Science.gov (United States)

    Peonim, Vichan; Srisont, Smith; Udnoon, Jitta; Wongwichai, Sompong; Thapon, Arisa; Worasuwannarak, Wisarn

    2016-11-01

    Fatal mass casualties by high velocity bullets (HVBs) are rare events in peaceful countries. This study presents 27 forensic autopsy cases with 32 shots fired by 5.56×45mm. HVB (M-16 rifle bullets) during the dispersing the mass rally in Bangkok Thailand, May 2010. It was found that twenty-three (71.88%) typical entrance HVB wounds had round sizes less than the bullet diameters. Most entrance wounds had microtears but no collar abrasion since a HVB has a small streamlined spitzer tip and full metal jacket. For exit wounds, there were various sizes and shapes depending on which section of wound ballistics presented when the bullet exited the body. If a bullet exited in the section of temporally cavity formation, there would be a large size exit wound in accordance with the degree of bullet yaw. This is different from civilian bullets whereby the shape looks like a cylindrical round nose and at low velocity that causes entrance wounds with a similar size to the bullet diameter and is usually round or oval shape with collar abrasion. The temporary cavity is not as large as in a HVB so exit wounds are not quite as large and present a ragged border compared to a HVB. We also reported 9 out of 32 shots (28.13%) of atypical entrance wounds that had various characteristics depending on site of injury and destabilization of bullets. These findings may be helpful to forensic pathologists and to give physicians, who need to diagnose HVB wounds, more confidence.

  7. Inconsistency in 9 mm bullets: correlation of jacket thickness to post-impact geometry measured with non-destructive X-ray computed tomography.

    Science.gov (United States)

    Thornby, John; Landheer, Dirk; Williams, Tim; Barnes-Warden, Jane; Fenne, Paul; Norman, Daniel; Attridge, Alex; Williams, Mark A

    2014-01-01

    Fundamental to any ballistic armour standard is the reference projectile to be defeated. Typically, for certification purposes, a consistent and symmetrical bullet geometry is assumed, however variations in bullet jacket dimensions can have far reaching consequences. Traditionally, characteristics and internal dimensions have been analysed by physically sectioning bullets--an approach which is of restricted scope and which precludes subsequent ballistic assessment. The use of a non-destructive X-ray computed tomography (CT) method has been demonstrated and validated (Kumar et al., 2011 [15]); the authors now apply this technique to correlate bullet impact response with jacket thickness variations. A set of 20 bullets (9 mm DM11) were selected for comparison and an image-based analysis method was employed to map jacket thickness and determine the centre of gravity of each specimen. Both intra- and inter-bullet variations were investigated, with thickness variations of the order of 200 μm commonly found along the length of all bullets and angular variations of up to 50 μm in some. The bullets were subsequently impacted against a rigid flat plate under controlled conditions (observed on a high-speed video camera) and the resulting deformed projectiles were re-analysed. The results of the experiments demonstrate a marked difference in ballistic performance between bullets from different manufacturers and an asymmetric thinning of the jacket is observed in regions of pre-impact weakness. The conclusions are relevant for future soft armour standards and provide important quantitative data for numerical model correlation and development. The implications of the findings of the work on the reliability and repeatability of the industry standard V50 ballistic test are also discussed.

  8. Simulation of a non-equilibrium helium plasma bullet emerging into oxygen at high pressure (250-760 Torr) and interacting with a substrate

    Science.gov (United States)

    Yan, Wen; Economou, Demetre J.

    2016-09-01

    A two-dimensional computational study of a plasma bullet emanating from a helium gas jet in oxygen ambient at high pressure (250-760 Torr) was performed, with emphasis on the bullet interaction with a substrate. Power was applied in the form of a trapezoidal +5 kV pulse lasting 150 ns. A neutral gas transport model was employed to predict the concentration distributions of helium and oxygen in the system. These were then used in a plasma dynamics model to investigate the characteristics of the plasma bullet during its propagation and interaction with a substrate. Upon ignition, the discharge first propagated as a surface wave along the inner wall of the containing tube, and then exited the tube with a well-defined ionization front (streamer or plasma bullet). The plasma bullet evolved from a hollow (donut-shaped) feature to one where the maximum of ionization was on axis. The bullet propagated in the gap between the tube exit and the substrate with an average speed of ˜2 × 105 m/s. Upon encountering a metal substrate, the bullet formed a conductive channel to the substrate. Upon encountering a dielectric substrate, the bullet turned into an ionization wave propagating radially along the substrate surface. For a conductive substrate, the radial species fluxes to the surface peaked on the symmetry axis. For a dielectric substrate, a ring-shaped flux distribution was observed. The "footprint" of plasma-surface interaction increased either by decreasing the gap between tube exit and substrate, decreasing the relative permittivity of an insulating substrate, or decreasing pressure. As the system pressure was lowered from 760 to 250 Torr, the discharge was initiated earlier, and the plasma bullet propagation speed increased. A reverse electric field developed during the late stages of the ramp-down of the pulse, which accelerated electrons forming a brief backward discharge.

  9. Cluster headache

    Science.gov (United States)

    Histamine headache; Headache - histamine; Migrainous neuralgia; Headache - cluster; Horton's headache; Vascular headache - cluster ... A cluster headache begins as a severe, sudden headache. The headache commonly strikes 2 to 3 hours after you fall ...

  10. Cluster Forests

    CERN Document Server

    Yan, Donghui; Jordan, Michael I

    2011-01-01

    Inspired by Random Forests (RF) in the context of classification, we propose a new clustering ensemble method---Cluster Forests (CF). Geometrically, CF randomly probes a high-dimensional data cloud to obtain "good local clusterings" and then aggregates via spectral clustering to obtain cluster assignments for the whole dataset. The search for good local clusterings is guided by a cluster quality measure $\\kappa$. CF progressively improves each local clustering in a fashion that resembles the tree growth in RF. Empirical studies on several real-world datasets under two different performance metrics show that CF compares favorably to its competitors. Theoretical analysis shows that the $\\kappa$ criterion is shown to grow each local clustering in a desirable way---it is "noise-resistant." A closed-form expression is obtained for the mis-clustering rate of spectral clustering under a perturbation model, which yields new insights into some aspects of spectral clustering.

  11. Vortical light bullets in second-harmonic-generating media supported by a trapping potential

    CERN Document Server

    Sakaguchi, Hidetsugu

    2013-01-01

    We introduce a three-dimensional (3D) model of optical media with the quadratic ($\\chi ^{(2)}$) nonlinearity and an effective 2D isotropic harmonic-oscillator (HO) potential. While it is well known that 3D \\chi^2 solitons with embedded vorticity ("vortical light bullets") are unstable in the free space, we demonstrate that they have a broad stability region in the present model, being supported by the HO potential against the splitting instability. The shape of the vortical solitons may be accurately predicted by the variational approximation (VA). They exist above a threshold value of the total energy (norm) and below another critical value, which determines a stability boundary. The existence threshold vanishes is a part of the parameter space, depending on the mismatch parameter, which is explained by means of the comparison with the 2D counterpart of the system. Above the stability boundary, the vortex features shape oscillations, periodically breaking its axisymmetric form and restoring it. Collisions be...

  12. Star Clusters

    OpenAIRE

    Gieles, M.

    1993-01-01

    Star clusters are observed in almost every galaxy. In this thesis we address several fundamental problems concerning the formation, evolution and disruption of star clusters. From observations of (young) star clusters in the interacting galaxy M51, we found that clusters are formed in complexes of stars and star clusters. These complexes share similar properties with giant molecular clouds, from which they are formed. Many (70%) of the young clusters will not survive the fist 10 Myr, due to t...

  13. TURBULENT COSMIC-RAY REACCELERATION AT RADIO RELICS AND HALOS IN CLUSTERS OF GALAXIES

    Energy Technology Data Exchange (ETDEWEB)

    Fujita, Yutaka [Department of Earth and Space Science, Graduate School of Science, Osaka University, Toyonaka, Osaka 560-0043 (Japan); Takizawa, Motokazu [Department of Physics, Yamagata University, 1-4-12 Kojirakawa-machi, Yamagata 990-8560 (Japan); Yamazaki, Ryo [Department of Physics and Mathematics, Aoyama Gakuin University, Fuchinobe, Chuou-ku, Sagamihara 252-5258 (Japan); Akamatsu, Hiroki [SRON Netherlands Institute for Space Research, Sorbonnelaan 2, 3584 CA Utrecht (Netherlands); Ohno, Hiroshi, E-mail: fujita@vega.ess.sci.osaka-u.ac.jp [Tohoku Bunkyo College, 515 Katayachi, Yamagata 990-2316 (Japan)

    2015-12-20

    Radio relics are synchrotron emission found on the periphery of galaxy clusters. From the position and the morphology, it is often believed that the relics are generated by cosmic-ray (CR) electrons accelerated at shocks through a diffusive shock acceleration (DSA) mechanism. However, some radio relics have harder spectra than the prediction of the standard DSA model. One example is observed in the cluster 1RXS J0603.3+4214, which is often called the “Toothbrush Cluster.” Interestingly, the position of the relic is shifted from that of a possible shock. In this study, we show that these discrepancies in the spectrum and the position can be solved if turbulent (re)acceleration is very effective behind the shock. This means that for some relics turbulent reacceleration may be the main mechanism to produce high-energy electrons, contrary to the common belief that it is the DSA. Moreover, we show that for efficient reacceleration, the effective mean free path of the electrons has to be much smaller than their Coulomb mean free path. We also study the merging cluster 1E 0657−56, or the “Bullet Cluster,” in which a radio relic has not been found at the position of the prominent shock ahead of the bullet. We indicate that a possible relic at the shock is obscured by the observed large radio halo that is generated by strong turbulence behind the shock. We propose a simple explanation of the morphological differences of radio emission among the Toothbrush, the Bullet, and the Sausage (CIZA J2242.8+5301) Clusters.

  14. Stick-slip behavior identified in helium cluster growth in the subsurface of tungsten: effects of cluster depth

    Science.gov (United States)

    Wang, Jinlong; Niu, Liang-Liang; Shu, Xiaolin; Zhang, Ying

    2015-10-01

    We have performed a molecular dynamics study on the growth of helium (He) clusters in the subsurface of tungsten (W) (1 0 0) at 300 K, focusing on the role of cluster depth. Irregular ‘stick-slip’ behavior exhibited during the evolution of the He cluster growth is identified, which is due to the combined effects of the continuous cluster growth and the loop punching induced pressure relief. We demonstrate that the He cluster grows via trap-mutation and loop punching mechanisms. Initially, the self-interstitial atom SIA clusters are almost always attached to the He cluster; while they are instantly emitted to the surface once a critical cluster pressure is reached. The repetition of this process results in the He cluster approaching the surface via a ‘stop-and-go’ manner and the formation of surface adatom islands (surface roughening), ultimately leading to cluster bursting and He escape. We reveal that, for the Nth loop punching event, the critical size of the He cluster to trigger loop punching and the size of the emitted SIA clusters are correspondingly increased with the increasing initial cluster depth. We tentatively attribute the observed depth effects to the lower formation energies of Frenkel pairs and the greatly reduced barriers for loop punching in the stress field of the W subsurface. In addition, some intriguing features emerge, such as the morphological transformation of the He cluster from ‘platelet-like’ to spherical, to ellipsoidal with a ‘bullet-like’ tip, and finally to a ‘bottle-like’ shape after cluster rupture.

  15. A Death Involving a Fired and Deflected Bullet: A Case Report from Lyon University Institute of Forensic Science, France.

    Science.gov (United States)

    Maujean, Géraldine; Guinet, Tiphaine; Malicier, Daniel

    2016-01-01

    In case of gunshot deaths, atypical wounds can make the distinction between entrance and exit wounds harder. They may be due either to anatomical reasons or to diverse cogent ballistic arguments. The reported case pertains to a fatal hunting accident involving an expanded conical point bullet against the neck with both atypical entrance and exit wounds. Ballistic analyses including test firings allowed a better understanding of the external and internal findings. Upon premature impact with an intermediary target, the bullet experienced expansion in the formation of sharp brass petals responsible for a star-shaped entry wound. The trajectory of the deformed high energy projectile through the victim's body was then deviated by the cervical column, causing it to be tangential to the skin when exiting the body. The description of such atypical cases may benefit other experts and may assist in their investigation into similar cases.

  16. Spatiotemporal light bullets and supercontinuum generation in β-BBO crystal with competing quadratic and cubic nonlinearities.

    Science.gov (United States)

    Šuminas, R; Tamošauskas, G; Valiulis, G; Dubietis, A

    2016-05-01

    We experimentally study filamentation and supercontinuum generation in a birefringent medium [beta-barium borate (β-BBO) crystal] pumped by intense 90 fs, 1.8 μm laser pulses whose carrier wavelength falls in the range of anomalous group velocity dispersion of the crystal. We demonstrate that the competition between the intrinsic cubic and cascaded-quadratic nonlinearities may serve as a useful tool for controlling the self-action effects via phase matching condition. In particular, we found that spectral superbroadening of the ordinary polarization is linked to three-dimensional self-focusing and formation of self-compressed spatiotemporal light bullets that could be accessed within a certain range of either positive or negative phase mismatch. In the extraordinary polarization, we detect giant spectral shifts of the second harmonic radiation, which are attributed to a light bullet-induced self-phase matching.

  17. Experimental research on the penetration of tungsten-fiber/metallic-glass matrix composite material bullet into steel target

    OpenAIRE

    Chen X.W.; Chen G

    2012-01-01

    In the present paper, the penetration experiments of tungsten-fiber/metallic-glass matrix composite material bullets into 45# steel targets are conducted by employing H25 artillery. In which, an experimental technique of sub-caliber penetration is constructed. The quasi static and dynamic behaviours of tungsten-fiber/metallic-glass matrix composite material are also experimental investigated. The self-sharpening phenomenon of composite material is observed. Integrated with metallographic anal...

  18. Pattern, presentation and management of vascular injuries due to pellets and rubber bullets in a conflict zone

    Directory of Open Access Journals (Sweden)

    Mohd L Wani

    2013-01-01

    Full Text Available Background: Rubber bullets and pellet guns are considered non-lethal low-velocity weapons. They are used to disperse a mob during street protests. The present study was undertaken to analyze the pattern, presentation and management of vascular injuries caused by these weapons. Patients and Methods: This was a prospective study of patients with features of vascular injuries due to pellets and rubber bullets from June 2010 to November 2010. All patients with features of vascular injuries due to these non-lethal weapons were included in the study. Vascular injuries caused by other causes were excluded from the study. Results: A total of 35 patients who presented with features of vascular injury during this period were studied. All of them were males. The mean age was 22 years. Fifteen patients were revascularized primarily, 19 patients needed reverse saphenous vein graft and, in one, patient lateral repair was done. There were two mortalities in our series. Wound infection was the most common complication. The amputation rate was around 6%. Conclusion: Pellet and rubber bullets can cause serious life-threatening injuries. Vascular injury caused by these weapons need no different approach than other vascular injuries. Early revascularization and prompt resuscitation prevents the loss of limb or life.

  19. Two bullets to the head and an early winter: fate permits Kutuzov to defeat Napoleon at Moscow.

    Science.gov (United States)

    Kushchayev, Sergiy V; Belykh, Evgenii; Fishchenko, Yakiv; Salei, Aliaksei; Teytelboym, Oleg M; Shabaturov, Leonid; Cruse, Mark; Preul, Mark C

    2015-07-01

    General Mikhail Kutuzov (circa 1745-1813) brilliantly repelled Napoleon's invasion of Russia. Honored as a national hero and a savior of Russia, Kutuzov has a unique medical story. He was shot in the head twice while fighting the Turks (1774 and 1788) and survived the serious injuries seemingly against all odds. The first bullet "ran through the head from one temple to the other behind both eyes." The second bullet entered the cheek, destroyed upper teeth, traveled through the head, and exited the occiput. Massot, a French surgeon with the Russian army, wrote after treating Kutuzov's seemingly two mortal wounds: "It must be believed that fate appoints Kutuzov to something great, because he was still alive after two injuries, a death sentence by all the rules of medical science." Aided by Massot's expert surgical technique, Kutuzov lived to become intimately engaged in events that altered world history. His health did, however, suffer significant effects due to the bullet wounds. In 1812, as Napoleon's Grande Armée approached, Kutuzov realized he could not confront Napoleon and he strategically retreated from Moscow, submitting the French to the harsh winter and Russian cavalry. Napoleon's devastated army retreated to Paris, and Kutuzov became the personification of Russian spirit and character. Kutuzov's survival of two nearly mortal head wounds created the legends, additional mystery, and drama surrounding him, not the least astonishing of which was the skilled neurosurgical care that probably saved his life.

  20. Purification and Structural Analysis of Plectin and BPAG1e.

    Science.gov (United States)

    Manso, José A; García Rubio, Inés; Gómez-Hernández, María; Ortega, Esther; Buey, Rubén M; Carballido, Ana M; Carabias, Arturo; Alonso-García, Noelia; de Pereda, José M

    2016-01-01

    Plectin and BPAG1e belong to the plakin family of high-molecular-weight proteins that interconnect the cytoskeletal systems and anchor them to junctional complexes. Plectin and BPAG1e are prototypical plakins with a similar tripartite modular structure. The N- and C-terminal regions are built of multiple discrete structural domains, while the central rod domain mediates dimerization by coiled-coil interactions. Owing to the mosaic organization of plakins, the structure of their constituent individual domains or small multi-domain segments can be analyzed isolated. Yet, understanding the integrated function of large regions, oligomers, and heterocomplexes of plakins is difficult due to the large and segmented structure. Here, we describe methods for the production of plectin and BPAG1e samples suitable for structural and biophysical analysis. In addition, we discuss the combination of hybrid methods that yield information at several resolution levels to study the complex, multi-domain, and flexible structure of plakins.

  1. High-Velocity Interstellar Bullets in IRAS05506+2414: A Very Young Protostar

    CERN Document Server

    Sahai, Raghvendra; Contreras, Carmen Sánchez; Morris, Mark; Sarkar, Geetanjali

    2008-01-01

    We have made a serendipitous discovery of an enigmatic outflow source, IRAS 05506+2414 (hereafter IRAS 05506), as part of a multi-wavelength survey of pre-planetary nebulae (PPNs). The HST optical and near-infrared images show a bright compact central source with a jet-like extension, and a fan-like spray of high-velocity (with radial velocities upto 350 kms/s) elongated knots which appear to emanate from it. These structures are possibly analogous to the near-IR "bullets" seen in the Orion nebula. Interferometric observations at 2.6 mm show the presence of a high-velocity CO outflow and a continuum source also with a faint extension, both of which are aligned with the optical jet structure. IRAS 05506 is most likely not a PPN. We find extended NH3 (1,1) emission towards IRAS 05506; these data together with the combined presence of far-IR emission, H2O and OH masers, and CO and CS J=2-1 emission, strongly argue for a dense, dusty star-forming core associated with IRAS 05506. IRAS 05506 is probably an intermed...

  2. Meaningful Clusters

    Energy Technology Data Exchange (ETDEWEB)

    Sanfilippo, Antonio P.; Calapristi, Augustin J.; Crow, Vernon L.; Hetzler, Elizabeth G.; Turner, Alan E.

    2004-05-26

    We present an approach to the disambiguation of cluster labels that capitalizes on the notion of semantic similarity to assign WordNet senses to cluster labels. The approach provides interesting insights on how document clustering can provide the basis for developing a novel approach to word sense disambiguation.

  3. VLA Discovers Giant Rings Around Galaxy Cluster

    Science.gov (United States)

    2006-11-01

    Astronomers using the National Science Foundation's Very Large Array (VLA) radio telescope have discovered giant, ring-like structures around a cluster of galaxies. The discovery provides tantalizing new information about how such galaxy clusters are assembled, about magnetic fields in the vast spaces between galaxy clusters, and possibly about the origin of cosmic rays. Radio-Optical Image of Cluster Galaxy Cluster Abell 3376 (Radio/Optical) CREDIT: Joydeep Bagchi, IUCAA, NRAO/AUI/NSF Above, a combined radio/optical image shows the galaxy cluster Abell 3376 in visible light (blue) and radio (red) images. The giant radio arcs surrounding the cluster were discovered using the Very Large Array. The visible-light image is from the Digitized Sky survey. Below, an X-ray image of Abell 3376 made using the European Space Agency's XMM-Newton telescope shows a spectacular, bullet-shaped region of X-rays coming from gas heated to 60 million degrees Kelvin. The bullet shape results from the supersonic collision of a smaller smaller galaxy subcluster with the main body of the larger cluster. Click on images for larger version. X-Ray Image of Cluster Galaxy Cluster Abell 3376 (X-Ray) CREDIT: Joydeep Bagchi, IUCAA, ESA "These giant, radio-emitting rings probably are the result of shock waves caused by violent collisions of smaller groups of galaxies within the cluster," said Joydeep Bagchi, of the Inter-University Centre for Astronomy and Astrophysics in Pune, India, who led an international research team. The scientists reported their findings in the November 3 edition of the journal Science. The newly-discovered ring segments, some 6 million light-years across, surround a galaxy cluster called Abell 3376, more than 600 million light-years from Earth. They were revealed because fast-moving electrons emitted radio waves as they spiraled around magnetic field lines in intergalactic space. "Even from this large distance, the feeble radio waves were easily picked up by the VLA

  4. Weighted Clustering

    DEFF Research Database (Denmark)

    Ackerman, Margareta; Ben-David, Shai; Branzei, Simina

    2012-01-01

    We investigate a natural generalization of the classical clustering problem, considering clustering tasks in which different instances may have different weights.We conduct the first extensive theoretical analysis on the influence of weighted data on standard clustering algorithms in both...... the partitional and hierarchical settings, characterizing the conditions under which algorithms react to weights. Extending a recent framework for clustering algorithm selection, we propose intuitive properties that would allow users to choose between clustering algorithms in the weighted setting and classify...... algorithms accordingly....

  5. The precessing jets of 1E 1740.7-2942

    CERN Document Server

    Luque-Escamilla, Pedro L; Martinez-Aroza, Josee

    2015-01-01

    Context. 1E 1740.7-2942 is believed to be one of the two prototypical microquasars towards the Galactic center region whose X-ray states strongly resemble those of Cygnus X-1. Yet, the bipolar radio jets of 1E 1740.7-2942 are very reminiscent of a radio galaxy. The true nature of the object has thus remained an open question for nearly a quarter of a century. Aims. Our main goal here is to confirm the Galactic membership of 1E 1740.7-2942 by searching for morphological changes of its extended radio jets in human timescales. This work was triggered as a result of recent positive detection of fast structural changes in the large-scale jets of its 'twin' GRS 1758-258. Methods. We carried out an in-depth exploration of the VLA public archives and fully recalibrated all 1E 1740.7-2942 extended data sets in the C configuration of the array. We obtained and analyzed matching beam radio maps for five epochs, covering years 1992, 1993, 1994, 1997 and 2000, with an angular resolution of a few arcseconds. Results. We cl...

  6. Cluster Lenses

    CERN Document Server

    Kneib, Jean-Paul; 10.1007/s00159-011-0047-3

    2012-01-01

    Clusters of galaxies are the most recently assembled, massive, bound structures in the Universe. As predicted by General Relativity, given their masses, clusters strongly deform space-time in their vicinity. Clusters act as some of the most powerful gravitational lenses in the Universe. Light rays traversing through clusters from distant sources are hence deflected, and the resulting images of these distant objects therefore appear distorted and magnified. Lensing by clusters occurs in two regimes, each with unique observational signatures. The strong lensing regime is characterized by effects readily seen by eye, namely, the production of giant arcs, multiple-images, and arclets. The weak lensing regime is characterized by small deformations in the shapes of background galaxies only detectable statistically. Cluster lenses have been exploited successfully to address several important current questions in cosmology: (i) the study of the lens(es) - understanding cluster mass distributions and issues pertaining...

  7. The nongravitational interactions of dark matter in colliding galaxy clusters.

    Science.gov (United States)

    Harvey, David; Massey, Richard; Kitching, Thomas; Taylor, Andy; Tittley, Eric

    2015-03-27

    Collisions between galaxy clusters provide a test of the nongravitational forces acting on dark matter. Dark matter's lack of deceleration in the "bullet cluster" collision constrained its self-interaction cross section σ(DM)/m dark matter) for long-ranged forces. Using the Chandra and Hubble Space Telescopes, we have now observed 72 collisions, including both major and minor mergers. Combining these measurements statistically, we detect the existence of dark mass at 7.6σ significance. The position of the dark mass has remained closely aligned within 5.8 ± 8.2 kiloparsecs of associated stars, implying a self-interaction cross section σ(DM)/m < 0.47 cm(2)/g (95% CL) and disfavoring some proposed extensions to the standard model.

  8. Data of evolutionary structure change: 1E4XH-1JGUH [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E4XH-1JGUH 1E4X 1JGU H H QVQLQQPGAELVKPGASVKLSCKASGFTFTNYWMHWVKQ...EE EEE EEE EEEEEEEEEEE EEEEEEE EEEEEE --- 0... 1E4X H 1E4XHPHE CA 185 ARG CA 224 ILE CA 296 1E4X... H 1E4XH IGEILPSNGRT

  9. Data of evolutionary structure change: 1E4XI-1CF8H [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E4XI-1CF8H 1E4X 1CF8 I H QVQLQQPGAELVKPGPSVKLSCKASGFTFT-NYWMHWVK...EEE EEEEEEEEEE EEEEEEE EEEEEE - 0 1E4X... I 1E4XI...A 262 ASP CA 228 THR CA 300 ARG CA 287 1E4X... I 1E4XI

  10. Data of evolutionary structure change: 1E4XI-1LO3H [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E4XI-1LO3H 1E4X 1LO3 I H QVQLQQPGAELVKPGPSVKLSCKASGFTFTNYWMHWVKQ...EEEEEEEEEEHHHH EEEEEEE EEEEE - 0 1E4X... I 1E4XI ...6 LEU CA 230 ILE CA 298 TYR CA 288 1E4X... I 1E4XI GEILPSNGRTN

  11. Effect of electron-withdrawing power of the substituted group on ${}^{\\bullet}$OH radical reaction with substituted aryl sulphides: A pulse radiolysis study

    Indian Academy of Sciences (India)

    Hari Mohan

    2002-12-01

    In neutral aqueous solution of (phenylthio)acetic acid, hydroxyl radical is observed to react with a bimolecular rate constant of 7.2 × 109 dm3 mol-1 s-1 and the transient absorption bands are assigned to ${}^{\\bullet}$OH radical addition to benzene and sulphur with a rough estimated values of 50 and 40% respectively. The reaction of the ${}^{\\bullet}$OH radical with diphenyl sulphide ( = 4.3 × 108 dm3 mol-1 s-1) is observed to take place with formation of solute radical cation, OH-adduct at sulphur and benzene with estimated values of about 12, 28 and 60% respectively. The transient absorption bands observed on reaction of ${}^{\\bullet}$OH radical, in neutral aqueous solution of 4-(methylthio) phenyl acetic acid, are assigned to solute radical cation (max = 550 and 730 nm), OH-adduct at sulphur (max = 360 nm) and addition at benzene ring (max = 320 nm). The fraction of ${}^{\\bullet}$OH radical reacting to form solute radical cation is observed to depend on the electron-withdrawing power of substituted group. In acidic solutions, depending on the concentration of acid and electron-withdrawing power, solute radical cation is the only transient species formed on reaction of ${}^{\\bullet}$OH radical with the sulphides studied.

  12. The precessing jets of 1E 1740.7-2942

    Science.gov (United States)

    Luque-Escamilla, Pedro L.; Martí, Josep; Martínez-Aroza, José

    2015-12-01

    Context. The source 1E 1740.7-2942 is believed to be one of the two prototypical microquasars towards the Galactic center region whose X-ray states strongly resemble those of Cygnus X-1. Yet, the bipolar radio jets of 1E 1740.7-2942 are very reminiscent of a radio galaxy. The true nature of the object has thus remained an open question for nearly a quarter of a century. Aims: Our main goal here is to confirm the Galactic membership of 1E 1740.7-2942 by searching for morphological changes of its extended radio jets in human timescales. This work was triggered as a result of recent positive detection of fast structural changes in the large-scale jets of the very similar source GRS 1758-258. Methods: We carried out an in-depth exploration of the Very Large Array public archives and fully recalibrated all 1E 1740.7-2942 extended data sets in the C configuration of the array. We obtained and analyzed matching beam radio maps for five epochs, covering years 1992, 1993, 1994, 1997 and 2000, with an angular resolution of a few arcseconds. Results: We clearly detected structural changes in the arc-minute jets of 1E 1740.7-2942 on timescales of roughly a year, which set a firm distance upper limit of 12 kpc. Moreover, a simple precessing twin-jet model was simultaneously fitted to the five observing epochs available. The observed changes in the jet flow are strongly suggestive of a precession period of ~1.3 yr. Conclusions: The fitting of the precession model to the data yields a distance of ~5 kpc. This value, and the observed changes, rule out any remaining doubts about the 1E 1740.7-2942 Galactic nature. To our knowledge, this microquasar is the second whose jet precession ephemeris become available after SS433. This kind of information is relevant to the physics of compact objects, since the genesis of the precession phenomenon occurs very close to the interplay region between the accretion disk and the compact object in the system. Appendix A and a movie associated to

  13. Data Clustering

    Science.gov (United States)

    Wagstaff, Kiri L.

    2012-03-01

    On obtaining a new data set, the researcher is immediately faced with the challenge of obtaining a high-level understanding from the observations. What does a typical item look like? What are the dominant trends? How many distinct groups are included in the data set, and how is each one characterized? Which observable values are common, and which rarely occur? Which items stand out as anomalies or outliers from the rest of the data? This challenge is exacerbated by the steady growth in data set size [11] as new instruments push into new frontiers of parameter space, via improvements in temporal, spatial, and spectral resolution, or by the desire to "fuse" observations from different modalities and instruments into a larger-picture understanding of the same underlying phenomenon. Data clustering algorithms provide a variety of solutions for this task. They can generate summaries, locate outliers, compress data, identify dense or sparse regions of feature space, and build data models. It is useful to note up front that "clusters" in this context refer to groups of items within some descriptive feature space, not (necessarily) to "galaxy clusters" which are dense regions in physical space. The goal of this chapter is to survey a variety of data clustering methods, with an eye toward their applicability to astronomical data analysis. In addition to improving the individual researcher’s understanding of a given data set, clustering has led directly to scientific advances, such as the discovery of new subclasses of stars [14] and gamma-ray bursts (GRBs) [38]. All clustering algorithms seek to identify groups within a data set that reflect some observed, quantifiable structure. Clustering is traditionally an unsupervised approach to data analysis, in the sense that it operates without any direct guidance about which items should be assigned to which clusters. There has been a recent trend in the clustering literature toward supporting semisupervised or constrained

  14. On non-equilibrium atmospheric pressure plasma jets and plasma bullet

    Science.gov (United States)

    Lu, Xinpei

    2012-10-01

    Because of the enhanced plasma chemistry, atmospheric pressure nonequilibrium plasmas (APNPs) have been widely studied for several emerging applications such as biomedical applications. For the biomedical applications, plasma jet devices, which generate plasma in open space (surrounding air) rather than in confined discharge gaps only, have lots of advantages over the traditional dielectric barrier discharge (DBD) devices. For example, it can be used for root canal disinfection, which can't be realized by the traditional plasma device. On the other hand, currently, the working gases of most of the plasma jet devices are noble gases or the mixtures of the noble gases with small amount of O2, or air. If ambient air is used as the working gas, several serious difficulties are encountered in the plasma generation process. Amongst these are high gas temperatures and disrupting instabilities. In this presentation, firstly, a brief review of the different cold plasma jets developed to date is presented. Secondly, several different plasma jet devices developed in our lab are reported. The effects of various parameters on the plasma jets are discussed. Finally, one of the most interesting phenomena of APNP-Js, the plasma bullet is discussed and its behavior is described. References: [1] X. Lu, M. Laroussi, V. Puech, Plasma Sources Sci. Technol. 21, 034005 (2012); [2] Y. Xian, X. Lu, S. Wu, P. Chu, and Y. Pan, Appl. Phys. Lett. 100, 123702 (2012); [3] X. Pei, X. Lu, J. Liu, D. Liu, Y. Yang, K. Ostrikov, P. Chu, and Y. Pan, J. Phys. D 45, 165205 (2012).

  15. DOE-2, BDL summary. Version 2.1E

    Energy Technology Data Exchange (ETDEWEB)

    Winkelmann, F.C.; Birdsall, B.E.; Buhl, W.F.; Ellington, K.L.; Erdem, A.E. [Lawrence Berkeley Lab., CA (United States); Hirsch, J.J.; Gates, S. [Hirsch & Associates, Camarillo, CA (United States)

    1993-11-01

    This document contains summary information on all commands and keywords in the DOE-2 Building Description Language (BDL). It also contains supplementary tables and maps. The fundamentals of BDL are discussed in Chapter II of the Reference Manual (2.1A); detailed descriptions of the commands and keywords summarized here can be found in the Reference Manual (2.1A) and in the Supplement (2.1E).

  16. Cluster Chemistry

    Institute of Scientific and Technical Information of China (English)

    2011-01-01

    @@ Cansisting of eight scientists from the State Key Laboratory of Physical Chemistry of Solid Surfaces and Xiamen University, this creative research group is devoted to the research of cluster chemistry and creation of nanomaterials.After three-year hard work, the group scored a series of encouraging progresses in synthesis of clusters with special structures, including novel fullerenes, fullerene-like metal cluster compounds as well as other related nanomaterials, and their properties study.

  17. Storage and retrieval of (3+1)-dimensional weak-light bullets and vortices in a coherent atomic gas

    CERN Document Server

    Chen, Zhiming; Li, Hui-jun; Hang, Chao; Huang, Guoxiang

    2016-01-01

    A robust light storage and retrieval (LSR) in high dimensions is highly desirable for light and quantum information processing. However, most schemes on LSR realized up to now encounter problems due to not only dissipation, but also dispersion and diffraction, which make LSR with a very low fidelity. Here we propose a scheme to achieve a robust storage and retrieval of weak nonlinear high-dimensional light pulses in a coherent atomic gas via electromagnetically induced transparency. We show that it is available to produce stable (3+1)-dimensional light bullets and vortices, which have very attractive physical property and are suitable to obtain a robust LSR in high dimensions.

  18. A motion model for bullet penetrating gelatin%弹头侵彻明胶的运动模型

    Institute of Scientific and Technical Information of China (English)

    刘坤; 吴志林; 徐万和; 莫根林

    2012-01-01

    To research the motion of a bullet into the muscular tissue, the gelatin was used to simulate the muscular tissue. Based on the properties of the gelatin, a two-dimensional motion model was established for the projectile penetrating the gelatin in which reflecting the difference between attack angle and yaw angle. And the bullet motions in the horizontal and vertical directions -were taken into account in the established motion model. Based on the Runge-Kutta method, the motion model was calculated by choosing the ordinary bullets with the diameters of 7, 62 and 5. 80 mm, respectively, as killer elements. The calculated results were compared with the corresponding experimental results. Comparisons show lhat the two-dimensional motion model can describe the motion of the bullets penetrating the gelatin accurately. And the motion model established is of a certain commonality and can provide a theoretical reference for the ammunition design and the wound treatment.%为探讨弹头在肌肉组织中的运动规律,以明胶作为组织模拟物,结合明胶力学性质,在区别攻角和偏角的情况下,建立同时考虑水平和垂直方向弹头侵彻明胶的二维运动模型.以7.62 mm普通弹和5.8mm普通弹为杀伤元,根据龙格-库塔法原理对运动模型进行数值计算.同时,对2种弹丸侵彻明胶实验数据进行了对比分析.分析结果表明,该二维运动模型能够准确合理的描述2种弹丸侵彻明胶的运动过程,具有一定通用性,可为弹药设计和战伤救治提供理论参考.

  19. Clustered regression with unknown clusters

    CERN Document Server

    Barman, Kishor

    2011-01-01

    We consider a collection of prediction experiments, which are clustered in the sense that groups of experiments ex- hibit similar relationship between the predictor and response variables. The experiment clusters as well as the regres- sion relationships are unknown. The regression relation- ships define the experiment clusters, and in general, the predictor and response variables may not exhibit any clus- tering. We call this prediction problem clustered regres- sion with unknown clusters (CRUC) and in this paper we focus on linear regression. We study and compare several methods for CRUC, demonstrate their applicability to the Yahoo Learning-to-rank Challenge (YLRC) dataset, and in- vestigate an associated mathematical model. CRUC is at the crossroads of many prior works and we study several prediction algorithms with diverse origins: an adaptation of the expectation-maximization algorithm, an approach in- spired by K-means clustering, the singular value threshold- ing approach to matrix rank minimization u...

  20. Forensic Medical Peculiarities of Skin Damage Caused by a Large-Caliber Bullet Cartridge of Traumatic (Non-Lethal) Action “Teren-12P”

    OpenAIRE

    Sapielkin, V. V.

    2016-01-01

    The limitation of the database on the properties of the bullet cartridge of traumatic (non-lethal) action 12-gauge “Teren-12P” as well as the nature and peculiarities of injuries caused by it can lead to certain difficulties in the conduction of the complex forensic examinations when investigating their wide-scale use. Using pig skin and ballistic clay experimental shots from shotgun “Fort-500M” using bullet cartridge “Teren-12P” from a distance of 15 m were carried out. The obtained data wer...

  1. Subspace clustering through attribute clustering

    Institute of Scientific and Technical Information of China (English)

    Kun NIU; Shubo ZHANG; Junliang CHEN

    2008-01-01

    Many recently proposed subspace clustering methods suffer from two severe problems. First, the algorithms typically scale exponentially with the data dimensionality or the subspace dimensionality of clusters. Second, the clustering results are often sensitive to input parameters. In this paper, a fast algorithm of subspace clustering using attribute clustering is proposed to over-come these limitations. This algorithm first filters out redundant attributes by computing the Gini coefficient. To evaluate the correlation of every two non-redundant attributes, the relation matrix of non-redundant attributes is constructed based on the relation function of two dimensional united Gini coefficients. After applying an overlapping clustering algorithm on the relation matrix, the candidate of all interesting subspaces is achieved. Finally, all subspace clusters can be derived by clustering on interesting subspaces. Experiments on both synthesis and real datasets show that the new algorithm not only achieves a significant gain of runtime and quality to find subspace clusters, but also is insensitive to input parameters.

  2. X-1E Loaded in B-29 Mothership on Ramp

    Science.gov (United States)

    1955-01-01

    The Bell Aircraft Corporation X-1E airplane being loaded under the mothership, Boeing B-29. The X-planes had originally been lowered into a loading pit and the launch aircraft towed over the pit, where the rocket plane was hoisted by belly straps into the bomb bay. By the early 1950s a hydraulic lift had been installed on the ramp at the NACA High-Speed Flight Station to elevate the launch aircraft and then lower it over the rocket plane for mating.

  3. Advances in the Application of ICP-MS in Bullet Identiifcation%电感耦合等离子体质谱检验弹头研究进展

    Institute of Scientific and Technical Information of China (English)

    宋小娇; 郭洪玲; 梅宏成; 权养科

    2015-01-01

    本文简要介绍了电感耦合等离子体质谱仪(ICP-MS)的工作原理和几种常见的ICP-MS技术,综述了国外法庭科学领域应用ICP-MS技术分析弹头化学组成来推断弹头来源的研究成果,重点阐述了ICP-MS分析铅同位素组成在弹头检验中的应用,分析了国内在相关领域研究中存在的问题,指出研究国产弹头的铅同位素组成以及微量元素组成,并建立相关数据库,对推断弹头来源以及涉枪案件的侦破具有重要意义。%ABATRACT:In shooting cases, bullets are very important physical evidence. To link a bullet that has been ifred to a certain weapon, the most conclusive way is still by identifying the striation marks on bullet. However, quite often in casework, the marks comparison cannot be carried out. For example, the ifrearm is covered or the bullet is totally crushed, and only bullet fragments or particles remain in victims’ body or at the crime scene. In such circumstances, chemical analysis of bullet fragments or lead particles can play a pivotal role in helping to identify the source of the bullet. Usually, three kinds of chemistry comparisons can provide useful information: lead isotope ratios, the percentage of antimony and amounts of trace elements. Lead has four stable isotopes, namely204Pb,206Pb,207Pb and208Pb. The204Pb has no radioactive precursor, while the other three come from nuclear disintegration of238U,235U and232Th, respectively. The isotopic ratios of lead in bullets vary as a function of the age of the ore ifeld where lead was extracted, so isotopic composition analysis is reliable to distinguish the source of bullets. Antimony is added by manufacturers in different proportions to harden the bullet depending on the characteristics needed. Analysis of antimony content would contribute to conifrm the results obtained with the lead isotopic ratios measurement. The amounts of trace elements are relevant to lead origin and its manufacturing

  4. Test and Numerical Analysis for Penetration Residual Velocity of Bullet Considering Failure Strain Uncertainty of Composite Plates

    Energy Technology Data Exchange (ETDEWEB)

    Cha, Myungseok; Lee, Minhyung [Sejong Univ., Sejong (Korea, Republic of)

    2016-03-15

    The ballistic performance data of composite materials is distributed due to material inhomogeneity. In this paper, the uncertainty in residual velocity is obtained experimentally, and a method of predicting it is established numerically for the high-speed impact of a bullet into laminated composites. First, the failure strain distribution was obtained by conducting a tensile test using 10 specimens. Next, a ballistic impact test was carried out for the impact of a fragment-simulating projectile (FSP) bullet with 4ply ([0/90]s) and 8ply ([0/90/0/90]s) glass fiber reinforced plastic (GFRP) plates. Eighteen shots were made at the same impact velocity and the residual velocities were obtained. Finally, simulations were conducted to predict the residual velocities by using the failure strain distributions that were obtained from the tensile test. For this simulation, two impact velocities were chosen at 411.7m/s (4ply) and 592.5m/s (8ply). The simulation results show that the predicted residual velocities are in close agreement with test results. Additionally, the modeling of a composite plate with layered solid elements requires less calculation time than modeling with solid elements.

  5. High-Speed Bullet Ejections during the AGB to Planetary Nebula Transition: HST Observations of the Carbon Star, V Hydrae

    CERN Document Server

    Sahai, R; Morris, M R

    2016-01-01

    The well-studied carbon star, V Hya, showing evidence for high-speed, collimated outflows and dense equatorial structures, is a key object in the study of the poorly understood transition of AGB stars into aspherical planetary nebulae. Using the STIS instrument onboard HST, we have obtained high spatial-resolution long-slit optical spectra of V Hya that show high-velocity emission in [SII] and [FeII] lines. Our dataset, spanning three epochs spaced apart by a year during each of two periods (in 2002-2004 and 2011-2013), shows that V Hya ejects high-speed (about 200-250 km/s) bullets once every ~8.5 yr. The ejection axis flip-flops around a roughly eastern direction, both in and perpendicular to the sky-plane, and the radial velocities of the ejecta also vary in concert between low and high values. We propose a model in which the bullet ejection is associated with the periastron passage of a binary companion in an eccentric orbit around V Hya with an orbital period of ~8.5 yr. The flip-flop phenomenon is likel...

  6. Detection of lead nanoparticles in game meat by single particle ICP-MS following use of lead-containing bullets.

    Science.gov (United States)

    Kollander, Barbro; Widemo, Fredrik; Ågren, Erik; Larsen, Erik H; Loeschner, Katrin

    2017-03-01

    This study investigated whether game meat may contain nanoparticles of lead from ammunition. Lead nanoparticles in the range 40 to 750 nm were detected by ICP-MS in single particle mode in game shot with lead-containing bullets. The median diameter of the detected nanoparticles was around 60 nm. The particle mass concentration ranged from 290 to 340 ng/g meat and the particle number concentrations from 27 to 50 million particles/g meat. The size limit of detection strongly depended on the level of dissolved lead and was in the range of 40 to 80 nm. In game meat sampled more than 10 cm away from the wound channel, no lead particles with a diameter larger than 40 nm were detected. In addition to dissolved lead in meat that originated from particulates, the presence of lead nano particles in game meat represents a hitherto unattended source of lead with a largely unknown toxicological impact to humans. Graphical Abstract Detection of lead nanoparticles in game meat by single particle ICP-MS following use of leadcontaining bullets.

  7. Experimental research on the penetration of tungsten-fiber/metallic-glass matrix composite material bullet into steel target

    Directory of Open Access Journals (Sweden)

    Chen X.W.

    2012-08-01

    Full Text Available In the present paper, the penetration experiments of tungsten-fiber/metallic-glass matrix composite material bullets into 45# steel targets are conducted by employing H25 artillery. In which, an experimental technique of sub-caliber penetration is constructed. The quasi static and dynamic behaviours of tungsten-fiber/metallic-glass matrix composite material are also experimental investigated. The self-sharpening phenomenon of composite material is observed. Integrated with metallographic analysis, the failure modes of tungsten-fiber/metallic-glass matrix composite material are identified systemically and compared with the quasi-static and dynamic material tests. It includes four failure modes, i.e., shear fracture of tungsten fiber, brittle fracture of tungsten fiber and shear fracture of metallic glass matrix as well as melting of tungsten fiber and metallic glass matrix. Comparatively, three failure mechanisms of tungsten fiber in the bullet nose are also identified, i.e., shear fracture, splitting fracture and bending or/and buckling. Finally, the mechanism of self-sharpening behaviour of tungsten-fiber/metallic-glass matrix composite material is discussed.

  8. Combination of natural fiber Boehmeria nivea (ramie) with matrix epoxide for bullet proof vest body armor

    Science.gov (United States)

    Anggoro, Didi Dwi; Kristiana, Nunung

    2015-12-01

    Ballistic protection equipment, such as a bulletproof vest, is a soldier's most important means of preserving life and survivability in extreme combat conditions. The bulletproof vests are designed to protect the user's chest from injury without disturbing the ability to perform his duties. Aromatic polyamide or aramid fibers known under the trade name Kevlar, Trawon and so is synthetic fiber materials commonly used in the manufacture of bulletproof vests. This synthetic fibers have high tensile strength and ductility. Kevlar is expensive and imported material. In this study, will introduce local natural raw materials, ramie fiber (Boehmeria nivea) which is cheaper and environmentally friendly. It has enough tenacity and tensile strength as a bulletproof vest. This experiment uses two panels, there are Panel A as front surface of Panel B. Panel A is a combination of ramie and epoxide matrix, while panel B is only ramie. From several variations of experimental combinations between Panel A and Panel B, optimal combination obtained with 16 layers of panel A and 31-34 layers of panel B which is able to protect againts cal. 7.65 mm × 17 mm (.32 ACP) bullet fired through pistol .32 Pindad from a distance of 20 meters. Panel with a size of 20 cm × 20 cm has a total thickness between 12,922 to13,745 mm and a total weight between 506,26 to 520,926gram. Scanning electron microscopy (SEM) observations indicated that the porosity and surface area of the ramie fiber is smooth, fiber surfaces showed topography with micropores. SEM also showed well-arranged structure of fibers bonding. Energy Dispersive X-ray (EDX) analysis indicated 100 % carbon contents in ramie fiber. Test result indicates that panel from composite ramie-epoxide can reach the level 1of International Standard of NIJ - 010104. Compared to panel from polyester fiber, the panel from composite ramie-epoxide (0,50-0,52 kg) is lighter weight than panel polyester fiber (1,642 kg).

  9. Combination of natural fiber Boehmeria nivea (ramie) with matrix epoxide for bullet proof vest body armor

    Energy Technology Data Exchange (ETDEWEB)

    Anggoro, Didi Dwi, E-mail: anggorophd@gmail.com; Kristiana, Nunung, E-mail: nuna.c631@gmail.com [Master of Chemical Engineering, Faculty of Engineering, Diponegoro University Jln. Prof. Sudharto, Tembalang, Semarang, 50239 (Indonesia)

    2015-12-29

    Ballistic protection equipment, such as a bulletproof vest, is a soldier’s most important means of preserving life and survivability in extreme combat conditions. The bulletproof vests are designed to protect the user’s chest from injury without disturbing the ability to perform his duties. Aromatic polyamide or aramid fibers known under the trade name Kevlar, Trawon and so is synthetic fiber materials commonly used in the manufacture of bulletproof vests. This synthetic fibers have high tensile strength and ductility. Kevlar is expensive and imported material. In this study, will introduce local natural raw materials, ramie fiber (Boehmeria nivea) which is cheaper and environmentally friendly. It has enough tenacity and tensile strength as a bulletproof vest. This experiment uses two panels, there are Panel A as front surface of Panel B. Panel A is a combination of ramie and epoxide matrix, while panel B is only ramie. From several variations of experimental combinations between Panel A and Panel B, optimal combination obtained with 16 layers of panel A and 31-34 layers of panel B which is able to protect againts cal. 7.65 mm × 17 mm (.32 ACP) bullet fired through pistol .32 Pindad from a distance of 20 meters. Panel with a size of 20 cm × 20 cm has a total thickness between 12,922 to13,745 mm and a total weight between 506,26 to 520,926gram. Scanning electron microscopy (SEM) observations indicated that the porosity and surface area of the ramie fiber is smooth, fiber surfaces showed topography with micropores. SEM also showed well-arranged structure of fibers bonding. Energy Dispersive X-ray (EDX) analysis indicated 100 % carbon contents in ramie fiber. Test result indicates that panel from composite ramie-epoxide can reach the level 1of International Standard of NIJ - 010104. Compared to panel from polyester fiber, the panel from composite ramie-epoxide (0,50-0,52 kg) is lighter weight than panel polyester fiber (1,642 kg)

  10. Aging evaluation of class 1E batteries: Seismic testing

    Energy Technology Data Exchange (ETDEWEB)

    Edson, J.L. (EG and G Idaho, Inc., Idaho Falls, ID (USA))

    1990-08-01

    This report presents the results of a seismic testing program on naturally aged class 1E batteries obtained from a nuclear plant. The testing program is a Phase 2 activity resulting from a Phase 1 aging evaluation of class 1E batteries in safety systems of nuclear power plants, performed previously as a part of the US Nuclear Regulatory Commission's Nuclear Plant Aging Research Program and reported in NUREG/CR-4457. The primary purpose of the program was to evaluate the seismic ruggedness of naturally aged batteries to determine if aged batteries could have adequate electrical capacity, as determined by tests recommended by IEEE Standards, and yet have inadequate seismic ruggedness to provide needed electrical power during and after a safe shutdown earthquake (SSE) event. A secondary purpose of the program was to evaluate selected advanced surveillance methods to determine if they were likely to be more sensitive to the aging degradation that reduces seismic ruggedness. The program used twelve batteries naturally aged to about 14 years of age in a nuclear facility and tested them at four different seismic levels representative of the levels of possible earthquakes specified for nuclear plants in the United States. Seismic testing of the batteries did not cause any loss of electrical capacity. 19 refs., 29 figs., 7 tabs.

  11. Cosmology based on $f(R)$ gravity with ${\\cal O}(1)$ eV sterile neutrino

    CERN Document Server

    Chudaykin, A S; Starobinsky, A A; Burenin, R A

    2015-01-01

    We address the cosmological role of ${\\cal O}(1)$ eV sterile neutrino in modified gravity models. We confront the present cosmological data with the predictions of FLRW cosmological model based on a variant of $f(R)$ modified gravity proposed by one of the authors previously. This viable cosmological model which deviation from general relativity with an induced effective cosmological constant decreases as $R^{-2n}$ for large, but not too large values of the Ricci scalar $R$ provides an alternative to the bare cosmological constant explanation of the present dark energy and accelerated expansion of the Universe ($n=2$ is adopted). We used various up-to-date cosmological data sets including Planck CMB anisotropy, CMB lensing potential, BAO, cluster mass function and Hubble constant measurements. Using the low-z measurements of linear perturbation amplitude from galaxy cluster mass function data we find that sum of neutrino masses constrained by CMB+BAO data is not sufficient to compensate for the extra linear p...

  12. Cluster editing

    DEFF Research Database (Denmark)

    Böcker, S.; Baumbach, Jan

    2013-01-01

    . The problem has been the inspiration for numerous algorithms in bioinformatics, aiming at clustering entities such as genes, proteins, phenotypes, or patients. In this paper, we review exact and heuristic methods that have been proposed for the Cluster Editing problem, and also applications......The Cluster Editing problem asks to transform a graph into a disjoint union of cliques using a minimum number of edge modifications. Although the problem has been proven NP-complete several times, it has nevertheless attracted much research both from the theoretical and the applied side...

  13. Cluster analysis

    CERN Document Server

    Everitt, Brian S; Leese, Morven; Stahl, Daniel

    2011-01-01

    Cluster analysis comprises a range of methods for classifying multivariate data into subgroups. By organizing multivariate data into such subgroups, clustering can help reveal the characteristics of any structure or patterns present. These techniques have proven useful in a wide range of areas such as medicine, psychology, market research and bioinformatics.This fifth edition of the highly successful Cluster Analysis includes coverage of the latest developments in the field and a new chapter dealing with finite mixture models for structured data.Real life examples are used throughout to demons

  14. Weighted Clustering

    CERN Document Server

    Ackerman, Margareta; Branzei, Simina; Loker, David

    2011-01-01

    In this paper we investigate clustering in the weighted setting, in which every data point is assigned a real valued weight. We conduct a theoretical analysis on the influence of weighted data on standard clustering algorithms in each of the partitional and hierarchical settings, characterising the precise conditions under which such algorithms react to weights, and classifying clustering methods into three broad categories: weight-responsive, weight-considering, and weight-robust. Our analysis raises several interesting questions and can be directly mapped to the classical unweighted setting.

  15. Star formation in the massive cluster merger Abell 2744

    CERN Document Server

    Rawle, T D; Egami, E; Perez-Gonzalez, P G; Richard, J; Santos, J S; Valtchanov, I; Walth, G; Bouy, H; Haines, C P; Okabe, N

    2014-01-01

    We present a comprehensive study of star-forming (SF) galaxies in the HST Frontier Field recent cluster merger A2744 (z=0.308). Wide-field, ultraviolet-infrared (UV-IR) imaging enables a direct constraint of the total star formation rate (SFR) for 53 cluster galaxies, with SFR{UV+IR}=343+/-10 Msun/yr. Within the central 4 arcmin (1.1 Mpc) radius, the integrated SFR is complete, yielding a total SFR{UV+IR}=201+/-9 Msun/yr. Focussing on obscured star formation, this core region exhibits a total SFR{IR}=138+/-8 Msun/yr, a mass-normalised SFR{IR} of Sigma{SFR}=11.2+/-0.7 Msun/yr per 10^14 Msun and a fraction of IR-detected SF galaxies f{SF}=0.080(+0.010,-0.037). Overall, the cluster population at z~0.3 exhibits significant intrinsic scatter in IR properties (total SFR{IR}, Tdust distribution) apparently unrelated to the dynamical state: A2744 is noticeably different to the merging Bullet cluster, but similar to several relaxed clusters. However, in A2744 we identify a trail of SF sources including jellyfish galax...

  16. Simulations of the merging galaxy cluster Abell 3376

    CERN Document Server

    Machado, Rubens E G

    2013-01-01

    Observed galaxy clusters often exhibit X-ray morphologies suggestive of recent interaction with an infalling subcluster. Abell 3376 is a nearby (z=0.046) massive galaxy cluster whose bullet-shaped X-ray emission indicates that it may have undergone a recent collision. It displays a pair of Mpc-scale radio relics and its brightest cluster galaxy is located 970 h_70^-1 kpc away from the peak of X-ray emission, where the second brightest galaxy lies. We attempt to recover the dynamical history of Abell 3376. We perform a set of N-body adiabatic hydrodynamical simulations using the SPH code Gadget-2. These simulations of binary cluster collisions are aimed at exploring the parameter space of possible initial configurations. By attempting to match X-ray morphology, temperature, virial mass and X-ray luminosity, we set approximate constraints on some merger parameters. Our best models suggest a collision of clusters with mass ratio in the range 1/6-1/8, and having a subcluster with central gas density four times hi...

  17. Data of evolutionary structure change: 1E1QA-2HLDT [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E1QA-2HLDT 1E1Q 2HLD A T DLEETGRVLSIGDGIARVHGLRNVQAEEMVEFSSGLKGM...VDALVPIGRGQRELIIGDRQTGKTAVALDTILNQKRWNNGSDESKKLYCVYVAVGQKRSTVAQLVQTLEQHDAMKYSIIVAATASEAAPLQYLAPFTAASIGEWFRDN...bID> T 2HLDT ALKQVAGS

  18. Data of evolutionary structure change: 1E1RC-2HLDT [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E1RC-2HLDT 1E1R 2HLD C T ADTSVDLEETGRVLSIGDGIARVHGLRNVQAEEMVEFSS...VQTGLKAVDALVPIGRGQRELIIGDRQTGKTAVALDTILNQKRWNNGSDESKKLYCVYVAVGQKRSTVAQLVQTLEQHDAMKYSIIVAATASEAAPLQYLAPFTAASI... 2HLD T 2HLDT AAFAQ--

  19. Data of evolutionary structure change: 1E1RA-2HLDT [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E1RA-2HLDT 1E1R 2HLD A T DLEETGRVLSIGDGIARVHGLRNVQAEEMVEFSSGLKGM...VDALVPIGRGQRELIIGDRQTGKTAVALDTILNQKRWNNGSDESKKLYCVYVAVGQKRSTVAQLVQTLEQHDAMKYSIIVAATASEAAPLQYLAPFTAASIGEWFRDN...bChain>T 2HLDT ALKQVAGSLKLFL

  20. N2 Mole Fraction Dependence of Plasma Bullet Propagation in Premixed He/N2 Plasma Needle Discharge at Atmospheric Pressure

    Science.gov (United States)

    Ni, Gengsong; Qian, Muyang; Yang, Congying; Liu, Sanqiu; Wang, Dezhen

    2016-07-01

    In this work, a computational modeling study on the mechanism of the acceleration behavior of a plasma bullet in needle-plane configuration is presented. Above all, in our model, two sub-models of time-dependent plasma dynamics and laminar flow are connected using a oneway coupled method, and both the working gas and the surrounding gas around the plasma jet are assumed to be the same, which are premixed He/N2 gas. The mole fractions of the N2 (NMF) ingredient are set to be 0.01%, 0.1% and 1% in three cases, respectively. It is found that in each case, the plasma bullet accelerates with time to a peak velocity after it exits the nozzle and then decreases until getting to the treated surface, and that the velocity of the plasma bullet increases at each time moment with the peak value changing from 0.72×106 m/s to 0.80×106 m/s but then drops more sharply when the NMF varies from 0.01% to 1%. Besides, the electron impact ionizations of helium neutrals and nitrogen molecules are found to have key influences on the propagation of a plasma bullet instead of the penning ionization. supported by National Natural Science Foundation of China (No. 11465013), the Natural Science Foundation of Jiangxi Province, China (No. 20151BAB212012), and in part by the International Science and Technology Cooperation Program of China (No. 2015DFA61800)

  1. Water in low-mass star-forming regions with Herschel (WISH-LM): High-velocity H2O bullets in L1448-MM observed with HIFI

    CERN Document Server

    Kristensen, L E; Tafalla, M; Bachiller, R; Nisini, B; Liseau, R; Yildiz, U A

    2011-01-01

    Herschel-HIFI observations of water in the low-mass star-forming object L1448-MM, known for its prominent outflow, are presented, as obtained within the `Water in star-forming regions with Herschel' (WISH) key programme. Six H2-16O lines are targeted and detected (E_up/k_B ~ 50-250 K), as is CO J= 10-9 (E_up/k_B ~ 305 K), and tentatively H2-18O 110-101 at 548 GHz. All lines show strong emission in the "bullets" at |v| > 50 km/s from the source velocity, in addition to a broad, central component and narrow absorption. The bullets are seen much more prominently in H$_2$O than in CO with respect to the central component, and show little variation with excitation in H2O profile shape. Excitation conditions in the bullets derived from CO lines imply a temperature >150 K and density >10^5 cm^-3, similar to that of the broad component. The H2O/CO abundance ratio is similar in the "bullets" and the broad component, ~ 0.05-1.0, in spite of their different origins in the molecular jet and the interaction between the ou...

  2. BEST sensitivity to O(1) eV sterile neutrino

    CERN Document Server

    Barinov, Vladislav; Gorbunov, Dmitry; Ibragimova, Tatiana

    2016-01-01

    Numerous anomalous results in neutrino oscillation experiments can be attributed to interference of ~1 eV sterile neutrino. The specially designed to fully explore the Gallium anomaly Baksan Experiment on Sterile Transitions (BEST) starts next year. We investigate the sensitivity of BEST in searches for sterile neutrino mixed with electron neutrino. Then, performing the combined analysis of all the Gallium experiments (SAGE, GALLEX, BEST) we find the regions in model parameter space (sterile neutrino mass and mixing angle), which will be excluded if BEST agrees with no sterile neutrino hypothesis. For the opposite case, if BEST observes the signal as it follows from the sterile neutrino explanation of the Gallium (SAGE and GALLEX) anomaly, we show how BEST will improve upon the present estimates of the model parameters.

  3. DOE-2 supplement: Version 2.1E

    Energy Technology Data Exchange (ETDEWEB)

    Winkelmann, F.C.; Birdsall, B.E.; Buhl, W.F.; Ellington, K.L.; Erdem, A.E. [Lawrence Berkeley Lab., CA (United States); Hirsch, J.J.; Gates, S. [Hirsch (James J.) and Associates, Camarillo, CA (United States)

    1993-11-01

    This publication updates the DOE-2 Supplement form version 2.1D to version to 2.1E. It contains detailed discussions and instructions for using the features and enhancements introduced into the 2.1B, 2.1C, 2.1D, and 2.1E versions of the program. The building description section contains information on input functions in loads and systems, hourly report frequencies, saving files of hourly output for post processing, sharing hourly report data among program modules, the metric option, and input macros and general library features. The loads section contains information on sunspaces, sunspace modeling, window management and solar radiation, daylighting, trombe walls, fixed shades, fins and overhangs, shade schedules, self shades, heat distribution from lights, the Sherman-Grimsrud infiltrations method. terrain and height modification to wind speed, floor multipliers and interior wall types, improved exterior infrared radiation loss calculation, improved outside air film conductance calculation, window library, window frames, and switchable glazing. The systems section contains information on energy end use and meters, powered induction units, a packaged variable volume -- variable temperature system, a residential variable volume -- variable temperature system, air source heat pump enhancements, water loop heat pump enhancements, variable speed electric heat pump, gas heat pumps, hot water heaters, evaporative cooling, total gas solid-desiccant systems, add on desiccant cooling, water cooled condensers, evaporative precoolers outside air economizer control, optimum fan start, heat recovery from refrigerated case work, night ventilation, baseboard heating, moisture balance calculations, a residential natural ventilation algorithm, improved cooling coil model, system sizing and independent cooling and heating sizing ratios. The plant section contains information on energy meters, gas fired absorption chillers, engine driven compressor chillers, and ice energy storage.

  4. Implications for wildlife and humans of dietary exposure to lead from fragments of lead rifle bullets in deer shot in the UK

    Energy Technology Data Exchange (ETDEWEB)

    Knott, Jeff, E-mail: jeff.knott@rspb.org.uk [Royal Society for the Protection of Birds, The Lodge, Sandy, Bedfordshire SG19 2DL (United Kingdom); Gilbert, Jo; Hoccom, David G. [Royal Society for the Protection of Birds, The Lodge, Sandy, Bedfordshire SG19 2DL (United Kingdom); Green, Rhys E. [Royal Society for the Protection of Birds, The Lodge, Sandy, Bedfordshire SG19 2DL (United Kingdom); Conservation Science Group, Department of Zoology, University of Cambridge, Downing Street, Cambridge CB2 3EJ (United Kingdom)

    2010-12-01

    Lead poisoning caused by ingested spent lead shotgun pellets has long been known to be a cause of unnecessary mortality in waterfowl and has led to legislation limiting its use in many countries. Recent evidence has shown that the problem extends to terrestrial ecosystems and to fragmented rifle bullets eaten by scavengers as well as shotgun pellets. Dietary exposure of human consumers to lead from spent ammunition in game meat also poses potential risks to human health. To assess the degree of fragmentation of lead bullets used to kill wild deer, twelve deer were shot in the thorax using copper-jacketed lead-cored bullets, as part of planned deer management operations. The thoracic region of the eviscerated carcasses and the abdominal viscera of each deer were X-rayed. An average of 356 metal fragments was visible on radiographs of the carcass and 180 fragments in the viscera. The weight of fragments was estimated by reference to an X-rayed scale of fragments of known weight. The average total weight of metal fragments, likely to be mostly lead, was estimated to be 1.2 g for the carcass and 0.2 g for the viscera. The total estimated weight of fragments in the entire carcass was estimated to be 17% of the weight of the bullet. Most fragments were small in size, with those in the viscera being smaller than those in the carcass. Metal fragments in the viscera were sufficiently small that at least 80% of the metallic bullet-derived lead in the viscera would be expected to be ingested by scavenging birds, such as buzzards and eagles, which feed on them.

  5. Data of evolutionary structure change: 1E1QC-2HLDA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E1QC-2HLDA 1E1Q 2HLD C A ADTSVDLEETGRVLSIGDGIARVHGLRNVQAEEMVEFSS...ELFYKGIRPAINVGLSVSRVGSAAQTRAMKQVAGTMKLELAQYREVAAFAQFGSDLDAATQQLLSRGVRLTELLKQGQYSPMAIEEQVAVIYAGVRGYLDKLEPSKIT...RPAINVGLSVSRVGSAAQVKALKQVAGSLKLFLAQYREVAAFAQS--DLDASTKQTLVRGERLTQLLKQNQYSPLATEEQV...> 0 2HLD A 2HLDA AFAQS--DLDA...ain> 1E1Q C 1E1QC AFAQFGSDLDA

  6. The Dream About the Magic Silver Bullet – the Complexity of Designing for Tablet-Mediated Learning

    DEFF Research Database (Denmark)

    Jahnke, Isa; Svendsen, Niels Vandel; Johansen, Simon Kristoffer

    2014-01-01

    of reducing it. The teachers must learn how to navigate during the breakdowns before media tablets reduce complexity and reach a state in which the tablets take part in the classroom ecology as functional organs. The teachers have to deal with complex situations during class in situ. In order to be able......In this paper, we report three cases of the integration of technology, such as web-enabled media tablets in Scandinavian schools. Both qualitative and quantitative data have been applied. A daily challenge for teachers is to coordinate their group of students in a way that enables collaborative...... learning. We report the gaps and interrelations between the dreams and the practice of the teachers. They dream about an interconnected praxis – the magic silver bullet – and establish their visions of inter- connectivity because of their breakdown experiences of media tablets aiding complexity instead...

  7. Fuzzy Clustering

    DEFF Research Database (Denmark)

    Berks, G.; Keyserlingk, Diedrich Graf von; Jantzen, Jan;

    2000-01-01

    and clustering are the basic concerns in medicine. Classification depends on definitions of the classes and their required degree of participant of the elements in the cases' symptoms. In medicine imprecise conditions are the rule and therefore fuzzy methods are much more suitable than crisp ones. Fuzzy c....... A symptom may belong to more than one class. For instance to the class of very severe disease and to the class of failure of awareness of the own disturbance. The description of language failures by c-mean classification of analyzed factors correspond in many but not in all cases to the traditional......-mean clustering is an easy and well improved tool, which has been applied in many medical fields. We used c-mean fuzzy clustering after feature extraction from an aphasia database. Factor analysis was applied on a correlation matrix of 26 symptoms of language disorders and led to five factors. The factors...

  8. Estrogen sulfotransferase/SULT1E1 promotes human adipogenesis.

    Science.gov (United States)

    Ihunnah, Chibueze A; Wada, Taira; Philips, Brian J; Ravuri, Sudheer K; Gibbs, Robert B; Kirisci, Levent; Rubin, J Peter; Marra, Kacey G; Xie, Wen

    2014-05-01

    Estrogen sulfotransferase (EST/SULT1E1) is known to catalyze the sulfoconjugation and deactivation of estrogens. The goal of this study is to determine whether and how EST plays a role in human adipogenesis. By using human primary adipose-derived stem cells (ASCs) and whole-fat tissues from the abdominal subcutaneous fat of obese and nonobese subjects, we showed that the expression of EST was low in preadipocytes but increased upon differentiation. Overexpression and knockdown of EST in ASCs promoted and inhibited differentiation, respectively. The proadipogenic activity of EST in humans was opposite to the antiadipogenic effect of the same enzyme in rodents. Mechanistically, EST promoted adipogenesis by deactivating estrogens. The proadipogenic effect of EST can be recapitulated by using an estrogen receptor (ER) antagonist or ERα knockdown. In contrast, activation of ER in ASCs inhibited adipogenesis by decreasing the recruitment of the adipogenic peroxisome proliferator-activated receptor γ (PPARγ) onto its target gene promoters, whereas ER antagonism increased the recruitment of PPARγ to its target gene promoters. Linear regression analysis revealed a positive correlation between the expression of EST and body mass index (BMI), as well as a negative correlation between ERα expression and BMI. We conclude that EST is a proadipogenic factor which may serve as a druggable target to inhibit the turnover and accumulation of adipocytes in obese patients.

  9. Site of entrance wound and direction of bullet path in firearm fatalities as indicators of homicide versus suicide.

    Science.gov (United States)

    Druid, H

    1997-08-04

    In a retrospective study, 288 firearm deaths were analysed to identify factors indicating homicide. The cases were classified as suicides (213), homicides (54), accidents (14) and undetermined cases (7). A number of factors, related to the circumstances and the autopsy findings, were studied. Whereas 41% of the homicide victims were females, women only constituted 1.4% of the suicide victims. The mean age was 37 and 50 years among homicide and suicide victims, respectively. Most suicides were committed at or in the vicinity of the residence, whereas a majority of the homicides occurred elsewhere. The majority of the suicide victims had either left a suicide note or had medical records of previous psychiatric illness. In all groups, shotguns were the most frequent weapon used. Fifty-seven percent of the homicide victims, but only three percent of the suicide victims had sustained more than one gunshot wound. One-third of the homicide victims were shot at close range. Alcohol was present in one-third of both homicide and suicide victims. Whereas 38% of the homicidal gunshot wounds had their entrances at anatomical regions typical of suicide, the direction of the bullet path often differed from the directions recorded in suicides. Hence, in this material, an entrance wound in the right temple indicated suicide, but in combination with a direction back-to-front, the wound was more likely to be homicidal. This study suggests that an estimation of the direction of the internal bullet path should be conducted in firearm fatalities, and that this factor may assist in the determination of the manner of death.

  10. Quotients of cluster categories

    OpenAIRE

    Jorgensen, Peter

    2007-01-01

    Higher cluster categories were recently introduced as a generalization of cluster categories. This paper shows that in Dynkin types A and D, half of all higher cluster categories are actually just quotients of cluster categories. The other half can be obtained as quotients of 2-cluster categories, the "lowest" type of higher cluster categories. Hence, in Dynkin types A and D, all higher cluster phenomena are implicit in cluster categories and 2-cluster categories. In contrast, the same is not...

  11. Investigation about the influence of the mechanical properties of lead core and brass jacket of a NATO 7.62 mm ball bullet in numerical simulations of ballistic impacts

    Directory of Open Access Journals (Sweden)

    Scapin M.

    2012-08-01

    Full Text Available In the present work a validated numerical approach has been used in order to build a robust and reliable FE model of the impact of a NATO 7.62 mm ball bullet, against an aluminium transmission shaft. The bullet is a full metal jacket type, with a lead alloy core and a brass jacket. Target shaft is made by an Al6061-T6 aluminium alloy. According to the soft core (lead alloy of the bullet, most effort has been spent in order to evaluate the effect of bullet materials mechanical properties on the numerical results. Numerical analyses, carried out using the non-linear dynamic finite element solver Abaqus∖Explicit 6.10, have been performed focusing on core and jacket material behaviour (target material, Al6061-T6, has been previously calibrated by the authors. Thus numerical analyses have been performed considering for the mechanical behaviour of the bullet both a simplified approach (as reported in literature and new material data (with strain rate effect obtained by means of experimental tests on the two materials (lead and brass with specimens cut directly from the bullet. Finally the results of the analyses have been compared with real experimental ballistic tests.

  12. Investigation about the influence of the mechanical properties of lead core and brass jacket of a NATO 7.62 mm ball bullet in numerical simulations of ballistic impacts

    Science.gov (United States)

    Giglio, M.; Gilioli, A.; Manes, A.; Peroni, L.; Scapin, M.

    2012-08-01

    In the present work a validated numerical approach has been used in order to build a robust and reliable FE model of the impact of a NATO 7.62 mm ball bullet, against an aluminium transmission shaft. The bullet is a full metal jacket type, with a lead alloy core and a brass jacket. Target shaft is made by an Al6061-T6 aluminium alloy. According to the soft core (lead alloy) of the bullet, most effort has been spent in order to evaluate the effect of bullet materials mechanical properties on the numerical results. Numerical analyses, carried out using the non-linear dynamic finite element solver Abaqus∖Explicit 6.10, have been performed focusing on core and jacket material behaviour (target material, Al6061-T6, has been previously calibrated by the authors). Thus numerical analyses have been performed considering for the mechanical behaviour of the bullet both a simplified approach (as reported in literature) and new material data (with strain rate effect) obtained by means of experimental tests on the two materials (lead and brass) with specimens cut directly from the bullet. Finally the results of the analyses have been compared with real experimental ballistic tests.

  13. Regional Innovation Clusters

    Data.gov (United States)

    Small Business Administration — The Regional Innovation Clusters serve a diverse group of sectors and geographies. Three of the initial pilot clusters, termed Advanced Defense Technology clusters,...

  14. Cluster forcing

    DEFF Research Database (Denmark)

    Christensen, Thomas Budde

    -industrialism and the ‘liveable' region. In this paper the cluster strategies that have been applied to the automotive sector in Wales are analysed. The paper includes a theoretical discussion on how the cluster concept has been applied to industrial policies, along with an empirical analysis of the application of the concept...... automotive sector in Wales. The paper draws from a survey of Welsh automotive suppliers on the characteristics of the local business environment and innovation. On the basis of the survey it is concluded that the public sector has an important task ahead concerning the linkages between universities and local...... businesses. The universities were not considered by the participating companies to be important parts of the local business environment and inputs from universities did not appear to be an important source to access knowledge about new product development or new techniques in production, distribution...

  15. CRH2型动车组辅助电源系统故障分析%Fault analysis of auxiliary power system in CRH2 bullet train

    Institute of Scientific and Technical Information of China (English)

    李向超; 王亦军

    2013-01-01

    探讨了300 km速度级CRH2C型动车组辅助电源系统的供电电压、工作原理以及内部构成。针对CRH2C型动车组辅助电源系统的常见故障,分析了故障发生的原因,并提出了有效的应急处理措施。%The supply voltage, working principle and internal structure of auxiliary power supply system in 300 km/h grade CRH2C bullet train are discussed. The common fault causes of auxiliary power supply system in CRH2C bullet train are analyzed. The effective emergent measures for the fault treatment are put forward.

  16. Hybrid treatment of bullet embolism at the abdominal aortic bifurcation, complicated with thoracoabdominal aorta pseudoaneurysm and common iliac artery occlusion: case report

    Directory of Open Access Journals (Sweden)

    Patrick Bastos Metzger

    2014-03-01

    Full Text Available Embolization due to a firearm projectile entering the bloodstream is a rare event that is unlikely to be suspected during initial treatment of trauma patients. We describe and discuss a case of bullet embolism of the abdominal aortic bifurcation, complicated by a pseudoaneurysm of the thoracoabdominal aorta and occlusion of the right common iliac artery, but successfully treated using a combination of endovascular methods and conventional surgery.

  17. Data of evolutionary structure change: 1E1QC-2HLDT [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E1QC-2HLDT 1E1Q 2HLD C T ADTSVDLEETGRVLSIGDGIARVHGLRNVQAEEMVEFSS...VQTGLKAVDALVPIGRGQRELIIGDRQTGKTAVALDTILNQKRWNNGSDESKKLYCVYVAVGQKRSTVAQLVQTLEQHDAMKYSIIVAATASEAAPLQYLAPFTAASI...yChain> 2HLD T 2HLDT VAAFA---QDLD

  18. Data of evolutionary structure change: 1E1QB-2HLDT [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E1QB-2HLDT 1E1Q 2HLD B T DLEETGRVLSIGDGIARVHGLRNVQAEEMVEFSSGLKGM...SDRLVKEGELVKRTGNIVDVPVGPGLLGRVVDALGNPIDGKGPIDAAGRSRAQVKAPGILPRRSVHEPVQTGLKAVDALVPIGRGQRELIIGDRQTGKTAVALDT...dbChain> 2HLDT ALKQVAGSLKLFL 2HLD T 2HLDT VAAFAQDLDAST

  19. Data of evolutionary structure change: 1E1RB-2HLDT [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E1RB-2HLDT 1E1R 2HLD B T DLEETGRVLSIGDGIARVHGLRNVQAEEMVEFSSGLKGM...SDRLVKEGELVKRTGNIVDVPVGPGLLGRVVDALGNPIDGKGPIDAAGRSRAQVKAPGILPRRSVHEPVQTGLKAVDALVPIGRGQRELIIGDRQTGKTAVALDT...T 2HLDT ALKQVAGSLKLFL2HLD T 2HLDT VAAFAQDLDAST

  20. Data of evolutionary structure change: 1E0UC-3G2GD [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E0UC-3G2GD 1E0U 3G2G C D ----------------------------MKKTKIVCTIG...PKTESEEMLAKMLDAGMNVMRLNFSHGDYAEHGQRIQNLRNVMSKT------GKTAAILLDTKGPEIRTMKLEGGNDVSLKAGQTFTFTTDKSVI--GNSEMVAVTYE...GFTTDLSVGNTVLVDDGLIGMEVTAIEGNKVICKVLNNGDLGENKGVNLPGVSIALPALAEKDKQDLIFGCEQGVDFVAASFIRKRSDVIEIREHLKAHGGENIHIIS...KIENQEGLNNFDEILEASDGIMVARGDLGVEIPVEEVIFAQKMMIEKCIRALKVVITATMMLDSMIKNPRPTRAEAGDVAN...TAHQLVLSKGVVPQLV--KEITSTDDFYR----LGKELALQSGLAHKGDVVVMVSGALVPSGTTNTASVHVL- QTQQLHAAMADTFLEHMCRLD

  1. Data of evolutionary structure change: 1ANTI-1E04L [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1ANTI-1E04L 1ANT 1E04 I L ---------RDIPMNPMCIYRSPEKKATNRRVWELSKANSRFATTFYQHLADSKNDNDNIFLSPLSISTAFAMTKLGACNDTLQQLMEVFKFDTISEKTSDQIHFFFAKLNCRLYRKANKSSKLVSANRLFGDKSLTFNETYQDISE... 1ANT I 1ANTI AASTA--...4> 1ANT I 1ANTI ...line>VAL CA 395 1ANT I 1ANTI

  2. Data of evolutionary structure change: 1E1RC-2HLDA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E1RC-2HLDA 1E1R 2HLD C A ADTSVDLEETGRVLSIGDGIARVHGLRNVQAEEMVEFSS...ELFYKGIRPAINVGLSVSRVGSAAQTRAMKQVAGTMKLELAQYREVAAFAQFGSDLDAATQQLLSRGVRLTELLKQGQYSPMAIEEQVAVIYAGVRGYLDKLEPSKIT...RPAINVGLSVSRVGSAAQVKALKQVAGSLKLFLAQYREVAAFAQS--DLDASTKQTLVRGERLTQLLKQNQYSPLATEEQV...fEVID> 0 2HLD A 2HLDA AFAQS--DLDAS GGG -- HH

  3. Comparison of gunshot entrance morphologies caused by .40-caliber Smith & Wesson, .380-caliber, and 9-mm Luger bullets: a finite element analysis study.

    Directory of Open Access Journals (Sweden)

    Rodrigo Ivo Matoso

    Full Text Available Firearms can cause fatal wounds, which can be identified by traces on or around the body. However, there are cases where neither the bullet nor gun is found at the crime scene. Ballistic research involving finite element models can reproduce computational biomechanical conditions, without compromising bioethics, as they involve no direct tests on animals or humans. This study aims to compare the morphologies of gunshot entrance holes caused by.40-caliber Smith & Wesson (S&W, .380-caliber, and 9×19-mm Luger bullets. A fully metal-jacketed.40 S&W projectile, a fully metal-jacketed.380 projectile, and a fully metal-jacketed 9×19-mm Luger projectile were computationally fired at the glabellar region of the finite element model from a distance of 10 cm, at perpendicular incidence. The results show different morphologies in the entrance holes produced by the three bullets, using the same skull at the same shot distance. The results and traits of the entrance holes are discussed. Finite element models allow feasible computational ballistic research, which may be useful to forensic experts when comparing and analyzing data related to gunshot wounds in the forehead.

  4. Comparison of Gunshot Entrance Morphologies Caused by .40-Caliber Smith & Wesson, .380-Caliber, and 9-mm Luger Bullets: A Finite Element Analysis Study

    Science.gov (United States)

    Matoso, Rodrigo Ivo; Freire, Alexandre Rodrigues; Santos, Leonardo Soriano de Mello; Daruge Junior, Eduardo; Rossi, Ana Claudia; Prado, Felippe Bevilacqua

    2014-01-01

    Firearms can cause fatal wounds, which can be identified by traces on or around the body. However, there are cases where neither the bullet nor gun is found at the crime scene. Ballistic research involving finite element models can reproduce computational biomechanical conditions, without compromising bioethics, as they involve no direct tests on animals or humans. This study aims to compare the morphologies of gunshot entrance holes caused by.40-caliber Smith & Wesson (S&W), .380-caliber, and 9×19-mm Luger bullets. A fully metal-jacketed.40 S&W projectile, a fully metal-jacketed.380 projectile, and a fully metal-jacketed 9×19-mm Luger projectile were computationally fired at the glabellar region of the finite element model from a distance of 10 cm, at perpendicular incidence. The results show different morphologies in the entrance holes produced by the three bullets, using the same skull at the same shot distance. The results and traits of the entrance holes are discussed. Finite element models allow feasible computational ballistic research, which may be useful to forensic experts when comparing and analyzing data related to gunshot wounds in the forehead. PMID:25343337

  5. The non-gravitational interactions of dark matter in colliding galaxy clusters

    CERN Document Server

    Harvey, David; Kitching, Thomas; Taylor, Andy; Tittley, Eric

    2015-01-01

    Collisions between galaxy clusters provide a test of the non-gravitational forces acting on dark matter. Dark matter's lack of deceleration in the `bullet cluster collision' constrained its self-interaction cross-section \\sigma_DM/m < 1.25cm2/g (68% confidence limit) for long-ranged forces. Using the Chandra and Hubble Space Telescopes we have now observed 72 collisions, including both `major' and `minor' mergers. Combining these measurements statistically, we detect the existence of dark mass at 7.6\\sigma significance. The position of the dark mass has remained closely aligned within 5.8+/-8.2 kpc of associated stars: implying a self-interaction cross-section \\sigma_DM/m < 0.47 cm2/g (95% CL) and disfavoring some proposed extensions to the standard model.

  6. Big Bangs in Galaxy Clusters: Using X-ray Temperature Maps to Trace Merger Histories in Clusters with Radio Halos/Relics

    Science.gov (United States)

    Burns, Jack O.; Datta, Abhirup; Hallman, Eric J.

    2016-06-01

    Galaxy clusters are assembled through large and small mergers which are the most energetic events ("bangs") since the Big Bang. Cluster mergers "stir" the intracluster medium (ICM) creating shocks and turbulence which are illuminated by ~Mpc-sized radio features called relics and halos. These shocks heat the ICM and are detected in x-rays via thermal emission. Disturbed morphologies in x-ray surface brightness and temperatures are direct evidence for cluster mergers. In the radio, relics (in the outskirts of the clusters) and halos (located near the cluster core) are also clear signposts of recent mergers. Our recent ENZO cosmological simulations suggest that around a merger event, radio emission peaks very sharply (and briefly) while the x-ray emission rises and decays slowly. Hence, a sample of galaxy clusters that shows both luminous x-ray emission and radio relics/halos are good candidates for very recent mergers. We are in the early stages of analyzing a unique sample of 48 galaxy clusters with (i) known radio relics and/or halos and (ii) significant archival x-ray observations (>50 ksec) from Chandra and/or XMM. We have developed a new x-ray data analysis pipeline, implemented on parallel processor supercomputers, to create x-ray surface brightness, high fidelity temperature, and pressure maps of these clusters in order to study merging activity. The temperature maps are made using three different map-making techniques: Weighted Voronoi Tessellation, Adaptive Circular Binning, and Contour Binning. In this talk, we will show preliminary results for several clusters, including Abell 2744 and the Bullet cluster. This work is supported by NASA ADAP grant NNX15AE17G.

  7. Research on the Anti-Bullet Properties of Aerogel Composite Materials%气凝胶复合材料抗弹性能的研究

    Institute of Scientific and Technical Information of China (English)

    杨杰; 李树奎; 王富耻

    2011-01-01

    使用球形弹丸对硅气凝胶、有机气凝胶和碳气凝胶复合材料进行靶试实验,研究3种气凝胶复合材料的抗弹性能.实验表明:气凝胶作为面板可以有效提高复合靶板的抗弹能力;在子弹冲击过程中,气凝胶表现出明显的应变率强化效应,吸收子弹动能的能力显著提高;当气凝胶作为夹层,铝合金为面板和背板时,面板由于没有足够的背强作用而发生弯曲破坏,导致靶板整体抗弹性能提高不明显;有机气凝胶具有较高的动态压缩强度和较大的动态失效应变,因此其抗弹性能较好;硅气凝胶的动态压缩强度虽然低于碳气凝胶的动态压缩强度,但是其动态失效应变高于碳气凝胶的动态失效应变,因此硅气凝胶与碳气凝胶的抗弹能力相当.%Anti-bullet properties of silica aerogel, organic aerogel and carbon aerogel composite materials were investigated by target experiment using spherical projectile. Results show that when aerogels are used as faceplate, aerogels could improve the anti-bullet property of composite target obviously. Aerogels display a remarkable strain rate strengthening effect when they are impacted by projectile, which could improve the energy absorption capability of aerogels. When aerogels are sandwiched by aluminum alloy, aluminum alloy faceplate fails by bend due to the insufficient support of the aerogels interlayer, thus the anti-bullet property of composite target improves slightly. Organic aerogel has relatively high dynamic compressive strength and high dynamic failure strain, thus the anti-bullet property of organic aerogel is better than other aerogels. Silica aerogel has lower dynamic compressive strength than carbon aerogel. However, the dynamic failure strain of silica aerogel is higher than that of carbon aerogel. Thus the anti bullet property of silica aerogel is similar to that of carbon aerogel.

  8. An Automatic Clustering Technique for Optimal Clusters

    CERN Document Server

    Pavan, K Karteeka; Rao, A V Dattatreya; 10.5121/ijcsea.2011.1412

    2011-01-01

    This paper proposes a simple, automatic and efficient clustering algorithm, namely, Automatic Merging for Optimal Clusters (AMOC) which aims to generate nearly optimal clusters for the given datasets automatically. The AMOC is an extension to standard k-means with a two phase iterative procedure combining certain validation techniques in order to find optimal clusters with automation of merging of clusters. Experiments on both synthetic and real data have proved that the proposed algorithm finds nearly optimal clustering structures in terms of number of clusters, compactness and separation.

  9. Decrystallization of Crystals Using Gold "Nano-Bullets" and the Metal-Assisted and Microwave-Accelerated Decrystallization Technique.

    Science.gov (United States)

    Thompson, Nishone; Boone-Kukoyi, Zainab; Shortt, Raquel; Lansiquot, Carisse; Kioko, Bridgit; Bonyi, Enock; Toker, Salih; Ozturk, Birol; Aslan, Kadir

    2016-10-18

    Gout is caused by the overproduction of uric acid and the inefficient metabolism of dietary purines in humans. Current treatments of gout, which include anti-inflammatory drugs, cyclooxygenase-2 inhibitors, and systemic glucocorticoids, have harmful side-effects. Our research laboratory has recently introduced an innovative approach for the decrystallization of biological and chemical crystals using the Metal-Assisted and Microwave-Accelerated Evaporative Decrystallization (MAMAD) technique. In the MAMAD technique, microwave energy is used to heat and activate gold nanoparticles that behave as "nano-bullets" to rapidly disrupt the crystal structure of biological crystals placed on planar surfaces. In this study, crystals of various sizes and compositions were studied as models for tophaceous gout at different stages (i.e., uric acid as small crystals (~10-100 μm) and l-alanine as medium (~300 μm) and large crystals (~4400 μm). Our results showed that the use of the MAMAD technique resulted in the reduction of the size and number of uric acid and l-alanine crystals up to >40% when exposed to intermittent microwave heating (up to 20 W power at 8 GHz) in the presence of 20 nm gold nanoparticles up to 120 s. This study demonstrates that the MAMAD technique can be potentially used as an alternative therapeutic method for the treatment of gout by effective decrystallization of large crystals, similar in size to those that often occur in gout.

  10. Environment and air pollution like gun and bullet for low-income countries: war for better health and wealth.

    Science.gov (United States)

    Zou, Xiang; Azam, Muhammad; Islam, Talat; Zaman, Khalid

    2016-02-01

    The objective of the study is to examine the impact of environmental indicators and air pollution on "health" and "wealth" for the low-income countries. The study used a number of promising variables including arable land, fossil fuel energy consumption, population density, and carbon dioxide emissions that simultaneously affect the health (i.e., health expenditures per capita) and wealth (i.e., GDP per capita) of the low-income countries. The general representation for low-income countries has shown by aggregate data that consist of 39 observations from the period of 1975-2013. The study decomposes the data set from different econometric tests for managing robust inferences. The study uses temporal forecasting for the health and wealth model by a vector error correction model (VECM) and an innovation accounting technique. The results show that environment and air pollution is the menace for low-income countries' health and wealth. Among environmental indicators, arable land has the largest variance to affect health and wealth for the next 10-year period, while air pollution exerts the least contribution to change health and wealth of low-income countries. These results indicate the prevalence of war situation, where environment and air pollution become visible like "gun" and "bullet" for low-income countries. There are required sound and effective macroeconomic policies to combat with the environmental evils that affect the health and wealth of the low-income countries.

  11. Terahertz brightness at the extreme: demonstration of 5 GV/m, 17 T low frequency {\\lambda}3 terahertz bullet

    CERN Document Server

    Shalaby, Mostafa

    2014-01-01

    The brightness of a light source defines its applicability to nonlinear phenomena in science. Bright low frequency terahertz (< 5THz) radiation confined to a diffraction-limited spot size is a present hurdle due to the broad bandwidth and long wavelengths associated with single-cycle terahertz pulses as well as due to the lack of terahertz wavefront correctors. Here, using a present-technology system, we employ a new concept of terahertz wavefront manipulation and focusing optimization. We demonstrate a spatio-temporal confinement of terahertz energy at its physical limits to the least possible 3-dimensional light bullet volume of lambda cubic. This leads to a new regime of extremely bright terahertz radiation reaching 40 PW/m2 intensity. The presented work is focused on the sub-5 THz range using small aperture organic crystals DSTMS and OH1. The obtained peak field of up to 5 GV/m and 17 Tesla is order of magnitude higher than any reported single-cycle field oscillation in the entire THz range from a lase...

  12. Metazoan parasites in the head region of the bullet tuna Auxis rochei (Osteichthyes: Scombridae) from the western Mediterranean Sea.

    Science.gov (United States)

    Mele, S; Saber, S; Gómez-Vives, M J; Garippa, G; Alemany, F; Macías, D; Merella, P

    2015-11-01

    The head region of 72 bullet tuna Auxis rochei from the western Mediterranean Sea (south-east Spain and the Strait of Gibraltar) was examined for parasites. Seven metazoan species were found in the fish from south-east Spain: three monogeneans, two trematodes and two copepods, whereas only three species were isolated in the fish from the Strait of Gibraltar. A comparison of the levels of infection of the parasites according to fish size in south-east Spain showed that the prevalence of Didymozoon auxis and the mean abundance of Allopseudaxine macrova were higher in the larger hosts (range of fork length = 38-44 cm) than in the smaller ones (33-37 cm). A comparison of the parasite infections according to geographical region showed that the mean abundances of Nematobothriinae gen. sp. and Caligus bonito were higher in fish from south-east Spain than in those from the Strait of Gibraltar. A comparison of the parasite fauna of A. rochei from the Mediterranean Sea with the published data on Auxis spp. from the Atlantic, Indian and Pacific Oceans revealed the closest similarity between the Mediterranean A. rochei and the Atlantic A. thazard.

  13. Chandra observation of two shock fronts in the merging galaxy cluster Abell 2146

    CERN Document Server

    Russell, H R; Fabian, A C; Baum, S A; Donahue, M; Edge, A C; McNamara, B R; O'Dea, C P

    2010-01-01

    We present a new Chandra observation of the galaxy cluster Abell 2146 which has revealed a complex merging system with a gas structure that is remarkably similar to the Bullet cluster (eg. Markevitch et al. 2002). The X-ray image and temperature map show a cool 2-3 keV subcluster with a ram pressure stripped tail of gas just exiting the disrupted 6-7 keV primary cluster. From the sharp jump in the temperature and density of the gas, we determine that the subcluster is preceded by a bow shock with a Mach number M=2.2+/-0.8, corresponding to a velocity v=2200^{+1000}_{-900} km/s relative to the main cluster. We estimate that the subcluster passed through the primary core only 0.1-0.3 Gyr ago. In addition, we observe a slower upstream shock propagating through the outer region of the primary cluster and calculate a Mach number M=1.7+/-0.3. Based on the measured shock Mach numbers M~2 and the strength of the upstream shock, we argue that the mass ratio between the two merging clusters is between 3 and 4 to one. B...

  14. Cluster headache

    Directory of Open Access Journals (Sweden)

    Ducros Anne

    2008-07-01

    Full Text Available Abstract Cluster headache (CH is a primary headache disease characterized by recurrent short-lasting attacks (15 to 180 minutes of excruciating unilateral periorbital pain accompanied by ipsilateral autonomic signs (lacrimation, nasal congestion, ptosis, miosis, lid edema, redness of the eye. It affects young adults, predominantly males. Prevalence is estimated at 0.5–1.0/1,000. CH has a circannual and circadian periodicity, attacks being clustered (hence the name in bouts that can occur during specific months of the year. Alcohol is the only dietary trigger of CH, strong odors (mainly solvents and cigarette smoke and napping may also trigger CH attacks. During bouts, attacks may happen at precise hours, especially during the night. During the attacks, patients tend to be restless. CH may be episodic or chronic, depending on the presence of remission periods. CH is associated with trigeminovascular activation and neuroendocrine and vegetative disturbances, however, the precise cautive mechanisms remain unknown. Involvement of the hypothalamus (a structure regulating endocrine function and sleep-wake rhythms has been confirmed, explaining, at least in part, the cyclic aspects of CH. The disease is familial in about 10% of cases. Genetic factors play a role in CH susceptibility, and a causative role has been suggested for the hypocretin receptor gene. Diagnosis is clinical. Differential diagnoses include other primary headache diseases such as migraine, paroxysmal hemicrania and SUNCT syndrome. At present, there is no curative treatment. There are efficient treatments to shorten the painful attacks (acute treatments and to reduce the number of daily attacks (prophylactic treatments. Acute treatment is based on subcutaneous administration of sumatriptan and high-flow oxygen. Verapamil, lithium, methysergide, prednisone, greater occipital nerve blocks and topiramate may be used for prophylaxis. In refractory cases, deep-brain stimulation of the

  15. Lysosomal-associated transmembrane protein 5 (LAPTM5 is a molecular partner of CD1e.

    Directory of Open Access Journals (Sweden)

    Catherine Angénieux

    Full Text Available The CD1e protein participates in the presentation of lipid antigens in dendritic cells. Its transmembrane precursor is transported to lysosomes where it is cleaved into an active soluble form. In the presence of bafilomycin, which inhibits vacuolar ATPase and consequently the acidification of endosomal compartments, CD1e associates with a 27 kD protein. In this work, we identified this molecular partner as LAPTM5. The latter protein and CD1e colocalize in trans-Golgi and late endosomal compartments. The quantity of LAPTM5/CD1e complexes increases when the cells are treated with bafilomycin, probably due to the protection of LAPTM5 from lysosomal proteases. Moreover, we could demonstrate that LAPTM5/CD1e association occurs under physiological conditions. Although LAPTM5 was previously shown to act as a platform recruiting ubiquitin ligases and facilitating the transport of receptors to lysosomes, we found no evidence that LATPM5 controls either CD1e ubiquitination or the generation of soluble lysosomal CD1e proteins. Notwithstanding these last observations, the interaction of LAPTM5 with CD1e and their colocalization in antigen processing compartments both suggest that LAPTM5 might influence the role of CD1e in the presentation of lipid antigens.

  16. Partitional clustering algorithms

    CERN Document Server

    2015-01-01

    This book summarizes the state-of-the-art in partitional clustering. Clustering, the unsupervised classification of patterns into groups, is one of the most important tasks in exploratory data analysis. Primary goals of clustering include gaining insight into, classifying, and compressing data. Clustering has a long and rich history that spans a variety of scientific disciplines including anthropology, biology, medicine, psychology, statistics, mathematics, engineering, and computer science. As a result, numerous clustering algorithms have been proposed since the early 1950s. Among these algorithms, partitional (nonhierarchical) ones have found many applications, especially in engineering and computer science. This book provides coverage of consensus clustering, constrained clustering, large scale and/or high dimensional clustering, cluster validity, cluster visualization, and applications of clustering. Examines clustering as it applies to large and/or high-dimensional data sets commonly encountered in reali...

  17. Atomic mobility in energetic cluster deposition

    Institute of Scientific and Technical Information of China (English)

    PAN Zheng-Ying; WANG Yue-Xia; WEI Qi; LI Zhi-Jie; ZHOU Liang; ZHANG Liang-Kun

    2004-01-01

    This paper tries to outline the influence of atomic mobility on the initial fabrication of thin films formed by LECBD. Based on our recent studies on low-energy cluster beam deposition (LECBD) by molecular dynamics simulation, two examples, the deposition of small carbon clusters on Si and diamond surfaces and Al clusters on Ni substrate, were mainly discussed. The impact energy of the cluster ranges from 0.1 eV to 100 eV. In the former case,the mobility and the lateral migration of surface atoms, especially the recoil atoms, are enhanced with increasing the impact energy, which promote the film to be smoother and denser. For the latter case, the transverse kinetic energy of cluster atoms, caused mainly by the collision between moving cluster atoms, dominates the lateral spread of cluster atoms on the surface, which is contributive to layer-by-layer growth of thin films. Our result is consistent with the experimental observations that the film structure is strongly dependent on the impact energy. In addition, it elucidates that the atomic mobility takes a leading role in the structure characteristic of films formed by LECBD.

  18. Clustering and Community Detection with Imbalanced Clusters

    OpenAIRE

    Aksoylar, Cem; Qian, Jing; Saligrama, Venkatesh

    2016-01-01

    Spectral clustering methods which are frequently used in clustering and community detection applications are sensitive to the specific graph constructions particularly when imbalanced clusters are present. We show that ratio cut (RCut) or normalized cut (NCut) objectives are not tailored to imbalanced cluster sizes since they tend to emphasize cut sizes over cut values. We propose a graph partitioning problem that seeks minimum cut partitions under minimum size constraints on partitions to de...

  19. A comparison of surface topography characterization technologies for use in comparing spent bullet and cartridge case signatures

    Energy Technology Data Exchange (ETDEWEB)

    Batishko, C.R.; Hickman, B.J.; Cuta, F.M.

    1992-11-01

    The Pacific Northwest Laboratory was tasked by the US Department of Energy to provide technical assistance to the Federal Bureau of Investigation in evaluating and ranking technologies potentially useful in high-speed comparison of unique spent bullet and cartridge case surface signatures. Information sources included vendor input, current relevant literature, vendor phone contacts, other FBI resources, relevant PNL reports, and personal contact with numerous PNL technical staff. A comprehensive list of technologies was reduced to a list of 38 by grouping very similar methodologies, and further reduced to a short list of six by applying a set of five minimum functional requirements. A total of 14 primary criteria, many having secondary criteria, were subsequently used to evaluate each technology. The ranked short list results are reported and supported in this document, and their scores normalized to a hypothetical ideal system are as follows: (1) confocal microscopy 82.13; (2) laser dynamic focusing 72.04; (3)moire interferometry V70.94; (4)fringe field capacitance;(5)laser triangulation 66.18; (6)structured/sectioned light 65.55. Information available within the time/budget constraints which was used for the evaluation and ranking was not sufficiently detailed to evaluate specific implementations of the technologies. Each of the technologies in the short list was judged potentially capable of meeting the minimum requirements. Clever, novel engineering solutions resulting in a more cost-effective system, or a closer fit to the ``ideal system,`` could result in a reordering of the short list when actual technical proposals are evaluated. Therefore, it is recommended that a Request for Proposal not be limited to only the highest ranked technology, but include all six technologies in the short list.

  20. A comparison of surface topography characterization technologies for use in comparing spent bullet and cartridge case signatures

    Energy Technology Data Exchange (ETDEWEB)

    Batishko, C.R.; Hickman, B.J.; Cuta, F.M.

    1992-11-01

    The Pacific Northwest Laboratory was tasked by the US Department of Energy to provide technical assistance to the Federal Bureau of Investigation in evaluating and ranking technologies potentially useful in high-speed comparison of unique spent bullet and cartridge case surface signatures. Information sources included vendor input, current relevant literature, vendor phone contacts, other FBI resources, relevant PNL reports, and personal contact with numerous PNL technical staff. A comprehensive list of technologies was reduced to a list of 38 by grouping very similar methodologies, and further reduced to a short list of six by applying a set of five minimum functional requirements. A total of 14 primary criteria, many having secondary criteria, were subsequently used to evaluate each technology. The ranked short list results are reported and supported in this document, and their scores normalized to a hypothetical ideal system are as follows: (1) confocal microscopy 82.13; (2) laser dynamic focusing 72.04; (3)moire interferometry V70.94; (4)fringe field capacitance;(5)laser triangulation 66.18; (6)structured/sectioned light 65.55. Information available within the time/budget constraints which was used for the evaluation and ranking was not sufficiently detailed to evaluate specific implementations of the technologies. Each of the technologies in the short list was judged potentially capable of meeting the minimum requirements. Clever, novel engineering solutions resulting in a more cost-effective system, or a closer fit to the ideal system,'' could result in a reordering of the short list when actual technical proposals are evaluated. Therefore, it is recommended that a Request for Proposal not be limited to only the highest ranked technology, but include all six technologies in the short list.

  1. 子弹撞击对发射药易损性响应影响研究%Vulnerabile Response of Gun Propellant by Bullet Impact Test

    Institute of Scientific and Technical Information of China (English)

    张邹邹; 杨丽侠; 刘来东; 张衡

    2011-01-01

    The response characterastics and the impact factors of typical propellant charges were discussed in terms of general methods of tailoring the propellants to counter mechanical threats by the bullet impact,where bullet type is a 12.7 mm armor-piercing projectile,and the impact velocity is (850 ±20) m ? S-1. The results show that there are obvious correlations with the propellant compositions,forms and the piercing depth in the vulnerability response extents by the bullet impacts,but the energy level of pro-pellants. Also,there are obvious influence on the propellant vulnerability response for the restrained conditions to the propel lants. The typical propellants have no violent reaction in the weaker restrained conditions.%选用单基药、双基药、太根药和硝基胍药等发射药,采用速度为(850±20)m·s-1的12.7 mm标准穿甲弹撞击样弹,研究子弹撞击机械刺激下发射药的易损性响应特性和影响因素.结果表明:子弹撞击对发射药的易损性响应程度与发射药能量水平无明显对应关系,但与其配方组分、药型以及子弹的穿透深度有一定关系;约束条件对发射药子弹撞击下易损性响应影响明显,发射药在强约束条件下发生燃烧甚至比燃烧更剧烈的反应,而在弱约束条件下未发生燃烧反应.

  2. A merger mystery: no radio halo in the merging cluster Abell 2146

    CERN Document Server

    Russell, H R; Edge, A C; McNamara, B R; Sanders, J S; Fabian, A C; Baum, S A; Canning, R E A; Donahue, M; O'Dea, C P

    2011-01-01

    We present a new 400 ks Chandra X-ray observation and a GMRT radio observation at 325 MHz of the merging galaxy cluster Abell 2146. The Chandra observation reveals detailed structure associated with the major merger event including the Mach M=2.1+/-0.3 bow shock located ahead of the dense subcluster core and the first known example of an upstream shock (M=1.52+/-0.07). Surprisingly, the deep GMRT observation at 325 MHz does not detect an extended radio halo or any radio relics associated with the shock fronts. All other merging galaxy clusters with X-ray detected shock fronts, including the Bullet cluster, Abell 520 and Abell 754, and clusters with candidate shock fronts have detected radio halos or relics. We calculate a 3 sigma upper limit of 13 mJy, which is significantly below the radio power expected by the observed P_{radio}-L_{X-ray} correlation for merging systems. We explore possible explanations for this unexpected result including the cluster mass, magnetic field, pre-existing electron population, ...

  3. Cluster headaches.

    Science.gov (United States)

    Ryan, R E; Ryan, R E

    1989-12-01

    The patient with cluster headaches will be afflicted with the most severe type of pain that one will encounter. If the physician can do something to help this patient either by symptomatic or, more importantly, prophylactic treatment, he or she will have a most thankful patient. This type of headache is seen most frequently in men, and occurs in a cyclic manner. During an acute cycle, the patient will experience a daily type of pain that may occur many times per day. The pain is usually unilateral and may be accompanied by unilateral lacrimation, conjunctivitis, and clear rhinorrhea. Prednisone is the first treatment we employ. Patients are seen for follow-up approximately twice a week, and their medication is lowered in an appropriate manner, depending on their response to the treatment. Regulation of dosage has to be individualized, and when one reaches the lower dose such as 5 to 10 mg per day, the drug may have to be tapered more slowly, or even maintained at that level for a period of time to prevent further recurrence of symptoms. We frequently will use an intravenous histamine desensitization technique to prevent further attacks. We will give the patient an ergotamine preparation to use for symptomatic relief. As these patients often have headaches during the middle of the night, we will place the patient on a 2-mg ergotamine preparation to take prior to going to bed in the evening. This often works in a prophylactic nature, and prevents the nighttime occurrence of a headache. We believe that following these principles to make the accurate diagnosis and institute the proper therapy will help the practicing otolaryngologist recognize and treat patients suffering from this severe pain.

  4. [Comments on the paper by D. Tausch et al. Experiments on the penetration power of various bullets into skin and muscle tissue (author's transl)].

    Science.gov (United States)

    Dammermann, W

    1979-07-17

    The objections in the following comments on a recent paper by Tausch et al. (1978) are raised principally to the points that the mass of the projectile is given an importance for the penetration which is not justified, and that the inherent uncertainty of the measurement data and the scope of validity of the empirical formulas are not sufficiently taken into account. The discussion on the process of penetration and a discontinuity of the depth of penetration as a function of the velocity of the bullet is of fundamental significance, with consequences for the definition of the critical velocity.

  5. Use of echocardiographic subxiphoid five-sixth area length (bullet method in evaluation of adequacy of borderline left ventricle in hypoplastic left heart complex

    Directory of Open Access Journals (Sweden)

    Justin T Tretter

    2015-01-01

    Full Text Available Indexed left ventricular end-diastolic volume (ILVEDV is commonly used in evaluating "borderline left ventricle (LV" in hypoplastic left heart complex (HLHC to determine if the LV can sustain adequate systemic cardiac output. Commonly used quantification methods include biplane Simpson or the traditional five-sixth area length "bullet" methods, which have been shown to underestimate true LV volumes, when septal position is mildly abnormal. Subxiphoid five-sixth area length method is proposed as a more accurate estimate of true LV volume in the evaluation of borderline LV.

  6. Data of evolutionary structure change: 1AIJL-1E14M [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1AIJL-1E14M 1AIJ 1E14 L M -------------------ALLSFERKYRVPGGTLV--G...ment> 0 1AIJ L 1AIJ...2218189239502 8.040038108825684 1 1AIJ... L 1AIJL YGLGG-A... 333 GLU CA 294 ARG CA 276 1AIJ

  7. Physicochemical and biological characterization of 1E10 Anti-Idiotype vaccine

    Directory of Open Access Journals (Sweden)

    Machado Yoan J

    2011-11-01

    Full Text Available Abstract Background 1E10 monoclonal antibody is a murine anti-idiotypic antibody that mimics N-glycolyl-GM3 gangliosides. This antibody has been tested as an anti-idiotypic cancer vaccine, adjuvated in Al(OH3, in several clinical trials for melanoma, breast, and lung cancer. During early clinical development this mAb was obtained in vivo from mice ascites fluid. Currently, the production process of 1E10 is being transferred from the in vivo to a bioreactor-based method. Results Here, we present a comprehensive molecular and immunological characterization of 1E10 produced by the two different production processes in order to determine the impact of the manufacturing process in vaccine performance. We observed differences in glycosylation pattern, charge heterogeneity and structural stability between in vivo-produced 1E10 and bioreactor-obtained 1E10. Interestingly, these modifications had no significant impact on the immune responses elicited in two different animal models. Conclusions Changes in 1E10 primary structure like glycosylation; asparagine deamidation and oxidation affected 1E10 structural stability but did not affect the immune response elicited in mice and chickens when compared to 1E10 produced in mice.

  8. Data of evolutionary structure change: 1E4WL-1MCEA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E4WL-1MCEA 1E4W 1MCE L A DIQMTQTPSSLSASLGDRVTISCRASQ---DISHYLNWF...DINVKWKIDGSERQNGVLDSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC- PSALTQ-PPSASGSLGQSVTI...ain>A 1MCEA CSSYEGSDNFV EE...263 ALA CA 289 1MCE A 1MCEA...in>A 1MCEA SKQSN-NKYAA -

  9. Data of evolutionary structure change: 1E4XL-1MCEA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E4XL-1MCEA 1E4X 1MCE L A DIQMTQTPSSLSASLGDRVTISCRASQ---DISHYLNWF...DINVKWKIDGSERQNGVLDSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC- PSALTQ-PPSASGSLGQSVTI...hain>A 1MCEA YYCSSYEGSDN E...line> ALA CA 288 1MCE A 1MCEA...onfEVID> 3 1MCE A 1MCEA

  10. Data of evolutionary structure change: 1E6OL-1MCEA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E6OL-1MCEA 1E6O 1MCE L A EIVLTQSPAITAASLGQKVTITCSAS----SSVSYMHWY...DINVKWKIDGSERQNGVLNSWTDQDS-KDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN--- PSALTQ-PPSASGSLGQSVT...82 1MCE A 1MCEA...in> 1MCE A 1MCEA...2 1MCE A 1MCEA

  11. Data of evolutionary structure change: 1E52A-4OTAI [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E52A-4OTAI 1E52 4OTA A I LEPDNVPMDMSPKALQQKIHELEGLMMQHAQNLEFEEAA... 0 4OTA I 4OTAI 21.018999099731445 -8.57699966430664 97.70899963378906 tion> 0.95...999752044678 0.28600001335144043 tion> 1.992616057395935 2.8046770095825195 ...

  12. Data of evolutionary structure change: 1E52A-4OTAR [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E52A-4OTAR 1E52 4OTA A R LEPDNVPMDMSPKALQQKIHELEGLMMQHAQNLEFEEAA... 0 4OTA R 4OTAR 26.631000518798828 -29.371999740600586 72.0260009765625 ...74316 -0.878000020980835 -0.3100000023841858 tion> 1.9946750402450562 2.806180953979492 ...

  13. Data of evolutionary structure change: 1E52A-4OTAG [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E52A-4OTAG 1E52 4OTA A G LEPDNVPMDMSPKALQQKIHELEGLMMQHAQNLEFEEAA...>0 4OTA G 4OTAG -7.752999782562256 -21.667999267578125 97.37799835205078 tion> ... -0.6010000109672546 0.1940000057220459 tion> 1.9995390176773071 2.805448055267334 ...

  14. Data of evolutionary structure change: 1E52B-4OTAM [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E52B-4OTAM 1E52 4OTA B M LEPDNVPMDMSPKALQQKIHELEGLMMQHAQNLEFEEAA...EVID> 0 4OTA M 4OTA... -21.030000686645508 -2.2130000591278076 40.415000915527344 ...-0.5630000233650208 -0.19499999284744263 -0.8029999732971191 tion> 1.9910509586334229 2.7949159145355225 ...

  15. Data of evolutionary structure change: 1E52A-4OTAD [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E52A-4OTAD 1E52 4OTA A D LEPDNVPMDMSPKALQQKIHELEGLMMQHAQNLEFEEAA...>0 4OTA D 4OTAD -19.621000289916992 33.64500045776367 tion> 0.58799999...60437 -0.2669999897480011 tion> 2.00280499458313 2.825521945953369 ...

  16. Data of evolutionary structure change: 1E52A-4OTAJ [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E52A-4OTAJ 1E52 4OTA A J LEPDNVPMDMSPKALQQKIHELEGLMMQHAQNLEFEEAA...fEVID> 0 4OTA J 4OTA...rallel> 16.440000534057617 -7.355000019073486 113.11000061035156 tion>....4909999966621399 -0.23899999260902405 tion> 1.9981789588928223 2.8151841163635254 ...

  17. Data of evolutionary structure change: 1E52A-4OTAH [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E52A-4OTAH 1E52 4OTA A H LEPDNVPMDMSPKALQQKIHELEGLMMQHAQNLEFEEAA...fEVID> 0 4OTA H 4OTA...23486328 tion> -0.4189999997615814 -0.828000009059906 -0.3720000088214...6055 -0.8370000123977661 0.5109999775886536 -0.1940000057220459 tion> 1.9984849691390991 2.812535047531128 ...

  18. Data of evolutionary structure change: 1E52B-4OTAJ [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E52B-4OTAJ 1E52 4OTA B J LEPDNVPMDMSPKALQQKIHELEGLMMQHAQNLEFEEAA...fEVID> 0 4OTA J 4OTA...llel> 3.2679998874664307 16.643999099731445 95.48200225830078 tion> 0.8259999752044678 tion> 1.9976840019226074 2.8146679401397705 ...

  19. Data of evolutionary structure change: 1E52B-4OTAQ [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E52B-4OTAQ 1E52 4OTA B Q LEPDNVPMDMSPKALQQKIHELEGLMMQHAQNLEFEEAA...> 0 4OTA... Q 4OTAQ KETLI-REVSE 38.95899963378906 tion> 0.08500000089406967 0.9610000252723694 0.4729999899864197 -0.27300000190734863 -0.8379999995231628

  20. Data of evolutionary structure change: 1E52B-4OTAH [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E52B-4OTAH 1E52 4OTA B H LEPDNVPMDMSPKALQQKIHELEGLMMQHAQNLEFEEAA...fEVID> 0 4OTA H 4OTA...> -0.5889999866485596 -0.09799999743700027 0.8019999861717224 tion> 1.9979859590530396 2.8120179176330566 ... ... -20.273000717163086 -4.440999984741211 94.379997253...41797 tion> 0.39899998903274536 0.828000009059906 0.39399999380111694<

  1. Data of evolutionary structure change: 1E52B-4OTAB [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E52B-4OTAB 1E52 4OTA B B LEPDNVPMDMSPKALQQKIHELEGLMMQHAQNLEFEEAA...fEVID> 0 4OTA B 4OTA...3.15999984741211 20.631000518798828 17.600000381469727 tion> 0.9430000...04632568 0.8389999866485596 tion> 1.9927129745483398 2.7974250316619873 ...

  2. Data of evolutionary structure change: 1E52B-4OTAK [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E52B-4OTAK 1E52 4OTA B K LEPDNVPMDMSPKALQQKIHELEGLMMQHAQNLEFEEAA...>0 4OTA K 4OTAK -16.0939998626709 77.69400024414062 tion> 0.4510000050...1858 -0.847000002861023 tion> 1.994042992591858 2.79762601852417 ...

  3. Data of evolutionary structure change: 1E52A-4OTAB [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E52A-4OTAB 1E52 4OTA A B LEPDNVPMDMSPKALQQKIHELEGLMMQHAQNLEFEEAA...fEVID> 0 4OTA B 4OTA...0.013000000268220901 -3.368000030517578 35.22800064086914 tion> -0.947...000171661377 -0.1899999976158142 tion> 1.993204951286316 2.797945976257324 ...

  4. Data of evolutionary structure change: 1E52B-4OTAA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E52B-4OTAA 1E52 4OTA B A LEPDNVPMDMSPKALQQKIHELEGLMMQHAQNLEFEEAA...t> 0 4OTA A 4OTA...allel> -8.633999824523926 23.224000930786133 2.4660000801086426 tion> ...y>0.6079999804496765 -0.7549999952316284 tion> 2.0007169246673584 2.8046839237213135 ...

  5. Data of evolutionary structure change: 1E52A-4OTAQ [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E52A-4OTAQ 1E52 4OTA A Q LEPDNVPMDMSPKALQQKIHELEGLMMQHAQNLEFEEAA...> 0 4OTA... Q 4OTAQ KETLI-REVSE -32.874000549316406 56.58599853515625 tion> -0.06800000369548798 -0....21400000154972076 tion> 1.9998979568481445 2.8079090118408203 ...

  6. Data of evolutionary structure change: 1E52A-4OTAP [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E52A-4OTAP 1E52 4OTA A P LEPDNVPMDMSPKALQQKIHELEGLMMQHAQNLEFEEAA... 0 4OTA P 4OTAP -3.50600004196167 74.552001953125 tion> -0.80599999427...3 -0.17900000512599945 tion> 1.997607946395874 2.8045730590820312 ...

  7. Data of evolutionary structure change: 1E52A-4OTAO [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E52A-4OTAO 1E52 4OTA A O LEPDNVPMDMSPKALQQKIHELEGLMMQHAQNLEFEEAA...>0 4OTA O 4OTAO -2.740999937057495 59.154998779296875 tion> 0.8669999837875366 0.3...949999809265137 -0.4779999852180481 0.8199999928474426 0.3149999976158142

  8. Data of evolutionary structure change: 1E52A-4OTAE [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E52A-4OTAE 1E52 4OTA A E LEPDNVPMDMSPKALQQKIHELEGLMMQHAQNLEFEEAA...>0 4OTA E 4OTAE -5.197999954223633 -31.14299964904785 19.062000274658203 tion> -0.972000002861023 0.22200000286102295 tion> 1.9988939762115479 2.805737018585205 ...

  9. Data of evolutionary structure change: 1E52B-4OTAL [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E52B-4OTAL 1E52 4OTA B L LEPDNVPMDMSPKALQQKIHELEGLMMQHAQNLEFEEAA...>0 4OTA L 4OTAL 9.65999984741211 -14.574000358581543 92.75199890136719 tion> -0.....5839999914169312 0.734000027179718 1.9978070259094238 2.8073511123657227 ...

  10. Data of evolutionary structure change: 1E52B-4OTAN [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E52B-4OTAN 1E52 4OTA B N LEPDNVPMDMSPKALQQKIHELEGLMMQHAQNLEFEEAA...x>0 4OTA N 4OTAN -17.95800018310547 -8.309000015258789 55.1609992980957 tion> -0.3370000123977661 0.7979999780654907 tion> 1.993736982345581 2.7896270751953125 ...

  11. Data of evolutionary structure change: 1E52A-4OTAM [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E52A-4OTAM 1E52 4OTA A M LEPDNVPMDMSPKALQQKIHELEGLMMQHAQNLEFEEAA...EVID> 0 4OTA M 4OTA...> -7.85699987411499 -26.211999893188477 58.04199981689453 ...x>-0.4690000116825104 -0.8650000095367432 0.18000000715255737 tion> 1.9915380477905273 2.7954370975494385 ...

  12. Data of evolutionary structure change: 1E52B-4OTAE [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E52B-4OTAE 1E52 4OTA B E LEPDNVPMDMSPKALQQKIHELEGLMMQHAQNLEFEEAA...>0 4OTA E 4OTAE -18.371000289916992 -7.144000053405762 1.434999942779541 tion> 0...>-0.4449999928474426 -0.7960000038146973 tion> 1.9984110593795776 2.8052260875701904 ...

  13. Data of evolutionary structure change: 1E52A-4OTAC [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E52A-4OTAC 1E52 4OTA A C LEPDNVPMDMSPKALQQKIHELEGLMMQHAQNLEFEEAA...>0 4OTA C 4OTAC -24.429000854492188 18.4689998626709 tion> 0.3219999...62260437 0.2590000033378601 tion> 1.9993360042572021 2.7992570400238037 ...

  14. Data of evolutionary structure change: 1E52A-4OTAA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E52A-4OTAA 1E52 4OTA A A LEPDNVPMDMSPKALQQKIHELEGLMMQHAQNLEFEEAA...t> 0 4OTA A 4OTA...arallel> 4.539000034332275 -0.7739999890327454 20.0939998626709 tion> ...639038 0.3109999895095825 tion> 2.001197099685669 2.8052051067352295 ...

  15. Data of evolutionary structure change: 1E52B-4OTAO [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E52B-4OTAO 1E52 4OTA B O LEPDNVPMDMSPKALQQKIHELEGLMMQHAQNLEFEEAA...>0 4OTA O 4OTAO 21.257999420166016 41.527000427246094 tion> -0.8690000176429749 -0.3...0000023841858 0.019999999552965164 0.652999997138977 -0.7570000290870667

  16. Data of evolutionary structure change: 1E2TE-2PFRB [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E2TE-2PFRB 1E2T 2PFR E B HMTSFLHAYFTRLHCQPLGVPTVEALRTLHLAHNCAIPF...ine>ARG CA 540 2PFR B 2PFR...U CA 192 GLN CA 212 VAL CA 235 2PFR... B 2PFRB RKFNYKDNTDLVEFK 2.9440479278564453 2 2PFR

  17. Data of evolutionary structure change: 1E2TG-2PFRB [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E2TG-2PFRB 1E2T 2PFR G B HMTSFLHAYFTRLHCQPLGVPTVEALRTLHLAHNCAIPF...ine> ARG CA 539 2PFR B 2PFR...CA 191 GLN CA 212 VAL CA 236 2PFR B 2PFRB RKFNYKDNTDLVEFK 2.972101926803589 2 2PFR<

  18. Data of evolutionary structure change: 1E43A-2DIEA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E43A-2DIEA 1E43 2DIE A A VNGTLMQYFEWYTPNDGQHWKRLQNDAEHLSDIGITAVW...WTKFDFPGRGNTHSNFKWRWYHFDGTDWDQSRQLQNKIYKFRGTGKAWDWEVDIENGNYDYLMYADIDMDHPEVINELRNWGVWYTNTLNLDGFRIDAVKHIKYSYTR...ine> PHE CA 463 2DIE A 2DIE...613037109375 1 2DIE... A 2DIEA GIPTH---GVPSM

  19. Data of evolutionary structure change: 1CTMA-1E2ZC [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available M A 1CTMA IVDASNERQVI ...1CTMA-1E2ZC 1CTM 1E2Z A C YPIFAQQNYENPREATGRIVCANCHLASKPVDIEVPQAV...EEEEEE EEEEEEE - EEEEEEE EEE EEEEEEEEEE 0 1CT...M A 1CTMA KILRK--EKGGY ure>EEEEE-- EEure>

  20. Data of evolutionary structure change: 1CTMA-1E2WA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1CTMA-1E2WA 1CTM 1E2W A A YPIFAQQNYENPREATGRIVCANCHLASKPVDIEVPQAV...index> 1CTM A 1CTM...A ILRKE--KGGYE ure>EEEE -- EEEure> ITALSEKKGGFE ure>EE EEEure> IEKAN-GEVVV ure>EEE - EEEEure> <

  1. Data of evolutionary structure change: 1CTMA-1E2ZA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1CTMA-1E2ZA 1CTM 1E2Z A A YPIFAQQNYENPREATGRIVCANCHLASKPVDIEVPQAV...EEEEEEEE EEEEEEEE - EEEEEEE EEE EEEEEEEEEE 0 1CTM A 1CTMA ILRKE--KGGYE ure>EEEE -- EEEure> ITALSEKKGGFE EEEE EEEure>

  2. Factorial PD-Clustering

    CERN Document Server

    Tortora, Cristina; Summa, Mireille Gettler

    2011-01-01

    Factorial clustering methods have been developed in recent years thanks to the improving of computational power. These methods perform a linear transformation of data and a clustering on transformed data optimizing a common criterion. Factorial PD-clustering is based on Probabilistic Distance clustering (PD-clustering). PD-clustering is an iterative, distribution free, probabilistic, clustering method. Factorial PD-clustering make a linear transformation of original variables into a reduced number of orthogonal ones using a common criterion with PD-Clustering. It is demonstrated that Tucker 3 decomposition allows to obtain this transformation. Factorial PD-clustering makes alternatively a Tucker 3 decomposition and a PD-clustering on transformed data until convergence. This method could significantly improve the algorithm performance and allows to work with large dataset, to improve the stability and the robustness of the method.

  3. THE STUDIES ON THE PROTECTION FUNCTION OF COMPOUND MATERIAL MULTI-FUNCTION BULLET-PROOF PLATE%复合材料多功能防弹板防弹性能研究

    Institute of Scientific and Technical Information of China (English)

    李欢秋; 欧阳科峰; 张仕

    2013-01-01

    Although the bullet-proof plates made by single armor steel or the armed fiber have good characteristics of and-penetration to high-speed bullet, but the compound structure can greatly increase bullet-proof properties and reduce its area density. The propertities of penetration of the sandwich structure with foam and armor steel reinforced by the armed fiber under the 56 types with 7. 62 mm common steel core bullet are studied by experiments and numerical analysis. The protective ability of and-bullet and influence factors of the absorbing bullet kinetic energy have been researched through the different compound forms of foam sandwich structure. The concept of the best bullet-proof speed zone and V50 homologous formula in the structure are given. So the bullet-proof plates with the best benefit-cost ratio can be designed.%虽然单一的装甲钢或芳纶板具有良好的防高速弹丸贯穿性能,但采用复合结构可以大大提高单一防弹板的防弹效率,减轻防护板面密度.通过弹道实验和数值模拟方法研究了装甲钢复合芳纶泡沫夹层结构抗56式7.62mm普通钢芯弹贯穿特性;探讨了不同复合形式的装甲钢复合芳纶泡沫夹层结构抵抗弹丸的防护效能和影响防弹板吸收子弹动能的因素;提出了该种装甲钢复合芳纶泡沫夹层结构最佳防弹速度区间的概念和相应的V50估算公式,由此可以设计出防弹效费比最佳的防弹板.

  4. Possibilistic Exponential Fuzzy Clustering

    Institute of Scientific and Technical Information of China (English)

    Kiatichai Treerattanapitak; Chuleerat Jaruskulchai

    2013-01-01

    Generally,abnormal points (noise and outliers) cause cluster analysis to produce low accuracy especially in fuzzy clustering.These data not only stay in clusters but also deviate the centroids from their true positions.Traditional fuzzy clustering like Fuzzy C-Means (FCM) always assigns data to all clusters which is not reasonable in some circumstances.By reformulating objective function in exponential equation,the algorithm aggressively selects data into the clusters.However noisy data and outliers cannot be properly handled by clustering process therefore they are forced to be included in a cluster because of a general probabilistic constraint that the sum of the membership degrees across all clusters is one.In order to improve this weakness,possibilistic approach relaxes this condition to improve membership assignment.Nevertheless,possibilistic clustering algorithms generally suffer from coincident clusters because their membership equations ignore the distance to other clusters.Although there are some possibilistic clustering approaches that do not generate coincident clusters,most of them require the right combination of multiple parameters for the algorithms to work.In this paper,we theoretically study Possibilistic Exponential Fuzzy Clustering (PXFCM) that integrates possibilistic approach with exponential fuzzy clustering.PXFCM has only one parameter and not only partitions the data but also filters noisy data or detects them as outliers.The comprehensive experiments show that PXFCM produces high accuracy in both clustering results and outlier detection without generating coincident problems.

  5. Evolutionary analysis of rubella viruses in mainland China during 2010-2012: endemic circulation of genotype 1E and introductions of genotype 2B.

    Science.gov (United States)

    Zhu, Zhen; Rivailler, Pierre; Abernathy, Emily; Cui, Aili; Zhang, Yan; Mao, Naiyin; Xu, Songtao; Zhou, Shujie; Lei, Yue; Wang, Yan; Zheng, Huanying; He, Jilan; Chen, Ying; Li, Chongshan; Bo, Fang; Zhao, Chunfang; Chen, Meng; Lu, Peishan; Li, Fangcai; Gu, Suyi; Gao, Hui; Guo, Yu; Chen, Hui; Feng, Daxing; Wang, Shuang; Tang, Xiaomin; Lei, Yake; Feng, Yan; Deng, Lili; Gong, Tian; Fan, Lixia; Xu, Wenbo; Icenogle, Joseph

    2015-01-23

    Rubella remains a significant burden in mainland China. In this report, 667 viruses collected in 24 of 31 provinces of mainland China during 2010-2012 were sequenced and analyzed, significantly extending previous reports on limited numbers of viruses collected before 2010. Only viruses of genotypes 1E and 2B were found. Genotype 1E viruses were found in all 24 provinces. Genotype 1E viruses were likely introduced into mainland China around 1997 and endemic transmission of primarily one lineage became established. Viruses reported here from 2010-2012 are largely in a single cluster within this lineage. Genotype 2B viruses were rarely detected in China prior to 2010. This report documents a previously undetected 2B lineage, which likely became endemic in eastern provinces of China between 2010 and 2012. Bayesian analyses were performed to estimate the evolutionary rates and dates of appearance of the genotype 1E and 2B viral linages in China. A skyline plot of viral population diversity did not provide evidence of reduction of diversity as a result of vaccination, but should be useful as a baseline for such reductions as vaccination programs for rubella become widespread in mainland China.

  6. Dissolution of Globular Clusters

    OpenAIRE

    Baumgardt, Holger

    2006-01-01

    Globular clusters are among the oldest objects in galaxies, and understanding the details of their formation and evolution can bring valuable insight into the early history of galaxies. This review summarises the current knowledge about the dissolution of star clusters and discusses the implications of star cluster dissolution for the evolution of the mass function of star cluster systems in galaxies.

  7. Structures of Mn clusters

    Indian Academy of Sciences (India)

    Tina M Briere; Marcel H F Sluiter; Vijay Kumar; Yoshiyuki Kawazoe

    2003-01-01

    The geometries of several Mn clusters in the size range Mn13–Mn23 are studied via the generalized gradient approximation to density functional theory. For the 13- and 19-atom clusters, the icosahedral structures are found to be most stable, while for the 15-atom cluster, the bcc structure is more favoured. The clusters show ferrimagnetic spin configurations.

  8. Contextualizing the Cluster

    DEFF Research Database (Denmark)

    Giacomin, Valeria

    This dissertation examines the case of the palm oil cluster in Malaysia and Indonesia, today one of the largest agricultural clusters in the world. My analysis focuses on the evolution of the cluster from the 1880s to the 1970s in order to understand how it helped these two countries to integrate......-researched topic in the cluster literature – the emergence of clusters, their governance and institutional change, and competition between rival cluster locations – through the case of the Southeast Asian palm oil cluster....

  9. Mechanical properties at high strain-rate of lead core and brass jacket of a NATO 7.62 mm ball bullet

    Directory of Open Access Journals (Sweden)

    Manes A.

    2012-08-01

    Full Text Available Numerical simulations are now an actual option in order to try to reproduce and understand the mechanical response in components subjected to extreme loading conditions, like in a ballistic impact. A correct materials calibration is therefore necessary in order to extract the materials parameters. In this work the simple and widely used Johnson-Cook model was used to analyse the experimental data obtained for the characterization of the bullet materials. The bullet under investigation is a full metal jacket ball, with a lead-antimony alloy core and a brass jacket. The experimental tests cover a wide range in strain-rate, starting from quasi-static tests up to high dynamic tests performed on a standard Split Hopkinson Pressure Bar setup. In general, there is a great lack in strain-rate sensitivity and failure data. Pure lead is very soft and ductile, so antimony is used to give greater hardness and strength. The results of this study show a significant strain-rate influence for this alloy that can be associated with the presence of the lead-antimony phases and their structures. Also in case of the brass the results showed significant strain-rate sensitivity in the material response.

  10. Suicidal single gunshot injury to the head: differences in site of entrance wound and direction of the bullet path between right- and left-handed--an autopsy study.

    Science.gov (United States)

    Nikolić, Slobodan; Zivković, Vladimir; Babić, Dragan; Juković, Fehim

    2012-03-01

    The aim of this study was to determine the differences in the anatomical site of a gunshot entrance wound and the direction of the bullet path between right- and left-handed subjects who committed a suicide by a single gunshot injury to the head. The retrospective autopsy study was performed for a 10-year period, and it included selected cases of single suicidal gunshot head injury, committed by handguns. We considered only contact or near-contact wounds. The sample included 479 deceased, with average age 47.1 ± 19.1 years (range, 12-89 years): 432 males and 47 females, with 317 right-handed, 25 left-handed, and 137 subjects with unknown dominant hand. In our observed sample, most cases involved the right temple as the site of entrance gunshot wound (about 67%), followed by the mouth (16%), forehead (7%), left temple (6%), submental (2%), and parietal region (1%). The left temple, right temple, and forehead were the sites of the gunshot entrance wounds, which were the best predictors of the handedness of the deceased (Spearman ρ = 0.149, P = 0.006). Our study showed that the direction of the bullet intracranial path in cases of suicide was even a more potent predictor of the handedness of the deceased (Spearman ρ = 0.263, P = 0.000; Wald = 149.503, P = 0.000).

  11. Facile green fabrication of nanostructure ZnO plates, bullets, flower, prismatic tip, closed pine cone: Their antibacterial, antioxidant, photoluminescent and photocatalytic properties.

    Science.gov (United States)

    Madan, H R; Sharma, S C; Udayabhanu; Suresh, D; Vidya, Y S; Nagabhushana, H; Rajanaik, H; Anantharaju, K S; Prashantha, S C; Sadananda Maiya, P

    2016-01-05

    Green synthesis of multifunctional Zinc oxide nanoparticles (NPs) with a variety of morphologies were achieved by low temperature solution combustion route employing neem (Azadirachta indica) extract as fuel. The nanoparticles were characterized by PXRD, FTIR, XPS, Raman and UV-Visible spectroscopic studies. The Morphologies were studied by SEM and TEM analysis. The NPs were subjected for photoluminescence, photocatalytic, antibacterial and antioxidant activity studies. PXRD pattern confirmed the hexagonal wurtzite structure of the product. SEM images indicated the transformation of mushroom like hexagonal disks to bullets, buds, cones, bundles and closed pine cone structured NPs with increase in the concentration of neem extract in reaction mixture. The NPs exhibited prominent green emission due to the presence of intrinsic defect centers. The as-formed bullet shaped ZnO with 4ml of neem extract was found to decolorize Methylene blue (MB) under Sunlight and UV light irradiation. The antibacterial studies indicated that ZnO NPs of concentration 500, 750 and 1000μg resulted in significant antibacterial activity on Klebsiella aerogenes and Staphylococcus aureus but not against Escherichia coli and Pseudomonas aeruginosa in agar well diffusion method. Further, ZnO NPs exhibited significant antioxidant activity against scavenging DPPH free radicals. The current investigation demonstrated green engineering method for the synthesis of multifunctional ZnO NPs with interesting morphologies using neem extract.

  12. Mechanical properties at high strain-rate of lead core and brass jacket of a NATO 7.62 mm ball bullet

    Science.gov (United States)

    Peroni, L.; Scapin, M.; Fichera, C.; Manes, A.; Giglio, M.

    2012-08-01

    Numerical simulations are now an actual option in order to try to reproduce and understand the mechanical response in components subjected to extreme loading conditions, like in a ballistic impact. A correct materials calibration is therefore necessary in order to extract the materials parameters. In this work the simple and widely used Johnson-Cook model was used to analyse the experimental data obtained for the characterization of the bullet materials. The bullet under investigation is a full metal jacket ball, with a lead-antimony alloy core and a brass jacket. The experimental tests cover a wide range in strain-rate, starting from quasi-static tests up to high dynamic tests performed on a standard Split Hopkinson Pressure Bar setup. In general, there is a great lack in strain-rate sensitivity and failure data. Pure lead is very soft and ductile, so antimony is used to give greater hardness and strength. The results of this study show a significant strain-rate influence for this alloy that can be associated with the presence of the lead-antimony phases and their structures. Also in case of the brass the results showed significant strain-rate sensitivity in the material response.

  13. Clustering in analytical chemistry.

    Science.gov (United States)

    Drab, Klaudia; Daszykowski, Michal

    2014-01-01

    Data clustering plays an important role in the exploratory analysis of analytical data, and the use of clustering methods has been acknowledged in different fields of science. In this paper, principles of data clustering are presented with a direct focus on clustering of analytical data. The role of the clustering process in the analytical workflow is underlined, and its potential impact on the analytical workflow is emphasized.

  14. On the Formation of Cool, Non-Flowing Cores in Galaxy Clusters via Hierarchical Mergers

    CERN Document Server

    Burns, J O; Norman, M L; Bryan, G L

    2003-01-01

    We present a new model for the creation of cool cores in rich galaxy clusters within a LambdaCDM cosmological framework using the results from high spatial dynamic range, adaptive mesh hydro/N-body simulations. It is proposed that cores of cool gas first form in subclusters and these subclusters merge to create rich clusters with cool, central X-Ray excesses. The rich cool clusters do not possess ``cooling flows'' due to the presence of bulk velocities in the intracluster medium in excess of 1000 km/sec produced by on-going accretion of gas from supercluster filaments. This new model has several attractive features including the presence of substantial core substructure within the cool cores, and it predicts the appearance of cool bullets, cool fronts, and cool filaments all of which have been recently observed with X-Ray satellites. This hierarchical formation model is also consistent with the observation that cool cores in Abell clusters occur preferentially in dense supercluster environments. On the other ...

  15. Construction of a recombinant adenovirus Vector of human papillomavirus type 16 L1_E7c

    Institute of Scientific and Technical Information of China (English)

    2000-01-01

    Human papillomaviruses are closely associated with human cervical cancer, especially HPV types 16 and 18. At present, HPV can not be produced in large quantity; it also has tumorgenicity and these properties of HPV have seriously hampered the development of HPV vaccine. HPV type 16 L1 proteins can assembled into virus-like particles (VLP), which are morphologically identical to the nature virion. In order to develop the recombinant adenovirus vectors of HPV, we constructed a recombinant adenovirus shuttle plasmid pCA14 L1-E7c. Methods: Human papillomavirus type 16 L1 open reading frame without terminator codon (TAA) (5559- 7152) and E7c (682- 855) were amplified using PCR. The L1 and E7c fragments were inserted into pGEM-T easy vectors by T- A strategy, named pTAL1 and pTAE7c. pTAL1 was cut with Hind III and BglII, the pTAE7c with BamHI and ClaI. The L1 DNA fragment, E7c and pBluesscript SK were ligated together using T4 DNA ligase. pBSL1-E7c and pBSL1-E7c was digested with Hind III and Xhol. The L1-E7c fragment was inserted into adenovirus shuttle plasmids pCAl4, named pCAl4L1-E7c. DNA sequence results indicated that The L1-E7c DNA fragment can encode the HPV16L1-E7 fusion protein correctly. Results: The L1 and E7c DNA fragments were amplified by PCR and recombinant plasmid pTAL1, pTAE7c, pBSL1-E7c and pCA14L1-E7c were constructed correctly. The pCAl4L1-E7c can be used in the further research work, cotransfected the 293 cell with the parent adenovirus pBHG10. Conclusion: Our results indicated that we have constructed a HPV16L1-E7 fusion DNA fragments and the adenovirus shuttle plasmids pCALl-E7c for the further research.

  16. Oncogenic AKT1(E17K) mutation induces mammary hyperplasia but prevents HER2-driven tumorigenesis.

    Science.gov (United States)

    Mancini, Maria L; Lien, Evan C; Toker, Alex

    2016-04-05

    One of the most frequently deregulated signaling pathways in breast cancer is the PI 3-K/Akt cascade. Genetic lesions are commonly found in PIK3CA, PTEN, and AKT, which lead to excessive and constitutive activation of Akt and downstream signaling that results in uncontrolled proliferation and increased cellular survival. One such genetic lesion is the somatic AKT1(E17K) mutation, which has been identified in 4-8% of breast cancer patients. To determine how this mutation contributes to mammary tumorigenesis, we constructed a genetically engineered mouse model that conditionally expresses human AKT1(E17K) in the mammary epithelium. Although AKT1(E17K) is only weakly constitutively active and does not promote proliferation in vitro, it is capable of escaping negative feedback inhibition to exhibit sustained signaling dynamics in vitro. Consistently, both virgin and multiparous AKT1(E17K) mice develop mammary gland hyperplasia that do not progress to carcinoma. This hyperplasia is accompanied by increased estrogen receptor expression, although exposure of the mice to estrogen does not promote tumor development. Moreover, AKT1(E17K) prevents HER2-driven mammary tumor formation, in part through negative feedback inhibition of RTK signaling. Analysis of TCGA breast cancer data revealed that the mRNA expression, total protein levels, and phosphorylation of various RTKs are decreased in human tumors harboring AKT1(E17K).

  17. Insulin-secreting INS-1E cells express functional TRPV1 channels.

    Science.gov (United States)

    Fågelskiöld, Amanda Jabin; Kannisto, Kristina; Boström, Anna; Hadrovic, Banina; Farre, Cecilia; Eweida, Mohamed; Wester, Kenneth; Islam, Md Shahidul

    2012-01-01

    We have studied whether functional TRPV1 channels exist in the INS-1E cells, a cell type used as a model for β-cells, and in primary β-cells from rat and human. The effects of the TRPV1 agonists capsaicin and AM404 on the intracellular free Ca (2+) concentration ([Ca (2+)]i) in the INS-1E cells were studied by fura-2 based microfluorometry. Capsaicin increased [Ca (2+)]i in a concentration-dependent manner, and the [Ca (2+)]i increase was dependent on extracellular Ca (2+). AM404 also increased [Ca (2+)]i in the INS-1E cells. Capsazepine, a specific antagonist of TRPV1, completely blocked the capsaicin- and AM404-induced [Ca (2+)]i increases. Capsaicin did not increase [Ca (2+)]i in the primary β-cells from rat and human. Whole cell patch clamp configuration was used to record currents across the plasma membrane in the INS-1E cells. Capsaicin elicited inward currents that were inhibited by capsazepine. Western blot analysis detected TRPV1 proteins in the INS-1E cells and the human islets. Immunohistochemistry was used to study the expression of TRPV1, but no TRPV1 protein immunoreactivity was detected in the human islet cells and the human insulinoma cells. We conclude that the INS-1E cells, but not the primary β-cells, express functional TRPV1 channels.

  18. What Makes Clusters Decline?

    DEFF Research Database (Denmark)

    Østergaard, Christian Richter; Park, Eun Kyung

    2015-01-01

    Most studies on regional clusters focus on identifying factors and processes that make clusters grow. However, sometimes technologies and market conditions suddenly shift, and clusters decline. This paper analyses the process of decline of the wireless communication cluster in Denmark....... The longitudinal study on the high-tech cluster reveals that technological lock-in and exit of key firms have contributed to decline. Entrepreneurship has a positive effect on the cluster’s adaptive capabilities, while multinational companies have contradicting effects by bringing in new resources to the cluster...

  19. Marriage à-la-MOND: Baryonic dark matter in galaxy clusters and the cooling flow puzzle

    Science.gov (United States)

    Milgrom, Mordehai

    2008-05-01

    I start with a brief introduction to MOND phenomenology and its possible roots in cosmology—a notion that may turn out to be the most far reaching aspect of MOND. Next I discuss the implications of MOND for the dark matter (DM) doctrine: MOND's successes imply that baryons determine everything. For DM this would mean that the puny tail of leftover baryons in galaxies wags the hefty DM dog. This has to occur in many intricate ways, and despite the haphazard construction history of galaxies—a very tall order. I then concentrate on galaxy clusters in light of MOND, which still requires some yet undetected cluster dark matter, presumably in some baryonic form (CBDM). This CBDM might contribute to the heating of the X-ray emitting gas and thus alleviate the cooling flow puzzle. MOND, qua theory of dynamics, does not directly enter the microphysics of the gas; however, it does force a new outlook on the role of DM in shaping the cluster gas dynamics: MOND tells us that the cluster DM is not cold dark matter, is not so abundant, and is not expected in galaxies; it is thus not subject to constraints on baryonic DM in galaxies. The mass in CBDM required in a whole cluster is, typically, similar to that in hot gas, but is rather more centrally concentrated, totally dominating the core. The CBDM contribution to the baryon budget in the universe is thus small. Its properties, deduced for isolated clusters, are consistent with the observations of the "bullet cluster". Its kinetic energy reservoir is much larger than that of the hot gas in the core, and would suffice to keep the gas hot for many cooling times. Heating can be effected in various ways depending on the exact nature of the CBDM, from very massive black holes to cool, compact gas clouds.

  20. Service Like a Bullet

    Institute of Scientific and Technical Information of China (English)

    2010-01-01

    A new fast train boosts competition and the economy in south China’s Pearl River Delta regions The launch of China’s longest high-speed rail road between the two major cities of Wuhan and Guangzhou will

  1. The Cluster Substructure - Alignment Connection

    OpenAIRE

    Plionis, Manolis

    2001-01-01

    Using the APM cluster data we investigate whether the dynamical status of clusters is related to the large-scale structure of the Universe. We find that cluster substructure is strongly correlated with the tendency of clusters to be aligned with their nearest neighbour and in general with the nearby clusters that belong to the same supercluster. Furthermore, dynamically young clusters are more clustered than the overall cluster population. These are strong indications that cluster develop in ...

  2. Expression of Estrogen Sulfotransferase 1E1 and Steroid Sulfatase in Breast Cancer: A Immunohistochemical Study

    Directory of Open Access Journals (Sweden)

    D. Poisson Paré

    2009-01-01

    Full Text Available It is known that the steroid sulfatase (STS and the estrogen sulfotransferase (EST1E1 are commonly expressed in human breast carcinomas. STS and EST1E1 combined action could maintain the equilibrium between sulfated (inactive and unconjugated (active estrogens, which might have effects on development of hormone dependent breast cancer. We studied the expression of the STS and EST1E1 in 88 breast carcinomas and 57 adjacent non-malignant tissues by immunohistochemistry. The results were correlated with the tumor expression of estrogen receptor α (ER-α and β (ER-β, progesterone receptor A (PR-A and B (PR-B and the proliferation marker CDC47, the tumoral type and stage and the age at surgery. STS expression was higher in carcinoma specimens than in adjacent normal tissues, although not to a significant level (p = 0.064 and it was positively associated with CDC47 expression (p 0.05. These observations support the hypothesis that STS is overexpressed in breast cancer and associated with a worse prognosis. EST1E1 was observed for the first time in the nuclei of epithelial and tumoral cells. Tumor expression of EST1E1 was positively correlated with ER-β (p 0.01 and PR-B (p 0.05, two steroid receptors already associated with an improve prognosis for breast cancer. Controlling the STS overexpression in carcinomas could be a way to inhibit cancer growth. The significance of the association between EST1E1 and ER-β or PR-B should be further studied since these two receptors are transcription activators and may regulate the expression of protective enzymes like EST1E1.

  3. Nuclear Clusters in Astrophysics

    Energy Technology Data Exchange (ETDEWEB)

    Kubono, S.; Binh, Dam N.; Hayakawa, S.; Hashimoto, H.; Kahl, D.; Wakabayashi, Y.; Yamaguchi, H. [Center for Nuclear Study (CNS), University of Tokyo, Wako Branch at RIKEN 2-1 Hirosawa, Wako, Saitama, 351-0198 (Japan); Teranishi, T. [Department of Physics, Kyushu University, Fukuoka, 812-8581 (Japan); Iwasa, N. [Department of Physics, Tohoku University, Sendai, 980-8578 (Japan); Komatsubara, T. [Department of Physics, Tsukuba University, Ibaraki, 305-8571 (Japan); Kato, S. [Department of Physics, Yamagata University, Yamagata, 990-8560 (Japan); Khiem, Le H. [Institute of Physics, Vietnam Academy for Science and Technology, Hanoi (Viet Nam)

    2010-03-01

    The role of nuclear clustering is discussed for nucleosynthesis in stellar evolution with Cluster Nucleosynthesis Diagram (CND) proposed before. Special emphasis is placed on alpha-induced stellar reactions together with molecular states for O and C burning.

  4. [Pathophysiology of cluster headache].

    Science.gov (United States)

    Donnet, Anne

    2015-11-01

    The aetiology of cluster headache is partially unknown. Three areas are involved in the pathogenesis of cluster headache: the trigeminal nociceptive pathways, the autonomic system and the hypothalamus. The cluster headache attack involves activation of the trigeminal autonomic reflex. A dysfunction located in posterior hypothalamic gray matter is probably pivotal in the process. There is a probable association between smoke exposure, a possible genetic predisposition and the development of cluster headache.

  5. Cluster Physics with Merging Galaxy Clusters

    Directory of Open Access Journals (Sweden)

    Sandor M. Molnar

    2016-02-01

    Full Text Available Collisions between galaxy clusters provide a unique opportunity to study matter in a parameter space which cannot be explored in our laboratories on Earth. In the standard LCDM model, where the total density is dominated by the cosmological constant ($Lambda$ and the matter density by cold dark matter (CDM, structure formation is hierarchical, and clusters grow mostly by merging.Mergers of two massive clusters are the most energetic events in the universe after the Big Bang,hence they provide a unique laboratory to study cluster physics.The two main mass components in clusters behave differently during collisions:the dark matter is nearly collisionless, responding only to gravity, while the gas is subject to pressure forces and dissipation, and shocks and turbulenceare developed during collisions. In the present contribution we review the different methods used to derive the physical properties of merging clusters. Different physical processes leave their signatures on different wavelengths, thusour review is based on a multifrequency analysis. In principle, the best way to analyze multifrequency observations of merging clustersis to model them using N-body/HYDRO numerical simulations. We discuss the results of such detailed analyses.New high spatial and spectral resolution ground and space based telescopeswill come online in the near future. Motivated by these new opportunities,we briefly discuss methods which will be feasible in the near future in studying merging clusters.

  6. The Durban Auto Cluster

    DEFF Research Database (Denmark)

    Lorentzen, Jochen; Robbins, Glen; Barnes, Justin

    2004-01-01

    The paper describes the formation of the Durban Auto Cluster in the context of trade liberalization. It argues that the improvement of operational competitiveness of firms in the cluster is prominently due to joint action. It tests this proposition by comparing the gains from cluster activities i...

  7. Herschel Observations of a Potential Core Forming Clump: Perseus B1-E

    CERN Document Server

    Sadavoy, S I; Andre, Ph; Pezzuto, S; Bernard, J -P; Bontemps, S; Bressert, E; Chitsazzadeh, S; Fallscheer, C; Hennemann, M; Hill, T; Martin, P; Motte, F; Luong, Q Nguyen; Peretto, N; Reid, M; Schneider, N; Testi, L; White, G J; Wilson, C

    2011-01-01

    We present continuum observations of the Perseus B1-E region from the Herschel Gould Belt Survey. These Herschel data reveal a loose grouping of substructures at 160 - 500 micron not seen in previous submillimetre observations. We measure temperature and column density from these data and select the nine densest and coolest substructures for follow-up spectral line observations with the Green Bank Telescope. We find that the B1-E clump has a mass of ~ 100 solar masses and appears to be gravitationally bound. Furthermore, of the nine substructures examined here, one substructure (B1-E2) appears to be itself bound. The substructures are typically less than a Jeans length from their nearest neighbour and thus, may interact on a timescale of ~ 1 Myr. We propose that B1-E may be forming a first generation of dense cores, which could provide important constraints on the initial conditions of prestellar core formation. Our results suggest that B1-E may be influenced by a strong, localized magnetic field, but further...

  8. Herschel observations of a potential core-forming clump: Perseus B1-E

    Science.gov (United States)

    Sadavoy, S. I.; di Francesco, J.; André, Ph.; Pezzuto, S.; Bernard, J.-P.; Bontemps, S.; Bressert, E.; Chitsazzadeh, S.; Fallscheer, C.; Hennemann, M.; Hill, T.; Martin, P.; Motte, F.; Nguyen Luong, Q.; Peretto, N.; Reid, M.; Schneider, N.; Testi, L.; White, G. J.; Wilson, C.

    2012-04-01

    We present continuum observations of the Perseus B1-E region from the Herschel Gould Belt Survey. These Herschel data reveal a loose grouping of substructures at 160-500 μm not seen in previous submillimetre observations. We measure temperature and column density from these data and select the nine densest and coolest substructures for follow-up spectral line observations with the Green Bank Telescope. We find that the B1-E clump has a mass of ~100 M⊙ and appears to be gravitationally bound. Furthermore, of the nine substructures examined here, one substructure (B1-E2) appears to be itself bound. The substructures are typically less than a Jeans length from their nearest neighbour and thus, may interact on a timescale of ~1 Myr. We propose that B1-E may be forming a first generation of dense cores, which could provide important constraints on the initial conditions of prestellar core formation. Our results suggest that B1-E may be influenced by a strong, localized magnetic field, but further observations are still required.

  9. Mitochondrial genome of the bullet tuna Auxis rochei from Indo-West Pacific collection provides novel genetic information about two subspecies.

    Science.gov (United States)

    Li, Mingming; Guo, Liang; Zhang, Heng; Yang, Sen; Chen, Xinghan; Lin, Haoran; Meng, Zining

    2016-09-01

    Previously morphological studies supported the division of the bullet tuna into the two subspecies, Auxis rochei rochei and A. rochei eudorax. As a cosmopolitan species, A. rochei rochei ranges in the Indo-West Pacific and Atlantic oceans, while A. rochei eudorax inhabits in eastern Pacific region. Here, we used the HiSeq next-generation sequencing technique to determine the mitochondrial genome (mitogenome) of A. rochei from Indo-West Pacific collection, and then compared our data with mitogenomic sequences of the Atlantic and eastern Pacific retrieved from NCBI database. Results showed the mitogenome of A. rochei from three geographic collections shared the same genes and gene order, similar to typical teleosts. Also, we examined a low level of nucleotide diversity among these mitogenomic sequences. Interestingly, nucleotide diversity of intra-subspecies (Atlantic versus Indo-West) was higher than that of inter-subspecies (Atlantic versus eastern Pacific, Indo-West versus eastern Pacific).

  10. Experimental Investigation of Stochastic Pulsation and Formation of Light Bullets with Megagauss Magnetic Fields by an Intense Laser Pulse Propagating in a Preionized Plasma

    Science.gov (United States)

    Vogel, Nadja I.; Kochan, N.

    2001-01-01

    The generation of extremely stable light bullets in a preformed plasma near critical density has been observed experimentally during the interaction of intense picosecond laser beam with a metallic target in air. Optical probing measurements indicate the formation of pulsating channels, typically of about 5 μm in diameter, directed towards a heating laser beam, as well as of disconnected massive plasma blocks moving also towards the laser beam. The velocities of the dense plasma blocks reach the values of 4.5×108 cm/s. The blocks are stable during their acceleration and propagation in air. Self-generated magnetic fields up to 4-7 MG were observed by means of the Faraday rotation of a probe laser beam.

  11. Sequence-based Association Analysis Reveals an MGST1 eQTL with Pleiotropic Effects on Bovine Milk Composition

    Science.gov (United States)

    Littlejohn, Mathew D.; Tiplady, Kathryn; Fink, Tania A.; Lehnert, Klaus; Lopdell, Thomas; Johnson, Thomas; Couldrey, Christine; Keehan, Mike; Sherlock, Richard G.; Harland, Chad; Scott, Andrew; Snell, Russell G.; Davis, Stephen R.; Spelman, Richard J.

    2016-01-01

    The mammary gland is a prolific lipogenic organ, synthesising copious amounts of triglycerides for secretion into milk. The fat content of milk varies widely both between and within species, and recent independent genome-wide association studies have highlighted a milk fat percentage quantitative trait locus (QTL) of large effect on bovine chromosome 5. Although both EPS8 and MGST1 have been proposed to underlie these signals, the causative status of these genes has not been functionally confirmed. To investigate this QTL in detail, we report genome sequence-based imputation and association mapping in a population of 64,244 taurine cattle. This analysis reveals a cluster of 17 non-coding variants spanning MGST1 that are highly associated with milk fat percentage, and a range of other milk composition traits. Further, we exploit a high-depth mammary RNA sequence dataset to conduct expression QTL (eQTL) mapping in 375 lactating cows, revealing a strong MGST1 eQTL underpinning these effects. These data demonstrate the utility of DNA and RNA sequence-based association mapping, and implicate MGST1, a gene with no obvious mechanistic relationship to milk composition regulation, as causally involved in these processes. PMID:27146958

  12. High-speed Bullet Ejections during the AGB-to-Planetary Nebula Transition: HST Observations of the Carbon Star, V Hydrae

    Science.gov (United States)

    Sahai, R.; Scibelli, S.; Morris, M. R.

    2016-08-01

    The well-studied carbon star, V Hya, showing evidence for high-speed, collimated outflows and dense equatorial structures, is a key object in the study of the poorly understood transition of AGB stars into aspherical planetary nebulae. Using the Space Telescope Imaging Spectrograph instrument on board the Hubble Space Telescope, we have obtained high spatial-resolution long-slit optical spectra of V Hya that show high-velocity emission in [S ii] and [Fe ii] lines. Our data set, spanning three epochs spaced apart by a year during each of two periods (in 2002-2004 and 2011-2013), shows that V Hya ejects high-speed (˜200-250 {km} {{{s}}}-1) bullets once every ˜8.5 years. The ejection axis flip-flops around a roughly eastern direction, both in and perpendicular to the sky-plane, and the radial velocities of the ejecta also vary in concert between low and high values. We propose a model in which the bullet ejection is associated with the periastron passage of a binary companion in an eccentric orbit around V Hya with an orbital period of ˜8.5 years. The flip-flop phenomenon is likely the result of collimated ejection from an accretion disk (produced by gravitational capture of material from the primary) that is warped and precessing, and/or that has a magnetic field that is misaligned with that of the companion or the primary star. We show how a previously observed 17 year period in V Hya’s light-cycle can also be explained in our model. Additionally, we describe how the model proposed here can be extended to account for multipolar nebulae.

  13. Effects of E2 and E1-E2 Interference on Coulomb Dissociation of 19C

    Institute of Scientific and Technical Information of China (English)

    Rajesh Kharab; Pardeep Singh; Ravinder Kumar

    2007-01-01

    We investigate the effects of higher order multipole transitions, in particular electric quadrupole (E2) and E1-E2interference, on the Coulomb dissociation of 19 C within the framework of the first order eikonal approximation.The sensitivity of the total Coulomb breakup cross section and the longitudinal momentum distribution of the core fragment to these effects are checked. The breakup occurs predominately through the dipole transition and the contribution of E2 transition to the total cross section is found to be within the range from 1 to 3% of that of E1. It is further observed that the E1-E2 interference term contributes nothing to the integrated cross section.On the other hand, the longitudinal momentum distribution is observed to be insensitive to the E2 transition while the E1-E2 interference introduces a small asymmetry in its shape.

  14. Cluster analysis for applications

    CERN Document Server

    Anderberg, Michael R

    1973-01-01

    Cluster Analysis for Applications deals with methods and various applications of cluster analysis. Topics covered range from variables and scales to measures of association among variables and among data units. Conceptual problems in cluster analysis are discussed, along with hierarchical and non-hierarchical clustering methods. The necessary elements of data analysis, statistics, cluster analysis, and computer implementation are integrated vertically to cover the complete path from raw data to a finished analysis.Comprised of 10 chapters, this book begins with an introduction to the subject o

  15. Management of cluster headache

    DEFF Research Database (Denmark)

    Tfelt-Hansen, Peer C; Jensen, Rigmor H

    2012-01-01

    and agitation. Patients may have up to eight attacks per day. Episodic cluster headache (ECH) occurs in clusters of weeks to months duration, whereas chronic cluster headache (CCH) attacks occur for more than 1 year without remissions. Management of cluster headache is divided into acute attack treatment....... In drug-resistant CCH, neuromodulation with either occipital nerve stimulation or deep brain stimulation of the hypothalamus is an alternative treatment strategy. For most cluster headache patients there are fairly good treatment options both for acute attacks and for prophylaxis. The big problem...

  16. Cluster Decline and Resilience

    DEFF Research Database (Denmark)

    Østergaard, Christian Richter; Park, Eun Kyung

    -2011. Our longitudinal study reveals that technological lock-in and exit of key firms have contributed to impairment of the cluster’s resilience in adapting to disruptions. Entrepreneurship has a positive effect on cluster resilience, while multinational companies have contradicting effects by bringing......Most studies on regional clusters focus on identifying factors and processes that make clusters grow. However, sometimes technologies and market conditions suddenly shift, and clusters decline. This paper analyses the process of decline of the wireless communication cluster in Denmark, 1963...

  17. A Note on the Discovery of Absorption Features in 1E 1207.4-5209

    Institute of Scientific and Technical Information of China (English)

    徐仁新; 王洪光; 乔国俊

    2003-01-01

    Sanwal et al. [Astrophys. J. 574 (2002) L61] supposed that it is very difficult to interpret the absorption features in terms of cyclotron lines. However, we would like to address here that the possibility of the absorption being cyclotron resonance cannot be ruled out. We propose that the isolate neutron star, 1E 1207.4-5209 in the centre of supernova remnant PKS 1209-51/52, has a debris disc and is in a propeller phase, with an accretion rate ~ 6 × 10-11M⊙/year. In this scenario, 1E 1207.4-5209 could also be a bare strange star.

  18. Birc1e/Naip5 rapidly antagonizes modulation of phagosome maturation by Legionella pneumophila.

    Science.gov (United States)

    Fortier, Anne; de Chastellier, Chantal; Balor, Stéphanie; Gros, Philippe

    2007-04-01

    Legionella survives intracellularly by preventing fusion with lysosomes, due to phagosome escape from the endocytic pathway at an early stage of phagosome maturation, and by creating a replicative organelle that acquires endoplasmic reticulum (ER) characteristics through sustained interactions and fusion with the ER. Intracellular replication of Legionella pneumophila in mouse macrophages is controlled by the Lgn1 locus. Functional complementation in vivo has identified the Birc1e/Naip5 gene as being responsible for the Lgn1 effect. To understand the function and temporal site of action of Birc1e/Naip5 in susceptibility to L. pneumophila, we examined the biogenesis of Legionella-containing vacuoles (LCVs) formed in permissive A/J macrophages and in their Birc1e/Naip5 transgenic non-permissive counterpart. Birc1e/Naip5 effects on acquisition of lysosomal and ER markers were evident within 1-2 h following infection. A significantly higher proportion of LCVs formed in Birc1e/Naip5 transgenic macrophages had acquired the lysosomal markers cathepsin D and Lamp1 by 2 h post infection, whereas a significantly higher proportion of LCVs formed in permissive macrophages were positively stained for the ER markers BAP31 and calnexin, 6 h post infection. Likewise, studies by electron microscopy showed acquisition of lysosomal contents (horseradish peroxidase), within the first hour following phagocytic uptake, by LCVs formed in Birc1e/Naip5 transgenic macrophages and delivery of the ER marker glucose 6-phosphatase (G6Pase) only to the lumen of LCVs formed in A/J macrophages. Finally, a larger proportion of LCVs formed in A/J macrophages were studded with ribosomes 24 h post infection, compared with LCVs formed in Birc1e/Naip5 transgenic macrophages. These results suggest that sensing of L. pneumophila products by Birc1e/Naip5 in macrophages occurs rapidly following phagocytosis, a process that antagonizes the ability of L. pneumophila to remodel its phagosome into a specialized

  19. Clustering high dimensional data

    DEFF Research Database (Denmark)

    Assent, Ira

    2012-01-01

    to render traditional clustering algorithms ineffective. The curse of dimensionality, among other effects, means that with increasing number of dimensions, a loss of meaningful differentiation between similar and dissimilar objects is observed. As high-dimensional objects appear almost alike, new approaches...... for clustering are required. Consequently, recent research has focused on developing techniques and clustering algorithms specifically for high-dimensional data. Still, open research issues remain. Clustering is a data mining task devoted to the automatic grouping of data based on mutual similarity. Each cluster...... that provide different cluster models and different algorithmic approaches for cluster detection. Common to all approaches is the fact that they require some underlying assessment of similarity between data objects. In this article, we provide an overview of the effects of high-dimensional spaces...

  20. Clusters in nuclei

    CERN Document Server

    Beck, Christian

    Following the pioneering discovery of alpha clustering and of molecular resonances, the field of nuclear clustering is today one of those domains of heavy-ion nuclear physics that faces the greatest challenges, yet also contains the greatest opportunities. After many summer schools and workshops, in particular over the last decade, the community of nuclear molecular physicists has decided to collaborate in producing a comprehensive collection of lectures and tutorial reviews covering the field. This third volume follows the successful Lect. Notes Phys. 818 (Vol. 1) and 848 (Vol. 2), and comprises six extensive lectures covering the following topics:  - Gamma Rays and Molecular Structure - Faddeev Equation Approach for Three Cluster Nuclear Reactions - Tomography of the Cluster Structure of Light Nuclei Via Relativistic Dissociation - Clustering Effects Within the Dinuclear Model : From Light to Hyper-heavy Molecules in Dynamical Mean-field Approach - Clusterization in Ternary Fission - Clusters in Light N...

  1. Unconventional methods for clustering

    Science.gov (United States)

    Kotyrba, Martin

    2016-06-01

    Cluster analysis or clustering is a task of grouping a set of objects in such a way that objects in the same group (called a cluster) are more similar (in some sense or another) to each other than to those in other groups (clusters). It is the main task of exploratory data mining and a common technique for statistical data analysis used in many fields, including machine learning, pattern recognition, image analysis, information retrieval, and bioinformatics. The topic of this paper is one of the modern methods of clustering namely SOM (Self Organising Map). The paper describes the theory needed to understand the principle of clustering and descriptions of algorithm used with clustering in our experiments.

  2. Spatial cluster modelling

    CERN Document Server

    Lawson, Andrew B

    2002-01-01

    Research has generated a number of advances in methods for spatial cluster modelling in recent years, particularly in the area of Bayesian cluster modelling. Along with these advances has come an explosion of interest in the potential applications of this work, especially in epidemiology and genome research. In one integrated volume, this book reviews the state-of-the-art in spatial clustering and spatial cluster modelling, bringing together research and applications previously scattered throughout the literature. It begins with an overview of the field, then presents a series of chapters that illuminate the nature and purpose of cluster modelling within different application areas, including astrophysics, epidemiology, ecology, and imaging. The focus then shifts to methods, with discussions on point and object process modelling, perfect sampling of cluster processes, partitioning in space and space-time, spatial and spatio-temporal process modelling, nonparametric methods for clustering, and spatio-temporal ...

  3. CLEAN: CLustering Enrichment ANalysis

    Directory of Open Access Journals (Sweden)

    Medvedovic Mario

    2009-07-01

    Full Text Available Abstract Background Integration of biological knowledge encoded in various lists of functionally related genes has become one of the most important aspects of analyzing genome-wide functional genomics data. In the context of cluster analysis, functional coherence of clusters established through such analyses have been used to identify biologically meaningful clusters, compare clustering algorithms and identify biological pathways associated with the biological process under investigation. Results We developed a computational framework for analytically and visually integrating knowledge-based functional categories with the cluster analysis of genomics data. The framework is based on the simple, conceptually appealing, and biologically interpretable gene-specific functional coherence score (CLEAN score. The score is derived by correlating the clustering structure as a whole with functional categories of interest. We directly demonstrate that integrating biological knowledge in this way improves the reproducibility of conclusions derived from cluster analysis. The CLEAN score differentiates between the levels of functional coherence for genes within the same cluster based on their membership in enriched functional categories. We show that this aspect results in higher reproducibility across independent datasets and produces more informative genes for distinguishing different sample types than the scores based on the traditional cluster-wide analysis. We also demonstrate the utility of the CLEAN framework in comparing clusterings produced by different algorithms. CLEAN was implemented as an add-on R package and can be downloaded at http://Clusteranalysis.org. The package integrates routines for calculating gene specific functional coherence scores and the open source interactive Java-based viewer Functional TreeView (FTreeView. Conclusion Our results indicate that using the gene-specific functional coherence score improves the reproducibility of the

  4. The lifetime of electronic excitations in metal clusters

    Science.gov (United States)

    Quijada, M.; Díez Muiño, R.; Echenique, P. M.

    2005-05-01

    Density functional theory and the self-energy formalism are used to evaluate the lifetime of electronic excitations in metal clusters of nanometre size. The electronic structure of the cluster is obtained in the jellium model and spherical symmetry is assumed. Two effects that depend on the size of the clusters are discussed: the change in the number of final states to which the excitation can decay, and the modification in the screened interaction between electrons. For clusters with density parameter rs = 4 and diameter a few nanometres, a lifetime value of {\\approx }5 fs is reached for electronic excitations of {\\approx }1 eV. This value is of the same order of magnitude of that obtained in the bulk limit at the same level of approximation. For smaller clusters, a distinct non-monotonic behaviour of the lifetime as a function of the cluster size is found and the lifetime of excitations of {\\approx }1 eV can vary between 4 and 30 fs.

  5. Agricultural Clusters in the Netherlands

    NARCIS (Netherlands)

    Schouten, M.A.; Heijman, W.J.M.

    2012-01-01

    Michael Porter was the first to use the term cluster in an economic context. He introduced the term in The Competitive Advantage of Nations (1990). The term cluster is also known as business cluster, industry cluster, competitive cluster or Porterian cluster. This article aims at determining and mea

  6. Complete Genome Sequences of Legionella pneumophila subsp. fraseri Strains Detroit-1 and Dallas 1E

    Science.gov (United States)

    Raphael, Brian H.; Kozak-Muiznieks, Natalia A.; Morrison, Shatavia S.; Mercante, Jeffrey W.

    2017-01-01

    ABSTRACT We report here the complete genome sequences of two of the earliest known strains of Legionella pneumophila subsp. fraseri. Detroit-1 is serogroup 1 and was isolated from a lung biopsy specimen in 1977. Dallas 1E is serogroup 5 and was isolated in 1978 from a cooling tower. PMID:28153889

  7. Exceptional flaring activity of the anomalous X-ray pulsar 1E 1547.0-5408

    CERN Document Server

    Savchenko, V; Beckmann, V; Produit, N; Walter, R

    2009-01-01

    (Abridged) We studied an exceptional period of activity of the anomalous X-ray pulsar 1E 1547.0-5408 in January 2009, during which about 200 bursts were detected by INTEGRAL. The major activity episode happened when the source was outside the field of view of all the INTEGRAL instruments. But we were still able to study the properties of 84 bursts detected simultaneously by the anti-coincidence shield of the spectrometer SPI and by the detector of the imager ISGRI. We find that the luminosity of the 22 January 2009 bursts of 1E 1547.0-5408 was > 1e42 erg/s. This luminosity is comparable to that of the bursts of soft gamma repeaters (SGR) and is at least two orders of magnitude larger than the luminosity of the previously reported bursts from AXPs. Similarly to the SGR bursts, the brightest bursts of 1E 1547.0-5408 consist of a short spike of ~100 ms duration with a hard spectrum, followed by a softer extended tail of 1-10 s duration, which occasionally exhibits pulsations with the source spin period of ~2 s. ...

  8. NuSTAR Observations of the Magnetar 1E 2259+586

    DEFF Research Database (Denmark)

    Vogel, Julia K.; Hascoet, Romain; Kaspi, Victoria M.;

    2014-01-01

    We report on new broad band spectral and temporal observations of the magnetar 1E 2259+586, which is located in the supernova remnant CTB 109. Our data were obtained simultaneously with the Nuclear Spectroscopic Telescope Array (NuSTAR) and Swift, and cover the energy range from 0.5-79 keV. We pr...

  9. The spectrum and pulses of 1E 2259+586 from ASCA and BBXRT observations

    Science.gov (United States)

    Corbet, R. H. D.; Smale, A. P.; Ozaki, M.; Koyama, K.; Iwasawa, K.

    1995-01-01

    The 7 s X-ray pulsator 1E 2259+586 was observed for approximately 1 day in 1993 with the Advanced Satellite for Cosmology and Astrophysics (ASCA). Observations were also obtained with Broad Band X-ray Telescope (BBXRT) in 1990 a few months after Ginga had observed 1E 2259+586 to be brighter than normal and the BBXRT data show 1E 2259+586 to be at an intermediate brightness level. By contrast, the ASCA data appear to have been obtained during a more common lower luminosity state. The pulse profiles we obtain are consistent with a connection between flux and pulse shape reported from Ginga data, and the pulsator continues to spin down. We use our high spectral resolution data to search for cyclotron lines in the spectrum that were claimed from observations made with other satellites. We find that the ASCA spectra of 1E 2259+586 cannot be satisfactorily fitted with either a single power law or a combination of two power laws, and that significant residuals occur around 1.5 and 5 keV. However, a combination of a power law and blackbody gives a good fit over the entire ASCA energy band with no evidence of spectral features. We have reanalyzed a Ginga LAC spectrum and find that this is also significantly better fitted by this two-component spectrum than a single power law. A possible explanation for such a two-component spectrum is that the blackbody emission comes from a neutron star and that the power-law component comes, at least in part, from a surrounding nebula. As there has, so far, no direct evidence that 1E 2259+586 is a binary system we consider whether there are other plausible mechanisms that might power the observed X-ray emission.

  10. Clustering Categorical Data:A Cluster Ensemble Approach

    Institute of Scientific and Technical Information of China (English)

    He Zengyou(何增友); Xu Xiaofei; Deng Shengchun

    2003-01-01

    Clustering categorical data, an integral part of data mining,has attracted much attention recently. In this paper, the authors formally define the categorical data clustering problem as an optimization problem from the viewpoint of cluster ensemble, and apply cluster ensemble approach for clustering categorical data. Experimental results on real datasets show that better clustering accuracy can be obtained by comparing with existing categorical data clustering algorithms.

  11. Spatial Scan Statistic: Selecting clusters and generating elliptic clusters

    DEFF Research Database (Denmark)

    Christiansen, Lasse Engbo; Andersen, Jens Strodl

    2004-01-01

    The spatial scan statistic is widely used to search for clusters. This paper shows that the usually applied elimination of overlapping clusters to find secondary clusters is sensitive to smooth changes in the shape of the clusters. We present an algorithm for generation of set of confocal elliptic...... clusters. In addition, we propose a new way to present the information in a given set of clusters based on the significance of the clusters....

  12. Disentangling Porterian Clusters

    DEFF Research Database (Denmark)

    Jagtfelt, Tue

    This dissertation investigates the contemporary phenomenon of industrial clusters based on the work of Michael E. Porter, the central progenitor and promoter of the cluster notion. The dissertation pursues two central questions: 1) What is a cluster? and 2) How could Porter’s seemingly fuzzy...... to his membership on the Commission on Industrial Competitiveness, and that the cluster notion found in his influential book, Nations, represents a significant shift in his conception of cluster compared with his early conceptions. This shift, it is argued, is a deliberate attempt by Porter to create......, contested theory become so widely disseminated and applied as a normative and prescriptive strategy for economic development? The dissertation traces the introduction of the cluster notion into the EU’s Lisbon Strategy and demonstrates how its inclusion originates from Porter’s colleagues: Professor Örjan...

  13. Online Correlation Clustering

    CERN Document Server

    Mathieu, Claire; Schudy, Warren

    2010-01-01

    We study the online clustering problem where data items arrive in an online fashion. The algorithm maintains a clustering of data items into similarity classes. Upon arrival of v, the relation between v and previously arrived items is revealed, so that for each u we are told whether v is similar to u. The algorithm can create a new cluster for v and merge existing clusters. When the objective is to minimize disagreements between the clustering and the input, we prove that a natural greedy algorithm is O(n)-competitive, and this is optimal. When the objective is to maximize agreements between the clustering and the input, we prove that the greedy algorithm is .5-competitive; that no online algorithm can be better than .834-competitive; we prove that it is possible to get better than 1/2, by exhibiting a randomized algorithm with competitive ratio .5+c for a small positive fixed constant c.

  14. Melting of sodium clusters

    CERN Document Server

    Reyes-Nava, J A; Beltran, M R; Michaelian, K

    2002-01-01

    Thermal stability properties and the melting-like transition of Na_n, n=13-147, clusters are studied through microcanonical molecular dynamics simulations. The metallic bonding in the sodium clusters is mimicked by a many-body Gupta potential based on the second moment approximation of a tight-binding Hamiltonian. The characteristics of the solid-to-liquid transition in the sodium clusters are analyzed by calculating physical quantities like caloric curves, heat capacities, and root-mean-square bond length fluctuations using simulation times of several nanoseconds. Distinct melting mechanisms are obtained for the sodium clusters in the size range investigated. The calculated melting temperatures show an irregular variation with the cluster size, in qualitative agreement with recent experimental results. However, the calculated melting point for the Na_55 cluster is about 40 % lower than the experimental value.

  15. Cosmology with cluster surveys

    Indian Academy of Sciences (India)

    Subhabrata Majumdar

    2004-10-01

    Surveys of clusters of galaxies provide us with a powerful probe of the density and nature of the dark energy. The red-shift distribution of detected clusters is highly sensitive to the dark energy equation of state parameter . Upcoming Sunyaev–Zel'dovich (SZ) surveys would provide us large yields of clusters to very high red-shifts. Self-calibration of cluster scaling relations, possible for such a huge sample, would be able to constrain systematic biases on mass estimators. Combining cluster red-shift abundance with limited mass follow-up and cluster mass power spectrum can then give constraints on , as well as on 8 and to a few per cents.

  16. CSR in Industrial Clusters

    DEFF Research Database (Denmark)

    Lund-Thomsen, Peter; Pillay, Renginee G.

    2012-01-01

    Purpose – The paper seeks to review the literature on CSR in industrial clusters in developing countries, identifying the main strengths, weaknesses, and gaps in this literature, pointing to future research directions and policy implications in the area of CSR and industrial cluster development...... in this field and their comments incorporated in the final version submitted to Corporate Governance. Findings – The article traces the origins of the debate on industrial clusters and CSR in developing countries back to the early 1990s when clusters began to be seen as an important vehicle for local economic...... development in the South. At the turn of the millennium the industrial cluster debate expanded as clusters were perceived as a potential source of poverty reduction, while their role in promoting CSR among small and medium-sized enterprises began to take shape from 2006 onwards. At present, there is still...

  17. Cluster Management Institutionalization

    DEFF Research Database (Denmark)

    Normann, Leo; Agger Nielsen, Jeppe

    2015-01-01

    This article explores a new management form – cluster management – in Danish public sector day care. Although cluster management has been widely adopted in Danish day care at the municipality level, it has attracted only sparse research attention. We use theoretical insights from Scandinavian...... institutionalism together with a longitudinal case-based inquiry into how cluster management has entered and penetrated the management practices of day care in Denmark. We demonstrate how cluster management became widely adopted in the day care field not only because of its intrinsic properties but also because...... of how it was legitimized as a “ready-to-use” management model. Further, our account reveals how cluster management translated into considerably different local variants as it travelled into specific organizations. However, these processes have not occurred sequentially with cluster management first...

  18. FSR0190 - Another old distant galactic cluster

    CERN Document Server

    Fröbrich, D; Davis, C J

    2007-01-01

    We are conducting a large program to classify newly discovered Milky Way star cluster candidates from Froebrich et al. (2007). Here we present NIR follow-up observations of FSR0190 (RA=20h05m31.3s, DEC=33deg34'09" J2000). The cluster is situated close to the Galactic Plane (l=70.7302deg, b=+0.9498deg). It shows a circular shape, a relatively large number of core helium burning stars -- which clearly distinguishes the cluster from the rich field -- but no centrally condensed star density profile. We derive an age of more than 7Gyr, a Galactocentric distance of 10.5kpc, a distance of 10kpc from the Sun, and an extinction of A_K=0.8mag. The estimated mass is at least of the order of 1E5M_sun, and the absolute brightness is M_V<=-4.7mag; both are rather typical properties for Palomar-type globular clusters.

  19. Structures in Galaxy Clusters

    CERN Document Server

    Escalera, E; Girardi, M; Giuricin, G; Mardirossian, F; Mazure, A; Mezzetti, M

    1993-01-01

    The analysis of the presence of substructures in 16 well-sampled clusters of galaxies suggests a stimulating hypothesis: Clusters could be classified as unimodal or bimodal, on the basis of to the sub-clump distribution in the {\\em 3-D} space of positions and velocities. The dynamic study of these clusters shows that their fundamental characteristics, in particular the virial masses, are not severely biased by the presence of subclustering if the system considered is bound.

  20. Clustering Techniques in Bioinformatics

    Directory of Open Access Journals (Sweden)

    Muhammad Ali Masood

    2015-01-01

    Full Text Available Dealing with data means to group information into a set of categories either in order to learn new artifacts or understand new domains. For this purpose researchers have always looked for the hidden patterns in data that can be defined and compared with other known notions based on the similarity or dissimilarity of their attributes according to well-defined rules. Data mining, having the tools of data classification and data clustering, is one of the most powerful techniques to deal with data in such a manner that it can help researchers identify the required information. As a step forward to address this challenge, experts have utilized clustering techniques as a mean of exploring hidden structure and patterns in underlying data. Improved stability, robustness and accuracy of unsupervised data classification in many fields including pattern recognition, machine learning, information retrieval, image analysis and bioinformatics, clustering has proven itself as a reliable tool. To identify the clusters in datasets algorithm are utilized to partition data set into several groups based on the similarity within a group. There is no specific clustering algorithm, but various algorithms are utilized based on domain of data that constitutes a cluster and the level of efficiency required. Clustering techniques are categorized based upon different approaches. This paper is a survey of few clustering techniques out of many in data mining. For the purpose five of the most common clustering techniques out of many have been discussed. The clustering techniques which have been surveyed are: K-medoids, K-means, Fuzzy C-means, Density-Based Spatial Clustering of Applications with Noise (DBSCAN and Self-Organizing Map (SOM clustering.

  1. Clustering of Absorbers

    CERN Document Server

    Cristiani, S; D'Odorico, V; Fontana, A; Giallongo, E; Moscardini, L; Savaglio, S

    1997-01-01

    The observed clustering of Lyman-$\\alpha$ lines is reviewed and compared with the clustering of CIV systems. We argue that a continuity of properties exists between Lyman-$\\alpha$ and metal systems and show that the small-scale clustering of the absorbers is consistent with a scenario of gravitationally induced correlations. At large scales statistically significant over and under-densities (including voids) are found on scales of tens of Mpc.

  2. Galaxy Clusters with Chandra

    CERN Document Server

    Forman, W; Markevitch, M L; Vikhlinin, A A; Churazov, E

    2002-01-01

    We discuss Chandra results related to 1) cluster mergers and cold fronts and 2) interactions between relativistic plasma and hot cluster atmospheres. We describe the properties of cold fronts using NGC1404 in the Fornax cluster and A3667 as examples. We discuss multiple surface brightness discontinuities in the cooling flow cluster ZW3146. We review the supersonic merger underway in CL0657. Finally, we summarize the interaction between plasma bubbles produced by AGN and hot gas using M87 and NGC507 as examples.

  3. Star Clusters within FIRE

    Science.gov (United States)

    Perez, Adrianna; Moreno, Jorge; Naiman, Jill; Ramirez-Ruiz, Enrico; Hopkins, Philip F.

    2017-01-01

    In this work, we analyze the environments surrounding star clusters of simulated merging galaxies. Our framework employs Feedback In Realistic Environments (FIRE) model (Hopkins et al., 2014). The FIRE project is a high resolution cosmological simulation that resolves star forming regions and incorporates stellar feedback in a physically realistic way. The project focuses on analyzing the properties of the star clusters formed in merging galaxies. The locations of these star clusters are identified with astrodendro.py, a publicly available dendrogram algorithm. Once star cluster properties are extracted, they will be used to create a sub-grid (smaller than the resolution scale of FIRE) of gas confinement in these clusters. Then, we can examine how the star clusters interact with these available gas reservoirs (either by accreting this mass or blowing it out via feedback), which will determine many properties of the cluster (star formation history, compact object accretion, etc). These simulations will further our understanding of star formation within stellar clusters during galaxy evolution. In the future, we aim to enhance sub-grid prescriptions for feedback specific to processes within star clusters; such as, interaction with stellar winds and gas accretion onto black holes and neutron stars.

  4. The Youngest Globular Clusters

    CERN Document Server

    Beck, Sara

    2014-01-01

    It is likely that all stars are born in clusters, but most clusters are not bound and disperse. None of the many protoclusters in our Galaxy are likely to develop into long-lived bound clusters. The Super Star Clusters (SSCs) seen in starburst galaxies are more massive and compact and have better chances of survival. The birth and early development of SSCs takes place deep in molecular clouds, and during this crucial stage the embedded clusters are invisible to optical or UV observations but are studied via the radio-infared supernebulae (RISN) they excite. We review observations of embedded clusters and identify RISN within 10 Mpc whose exciting clusters have a million solar masses or more in volumes of a few cubic parsecs and which are likely to not only survive as bound clusters, but to evolve into objects as massive and compact as Galactic globulars. These clusters are distinguished by very high star formation efficiency eta, at least a factor of 10 higher than the few percent seen in the Galaxy, probably...

  5. 15th Cluster workshop

    CERN Document Server

    Laakso, Harri; Escoubet, C. Philippe; The Cluster Active Archive : Studying the Earth’s Space Plasma Environment

    2010-01-01

    Since the year 2000 the ESA Cluster mission has been investigating the small-scale structures and processes of the Earth's plasma environment, such as those involved in the interaction between the solar wind and the magnetospheric plasma, in global magnetotail dynamics, in cross-tail currents, and in the formation and dynamics of the neutral line and of plasmoids. This book contains presentations made at the 15th Cluster workshop held in March 2008. It also presents several articles about the Cluster Active Archive and its datasets, a few overview papers on the Cluster mission, and articles reporting on scientific findings on the solar wind, the magnetosheath, the magnetopause and the magnetotail.

  6. 动车电机检修工艺布局优化及信息化管理研究%A Research on Optimizationand Informatization Management of the Process Layout of Maintenanceand Repair for BulletTrain

    Institute of Scientific and Technical Information of China (English)

    蔡阳; 刘丹丹; 杨朋飞; 王长江; 胡林福; 雷金; 赵桂发

    2015-01-01

    This paper introducedthe compositepatternof themaintenance assemblylineof bullet train, from the perspec-tive of lean production,it integrated the concept of “a flow" andbalancedproducting line balancing , combined with modern information technology, it designed a new patten of process layout for the maintenanceof bullet train.%主要介绍了动车电机检修的流水线组成模式,从精益生产角度,综合运用“一个流”和生产线平衡理念,结合现代信息技术,设计一种动车电机检修工艺布局新模式。

  7. Document Clustering Based on Semi-Supervised Term Clustering

    Directory of Open Access Journals (Sweden)

    Hamid Mahmoodi

    2012-05-01

    Full Text Available The study is conducted to propose a multi-step feature (term selection process and in semi-supervised fashion, provide initial centers for term clusters. Then utilize the fuzzy c-means (FCM clustering algorithm for clustering terms. Finally assign each of documents to closest associated term clusters. While most text clustering algorithms directly use documents for clustering, we propose to first group the terms using FCM algorithm and then cluster documents based on terms clusters. We evaluate effectiveness of our technique on several standard text collections and compare our results with the some classical text clustering algorithms.

  8. Suzaku Studies of the Supernova Remnant CTB~109 Hosting the Magnetar 1E~2259+586

    CERN Document Server

    Nakano, Toshio; Hiraga, Junoko S; Uchiyama, Hideki; Kaneda, Hidehiro; Enoto, Teruaki

    2015-01-01

    Ages of the magnetar 1E 2259+586 and the associated supernova remnant CTB~109 were studied. Analyzing the Suzaku data of CTB~109, its age was estimated to be $\\sim$14~kyr, which is much shorter than the measured characteristic age of 1E 2259+586, 230 kyr. This reconfirms the previously reported age discrepancy of this magnetar/remnant association, and suggests that the characteristic ages of magnetars are generally over-estimated as compared to their true ages. This discrepancy is thought to arise because the former are calculated without considering decay of the magnetic fields. This novel view is supported independently by much stronger Galactic-plane concentration of magnetars than other pulsars. The process of magnetic field decay in magnetars is mathematically modeled. It is implied that magnetars are much younger objects than previously considered, and can dominate new-born neutron stars.

  9. Possible NIR counterpart to the AXP 1E 1547.0-5408

    Science.gov (United States)

    Mignani, R. P.; Rea, N.; Israel, G. L.; Testa, V.; Esposito, P.

    2008-10-01

    On 2008 October 3rd, Swift-BAT triggered on several short bursts from the direction of the Anomalous X-ray Pulsar (AXP) 1E1547.0-5408 (Krimm et al. GCN 8311, 8312; Rea et al. Atel #1756). This is the second known transient radio AXP discovered to date (Gelfand & Gaensler 2007; Camilo et al. 2007), and it showed the previous X-ray outburst around June 2007 (Halpern et al. 2008). During the decay of the 2007 X-ray outburst we observed 1E 1547.0-5408 in the Ks band (on 2007 July 8th, 12th, and August 17th) with the NAOS -CONICA (NACO) instrument mounted at the ESO- VLT (Mignani, Rea, Testa, et al., 2008 submitted).

  10. "5M1E"法在生产管理中的运用

    Institute of Scientific and Technical Information of China (English)

    刘秋香

    2010-01-01

    人(man)、机械(machine)、材料(material)、方法(method)、环境(enviroment)、管理(manage)这几个主要环节实行全面质量管理,称为"5M1E"法.在生产管理中应用该法,可以达到提升人品质、提升产品品质,提高员工士气.

  11. Phenotypic diversity of toxigenic Vibrio cholerae O1 E1 Tor strains identified in China

    Institute of Scientific and Technical Information of China (English)

    赵璇

    2014-01-01

    Objective To understand the phenotypic diversity of toxigenic Vibrio cholerae O1 E1 Tor strains isolated from different provinces in China during the last 50 years.Methods Traditional biotyping testings including susceptibility to polymyxin B,sensitivity to groupⅣphage,Voges-Proskauer test and haemolysis of sheep erythrocytes were conducted.Results Data from Biotype-specific phenotype analysis revealed that only 133 isolates carried the typical E1 Tor phenotypes while the other 251

  12. Evidence for the magnetar nature of 1E 161348-5055 in RCW 103

    Science.gov (United States)

    D'Aì, A.; Evans, P. A.; Burrows, D. N.; Kuin, N. P. M.; Kann, D. A.; Campana, S.; Maselli, A.; Romano, P.; Cusumano, G.; La Parola, V.; Barthelmy, S. D.; Beardmore, A. P.; Cenko, S. B.; De Pasquale, M.; Gehrels, N.; Greiner, J.; Kennea, J. A.; Klose, S.; Melandri, A.; Nousek, J. A.; Osborne, J. P.; Palmer, D. M.; Sbarufatti, B.; Schady, P.; Siegel, M. H.; Tagliaferri, G.; Yates, R.; Zane, S.

    2016-12-01

    We report on the detection of a bright, short, structured X-ray burst coming from the supernova remnant RCW 103 on 2016 June 22 caught by the Swift/Burst Alert Telescope (BAT) monitor, and on the follow-up campaign made with Swift/X-ray Telescope, Swift/UV/Optical Telescope, and the optical/near-infrared (NIR) Gamma-Ray burst Optical and Near-infrared Detector. The characteristics of this flash, such as duration and spectral shape, are consistent with typical short bursts observed from soft gamma repeaters. The BAT error circle at 68 per cent confidence range encloses the point-like X-ray source at the centre of the nebula, 1E 161348-5055. Its nature has been long debated due to a periodicity of 6.67 h in X-rays, which could indicate either an extremely slow pulsating neutron star, or the orbital period of a very compact X-ray binary system. We found that 20 min before the BAT trigger, the soft X-ray emission of 1E 161348-5055 was a factor of ˜100 higher than measured 2 yr earlier, indicating that an outburst had already started. By comparing the spectral and timing characteristics of the source in the 2 yr before the outburst and after the BAT event, we find that, besides a change in luminosity and spectral shape, also the 6.67 h pulsed profile has significantly changed with a clear phase shift with respect to its low-flux profile. The UV/optical/NIR observations did not reveal any counterpart at the position of 1E 161348-5055. Based on these findings, we associate the BAT burst with 1E 161348-5055, we classify it as a magnetar, and pinpoint the 6.67 h periodicity as the magnetar spin period.

  13. The merging cluster Abell 1758: an optical and dynamical view

    Science.gov (United States)

    Monteiro-Oliveira, Rogerio; Serra Cypriano, Eduardo; Machado, Rubens; Lima Neto, Gastao B.

    2015-08-01

    The galaxy cluster Abell 1758-North (z=0.28) is a binary system composed by the sub-structures NW and NE. This is supposed to be a post-merging cluster due to observed detachment between the NE BCG and the respective X-ray emitting hot gas clump in a scenario very close to the famous Bullet Cluster. On the other hand, the projected position of the NW BCG coincides with the local hot gas peak. This system was been targeted previously by several studies, using multiple wavelengths and techniques, but there is still no clear picture of the scenario that could have caused this unusual configuration. To help solving this complex puzzle we added some pieces: firstly, we have used deep B, RC and z' Subaru images to perform both weak lensing shear and magnification analysis of A1758 (including here the South component that is not in interaction with A1758-North) modeling each sub-clump as an NFW profile in order to constrain masses and its center positions through MCMC methods; the second piece is the dynamical analysis using radial velocities available in the literature (143) plus new Gemini-GMOS/N measurements (68 new redshifts).From weak lensing we found that independent shear and magnification mass determinations are in excellent agreement between them and combining both we could reduce mass error bar by ~30% compared to shear alone. By combining this two weak-lensing probes we found that the position of both Northern BCGs are consistent with the masses centers within 2σ and and the NE hot gas peak to be offseted of the respective mass peak (M200=5.5 X 1014 M⊙) with very high significance. The most massive structure is NW (M200=7.95 X 1014 M⊙ ) where we observed no detachment between gas, DM and BCG.We have calculated a low line-of-sight velocity difference (<300 km/s) between A1758 NW and NE. We have combined it with the projected velocity of 1600 km/s which was estimated by previous X-ray analysis (David & Kempner 2004) and we have obtained a small angle between

  14. A Mid-Infrared Counterpart to the Magnetar 1E 2259+586

    CERN Document Server

    Kaplan, David L; Wang, Zhongxiang; Wachter, Stefanie

    2009-01-01

    We report the discovery of a 4.5 um counterpart to the anomalous X-ray pulsar (magnetar) 1E 2259+586 with the Spitzer Space Telescope. The mid-infrared flux density is 6.3+/-1.0 uJy at 4.5 um and <20 uJy (at 95% confidence) at 8 um, or 0.02% of the 2-10 keV X-ray flux (corrected for extinction). Combining our Spitzer measurements with previously published near-infrared data, we show that the overall infrared emission from 1E 2259+586 is qualitatively similar to that from the magnetar 4U 0142+61. Therefore the passive X-ray-heated dust disk model originally developed for 4U 0142+61 might also apply to 1E 2259+586. However, the IR data from this source can also be fitted by a simple power-law spectrum as might be expected from magnetospheric emission.

  15. Neutronic analysis of the 1D and 1E banks reflux detection system

    Energy Technology Data Exchange (ETDEWEB)

    Blanchard, A.

    1999-12-21

    Two H Canyon neutron monitoring systems for early detection of postulated abnormal reflux conditions in the Second Uranium Cycle 1E and 1D Mixer-Settle Banks have been designed and built. Monte Carlo neutron transport simulations using the general purpose, general geometry, n-particle MCNP code have been performed to model expected response of the monitoring systems to varying conditions.The confirmatory studies documented herein conclude that the 1E and 1D neutron monitoring systems are able to achieve adequate neutron count rates for various neutron source and detector configurations, thereby eliminating excessive integration count time. Neutron count rate sensitivity studies are also performed. Conversely, the transport studies concluded that the neutron count rates are statistically insensitive to nitric acid content in the aqueous region and to the transition region length. These studies conclude that the 1E and 1D neutron monitoring systems are able to predict the postulated reflux conditions for all examined perturbations in the neutron source and detector configurations. In the cases examined, the relative change in the neutron count rates due to postulated transitions from normal {sup 235}U concentration levels to reflux levels remain satisfactory detectable.

  16. Security 1E10 anti-idiotypic vaccine in patients with tumors of different locations

    Directory of Open Access Journals (Sweden)

    Carmen Viada

    2016-02-01

    Full Text Available Cancer is a leading cause of death in Cuba and the world. Lung cancer is the leading cause of death, breast cancer is the second leading cause of death and colorectal cancer is the third leading cause of death. The 1E10 anti-idiotype vaccine is a new immunotherapeutic agent, registered for lung cancer by the Center for Molecular Immunology (CIM. You want to evaluate the safety of this vaccine in the treatment of various cancer sites. To determine the safety adverse events occurred in six clinical trials (one stage I lung, 3 phase II in breast, colon and lung, 1 phase II-III and program expanded use, both in lung were evaluated. 656 patients were studied. Demographic variables, the characteristics of the disease and adverse events were measured. The studies were balanced with respect to baseline characteristics. The most common adverse events were local reactions associated with 1E10 anti-idiotype vaccine and systemic reactions of mild or moderate intensity that were not related to the administration of the vaccine under study. The 1E10 anti-idiotype vaccine is safe for the low frequency and intensity of adverse events reported.

  17. HST and VLT observations of the neutron star 1E 1207.4-5209

    CERN Document Server

    De Luca, A; Sartori, A; Hummel, W; Caraveo, P A; Mereghetti, S; Bignami, G F

    2010-01-01

    1E 1207.4-5209, the peculiar Central Compact object in the G296.5+10.0 supernova remnant, has been proposed to be an "anti-magnetar" - a young neutron star born with a weak dipole field. Accretion, possibly of supernova fallback material, has also been invoked to explain a large surface temperature anisotropy as well as the generation of peculiar cyclotron absorption features superimposed to its thermal spectrum. Interestingly enough, a faint optical/infrared source was proposed as a possible counterpart to 1E 1207.4-5209, but later questioned, based on coarse positional coincidence. Considering the large offset of 1E 1207.4-5209 with respect to the center of its host supernova remnant, the source should move at ~70 mas/yr. Thus, we tested the association by measuring the proper motion of the proposed optical counterpart. Using HST observations spanning 3.75 years, we computed a 3 sigma upper limit of 7 mas/yr. Absolute astrometry on the same HST data set also places the optical source significantly off the 9...

  18. Clustering Text Data Streams

    Institute of Scientific and Technical Information of China (English)

    Yu-Bao Liu; Jia-Rong Cai; Jian Yin; Ada Wai-Chee Fu

    2008-01-01

    Clustering text data streams is an important issue in data mining community and has a number of applications such as news group filtering, text crawling, document organization and topic detection and tracing etc. However, most methods are similarity-based approaches and only use the TF*IDF scheme to represent the semantics of text data and often lead to poor clustering quality. Recently, researchers argue that semantic smoothing model is more efficient than the existing TF.IDF scheme for improving text clustering quality. However, the existing semantic smoothing model is not suitable for dynamic text data context. In this paper, we extend the semantic smoothing model into text data streams context firstly. Based on the extended model, we then present two online clustering algorithms OCTS and OCTSM for the clustering of massive text data streams. In both algorithms, we also present a new cluster statistics structure named cluster profile which can capture the semantics of text data streams dynamically and at the same time speed up the clustering process. Some efficient implementations for our algorithms are also given. Finally, we present a series of experimental results illustrating the effectiveness of our technique.

  19. Neurostimulation in cluster headache

    DEFF Research Database (Denmark)

    Pedersen, Jeppe L; Barloese, Mads; Jensen, Rigmor H

    2013-01-01

    PURPOSE OF REVIEW: Neurostimulation has emerged as a viable treatment for intractable chronic cluster headache. Several therapeutic strategies are being investigated including stimulation of the hypothalamus, occipital nerves and sphenopalatine ganglion. The aim of this review is to provide...... effective strategy must be preferred as first-line therapy for intractable chronic cluster headache....

  20. Securing personal network clusters

    NARCIS (Netherlands)

    Jehangir, Assed; Heemstra de Groot, Sonia M.

    2007-01-01

    A Personal Network is a self-organizing, secure and private network of a user’s devices notwithstanding their geographic location. It aims to utilize pervasive computing to provide users with new and improved services. In this paper we propose a model for securing Personal Network clusters. Clusters

  1. [Cluster headache differential diagnosis].

    Science.gov (United States)

    Guégan-Massardier, Evelyne; Laubier, Cécile

    2015-11-01

    Cluster headache is characterized by disabling stereotyped headache. Early diagnosis allows appropriate treatment, unfortunately diagnostic errors are frequent. The main differential diagnoses are other primary or essential headaches. Migraine, more frequent and whose diagnosis is carried by excess, trigeminal neuralgia or other trigemino-autonomic cephalgia. Vascular or tumoral underlying condition can mimic cluster headache, neck and brain imaging is recommended, ideally MRI.

  2. Coma cluster of galaxies

    Science.gov (United States)

    1999-01-01

    Atlas Image mosaic, covering 34' x 34' on the sky, of the Coma cluster, aka Abell 1656. This is a particularly rich cluster of individual galaxies (over 1000 members), most prominently the two giant ellipticals, NGC 4874 (right) and NGC 4889 (left). The remaining members are mostly smaller ellipticals, but spiral galaxies are also evident in the 2MASS image. The cluster is seen toward the constellation Coma Berenices, but is actually at a distance of about 100 Mpc (330 million light years, or a redshift of 0.023) from us. At this distance, the cluster is in what is known as the 'Hubble flow,' or the overall expansion of the Universe. As such, astronomers can measure the Hubble Constant, or the universal expansion rate, based on the distance to this cluster. Large, rich clusters, such as Coma, allow astronomers to measure the 'missing mass,' i.e., the matter in the cluster that we cannot see, since it gravitationally influences the motions of the member galaxies within the cluster. The near-infrared maps the overall luminous mass content of the member galaxies, since the light at these wavelengths is dominated by the more numerous older stellar populations. Galaxies, as seen by 2MASS, look fairly smooth and homogeneous, as can be seen from the Hubble 'tuning fork' diagram of near-infrared galaxy morphology. Image mosaic by S. Van Dyk (IPAC).

  3. Cluster Management Institutionalization

    DEFF Research Database (Denmark)

    Normann, Leo; Agger Nielsen, Jeppe

    2015-01-01

    This article explores a new management form – cluster management – in Danish public sector day care. Although cluster management has been widely adopted in Danish day care at the municipality level, it has attracted only sparse research attention. We use theoretical insights from Scandinavian ins...

  4. Cluster Synchronization Algorithms

    NARCIS (Netherlands)

    Xia, Weiguo; Cao, Ming

    2010-01-01

    This paper presents two approaches to achieving cluster synchronization in dynamical multi-agent systems. In contrast to the widely studied synchronization behavior, where all the coupled agents converge to the same value asymptotically, in the cluster synchronization problem studied in this paper,

  5. Cost-Effective Clustering

    CERN Document Server

    Gottlieb, S

    2001-01-01

    Small Beowulf clusters can effectively serve as personal or group supercomputers. In such an environment, a cluster can be optimally designed for a specific problem (or a small set of codes). We discuss how theoretical analysis of the code and benchmarking on similar hardware lead to optimal systems.

  6. Relevant Subspace Clustering

    DEFF Research Database (Denmark)

    Müller, Emmanuel; Assent, Ira; Günnemann, Stephan;

    2009-01-01

    Subspace clustering aims at detecting clusters in any subspace projection of a high dimensional space. As the number of possible subspace projections is exponential in the number of dimensions, the result is often tremendously large. Recent approaches fail to reduce results to relevant subspace c...

  7. Finslerian MOND versus the Strong Gravitational Lensing of the Early-type Galaxies

    CERN Document Server

    Chang, Zhe; Li, Xin; Lin, Hai-Nan; Wang, Sai

    2013-01-01

    The gravitational lensing of Bullet Clusters and early-type galaxies pose serious challenges on the validity of MOND. Recently, Finslerian MOND, a generalization of MOND in the framework of Finsler gravity, has been proposed to explain the mass discrepancy problem of Bullet Cluster 1E 0657\\ 558. In this paper, we check the validity of the Finslerian MOND in describing the strong gravitational lensing of early-type galaxies. The investigation on ten strong lenses of the CASTLES samples shows that there is no strong evidence for the existence of dark matter.

  8. On TPC cluster reconstruction

    CERN Document Server

    Dydak, F; Nefedov, Y; Wotschack, J; Zhemchugov, A

    2004-01-01

    For a bias-free momentum measurement of TPC tracks, the correct determination of cluster positions is mandatory. We argue in particular that (i) the reconstruction of the entire longitudinal signal shape in view of longitudinal diffusion, electronic pulse shaping, and track inclination is important both for the polar angle reconstruction and for optimum r phi resolution; and that (ii) self-crosstalk of pad signals calls for special measures for the reconstruction of the z coordinate. The problem of 'shadow clusters' is resolved. Algorithms are presented for accepting clusters as 'good' clusters, and for the reconstruction of the r phi and z cluster coordinates, including provisions for 'bad' pads and pads next to sector boundaries, respectively.

  9. Job Oriented Monitoring Clusters

    Directory of Open Access Journals (Sweden)

    Vijayalaxmi Cigala,

    2011-03-01

    Full Text Available There has been a lot of development in the field of clusters and grids. Recently, the use of clusters has been on rise in every possible field. This paper proposes a system that monitors jobs onlarge computational clusters. Monitoring jobs is essential to understand how jobs are being executed. This helps us in understanding the complete life cycle of the jobs being executed on large clusters. Also, this paper describes how the information obtained by monitoring the jobs would help in increasing the overall throughput of clusters. Heuristics help in efficient job distribution among the computational nodes, thereby accomplishing fair job distribution policy. The proposed system would be capable of loadbalancing among the computational nodes, detecting failures, taking corrective actions after failure detection, job monitoring, system resource monitoring, etc.

  10. Neutrosophic Hierarchical Clustering Algoritms

    Directory of Open Access Journals (Sweden)

    Rıdvan Şahin

    2014-03-01

    Full Text Available Interval neutrosophic set (INS is a generalization of interval valued intuitionistic fuzzy set (IVIFS, whose the membership and non-membership values of elements consist of fuzzy range, while single valued neutrosophic set (SVNS is regarded as extension of intuitionistic fuzzy set (IFS. In this paper, we extend the hierarchical clustering techniques proposed for IFSs and IVIFSs to SVNSs and INSs respectively. Based on the traditional hierarchical clustering procedure, the single valued neutrosophic aggregation operator, and the basic distance measures between SVNSs, we define a single valued neutrosophic hierarchical clustering algorithm for clustering SVNSs. Then we extend the algorithm to classify an interval neutrosophic data. Finally, we present some numerical examples in order to show the effectiveness and availability of the developed clustering algorithms.

  11. A Commodity Computing Cluster

    Science.gov (United States)

    Teuben, P. J.; Wolfire, M. G.; Pound, M. W.; Mundy, L. G.

    We have assembled a cluster of Intel-Pentium based PCs running Linux to compute a large set of Photodissociation Region (PDR) and Dust Continuum models. For various reasons the cluster is heterogeneous, currently ranging from a single Pentium-II 333 MHz to dual Pentium-III 450 MHz CPU machines. Although this will be sufficient for our ``embarrassingly parallelizable problem'' it may present some challenges for as yet unplanned future use. In addition the cluster was used to construct a MIRIAD benchmark, and compared to equivalent Ultra-Sparc based workstations. Currently the cluster consists of 8 machines, 14 CPUs, 50GB of disk-space, and a total peak speed of 5.83 GHz, or about 1.5 Gflops. The total cost of this cluster has been about $12,000, including all cabling, networking equipment, rack, and a CD-R backup system. The URL for this project is http://dustem.astro.umd.edu.

  12. Mathematical classification and clustering

    CERN Document Server

    Mirkin, Boris

    1996-01-01

    I am very happy to have this opportunity to present the work of Boris Mirkin, a distinguished Russian scholar in the areas of data analysis and decision making methodologies. The monograph is devoted entirely to clustering, a discipline dispersed through many theoretical and application areas, from mathematical statistics and combina­ torial optimization to biology, sociology and organizational structures. It compiles an immense amount of research done to date, including many original Russian de­ velopments never presented to the international community before (for instance, cluster-by-cluster versions of the K-Means method in Chapter 4 or uniform par­ titioning in Chapter 5). The author's approach, approximation clustering, allows him both to systematize a great part of the discipline and to develop many in­ novative methods in the framework of optimization problems. The optimization methods considered are proved to be meaningful in the contexts of data analysis and clustering. The material presented in ...

  13. Cool Cluster Correctly Correlated

    Energy Technology Data Exchange (ETDEWEB)

    Varganov, Sergey Aleksandrovich [Iowa State Univ., Ames, IA (United States)

    2005-01-01

    Atomic clusters are unique objects, which occupy an intermediate position between atoms and condensed matter systems. For a long time it was thought that physical and chemical properties of atomic dusters monotonically change with increasing size of the cluster from a single atom to a condensed matter system. However, recently it has become clear that many properties of atomic clusters can change drastically with the size of the clusters. Because physical and chemical properties of clusters can be adjusted simply by changing the cluster's size, different applications of atomic clusters were proposed. One example is the catalytic activity of clusters of specific sizes in different chemical reactions. Another example is a potential application of atomic clusters in microelectronics, where their band gaps can be adjusted by simply changing cluster sizes. In recent years significant advances in experimental techniques allow one to synthesize and study atomic clusters of specified sizes. However, the interpretation of the results is often difficult. The theoretical methods are frequently used to help in interpretation of complex experimental data. Most of the theoretical approaches have been based on empirical or semiempirical methods. These methods allow one to study large and small dusters using the same approximations. However, since empirical and semiempirical methods rely on simple models with many parameters, it is often difficult to estimate the quantitative and even qualitative accuracy of the results. On the other hand, because of significant advances in quantum chemical methods and computer capabilities, it is now possible to do high quality ab-initio calculations not only on systems of few atoms but on clusters of practical interest as well. In addition to accurate results for specific clusters, such methods can be used for benchmarking of different empirical and semiempirical approaches. The atomic clusters studied in this work contain from a few atoms

  14. Spatially induced Airy-Bessel light bullets%空间诱导产生艾里-贝塞尔光弹研究

    Institute of Scientific and Technical Information of China (English)

    任志君; 吴琼; 周卫东; 吴根柱; 施逸乐

    2012-01-01

    利用波动方程,研究了脉冲贝塞尔光束在自由空间传输时的空间诱导群速度色散(SIGVD)效应.结果表明,三阶SIGVD能使脉冲贝塞尔光束的时域逐渐演化为艾里分布.由于艾里一贝塞尔光弹是一种新奇的时、空都不扩展的局域波包,能在光与物质相互作用的很多应用领域发挥作用.因此,本文提出了通过色散管理技术补偿二阶SIGVD,利用三阶SIGVD在自由空间产生艾里.贝塞尔光弹的方案.为分析这种光弹的时空传输特性,数值模拟了它在色散介质中的传输情况.结果表明,这种光弹能在色散介质中保持空域不衍射、时域不色散的稳定传输.%Based on wave equation, we theoretically study the effect of spatially induced group velocity dispersion (SIGVD) of pulsed Bessel light beam propagation in free space. The results show that the third-order SIGVD can make pulsed Bessel beam gradually evolve into temporally Airy distribution. Airy-Bessel wave packet is such an exotic localized optical wave packet that it can possibly serve versatile tool in the research of light-matter interactions and has extensive applications. Hence we demonstrate the realization scheme of Airy-Bessel light bullets in free space by compensating the second-order SIGVD through utilizing dispersion management technique. To analyze the spatiotemporal propagation properties, we numerically simulate this light bullet propagation in a dispersion medium. The results show that it can retain spatial diffraction-free and temporal dispersion-free propagation in medium.

  15. 弹载高冲击一体化子母弹子弹飞行姿态测量系统%The Integrative High Impact Embed Bullet Flying Attitude Detection System of Some Shrapnel

    Institute of Scientific and Technical Information of China (English)

    文丰; 任勇峰; 王强

    2012-01-01

    为了测试获取子母弹爆炸抛撒后的子弹飞行姿态,采用基于MEMS惯性测量组合与动态存储测试技术相结合的方法来测试子母弹子弹的飞行姿态,对系统的组成、工作原理和主要关键技术的实现途径进行了详细的介绍.系统以MEMS三维角速度和三维加速度的惯性测量组合为姿态敏感元件,一体化的子母弹子弹飞行姿态测量记录器主要由FLASH存储器、FPGA为中心控制器及多通道高速12位模数转换器等组成.记录器具有多通道、低功耗、体积小、大容量、高精度及嵌入子弹内部随子弹飞行测量等优点.系统试验结果表明:该系统能够准确获取子弹从抛撒到中靶的整个过程的姿态数据.%For getting the bullet attitude of some shrapnel after it is dispersed, the method based on MEMS IMU and the dynamic storage test technology is integrated for testing the bullet attitude of shrapnel. The principle of operation, the system composition and major critical implements is provided. The attitude sense organ is three axis angular velocity transducer and three axis accelerometer, the integrative bullet attitude of some shrapnel recorder is composed by flash memory, FPGA ( the center controller) and multi-channel high speed 12 bit ADC, etc. The merits of the recorder are multi-channel, low power dissipation, small in size but high storage capacity, high-precision and can be embed the bullet flying with it for real attitude detecting. The system test result of the flight test proves that the integrated system can get the flight attitude data, which is the bullet from firing to hitting the target.

  16. Cluster knockout reactions

    Indian Academy of Sciences (India)

    Arun K Jain; B N Joshi

    2014-04-01

    Cluster knockout reactions are expected to reveal the amount of clustering (such as that of , d and even of heavier clusters such as 12C, 16O etc.) in the target nucleus. In simple terms, incident medium high-energy nuclear projectile interacts strongly with the cluster (present in the target nucleus) as if it were existing as a free entity. Theoretically, the relatively softer interactions of the two outgoing particles with the residual nucleus lead to optical distortions and are treated in terms of distorted wave (DW) formalism. The long-range projectile–cluster interaction is accounted for, in terms of the finite range (FR) direct reaction formalism, as against the more commonly adopted zero-range (ZR) distorted wave impulse approximation (DWIA) formalism. Comparison of the DWIA calculations with the observed data provide information about the momentum distribution and the clustering spectroscopic factor of the target nucleus. Interesting results and some recent advancements in the area of (, 2) reactions and heavy cluster knockout reactions are discussed. Importance of the finite-range vertex and the final-state interactions are brought out.

  17. Software-Defined Cluster

    Institute of Scientific and Technical Information of China (English)

    聂华; 杨晓君; 刘淘英

    2015-01-01

    The cluster architecture has played an important role in high-end computing for the past 20 years. With the advent of Internet services, big data, and cloud computing, traditional clusters face three challenges: 1) providing flexible system balance among computing, memory, and I/O capabilities;2) reducing resource pooling overheads;and 3) addressing low performance-power efficiency. This position paper proposes a software-defined cluster (SDC) architecture to deal with these challenges. The SDC architecture inherits two features of traditional cluster: its architecture is multicomputer and it has loosely-coupled interconnect. SDC provides two new mechanisms: global I/O space (GIO) and hardware-supported native access (HNA) to remote devices. Application software can define a virtual cluster best suited to its needs from resources pools provided by a physical cluster, and traditional cluster ecosystems need no modification. We also discuss a prototype design and implementation of a 32-processor cloud server utilizing the SDC architecture.

  18. Spanning Tree Based Attribute Clustering

    DEFF Research Database (Denmark)

    Zeng, Yifeng; Jorge, Cordero Hernandez

    2009-01-01

    inconsistent edges from a maximum spanning tree by starting appropriate initial modes, therefore generating stable clusters. It discovers sound clusters through simple graph operations and achieves significant computational savings. We compare the Star Discovery algorithm against earlier attribute clustering...

  19. Textile Industrial Clusters in China

    Institute of Scientific and Technical Information of China (English)

    2010-01-01

    "National Textile Industry Cluster Development Seminar" convened, held by China National Textile and Apparel Council, 23 cities and towns were awarded as China’s Textile Industry Cluster Pilot District. By far, China’s textile industrial clusters have grown

  20. Shock fronts, electron-ion equilibration and ICM transport processes in the merging cluster Abell 2146

    CERN Document Server

    Russell, H R; Sanders, J S; Fabian, A C; Nulsen, P E J; Canning, R E A; Baum, S A; Donahue, M; Edge, A C; King, L J; O'Dea, C P

    2012-01-01

    We present a new 400 ks Chandra X-ray observation of the merging galaxy cluster Abell 2146. This deep observation reveals detailed structure associated with the major merger event including the Mach M=2.3+/-0.2 bow shock ahead of the dense, ram pressure stripped subcluster core and the first known example of an upstream shock in the ICM (M=1.6+/-0.1). By measuring the electron temperature profile behind each shock front, we determine the timescale for the electron population to thermally equilibrate with the shock-heated ions. We find that the temperature profile behind the bow shock is consistent with the timescale for Coulomb collisional equilibration and the postshock temperature is lower than expected for instant shock-heating of the electrons. Although like the Bullet cluster the electron temperatures behind the upstream shock front are hotter than expected, favouring the instant heating model, the uncertainty on the temperature values is greater here and there is significant substructure complicating th...

  1. A Hydrodynamical Solution for the "Twin-Tailed" Colliding Galaxy Cluster "El Gordo"

    CERN Document Server

    Molnar, Sandor M

    2014-01-01

    The distinctive cometary X-ray morphology of the recently discovered massive galaxy cluster "El Gordo" (ACT-CT J0102-4915; z=0.87) indicates that an unusually high-speed collision is ongoing between two massive galaxy clusters. A bright X-ray "bullet" leads a "twin-tailed" wake, with the SZ centroid at the end of the Northern tail. We show how the physical properties of this system can be determined using our FLASH-based, N-body/hydrodynamic model, constrained by detailed X-ray, Sunyaev-Zel'dovich (SZ), and Hubble lensing and dynamical data. The X-ray morphology and the location of the two Dark Matter components and the SZ peak are accurately described by a simple binary collision viewed about 480 million years after the first core passage. We derive an impact parameter of ~300 kpc, and a relative initial infall velocity of ~2250 km/sec when separated by the sum of the two virial radii assuming an initial total mass of 2.15x10^(15) Msun and a mass ratio of 1.9. Our model demonstrates that tidally stretched ga...

  2. Allodynia in Cluster Headache.

    Science.gov (United States)

    Wilbrink, Leopoldine A; Louter, Mark A; Teernstra, Onno Pm; van Zwet, Erik W; Huygen, Frank Jpm; Haan, Joost; Ferrari, Michel D; Terwindt, Gisela M

    2017-03-04

    Cutaneous allodynia is an established marker for central sensitization in migraine. There is debate whether cutaneous allodynia may also occur in cluster headache, another episodic headache disorder. Here we examined the presence and severity of allodynia in a large well-defined nation-wide population of people with cluster headache.Using validated questionnaires we assessed, cross-sectionally, ictal allodynia and comorbid depression and migraine in the nation-wide "Leiden University Cluster headache neuro-Analysis" (LUCA) study. Participants with cluster headache were diagnosed according to the International Classification of Headache Disorders criteria. Multivariate regression models were used, with correction for demographic factors and cluster headache subtype (chronic vs. episodic; recent attacks cluster headache responded of whom 218/606 (36%) had allodynia during attacks. Female gender (OR 2.05, 95% CI 1.28-3.29), low age at onset (OR 0.98, 95% CI 0.96- 0.99), lifetime depression (OR 1.63; 95% CI 1.06-2.50), comorbid migraine (OR 1.96; 95% CI 1.02-3.79), and having recent attacks (OR 1.80; 95% CI 1.13-2.86), but not duration of attacks and chronic cluster headache, were independent risk factors for allodynia.The high prevalence of cutaneous allodynia with similar risk factors for allodynia as found for migraine suggests that central sensitization, like in migraine, also occurs in cluster headache. In clinical practice, awareness that people with cluster headache may suffer from allodynia can in the future be an important feature in treatment options.

  3. Introduction to cluster dynamics

    CERN Document Server

    Reinhard, Paul-Gerhard

    2008-01-01

    Clusters as mesoscopic particles represent an intermediate state of matter between single atoms and solid material. The tendency to miniaturise technical objects requires knowledge about systems which contain a ""small"" number of atoms or molecules only. This is all the more true for dynamical aspects, particularly in relation to the qick development of laser technology and femtosecond spectroscopy. Here, for the first time is a highly qualitative introduction to cluster physics. With its emphasis on cluster dynamics, this will be vital to everyone involved in this interdisciplinary subje

  4. ClusterAlive

    Science.gov (United States)

    Caruso, G.; Arezzini, S.; Ciampa, A.; Formuso, A.; Mazzoni, E.

    2015-12-01

    INFN-Pisa Scientific Computing Center is working from many years both in GRID and HPC computing. The monitoring and managing tools have been key components of the center's successful operation. The lessons learned from the use of standard tools, such as Ganglia, have been starting points for the development of new tools specific for our infrastructure. In this note we will illustrate the integration of many different monitoring tools in one single platform called ClusterAlive. Aim of ClusterAlive is to increase the HPC cluster performance and simplify maintenance operations, possibly in a proactive approach.

  5. Raspberry Pi super cluster

    CERN Document Server

    Dennis, Andrew K

    2013-01-01

    This book follows a step-by-step, tutorial-based approach which will teach you how to develop your own super cluster using Raspberry Pi computers quickly and efficiently.Raspberry Pi Super Cluster is an introductory guide for those interested in experimenting with parallel computing at home. Aimed at Raspberry Pi enthusiasts, this book is a primer for getting your first cluster up and running.Basic knowledge of C or Java would be helpful but no prior knowledge of parallel computing is necessary.

  6. Cluster modular autocontenido

    OpenAIRE

    2009-01-01

    Desde hace años es común en organizaciones educativas y de investigación el desarrollo de actividades que requieren grandes capacidades de cálculo. La solución más común a estas necesidades es la compra o construcción de un cluster HPC (High Performance Computing), pero construir un cluster acarrea problemas y costos inesperados problemas al momento de utilizarlo y mantenerlo en operaciones. Nuestro proyecto busca desarrollar y documentar técnicas para construir un cluster HPC que sea fácilme...

  7. Extending Beowulf Clusters

    Science.gov (United States)

    Steinwand, Daniel R.; Maddox, Brian; Beckmann, Tim; Hamer, George

    2003-01-01

    Beowulf clusters can provide a cost-effective way to compute numerical models and process large amounts of remote sensing image data. Usually a Beowulf cluster is designed to accomplish a specific set of processing goals, and processing is very efficient when the problem remains inside the constraints of the original design. There are cases, however, when one might wish to compute a problem that is beyond the capacity of the local Beowulf system. In these cases, spreading the problem to multiple clusters or to other machines on the network may provide a cost-effective solution.

  8. Experimental investigation on the dissipative and elastic characteristics of a yaw colloidal damper destined to carbody suspension of a bullet train

    Science.gov (United States)

    Suciu, B.; Tomioka, T.

    2016-09-01

    Yaw damper represents a major source of excitation for flexural vibration of the railway carbody. In order to reduce transmissibility of such undesired excitation, yaw damper should allow for large force transmission at low working frequencies, but should behave as vibration isolator at high working frequencies. Unfortunately, the yaw oil damper (OD), which is nowadays in service, has poor intrinsic elastic capabilities and provides damping forces varying as a power function versus the piston speed. Since colloidal damper (CD) has intrinsic elastic capabilities and larger damping forces at lower excitation frequencies, it occurs as an attractive alternative solution to traditional yaw dampers. In this work, a yaw CD destined to carbody suspension of a bullet train was designed and manufactured; then, its dynamic characteristics, produced by both the frictional and colloidal effects, were evaluated from the experimental results, obtained during horizontal vibration tests, performed on a ball-screw shaker. Compared to the corresponding classical yaw OD, the trial yaw CD allowed for: weight reduction of 31.6%; large damping force, dissipated energy and spring constant at long piston stroke under low excitation frequency; low damping force, dissipated energy and spring constant at short piston stroke under high excitation frequency. Elastic properties were justified by introducing a model for the spring constant that included the effect of pore size distribution.

  9. Discovery of "Warm Dust" Galaxies in Clusters at z~0.3: Evidence for Stripping of Cool Dust in the Dense Environment?

    CERN Document Server

    Rawle, T D; Egami, E; Chung, S M; Pérez-González, P G; Smail, I; Walth, G; Altieri, B; Appleton, P; Alba, A Berciano; Blain, A W; Dessauges-Zavadsky, M; Fadda, D; Gonzalez, A H; Pereira, M J; Valtchanov, I; van der Werf, P P; Zemcov, M

    2012-01-01

    Using far-infrared imaging from the "Herschel Lensing Survey", we derive dust properties of spectroscopically-confirmed cluster member galaxies within two massive systems at z~0.3: the merging Bullet Cluster and the more relaxed MS2137.3-2353. Most star-forming cluster sources (~90%) have characteristic dust temperatures similar to local field galaxies of comparable infrared (IR) luminosity (T_dust ~ 30K). Several sub-LIRG (L_IR 37K) with far-infrared spectral energy distribution (SED) shapes resembling LIRG-type local templates. X-ray and mid-infrared data suggest that obscured active galactic nuclei do not contribute significantly to the infrared flux of these "warm dust" galaxies. Sources of comparable IR-luminosity and dust temperature are not observed in the relaxed cluster MS2137, although the significance is too low to speculate on an origin involving recent cluster merging. "Warm dust" galaxies are, however, statistically rarer in field samples (> 3sigma), indicating that the responsible mechanism ma...

  10. PRELIMINARY STUDY OF A NOVEL HUMAN PAPILLOMAVIRUS TYPE 16 L1/E6-E7 CHIMERIC RECOMBINANT DNA VACCINE

    Institute of Scientific and Technical Information of China (English)

    郑瑾; 马军; 张福萍; 杨筱凤; 董小平; 司履生; 王一理

    2004-01-01

    Objective Preparations of HPV16 L1/E6 and L1/E7 prophylactic and therapeutic DNA vaccines. Methods The nucleotides within HPV16 E6 and E7 genes, which are responsible for viral transforming activity, were mutated by mage primer site-directed mutagenesis method. The correctly mutated E6 and E7 fragments were separately cloned into an eukaryotic expression vector pVAX1, together with HPV16 L1 gene, generating chimeric recombinants plasmids 1MpVAX1-L1E6, 2MpVAX1-L1E6, 1MpVAX1-L1E7, 2MpVAX1-L1E7 and 3MpVAX1-L1E7. CHO cells were transiently transfected with the individual DNA vaccines by calcium phosphate method. Target protein expressions in the extracts of the transfected cell lines were measured by ELISA and immunohistochemistry, with HPV16 L1 and E6 specific monoclonal antibodies. Results ELISA assays showed the P/N ratios in the cell extracts transfected with L1E6 and L1E7 plasmids were more than 2.1. Immunohistochemistry revealed brownish precipitant signal in cytoplasm and nuclei of the transfected cells. Conclusion Successful constructions of prophylactic and therapeutic DNA vaccine plasmids lay solid foundation for future animal experiment and clinical trial.

  11. Combining cluster number counts and galaxy clustering

    Science.gov (United States)

    Lacasa, Fabien; Rosenfeld, Rogerio

    2016-08-01

    The abundance of clusters and the clustering of galaxies are two of the important cosmological probes for current and future large scale surveys of galaxies, such as the Dark Energy Survey. In order to combine them one has to account for the fact that they are not independent quantities, since they probe the same density field. It is important to develop a good understanding of their correlation in order to extract parameter constraints. We present a detailed modelling of the joint covariance matrix between cluster number counts and the galaxy angular power spectrum. We employ the framework of the halo model complemented by a Halo Occupation Distribution model (HOD). We demonstrate the importance of accounting for non-Gaussianity to produce accurate covariance predictions. Indeed, we show that the non-Gaussian covariance becomes dominant at small scales, low redshifts or high cluster masses. We discuss in particular the case of the super-sample covariance (SSC), including the effects of galaxy shot-noise, halo second order bias and non-local bias. We demonstrate that the SSC obeys mathematical inequalities and positivity. Using the joint covariance matrix and a Fisher matrix methodology, we examine the prospects of combining these two probes to constrain cosmological and HOD parameters. We find that the combination indeed results in noticeably better constraints, with improvements of order 20% on cosmological parameters compared to the best single probe, and even greater improvement on HOD parameters, with reduction of error bars by a factor 1.4-4.8. This happens in particular because the cross-covariance introduces a synergy between the probes on small scales. We conclude that accounting for non-Gaussian effects is required for the joint analysis of these observables in galaxy surveys.

  12. Deep NuSTAR and Swift monitoring observations of the magnetar 1E 1841-045

    DEFF Research Database (Denmark)

    An, Hongjun; Archibald, Robert F.; Hascoët, Romain;

    2015-01-01

    We report on a 350 ks NuSTAR observation of the magnetar 1E 1841-045 taken in 2013 September. During the observation, NuSTAR detected six bursts of short duration, with T90 ≲ 1 s. An elevated level of emission tail is detected after the brightest burst, persisting for ~1 ks. The emission showed a...... consistent with the footprint of the twisted magnetic field lines on the star. We also report on the 3 yr Swift monitoring observations obtained since 2011 July. The soft-X-ray spectrum remained stable during this period, and the timing behavior was noisy, with large timing residuals....

  13. The new SGR 1550-5418 is the old AXP 1E1547.0-5408

    Science.gov (United States)

    Rea, N.; Esposito, P.; Krimm, H. A.; Palmer, D. M.; Mereghetti, S.; Tiengo, A.; Israel, G. L.

    2008-10-01

    N. Rea (U. Amsterdam), P. Esposito (INAF-IASF, Milan), H. A. Krimm (CRESST/GSFC/USRA), D. M. Palmer (LANL), S. Mereghetti, A. Tiengo (INAF-IASF, Milan), G.L. Israel (INAF-OAR) Swift-BAT triggered today on several Galactic short bursts (Krimm et al. GCN 8311, 8312), which were claimed to come from a new Soft Gamma Repeater SGR 1550-5418. However, given the positional coincidence of this new putative SGR 1550-5418 with the Anomalous X-ray Pulsar (AXP) 1E1547.0-5408 (Gelfand & Gaensler 2007; Camilo et al.

  14. Analysis of trapped gas in 1E34 detonators by gas chromatography

    Energy Technology Data Exchange (ETDEWEB)

    Warner, D.K.; Back, P.S.; Barnhart, B.V.

    1980-05-14

    A method was developed to extract and then analyze gas trapped in thermally aged 1E34 detonators. This gas was extracted into an evacuated volume and injected into a gas chromatograph for separation and quantitative analysis. To effect this gas extraction, a device was designed for puncturing the detonator cup and capturing the effused gas. Limited testing of five detonators in this device shows amounts of gas ranging from about 0.5 X 10 {sup -7} to 12 X 10 {sup - 7} moles.

  15. AKAP 18 alpha and gamma have opposing effects on insulin release in INS-1E cells

    DEFF Research Database (Denmark)

    Josefsen, Knud; Lee, Ying C; Thams, Peter;

    2010-01-01

    A-kinase anchoring proteins (AKAPs) are known to compartmentalise protein kinase(s) to discrete cellular locations. Here we show that silencing of AKAP 18 alpha or gamma expression results in decreased or increased glucose-stimulated insulin secretion in INS-1E cells. Glucose stimulates AKAP 18...... alpha and inhibits AKAP 18 gamma mRNA expressions while palmitate markedly reduces AKAP 18 alpha expression. Human growth hormone (GH) stimulates AKAP 18 alpha expression and attenuates palmitate-induced suppression of AKAP 18 alpha mRNA level. The roles of AKAP 18 alpha and gamma in mediating insulin...

  16. Evolution of clustered storage

    CERN Document Server

    CERN. Geneva; Van de Vyvre, Pierre

    2007-01-01

    The session actually featured two presentations: * Evolution of clustered storage by Lance Hukill, Quantum Corporation * ALICE DAQ - Usage of a Cluster-File System: Quantum StorNext by Pierre Vande Vyvre, CERN-PH the second one prepared at short notice by Pierre (thanks!) to present how the Quantum technologies are being used in the ALICE experiment. The abstract to Mr Hukill's follows. Clustered Storage is a technology that is driven by business and mission applications. The evolution of Clustered Storage solutions starts first at the alignment between End-users needs and Industry trends: * Push-and-Pull between managing for today versus planning for tomorrow * Breaking down the real business problems to the core applications * Commoditization of clients, servers, and target devices * Interchangeability, Interoperability, Remote Access, Centralized control * Oh, and yes, there is a budget and the "real world" to deal with This presentation will talk through these needs and trends, and then ask the question, ...

  17. Globular clusters with Gaia

    Science.gov (United States)

    Pancino, E.; Bellazzini, M.; Giuffrida, G.; Marinoni, S.

    2017-01-01

    The treatment of crowded fields in Gaia data will only be a reality in a few years from now. In particular, for globular clusters, only the end-of-mission data (public in 2022-2023) will have the necessary full crowding treatment and will reach sufficient quality for the faintest stars. As a consequence, the work on the deblending and decontamination pipelines is still ongoing. We describe the present status of the pipelines for different Gaia instruments, and we model the end-of-mission crowding errors on the basis of available information. We then apply the nominal post-launch Gaia performances, appropriately worsened by the estimated crowding errors, to a set of 18 simulated globular clusters with different concentration, distance, and field contamination. We conclude that there will be 103-104 stars with astrometric performances virtually untouched by crowding (contaminated by <1 mmag) in the majoritiy of clusters. The most limiting factor will be field crowding, not cluster crowding: the most contaminated clusters will only contain 10-100 clean stars. We also conclude that: (i) the systemic proper motions and parallaxes will be determined to 1% or better up to ≃15 kpc, and the nearby clusters will have radial velocities to a few km s-1 ; (ii) internal kinematics will be of unprecendented quality, cluster masses will be determined to ≃10% up to 15 kpc and beyond, and it will be possible to identify differences of a few km s-1 or less in the kinematics (if any) of cluster sub-populations up to 10 kpc and beyond; (iii) the brightest stars (V≃17 mag) will have space-quality, wide-field photometry (mmag errors), and all Gaia photometry will have 1-3% errors on the absolute photometric calibration.

  18. Magnetic cluster excitations

    Science.gov (United States)

    Furrer, Albert; Waldmann, Oliver

    2013-01-01

    Magnetic clusters, i.e., assemblies of a finite number (between two or three and several hundred) of interacting spin centers which are magnetically decoupled from their environment, can be found in many materials ranging from inorganic compounds and magnetic molecules to artificial metal structures formed on surfaces and metalloproteins. Their magnetic excitation spectra are determined by the nature of the spin centers and of the magnetic interactions, and the particular arrangement of the mutual interaction paths between the spin centers. Small clusters of up to four magnetic ions are ideal model systems in which to examine the fundamental magnetic interactions, which are usually dominated by Heisenberg exchange, but often complemented by anisotropic and/or higher-order interactions. In large magnetic clusters, which may potentially deal with a dozen or more spin centers, there is the possibility of novel many-body quantum states and quantum phenomena. In this review the necessary theoretical concepts and experimental techniques to study the magnetic cluster excitations and the resulting characteristic magnetic properties are introduced, followed by examples of small clusters, demonstrating the enormous amount of detailed physical information that can be retrieved. The current understanding of the excitations and their physical interpretation in the molecular nanomagnets which represent large magnetic clusters is then presented, with a section devoted to the subclass of single-molecule magnets, distinguished by displaying quantum tunneling of the magnetization. Finally, there is a summary of some quantum many-body states which evolve in magnetic insulators characterized by built-in or field-induced magnetic clusters. The review concludes by addressing future perspectives in the field of magnetic cluster excitations.

  19. Cauchy cluster process

    DEFF Research Database (Denmark)

    Ghorbani, Mohammad

    2013-01-01

    In this paper we introduce an instance of the well-know Neyman–Scott cluster process model with clusters having a long tail behaviour. In our model the offspring points are distributed around the parent points according to a circular Cauchy distribution. Using a modified Cramér-von Misses test st...... statistic and the simulated pointwise envelopes it is shown that this model fits better than the Thomas process to the frequently analyzed long-leaf pine data-set....

  20. Parallel Wolff Cluster Algorithms

    Science.gov (United States)

    Bae, S.; Ko, S. H.; Coddington, P. D.

    The Wolff single-cluster algorithm is the most efficient method known for Monte Carlo simulation of many spin models. Due to the irregular size, shape and position of the Wolff clusters, this method does not easily lend itself to efficient parallel implementation, so that simulations using this method have thus far been confined to workstations and vector machines. Here we present two parallel implementations of this algorithm, and show that one gives fairly good performance on a MIMD parallel computer.

  1. SNR 1E0102.2-7219 after Six Years with Chandra

    Science.gov (United States)

    Rutkowski, M. J.; Schlegel, E. M.; Keohane, J.

    2005-12-01

    We present Chandra X-ray Observatory archived observations of the supernova remnant 1E0102.2-7219 in the Small Magellanic Cloud. Combining 22 ACIS-I observations for 230 ks of total exposure time, we present ACIS images with an unprecedented signal to noise ratio for this remnant. We present three upper limits on the X-ray flux for the remnant's elusive central compact object, which are consistent with current neutron star cooling models, based on a Cas A-like blackbody spectrum. Additionally, we discuss the elliptical structure of the remnant and the relative positions of the blast wave, the reverse shock, and the extent of 1E0102.2-7219's rim. This research was supported by the NSF REU Program at SAO under Eric Schlegel, whose research was supported by contract number NAS8-39073 from NASA to SAO for operation of the Chandra X-Ray Observatory. Jonathan Keohane's research was supported by Chandra award GO3-4070C.

  2. Mutant AKT1-E17K is oncogenic in lung epithelial cells

    Science.gov (United States)

    De Marco, Carmela; Malanga, Donatella; Rinaldo, Nicola; De Vita, Fernanda; Scrima, Marianna; Lovisa, Sara; Fabris, Linda; Carriero, Maria Vincenza; Franco, Renato; Rizzuto, Antonia; Baldassarre, Gustavo; Viglietto, Giuseppe

    2015-01-01

    The hotspot E17K mutation in the pleckstrin homology domain of AKT1 occurs in approximately 0.6–2% of human lung cancers. In this manuscript, we sought to determine whether this AKT1 variant is a bona-fide activating mutation and plays a role in the development of lung cancer. Here we report that in immortalized human bronchial epithelial cells (BEAS-2B cells) mutant AKT1-E17K promotes anchorage-dependent and -independent proliferation, increases the ability to migrate, invade as well as to survive and duplicate in stressful conditions, leading to the emergency of cells endowed with the capability to form aggressive tumours at high efficiency. We provide also evidence that the molecular mechanism whereby AKT1-E17K is oncogenic in lung epithelial cells involves phosphorylation and consequent cytoplasmic delocalization of the cyclin-dependent kinase (cdk) inhibitor p27. In agreement with these results, cytoplasmic p27 is preferentially observed in primary NSCLCs with activated AKT and predicts poor survival. PMID:26053093

  3. A Deep XMM-Newton Observation of the Enigmatic Microquasar 1E 1740.7-2942

    Science.gov (United States)

    Miller, Jon

    1E 1740.7-2942 is a microquasar residing in the Galactic center. It is persistently bright at X-ray energies and has been shown to power large scale bi-polar jets, thus making it an ideal source to probe the jet generation/launching mechanism in accreting black holes. Analysis of archival data hinted at the presence of a relativistically broadened iron line, providing a means to constrain the spin of the black hole in this system for the first time. In AO-10 we were awarded a 130 ks XMM-Newton category B target of oppurtunity (ToO) observation, with the aim of observing this system in the low-hard state. This observation was triggered in April 2012 and the data have been obtained, where a preliminary analysis reveals the expected broad iron line. Modeling this iron line will allow us to constrain the spin of the black hole and probe its relation to the presence of large scale jets in this system. We request a total of $63.7k funding to support the analysis of this deep XMM-Newton observation, including the primary target (1E 1740.7-2942) and the serendipitous sources in the field of view (destiny of the universe, and the nature of black holes, dark energy, dark matter, and gravity. and 2.4.2: Improve understanding of the many phenomena and processes associated with galaxy, stellar, and planetary system formation and evolution from the earliest epochs to today.

  4. The anti-glitch of magnetar 1E 2259+586 in the wind braking scenario

    Energy Technology Data Exchange (ETDEWEB)

    Tong, H., E-mail: tonghao@xao.ac.cn [Xinjiang Astronomical Observatory, Chinese Academy of Sciences, Urumqi, Xinjiang (China)

    2014-04-01

    The anti-glitch of magnetar 1E 2259+586 is analyzed theoretically. An enhanced particle wind during the observational interval takes away additional rotational energy of the neutron star, which will result in a net spin-down of the magnetar, i.e., an anti-glitch. In the wind braking scenario of the anti-glitch, there are several predictions: (1) a radiative event will always accompany the anti-glitch, (2) there will be a decrease/variation of the braking index after the anti-glitch, and (3) the anti-glitch is just a period of enhanced spin-down. If there are enough timing observations, a period of enhanced spin-down is expected instead of an anti-glitch. Applications to previous timing events of SGR 1900+14 and PSR J1846–0258 are also included. It is shown that current timing events of 1E 2259+586, SGR 1900+14, and PSR J1846–0258 can be understood safely in the wind braking model. The enhanced spin-down and absence of an anti-glitch before the giant flare of SGR 1806–20 is consistent with the wind braking scenario.

  5. Mutagenic Potential ofBos taurus Papillomavirus Type 1 E6 Recombinant Protein: First Description

    Directory of Open Access Journals (Sweden)

    Rodrigo Pinheiro Araldi

    2015-01-01

    Full Text Available Bovine papillomavirus (BPV is considered a useful model to study HPV oncogenic process. BPV interacts with the host chromatin, resulting in DNA damage, which is attributed to E5, E6, and E7 viral oncoproteins activity. However, the oncogenic mechanisms of BPV E6 oncoprotein per se remain unknown. This study aimed to evaluate the mutagenic potential of Bos taurus papillomavirus type 1 (BPV-1 E6 recombinant oncoprotein by the cytokinesis-block micronucleus assay (CBMNA and comet assay (CA. Peripheral blood samples of five calves were collected. Samples were subjected to molecular diagnosis, which did not reveal presence of BPV sequences. Samples were treated with 1 μg/mL of BPV-1 E6 oncoprotein and 50 μg/mL of cyclophosphamide (positive control. Negative controls were not submitted to any treatment. The samples were submitted to the CBMNA and CA. The results showed that BPV E6 oncoprotein induces clastogenesis per se, which is indicative of genomic instability. These results allowed better understanding the mechanism of cancer promotion associated with the BPV E6 oncoprotein and revealed that this oncoprotein can induce carcinogenesis per se. E6 recombinant oncoprotein has been suggested as a possible vaccine candidate. Results pointed out that BPV E6 recombinant oncoprotein modifications are required to use it as vaccine.

  6. Evidence for the magnetar nature of 1E 161348-5055 in RCW 103

    CERN Document Server

    D'Aì, A; Burrows, D N; Lien, A Y; Kann, D A; Campana, S; Maselli, A; Romano, P; Cusumano, G; La Parola, V; Beardmore, A P; Cenko, B; De Pasquale, M; Gehrels, N; Greiner, J; Kennea, J A; Klose, S; Melandri, A; Nousek, J A; Osborne, J P; Sbarufatti, B; Siegel, M H; Schady, P; Tagliaferri, G; Yates, R; Zane, S

    2016-01-01

    We report on the detection of a bright, short, hard X-ray burst coming from the supernova remnant RCW 103 on 2016 June 22 caught by the \\emph{Swift}/BAT monitor, and on a follow-up campaign made with \\emph{Swift}/XRT and the optical/NIR GROND detector. The characteristics of the flash, such as duration and spectral shape, are consistent with typical bursts observed from soft gamma repeaters. The BAT error circle at 68\\% confidence range encloses the point-like X-ray source at the centre of the nebula, 1E 161348-5055. Its nature has been long debated because of a periodicity of 6.67 hr in X-rays, that could indicate either an extremely slow pulsating neutron star, or an orbital period of a very compact X-ray binary system. We found that the soft X-ray emission of 1E 161348-5055, 20 minutes earlier than the BAT detected burst, was already a factor $\\sim$ 100 higher with respect to the past two years, indicating that an outburst had started. By comparing the spectral and timing characteristics of the source in t...

  7. Proposal to Search for Magnetically Charged Particles with Magnetic Charge 1e

    Energy Technology Data Exchange (ETDEWEB)

    Sullivan, Michael K. [SLAC National Accelerator Lab., Menlo Park, CA (United States); Fryberger, David [SLAC National Accelerator Lab., Menlo Park, CA (United States)

    2015-11-02

    A model for composite elementary Standard Model (SM) particles based upon magnetically bound vorton pairs, we briefly introduce here, predicts the existence of a complete family of magnetically charged particles, as well as their neutral isotopic partners (all counterparts to the SM elementary particles), in which the lowest mass (charged) particle would be an electrically neutral stable lepton, but which carries a magnetic charge equivalent to 1e. This new particle, which we call a magneticon (a counterpart to the electron) would be pair produced at all e+e- colliders at an Ecm above twice its mass. In addition, PP and PPbar colliders should also be able to produce these new particles through the Drell-Yan process. To our knowledge, no monopole search experiment has been sensitive to such a low-charged magnetic monopole above a particle mass of about 5 GeV/c2. Hence, we propose that a search for such a stable particle of magnetic charge 1e should be undertaken. We have taken the ATLAS detector at the LHC as an example in which this search might be done. To this end, we modeled the magnetic fields and muon trigger chambers of this detector. We show results from a simple Monte Carlo simulation program to indicate how these particles might look in the detector and describe how one might search for these new particles in the ATLAS data stream.

  8. On the Assembly of Dwarf Galaxies in Clusters and their Efficient Formation of Globular Clusters

    CERN Document Server

    Mistani, Pouria A; Pillepich, Annalisa; Sanchez-Janssen, Ruben; Vogelsberger, Mark; Nelson, Dylan; Rodriguez-Gomez, Vicente; Torrey, Paul; Hernquist, Lars

    2015-01-01

    Galaxy clusters contain a large population of low mass dwarf elliptical galaxies whose exact origin is unclear: their colors, structural properties and kinematics differ substantially from those of dwarf irregulars in the field. We use the Illustris cosmological simulation to study differences in the assembly paths of dwarf galaxies (3e8 < M_*/M_sun < 1e10) according to their environment. We find that cluster dwarfs achieve their maximum total and stellar mass on average ~ 8 and ~ 4.5 Gyr ago, respectively, around the time of infall into the clusters. In contrast, field dwarfs not subjected to environmental stripping, reach their maximum mass at redshift z = 0. This different assembly history naturally produces a color bimodality, with blue isolated dwarfs and redder cluster dwarfs exhibiting negligible star-formation today. The cessation of star formation happens over median times 3.5-5 Gyr depending on stellar mass, and shows a large scatter (~ 1-8 Gyr), with the lower values associated with starburst...

  9. Galaxy cluster's rotation

    CERN Document Server

    Manolopoulou, Maria

    2016-01-01

    We study the possible rotation of cluster galaxies, developing, testing and applying a novel algorithm which identifies rotation, if such does exits, as well as its rotational centre, its axis orientation, rotational velocity amplitude and, finally, the clockwise or counterclockwise direction of rotation on the plane of the sky. To validate our algorithms we construct realistic Monte-Carlo mock rotating clusters and confirm that our method provides robust indications of rotation. We then apply our methodology on a sample of Abell clusters with z<~0.1 with member galaxies selected from the SDSS DR10 spectroscopic database. We find that ~35% of our clusters are rotating when using a set of strict criteria, while loosening the criteria we find this fraction increasing to ~48%. We correlate our rotation indicators with the cluster dynamical state, provided either by their Bautz-Morgan type or by their X-ray isophotal shape and find for those clusters showing rotation that the significance and strength of their...

  10. Cluster functional renormalization group

    Science.gov (United States)

    Reuther, Johannes; Thomale, Ronny

    2014-01-01

    Functional renormalization group (FRG) has become a diverse and powerful tool to derive effective low-energy scattering vertices of interacting many-body systems. Starting from a free expansion point of the action, the flow of the RG parameter Λ allows us to trace the evolution of the effective one- and two-particle vertices towards low energies by taking into account the vertex corrections between all parquet channels in an unbiased fashion. In this work, we generalize the expansion point at which the diagrammatic resummation procedure is initiated from a free UV limit to a cluster product state. We formulate a cluster FRG scheme where the noninteracting building blocks (i.e., decoupled spin clusters) are treated exactly, and the intercluster couplings are addressed via RG. As a benchmark study, we apply our cluster FRG scheme to the spin-1/2 bilayer Heisenberg model (BHM) on a square lattice where the neighboring sites in the two layers form the individual two-site clusters. Comparing with existing numerical evidence for the BHM, we obtain reasonable findings for the spin susceptibility, the spin-triplet excitation energy, and quasiparticle weight even in coupling regimes close to antiferromagnetic order. The concept of cluster FRG promises applications to a large class of interacting electron systems.

  11. Cluster bomb ocular injuries

    Directory of Open Access Journals (Sweden)

    Ahmad M Mansour

    2012-01-01

    Full Text Available Purpose: To present the visual outcomes and ocular sequelae of victims of cluster bombs. Materials and Methods: This retrospective, multicenter case series of ocular injury due to cluster bombs was conducted for 3 years after the war in South Lebanon (July 2006. Data were gathered from the reports to the Information Management System for Mine Action. Results: There were 308 victims of clusters bombs; 36 individuals were killed, of which 2 received ocular lacerations and; 272 individuals were injured with 18 receiving ocular injury. These 18 surviving individuals were assessed by the authors. Ocular injury occurred in 6.5% (20/308 of cluster bomb victims. Trauma to multiple organs occurred in 12 of 18 cases (67% with ocular injury. Ocular findings included corneal or scleral lacerations (16 eyes, corneal foreign bodies (9 eyes, corneal decompensation (2 eyes, ruptured cataract (6 eyes, and intravitreal foreign bodies (10 eyes. The corneas of one patient had extreme attenuation of the endothelium. Conclusions: Ocular injury occurred in 6.5% of cluster bomb victims and 67% of the patients with ocular injury sustained trauma to multiple organs. Visual morbidity in civilians is an additional reason for a global ban on the use of cluster bombs.

  12. Determination of atomic cluster structure with cluster fusion algorithm

    DEFF Research Database (Denmark)

    Obolensky, Oleg I.; Solov'yov, Ilia; Solov'yov, Andrey V.

    2005-01-01

    We report an efficient scheme of global optimization, called cluster fusion algorithm, which has proved its reliability and high efficiency in determination of the structure of various atomic clusters.......We report an efficient scheme of global optimization, called cluster fusion algorithm, which has proved its reliability and high efficiency in determination of the structure of various atomic clusters....

  13. Equilibrium configurations of 11 eV sterile neutrinos in MONDian galaxy clusters

    Science.gov (United States)

    Angus, G. W.; Famaey, B.; Diaferio, A.

    2010-02-01

    Modified Newtonian dynamics (MOND) can fit a broad range of galaxy kinematic data, but struggles with clusters of galaxies. MONDian clusters need dark matter (DM), and here we test the 11 eVc-2 sterile neutrino (SN) - used to fit the first three acoustic peaks of the cosmic microwave background (CMB) - by investigating their equilibrium distributions in 30 groups and clusters over a wide range of temperatures. We do this by first taking the known SN density, necessary for hydrostatic equilibrium of the intracluster medium (or to produce the observed lensing map). Then, we solve for the SN velocity dispersion (VD), needed for their own hydrostatic equilibrium, through the equation of state for a partially degenerate neutrino gas. The VD is a unique, continuous function of radius determined by the density and mass of the SN particles. Knowing both the SN density and VD tells us the Tremaine-Gunn phase-space limit at all radii. We find that all 30 systems serendipitously reach the Tremaine-Gunn limit by the centre, which means a portion of the dynamical mass must always be covered by the brightest cluster galaxy. Interestingly, the typical fitted K-band mass-to-light ratio is unity and at most 1.2, which is very consistent - although leaving no margin for error - with stellar population synthesis models. Amidst the sample there are several special cases including the Coma cluster (for which DM was first proposed), NGC 720 (where geometrical evidence for DM was found) and the bullet cluster (where DM - of some kind - in clusters was directly proven to exist). We demonstrate that 11 eVc-2 SNs are unlikely to influence spiral galaxy rotation curves, as they do not influence even some very massive early-types (NGC 4125 and NGC 6482). Finally, we conclude that it is intriguing that the minimum mass of SN particle that can match the CMB is the same as the minimum mass found here to be consistent with equilibrium configurations of MONDian clusters of galaxies.

  14. Cluster fusion algorithm: application to Lennard-Jones clusters

    DEFF Research Database (Denmark)

    Solov'yov, Ilia; Solov'yov, Andrey V.; Greiner, Walter

    2008-01-01

    We present a new general theoretical framework for modelling the cluster structure and apply it to description of the Lennard-Jones clusters. Starting from the initial tetrahedral cluster configuration, adding new atoms to the system and absorbing its energy at each step, we find cluster growing...... paths up to the cluster size of 150 atoms. We demonstrate that in this way all known global minima structures of the Lennard-Jones clusters can be found. Our method provides an efficient tool for the calculation and analysis of atomic cluster structure. With its use we justify the magic number sequence...... for the clusters of noble gas atoms and compare it with experimental observations. We report the striking correspondence of the peaks in the dependence of the second derivative of the binding energy per atom on cluster size calculated for the chain of the Lennard-Jones clusters based on the icosahedral symmetry...

  15. Cluster fusion algorithm: application to Lennard-Jones clusters

    DEFF Research Database (Denmark)

    Solov'yov, Ilia; Solov'yov, Andrey V.; Greiner, Walter

    2006-01-01

    We present a new general theoretical framework for modelling the cluster structure and apply it to description of the Lennard-Jones clusters. Starting from the initial tetrahedral cluster configuration, adding new atoms to the system and absorbing its energy at each step, we find cluster growing...... paths up to the cluster size of 150 atoms. We demonstrate that in this way all known global minima structures of the Lennard-Jones clusters can be found. Our method provides an efficient tool for the calculation and analysis of atomic cluster structure. With its use we justify the magic number sequence...... for the clusters of noble gas atoms and compare it with experimental observations. We report the striking correspondence of the peaks in the dependence of the second derivative of the binding energy per atom on cluster size calculated for the chain of the Lennard-Jones clusters based on the icosahedral symmetry...

  16. Towards Nano-Materials with Precise Control over Properties via Cluster-Assemblies

    Science.gov (United States)

    Qian, Meichun; Reber, Arthur; Khanna, Shiv; Ugrinov, Angel; Chaki, Nirmalya; Mandal, Sukhendu; Saavedra, Héctor; Sen, Ayusman; Weiss, Paul

    2010-03-01

    One pathway towards nanomaterials with controllable band gaps is to assemble solids where atomic clusters serve as building blocks, because clusters' electronic structures vary with size, composition, and the charged state. To study the role of architecture in cluster assemblies, we synthesized multiple architectures of As7^3- clusters through controlling the counter-cations. Optical measurements revealed that the band gaps vary from 1.1-2.1 eV, even though the assemblies are constructed from identical cluster building blocks. First principles theoretical studies reveal that the variation is a result of altering the LUMO levels by changing the counter-cations. Additional variation in the gap is found by covalently linking the clusters with species of varying electronegativity to alter the degree of charge transfer. The findings offer a novel protocol for synthesis of nanoassemblies with tunable electronic properties.

  17. Subspace K-means clustering

    NARCIS (Netherlands)

    Timmerman, Marieke E.; Ceulemans, Eva; De Roover, Kim; Van Leeuwen, Karla

    2013-01-01

    To achieve an insightful clustering of multivariate data, we propose subspace K-means. Its central idea is to model the centroids and cluster residuals in reduced spaces, which allows for dealing with a wide range of cluster types and yields rich interpretations of the clusters. We review the existi

  18. Cluster Implantation and Deposition Apparatus

    DEFF Research Database (Denmark)

    Hanif, Muhammad; Popok, Vladimir

    2015-01-01

    In the current report, a design and capabilities of a cluster implantation and deposition apparatus (CIDA) involving two different cluster sources are described. The clusters produced from gas precursors (Ar, N etc.) by PuCluS-2 can be used to study cluster ion implantation in order to develop...... contributions to the theory of cluster stopping in matter as well as for practical applications requiring ultra-shallow implantation and modification of surfaces on the nanoscale. Metal clusters from the magnetron cluster source are of interest for the production of optical sensors to detect specific biological...

  19. Stellar populations in star clusters

    CERN Document Server

    Li, Chengyuan; Deng, Licai

    2016-01-01

    Stellar populations contain the most important information about star clus- ter formation and evolution. Until several decades ago, star clusters were believed to be ideal laboratories for studies of simple stellar populations (SSPs). However, discoveries of multiple stellar populations in Galactic globular clusters have expanded our view on stellar populations in star clusters. They have simultaneously generated a number of controversies, particularly as to whether young star clusters may have the same origin as old globular clusters. In addition, extensive studies have revealed that the SSP scenario does not seem to hold for some intermediate-age and young star clusters either, thus making the origin of multiple stellar populations in star clusters even more complicated. Stellar population anomalies in numerous star clusters are well-documented, implying that the notion of star clusters as true SSPs faces serious challenges. In this review, we focus on stellar populations in massive clusters with different ...

  20. NuSTAR observations of magnetar 1e 1841-045

    DEFF Research Database (Denmark)

    An, Hongjun; Hascoet, Romain; Kaspi, Victoria M.;

    2013-01-01

    We report new spectral and temporal observations of the magnetar 1E 1841-045 in the Kes 73 supernova remnant obtained with the Nuclear Spectroscopic Telescope Array. Combined with new Swift and archival XMM-Newton and Chandra observations, the phase-averaged spectrum is well characterized...... by a blackbody plus double power law, in agreement with previous multimission X-ray results. However, we are unable to reproduce the spectral results reported based on Suzaku observations. The pulsed fraction of the source is found to increase with photon energy. The measured rms pulsed fractions are similar...... the rotation axis and line of sight of similar to 50 degrees. In this model, the soft X-ray component is inconsistent with a single blackbody; adding a second blackbody or a power-law component fits the data. The two-blackbody interpretation suggests a hot spot of temperature kT approximate to 0.9 ke...

  1. Robinson-Schensted-Knuth Correspondence and Weak Polynomial Identities of M1,1(E)

    Institute of Scientific and Technical Information of China (English)

    Onofrio Mario Di Vincenzo; Roberto La Scala

    2005-01-01

    In this paper, it is proved that the ideal Iω of the weak polynomial identities of the superalgebra M1,1(E) is generated by the p roper polynomials [x1,x2, x3] and [x2,x1][xa,x1][x4, x1]. This is proved for any infinite field F of characteristic different a basis and the dimension of any multihomogeneous component of the quotient algebra B/(B ∩ Iw). We also compute the Hilbert series of this algebra. One of the main tools of this paper is a variant we found of the Robinson-Schensted-Knuth correspondence defined for single semistandard tableaux of double shape.

  2. E1, M1, E2 transition energies and probabilities of W$^{54+}$ ions

    CERN Document Server

    Ding, Xiao-bin; Liu, Jia-xin; Koike, Fumihiro; Murakami, Izumi; Kato, Daiji; Sakaue, Hiroyuki A; Nakamura, Nobuyuki; Dong, Chen-zhong

    2016-01-01

    A comprehensive theoretical study of the E1, M1, E2 transitions of Ca-like tungsten ions is presented. Using multi-configuration Dirac-Fock (MCDF) method with a restricted active space treatment, the wavelengths and probabilities of the M1 and E2 transitions between the multiplets of the ground state configuration ([Ne]3s$^{2}$3p$^{6}$3d$^{2}$) and of the E1 transitions between [Ne]3s$^{2}$3p$^{5}$3d$^{3}$ and [Ne]3s$^{2}$3p$^{6}$3d$^{2}$ have been calculated. The results are in reasonable agreement with available experimental data. The present E1 and M1 calculations are compared with previous theoretical values. For E2 transitions, the importance of electron correlation from 3s and 3p orbitals is pointed out. Several strong E1 transitions are predicted, which have potential advantage for plasma diagnostics.

  3. Notch1-Snail1-E-cadherin pathway in metastatic hepatocellular carcinoma.

    Science.gov (United States)

    Wang, Xiao Qi; Zhang, Wu; Lui, Eric L H; Zhu, Yongqiang; Lu, Ping; Yu, Xiaoming; Sun, Jisan; Yang, Sitian; Poon, Ronnie T P; Fan, Sheung Tat

    2012-08-01

    Notch signaling, a critical pathway for tissue development, also contributes to tumorigenesis in many cancers, but its pathological function in liver cancer is not well defined. In our study, Notch1 expression and its clinicopathological parameters were evaluated in 82 human hepatocellular carcinoma (HCC) patients. Plasmid-based siNotch1 shRNA was transiently or stably transfected into metastatic HCC cells and subsequently evaluated for the effects on orthotopic liver tumor metastasis in a mouse model as well as the effects on downstream pathways. Aberrant high expression of Notch1 was significantly associated with metastatic disease parameters in HCC patients, such as tumor-node-metastasis Stages III-IV and tumor venous invasion. Knocking-down Notch1 reduced cell motility in vitro and orthotopic tumor metastasis from the liver to the lung in vivo in a mouse model. In metastatic HCC cells, abnormal expression of Notch1 was associated with increased expression of Snail1 and repressed expression of E-cadherin; the Notch1-Snail1-E-cadherin association can also be found in HCC patient tumors. Inhibition of Notch1 by shRNA abolished Snail1 expression, which further resulted in the re-establishment of repressed E-cadherin in metastatic HCC cells. Thus, abnormal Notch1 expression was strongly associated with HCC metastatic disease, which might be mediated through the Notch1-Snail1-E-cadherin pathway. Knock-down of Notch1 reversed HCC tumor metastasis in a mouse model. Therefore, these data suggest that effective targeting of Notch signaling might also inhibit tumor metastasis.

  4. Clustering by Pattern Similarity

    Institute of Scientific and Technical Information of China (English)

    Hai-xun Wang; Jian Pei

    2008-01-01

    The task of clustering is to identify classes of similar objects among a set of objects. The definition of similarity varies from one clustering model to another. However, in most of these models the concept of similarity is often based on such metrics as Manhattan distance, Euclidean distance or other Lp distances. In other words, similar objects must have close values in at least a set of dimensions. In this paper, we explore a more general type of similarity. Under the pCluster model we proposed, two objects are similar if they exhibit a coherent pattern on a subset of dimensions. The new similarity concept models a wide range of applications. For instance, in DNA microarray analysis, the expression levels of two genes may rise and fall synchronously in response to a set of environmental stimuli. Although the magnitude of their expression levels may not be close, the patterns they exhibit can be very much alike. Discovery of such clusters of genes is essential in revealing significant connections in gene regulatory networks. E-commerce applications, such as collaborative filtering, can also benefit from the new model, because it is able to capture not only the closeness of values of certain leading indicators but also the closeness of (purchasing, browsing, etc.) patterns exhibited by the customers. In addition to the novel similarity model, this paper also introduces an effective and efficient algorithm to detect such clusters, and we perform tests on several real and synthetic data sets to show its performance.

  5. Chemical evolution of star clusters

    OpenAIRE

    van Loon, Jacco Th.

    2009-01-01

    I discuss the chemical evolution of star clusters, with emphasis on old globular clusters, in relation to their formation histories. Globular clusters clearly formed in a complex fashion, under markedly different conditions from any younger clusters presently known. Those special conditions must be linked to the early formation epoch of the Galaxy and must not have occurred since. While a link to the formation of globular clusters in dwarf galaxies has been suggested, present-day dwarf galaxi...

  6. Maximum-likelihood cluster recontruction

    CERN Document Server

    Bartelmann, M; Seitz, S; Schneider, P J; Bartelmann, Matthias; Narayan, Ramesh; Seitz, Stella; Schneider, Peter

    1996-01-01

    We present a novel method to recontruct the mass distribution of galaxy clusters from their gravitational lens effect on background galaxies. The method is based on a least-chisquare fit of the two-dimensional gravitational cluster potential. The method combines information from shear and magnification by the cluster lens and is designed to easily incorporate possible additional information. We describe the technique and demonstrate its feasibility with simulated data. Both the cluster morphology and the total cluster mass are well reproduced.

  7. 超音速密集弹丸脱靶量测量方法研究%Research on Miss Distance Measurement for Transsonic and Saturated Bullets

    Institute of Scientific and Technical Information of China (English)

    陈利风; 刘华林; 班方圆; 刘强

    2015-01-01

    Advantages and disadvantages of three radar ranging systems have been analyzed. To measure the miss distance of transonic saturated bullets,a new method based on the system of frequency modulated continuous wave is provided,adopting four antennas to receive signals. Broke through a key radar detection technology to ensure the RCS is biggest when the target is through the window. The Hough based algorithm to solve the problem of measurement data unable to be classified is designed. The simulation results show that the miss distance measurement method can effectively distinguish among multiple projectile trajectories. The test results are consistent with theoretical analysis,and proving this method is rationality and practicability.%分析了3种雷达测距体制的优缺点。针对超音速密集弹丸数量多、速度快等特点导致的脱靶量测量困难等问题,提出一种基于调频连续波体制的弹载雷达测距方法,采用四面天线收发分置结构,突破了正侧视开窗检测技术,保证目标在穿越窗口时RCS最强,并针对少数测量数据无法归类现象,设计了基于广义Hough变换的分类方法。仿真结果表明:该脱靶量测量方法可以有效区分多个弹丸轨迹。最后进行了试验验证,结果与理论分析一致,证明了该方法合理性和实用性。

  8. Clustering Game Behavior Data

    DEFF Research Database (Denmark)

    Bauckhage, C.; Drachen, Anders; Sifa, Rafet

    2015-01-01

    Recent years have seen a deluge of behavioral data from players hitting the game industry. Reasons for this data surge are many and include the introduction of new business models, technical innovations, the popularity of online games, and the increasing persistence of games. Irrespective...... of the causes, the proliferation of behavioral data poses the problem of how to derive insights therefrom. Behavioral data sets can be large, time-dependent and high-dimensional. Clustering offers a way to explore such data and to discover patterns that can reduce the overall complexity of the data. Clustering...... scientists and present a review and tutorial focusing on the application of clustering techniques to mine behavioral game data. Several algorithms are reviewed and examples of their application shown. Key topics such as feature normalization are discussed and open problems in the context of game analytics...

  9. The concept of cluster

    DEFF Research Database (Denmark)

    Laursen, Lea Louise Holst; Møller, Jørgen

    2013-01-01

    villages in order to secure their future. This paper will address the concept of cluster-villages as a possible approach to strengthen the conditions of contemporary Danish villages. Cluster-villages is a concept that gather a number of villages in a network-structure where the villages both work together...... to forskellige positioner ser vi en ny mulighed for landsbyudvikling, som vi kalder Clustervillages. In order to investigate the potentials and possibilities of the cluster-village concept the paper will seek to unfold the concept strategically; looking into the benefits of such concept. Further, the paper seeks...... to inscribe the concept into the existing debate regarding villages in the rural districts....

  10. Clusters in Light Nuclei

    CERN Document Server

    Beck, C; Zafra, A Sanchez i; Thummerer, S; Azaiez, F; Bednarczyk, P; Courtin, S; Curien, D; Dorvaux, O; Goasduff, A; ~Lebhertz, D; Nourreddine, A; ~Rousseau, M; Salsac, M -D; von Oertzen, W; Gebauer, B; Wheldon, C; Kokalova, Tz; Efimov, G; Zherebchevsky, V; Schulz, Ch; Bohlen, H G; Kamanin, D; de Angelis, G; Gadea, A; Lenzi, S; Napoli, D R; Szilner, S; Milin, M; Catford, W N; Jenkins, D G; Royer, G

    2010-01-01

    A great deal of research work has been undertaken in the alpha-clustering study since the pioneering discovery, half a century ago, of 12C+12C molecular resonances. Our knowledge of the field of the physics of nuclear molecules has increased considerably and nuclear clustering remains one of the most fruitful domains of nuclear physics, facing some of the greatest challenges and opportunities in the years ahead. In this work, the occurence of "exotic" shapes in light N=Z alpha-like nuclei is investigated. Various approaches of superdeformed and hyperdeformed bands associated with quasimolecular resonant structures are presented. Results on clustering aspects are also discussed for light neutron-rich Oxygen isotopes.

  11. 某炮弹底塞表面防护工艺霉菌试验研究%Mold Test of Surface Protection Technology for Base Plug of a Type of Bullet

    Institute of Scientific and Technical Information of China (English)

    殷宗莲; 黄波; 胥泽奇; 刘杰; 张凯

    2015-01-01

    Objective To study the optimal surface protection technology for Base Plug of a type of bullet. Methods Mold test method was used to test the anti-mold property and corrosion resistance of specimens of two kinds of base plug materials processed by different protection technologies. Results The causes for the different corrosion resistance and anti-mold performance was analyzed, the optimal combination of material and surface protection technology was selected, and some suggestions and measures for long storage and corrosion proof of bullets were put forward. Conclusion The optimal material and surface protection technology for base plug of bullet was 30CrMnSiA+galvanizing/zinc-nickel alloy coating+coating with 7258 aviation grease.%目的:研究某炮弹底塞最佳表面防护工艺。方法采用霉菌试验方法,对2种底塞材料多种表面处理与防护工艺样品的防霉性和防腐蚀性能进行试验和优选。结果分析了防霉性和防腐蚀性能优劣的原因,评定出了最优的材料和表面处理与防护工艺组合,提出了炮弹长贮防霉和防腐蚀的建议和措施。结论底塞最佳的材料和表面处理与防护工艺组合为30CrMnSiA+镀锌/镀锌镍合金+涂7258号航空润滑油脂。

  12. Evolution of a Powerful Radio Loud Quasar 3C186 and its Impact on the Cluster Environment at z=1

    CERN Document Server

    Siemiginowska, Aneta; Burke, Doug; Bechtold, Jill; Cheung, C C; LaMassa, Stephanie; Worrall, Diana M

    2007-01-01

    X-ray cluster emission has been observed mainly in clusters with "inactive" cD galaxies (L_bol ~1E40-1E43erg/sec), which do not show signs of accretion onto a SMBH. Our recent Chandra discovery of ~100kpc scale diffuse X-ray emission revealed the presence of an X-ray cluster associated with the radio loud quasar 3C186 at redshift z=1.1 and suggests interactions between the quasar and the cluster. In contrast to the majority of X-ray clusters the 3C186 cluster contains a quasar in the center whose radiative power alone exceeds that which would be needed to quench the cluster cooling. We present the Chandra X-ray data and new deep radio and optical images of this cluster. The 3C186 quasar is a powerful Compact Steep Spectrum radio source expanding into the cluster medium. The 2arcsec radio jet is unresolved in the Chandra observation, but its direction is orthogonal to the elliptical surface brightness of the cluster. The radio data show the possible presence of old radio lobes on 10 arcsec scale in the directi...

  13. South Asian Cluster

    Directory of Open Access Journals (Sweden)

    Ionel Sergiu Pirju

    2014-12-01

    Full Text Available This article aims at presenting the South Asian cluster composed of India, Indonesia, Iran and Malaysia, the intercultural values that characterizes it, the supported leadership style and tracing the main macroeconomic considerations which characterizes them. The research is synchronic, analysing the contemporary situation of these countries without reference to their evolution in time, by using the positivist paradigm that explains the reality at one point. It will be analysed the overall cluster with the existing interactions between the countries that composes it, while the article being one of information will avoid building recommendation, or new theories.

  14. I Cluster geografici

    Directory of Open Access Journals (Sweden)

    Maurizio Rosina

    2010-03-01

    Full Text Available Geographic ClustersOver the past decade, public alphanumeric database have been growing at exceptional rate. Most of data can be georeferenced, so that is possible gaining new knowledge from such databases. The contribution of this paper is two-fold. We first present a model of geographic clusters, which uses only geographic and functionally data properties. The model is useful to process huge amount of public/government data, even daily upgrading. After that, we merge the model into the framework GEOPOI (GEOcoding Points Of Interest, and show some graphic map results.

  15. Cluster-tilting theory

    OpenAIRE

    Simões, Raquel Coelho Guardado

    2008-01-01

    Tese de mestado em Matemática (Álgebra, Lógica e Fundamentos) apresentada à Universidade de Lisboa, através da Faculdade de Ciências, 2008 Resumo alargado disponível em português The notion of Cluster Algebra first appeared in 2001, in a paper by S. Fomin and A. Zelevinsky, studying the dual canonical basis of the quantum group of a finite dimensional simple Lie algebra over the complex numbers, and also total positivity for algebraic groups. Cluster categories, introduced by A. Buan, R...

  16. Kinematics of Clustering

    CERN Document Server

    Wang, Steven; Metcalfe, Guy; Wu, Jie

    2014-01-01

    The dynamical system for inertial particles in fluid flow has both attracting and repelling regions, the interplay of which can localize particles. In laminar flow experiments we find that particles, initially moving throughout the fluid domain, can undergo an instability and cluster into subdomains of the fluid when the flow Reynolds number exceeds a critical value that depends on particle and fluid inertia. We derive an expression for the instability boundary and for a universal curve that describes the clustering rate for all particles.

  17. An Emerge Approach in Inter Cluster Similarity for Quality Clusters

    Directory of Open Access Journals (Sweden)

    H. Venkateswara Reddy

    2013-04-01

    Full Text Available Relationship between the datasets is one most important issue in recent years. The recent methods are based mostly on the numerical data, but these methods are not suitable for real time data such as web pages, business transactions etc., which are known as Categorical data. It is difficult to find relationship in categorical data. In this paper, a new approach is proposed for finding the relationshipbetween the categorical data, hence to find relationship between the clusters. The main aim is to identify the quality clusters based on the relationship between clusters. If there is no relationship between clusters then those clusters are treated as quality clusters.

  18. Research on the Anti-bullet Performance of Composite Structure with Aerogel Interlayer%以气凝胶为夹层的复合结构抗弹性能研究

    Institute of Scientific and Technical Information of China (English)

    杨杰; 李树奎; 王富耻

    2012-01-01

    The composite targets made of bulletproof fibers, SiC/Al composite material and ceramics in which the aerogel is an interlayer were tested, and the anti-bullet performance of composite structure with aerogel interlayer were studied. The results show that, when the aerogel is combined with bulletproof fibers, the aerogel interlayer could improve the anti-bullet performance of composite target because the deformation of bulletproof fibers is greater due to the low strength of aerogel interlayer. Thus the energy absorption capacity of composite targets improves significantly, and the non-penetrability damage of projectile can also be prevented. When the aerogel is combined with SiC/Al composite material, the anti-bullet performance of composite target improves slightly. The aerogel interlayer could improve the integrality of composite material faceplate after ballistic experiment obviously. When aerogel is combined with ceramics, ceramic faceplate may be bent due to the insufficient support of the aerogel interlayer, resulting in the decrease in the anti-bullet performance of composite target.%对气凝胶分别与防弹纤维、SiC/A1复合材料和陶瓷组成的复合靶板进行靶试试验,研究气凝胶作为夹层时复合结构的抗弹性能.结果表明:当防弹纤维后面加上气凝胶夹层后,强度较低的气凝胶夹层使防弹纤维面板的变形有了很大的扩展空间,复合靶板吸收弹头动能的能力大幅提高,同时可以有效防止弹头的非贯穿性伤害.SiC/A1复合材料后面加上气凝胶夹层后,复合靶板的抗弹性能提高不明显,但可以大幅提高复合材料受到冲击后的完整性.当气凝胶作为夹层放置在陶瓷面板后面时,陶瓷面板由于没有足够的支撑作用而发生弯曲破坏,反而导致整个复合结构的防弹能力降低.

  19. Plumbism due to a bullet retained in a joint Intoxicación plúmbica por heridad de bala en una articulación: presentación de un caso y revisión del tema

    OpenAIRE

    1990-01-01

    We report on the case of a 32 year-old man with no laboral exposure to lead but who received a gunshot, seven years before, in the right coxofemoral joint; he developed classic manifestations of plumbism and had a blood lead level of 99 119/dl. This value decreased and the clinical and laboratory abnormalities improved after surgical removal of the retained bullet. We discuss the sparse literature available on t...

  20. Combining cluster number counts and galaxy clustering

    CERN Document Server

    Lacasa, Fabien

    2016-01-01

    We present a detailed modelling of the joint covariance matrix between cluster number counts and the galaxy angular power spectrum. To this end, we use a Halo Model framework complemented by a Halo Occupation Distribution model (HOD), and we work in full-sky. We demonstrate the importance of accounting for non-Gaussianity to produce accurate covariance predictions, as the Gaussian part of the covariance can in fact become subdominant in certain configurations. We discuss in particular the case of the super-sample covariance (SSC), including the effects of galaxy shot-noise, halo second order bias and non-local bias, and demonstrating interesting mathematical properties. Using the joint covariance matrix and a Fisher matrix methodology, we examine the prospects of combining these two probes to constrain cosmological and HOD parameters. We find that the combination indeed results in noticeable better constraints, in particular because the cross-covariance introduces a synergy between the probes on small scales....

  1. Ionization of large homogeneous and heterogeneous clusters generated in acetylene-Ar expansions: cluster ion polymerization.

    Science.gov (United States)

    Kočišek, J; Lengyel, J; Fárník, M

    2013-03-28

    Pure acetylene and mixed Ar-acetylene clusters are formed in supersonic expansions of acetylene/argon mixtures and analysed using reflectron time-of-flight mass spectrometer with variable electron energy ionization source. Acetylene clusters composed of more than a hundred acetylene molecules are generated at the acetylene concentration of ≈8%, while mixed species are produced at low concentrations (≈0.7%). The electron energy dependence of the mass spectra revealed the ionization process mechanisms in clusters. The ionization above the threshold for acetylene molecule of 11.5 eV results in the main ionic fragment progression (C2H2)n(+). At the electron energies ≥21.5 eV above the CH+CH(+) dissociative ionization limit of acetylene the fragment ions nominally labelled as (C2H2)nCH(+), n ≥ 2, are observed. For n ≤ 7 these fragments correspond to covalently bound ionic structures as suggested by the observed strong dehydrogenation [(C2H2)n - k × H](+) and [(C2H2)nCH - k × H](+). The dehydrogenation is significantly reduced in the mixed clusters where evaporation of Ar instead of hydrogen can stabilize the nascent molecular ion. The C3H3(+) ion was previously assigned to originate from the benzene molecular ion; however, the low appearance energy of ≈13.7 eV indicates that a less rigid covalently bound structure of C6H6(+) ion must also be formed upon the acetylene cluster electron ionization. The appearance energy of Arn(C2H2)(+) fragments above ≈15.1 eV indicates that the argon ionization is the first step in the fragment ion production, and the appearance energy of Arn≥2(C2H2)m≥2(+) at ≈13.7 eV is discussed in terms of an exciton transfer mechanism.

  2. THE ATACAMA COSMOLOGY TELESCOPE: PHYSICAL PROPERTIES OF SUNYAEV-ZEL'DOVICH EFFECT CLUSTERS ON THE CELESTIAL EQUATOR {sup ,}

    Energy Technology Data Exchange (ETDEWEB)

    Menanteau, Felipe; Hughes, John P. [Department of Physics and Astronomy, Rutgers University, 136 Frelinghuysen Road, Piscataway, NJ 08854 (United States); Sifon, Cristobal; Barrientos, L. Felipe; Duenner, Rolando; Infante, Leopoldo [Departamento de Astronomia y Astrofisica, Facultad de Fisica, Pontificia Universidad Catolica de Chile, Casilla 306, Santiago 22 (Chile); Battaglia, Nicholas [McWilliams Center for Cosmology, Department of Physics, Carnegie Mellon University, 5000 Forbes Avenue, Pittsburgh, PA 15213 (United States); Bond, J. Richard; Hajian, Amir; Hincks, Adam D. [Canadian Institute for Theoretical Astrophysics, University of Toronto, Toronto, ON M5S 3H8 (Canada); Crichton, Devin; Gralla, Megan; Marriage, Tobias A. [Department of Physics and Astronomy, The Johns Hopkins University, Baltimore, MD 21218-2686 (United States); Das, Sudeep [High Energy Physics Division, Argonne National Laboratory, 9700 S Cass Avenue, Lemont, IL 60439 (United States); Devlin, Mark J.; Dicker, Simon [Department of Physics and Astronomy, University of Pennsylvania, 209 South 33rd Street, Philadelphia, PA 19104 (United States); Hasselfield, Matthew [Department of Physics and Astronomy, University of British Columbia, Vancouver, BC V6T 1Z4 (Canada); Hilton, Matt [Astrophysics and Cosmology Research Unit, School of Mathematics, Statistics and Computer Science, University of KwaZulu-Natal, Durban (South Africa); Kosowsky, Arthur [Physics and Astronomy Department, University of Pittsburgh, 100 Allen Hall, 3941 O' Hara Street, Pittsburgh, PA 15260 (United States); Marsden, Danica [Department of Physics, University of California Santa Barbara, CA 93106 (United States); and others

    2013-03-01

    We present the optical and X-ray properties of 68 galaxy clusters selected via the Sunyaev-Zel'dovich (SZ) effect at 148 GHz by the Atacama Cosmology Telescope (ACT). Our sample, from an area of 504 deg{sup 2} centered on the celestial equator, is divided into two regions. The main region uses 270 deg{sup 2} of the ACT survey that overlaps with the co-added ugriz imaging from the Sloan Digital Sky Survey (SDSS) over Stripe 82 plus additional near-infrared pointed observations with the Apache Point Observatory 3.5 m telescope. We confirm a total of 49 clusters to z Almost-Equal-To 1.3, of which 22 (all at z > 0.55) are new discoveries. For the second region, the regular-depth SDSS imaging allows us to confirm 19 more clusters up to z Almost-Equal-To 0.7, of which 10 systems are new. We present the optical richness, photometric redshifts, and separation between the SZ position and the brightest cluster galaxy (BCG). We find no significant offset between the cluster SZ centroid and BCG location and a weak correlation between optical richness and SZ-derived mass. We also present X-ray fluxes and luminosities from the ROSAT All Sky Survey which confirm that this is a massive sample. One of the newly discovered clusters, ACT-CL J0044.4+0113 at z = 1.1 (photometric), has an integrated XMM-Newton X-ray temperature of kT{sub X} = 7.9 {+-} 1.0 keV and combined mass of M {sub 200a} = 8.2{sup +3.3} {sub -2.5} Multiplication-Sign 10{sup 14} h {sup -1} {sub 70} M {sub Sun }, placing it among the most massive and X-ray-hot clusters known at redshifts beyond z = 1. We also highlight the optically rich cluster ACT-CL J2327.4-0204 (RCS2 2327) at z = 0.705 (spectroscopic) as the most significant detection of the whole equatorial sample with a Chandra-derived mass of M {sub 200a} = 1.9{sup +0.6} {sub -0.4} Multiplication-Sign 10{sup 15} h {sup -1} {sub 70} M {sub Sun }, placing it in the ranks of the most massive known clusters like El Gordo and the Bullet Cluster.

  3. Localized attack on clustering networks

    CERN Document Server

    Dong, Gaogao; Du, Ruijin; Shao, Shuai; Stanley, H Eugene; Shlomo, Havlin

    2016-01-01

    Clustering network is one of which complex network attracting plenty of scholars to discuss and study the structures and cascading process. We primarily analyzed the effect of clustering coefficient to other various of the single clustering network under localized attack. These network models including double clustering network and star-like NON with clustering and random regular (RR) NON of ER networks with clustering are made up of at least two networks among which exist interdependent relation among whose degree of dependence is measured by coupling strength. We show both analytically and numerically, how the coupling strength and clustering coefficient effect the percolation threshold, size of giant component, critical coupling point where the behavior of phase transition changes from second order to first order with the increase of coupling strength between the networks. Last, we study the two types of clustering network: one type is same with double clustering network in which each subnetwork satisfies ...

  4. Clustering of resting state networks.

    Directory of Open Access Journals (Sweden)

    Megan H Lee

    Full Text Available BACKGROUND: The goal of the study was to demonstrate a hierarchical structure of resting state activity in the healthy brain using a data-driven clustering algorithm. METHODOLOGY/PRINCIPAL FINDINGS: The fuzzy-c-means clustering algorithm was applied to resting state fMRI data in cortical and subcortical gray matter from two groups acquired separately, one of 17 healthy individuals and the second of 21 healthy individuals. Different numbers of clusters and different starting conditions were used. A cluster dispersion measure determined the optimal numbers of clusters. An inner product metric provided a measure of similarity between different clusters. The two cluster result found the task-negative and task-positive systems. The cluster dispersion measure was minimized with seven and eleven clusters. Each of the clusters in the seven and eleven cluster result was associated with either the task-negative or task-positive system. Applying the algorithm to find seven clusters recovered previously described resting state networks, including the default mode network, frontoparietal control network, ventral and dorsal attention networks, somatomotor, visual, and language networks. The language and ventral attention networks had significant subcortical involvement. This parcellation was consistently found in a large majority of algorithm runs under different conditions and was robust to different methods of initialization. CONCLUSIONS/SIGNIFICANCE: The clustering of resting state activity using different optimal numbers of clusters identified resting state networks comparable to previously obtained results. This work reinforces the observation that resting state networks are hierarchically organized.

  5. On Dark Peaks and Missing Mass: A Weak-Lensing Mass Reconstruction of the Merging Cluster System A520

    Science.gov (United States)

    Clowe, Douglas; Markevitch, Maxim; Bradac, Marusa; Gonzalez, Anthony H.; Chung, Sun Mi

    2012-01-01

    Merging clusters of galaxies are unique in their power to directly probe and place limits on the self-interaction cross-section of dark matter. Detailed observations of several merging clusters have shown the intracluster gas to be displaced from the centroids of dark matter and galaxy density by ram pressure, while the latter components are spatially coincident, consistent with collisionless dark matter. This has been used to place upper limits on the dark matter particle self-interaction cross-section of order 1 sq cm/g. The cluster A520 has been seen as a possible exception. We revisit A520 presenting new Hubble Space Telescope Advanced Camera for Surveys mosaic images and a Magellan image set. We perform a detailed weak-lensing analysis and show that the weak-lensing mass measurements and morphologies of the core galaxy-filled structures are mostly in good agreement with previous works. There is, however, one significant difference: We do not detect the previously claimed "dark core" that contains excess mass with no significant galaxy overdensity at the location of the X-ray plasma. This peak has been suggested to be indicative of a large self-interaction cross-section for dark matter (at least approx 5alpha larger than the upper limit of 0.7 sq cm/g determined by observations of the Bullet Cluster). We find no such indication and instead find that the mass distribution of A520, after subtraction of the X-ray plasma mass, is in good agreement with the luminosity distribution of the cluster galaxies.We conclude that A520 shows no evidence to contradict the collisionless dark matter scenario.

  6. Protein microarrays for the identification of praja1 e3 ubiquitin ligase substrates.

    Science.gov (United States)

    Loch, Christian M; Eddins, Michael J; Strickler, James E

    2011-06-01

    Although they are the primary determinants of substrate specificity, few E3-substrate pairs have been positively identified, and few E3's profiled in a proteomic fashion. Praja1 is an E3 implicated in bone development and highly expressed in brain. Although it has been well studied relative to the majority of E3's, little is known concerning the repertoire of proteins it ubiquitylates. We sought to identify high confidence substrates for Praja1 from an unbiased proteomic profile of thousands of human proteins using protein microarrays. We first profiled Praja1 activity against a panel of E2's to identify its optimal partner in vitro. We then ubiquitylated multiple, identical protein arrays and detected putative substrates with reagents that vary in ubiquitin recognition according to the extent of chain formation. Gene ontology clustering identified putative substrates consistent with information previously known about Praja1 function, and provides clues into novel aspects of this enzyme's function.

  7. Clustering via Kernel Decomposition

    DEFF Research Database (Denmark)

    Have, Anna Szynkowiak; Girolami, Mark A.; Larsen, Jan

    2006-01-01

    Methods for spectral clustering have been proposed recently which rely on the eigenvalue decomposition of an affinity matrix. In this work it is proposed that the affinity matrix is created based on the elements of a non-parametric density estimator. This matrix is then decomposed to obtain poste...

  8. Detecting alternative graph clusterings.

    Science.gov (United States)

    Mandala, Supreet; Kumara, Soundar; Yao, Tao

    2012-07-01

    The problem of graph clustering or community detection has enjoyed a lot of attention in complex networks literature. A quality function, modularity, quantifies the strength of clustering and on maximization yields sensible partitions. However, in most real world networks, there are an exponentially large number of near-optimal partitions with some being very different from each other. Therefore, picking an optimal clustering among the alternatives does not provide complete information about network topology. To tackle this problem, we propose a graph perturbation scheme which can be used to identify an ensemble of near-optimal and diverse clusterings. We establish analytical properties of modularity function under the perturbation which ensures diversity. Our approach is algorithm independent and therefore can leverage any of the existing modularity maximizing algorithms. We numerically show that our methodology can systematically identify very different partitions on several existing data sets. The knowledge of diverse partitions sheds more light into the topological organization and helps gain a more complete understanding of the underlying complex network.

  9. Extended Fuzzy Clustering Algorithms

    NARCIS (Netherlands)

    U. Kaymak (Uzay); M. Setnes

    2000-01-01

    textabstractFuzzy clustering is a widely applied method for obtaining fuzzy models from data. It has been applied successfully in various fields including finance and marketing. Despite the successful applications, there are a number of issues that must be dealt with in practical applications of fuz

  10. Cluster headaches simulating parasomnias.

    Science.gov (United States)

    Isik, Ugur; D'Cruz, O 'Neill F

    2002-09-01

    Nocturnal episodes of agitated arousal in otherwise healthy young children are often related to nonrapid eye movement parasomnias (night terrors). However, in patients with acute onset or increased frequency of parasomnias, organic causes of discomfort must be excluded. We report four young children whose parasomnias were caused by nocturnal cluster headaches and who responded to indomethacin dramatically.

  11. Dettagli utilizzo cluster INTEL

    OpenAIRE

    2012-01-01

    Dall'inizio dell'anno 2004 il CILEA ospita e gestisce un cluster di processori Intel a 32 bit denominato avogadro. Esso é costituito da 128 nodi biprocessori Intel Xeon 3.06 GHz. L'articolo intende presentare le problematiche relative all'utilizzo della macchina processore fornendo le istruzioni operative necessarie all'uso più efficace.

  12. Fuzzy clustering of mechanisms

    Indian Academy of Sciences (India)

    Amitabha Ghosh; Dilip Kumar Pratihar; M V V Amarnath; Guenter Dittrich; Jorg Mueller

    2012-10-01

    During the course of development of Mechanical Engineering, a large number of mechanisms (that is, linkages to perform various types of tasks) have been conceived and developed. Quite a few atlases and catalogues were prepared by the designers of machines and mechanical systems. However, often it is felt that a clustering technique for handling the list of large number of mechanisms can be very useful,if it is developed based on a scientific principle. In this paper, it has been shown that the concept of fuzzy sets can be conveniently used for this purpose, if an adequate number of properly chosen attributes (also called characteristics) are identified. Using two clustering techniques, the mechanisms have been classified in the present work and in future, it may be extended to develop an expert system, which can automate type synthesis phase of mechanical design. To the best of the authors’ knowledge, this type of clustering of mechanisms has not been attempted before. Thus, this is the first attempt to cluster the mechanisms based on some quantitative measures. It may help the engineers to carry out type synthesis of the mechanisms.

  13. Emergence of regional clusters

    DEFF Research Database (Denmark)

    Dahl, Michael S.; Østergaard, Christian Richter; Dalum, Bent

    2010-01-01

    The literature on regional clusters has increased considerably during the last decade. The emergence and growth patterns are usually explained by such factors as unique local culture, regional capabilities, tacit knowledge or the existence of location-specific externalities (knowledge spillovers,...

  14. PVM Support for Clusters

    Science.gov (United States)

    Springer, P.

    2000-01-01

    The latest version of PVM (3.4.3) now contains support for a PC cluster running Linux, also known as a Beowulf system. A PVM user of a computer outside the Beowulf system can add the Beowulf as a single machine.

  15. Hybrid cluster identification

    Science.gov (United States)

    Martín-Herrero, J.

    2004-10-01

    I present a hybrid method for the labelling of clusters in two-dimensional lattices, which combines the recursive approach with iterative scanning to reduce the stack size required by the pure recursive technique, while keeping its benefits: single pass and straightforward cluster characterization and percolation detection parallel to the labelling. While the capacity to hold the entire lattice in memory is usually regarded as the major constraint for the applicability of the recursive technique, the required stack size is the real limiting factor. Resorting to recursion only for the transverse direction greatly reduces the recursion depth and therefore the required stack. It also enhances the overall performance of the recursive technique, as is shown by results on a set of uniform random binary lattices and on a set of samples of the Ising model. I also show how this technique may replace the recursive technique in Wolff's cluster algorithm, decreasing the risk of stack overflow and increasing its speed, and the Hoshen-Kopelman algorithm in the Swendsen-Wang cluster algorithm, allowing effortless characterization during generation of the samples and increasing its speed.

  16. Resolved SZE Cluster Count

    Institute of Scientific and Technical Information of China (English)

    Jia-Yu Tang; Zu-Hui Fan

    2003-01-01

    We study the counts of resolved SZE (Sunyaev-Zel'dovich effect) clus-ters expected from an interferometric survey in different cosmological models underdifferent conditions. The self-similar universal gas model and Press-Schechter massfunction are used. We take the observing frequency to be 90 GHz, and consider twodish diameters, 1.2 m and 2.5 m. We calculate the number density of the galaxyclusters dN/(dΩdz) at a high flux limit Slimv = 100mJy and at a relative lowSlimv = 10 mJy. The total numbers of SZE clusters N in two low-Ω0 models arecompared. The results show that the influence of the resolved effect depends notonly on D, but also on Slimv: at a given D, the effect is more significant for a highthan for a low Slim Also, the resolved effect for a flat universe is more impressivethan that for an open universe. For D = 1.2m and Slimv= 10mJy, the resolvedeffect is very weak. Considering the designed interferometers which will be used tosurvey SZE clusters, we find that the resolved effect is insignificant when estimatingthe expected yield of the SZE cluster surveys.

  17. Clustering under Perturbation Resilience

    CERN Document Server

    Balcan, Maria Florina

    2011-01-01

    Recently, Bilu and Linial \\cite{BL} formalized an implicit assumption often made when choosing a clustering objective: that the optimum clustering to the objective should be preserved under small multiplicative perturbations to distances between points. They showed that for max-cut clustering it is possible to circumvent NP-hardness and obtain polynomial-time algorithms for instances resilient to large (factor $O(\\sqrt{n})$) perturbations, and subsequently Awasthi et al. \\cite{ABS10} considered center-based objectives, giving algorithms for instances resilient to O(1) factor perturbations. In this paper, we greatly advance this line of work. For the $k$-median objective, we present an algorithm that can optimally cluster instances resilient to $(1 + \\sqrt{2})$-factor perturbations, solving an open problem of Awasthi et al.\\cite{ABS10}. We additionally give algorithms for a more relaxed assumption in which we allow the optimal solution to change in a small $\\epsilon$ fraction of the points after perturbation. ...

  18. Data clustering algorithms and applications

    CERN Document Server

    Aggarwal, Charu C

    2013-01-01

    Research on the problem of clustering tends to be fragmented across the pattern recognition, database, data mining, and machine learning communities. Addressing this problem in a unified way, Data Clustering: Algorithms and Applications provides complete coverage of the entire area of clustering, from basic methods to more refined and complex data clustering approaches. It pays special attention to recent issues in graphs, social networks, and other domains.The book focuses on three primary aspects of data clustering: Methods, describing key techniques commonly used for clustering, such as fea

  19. Quartile Clustering: A quartile based technique for Generating Meaningful Clusters

    CERN Document Server

    Goswami, Saptarsi

    2012-01-01

    Clustering is one of the main tasks in exploratory data analysis and descriptive statistics where the main objective is partitioning observations in groups. Clustering has a broad range of application in varied domains like climate, business, information retrieval, biology, psychology, to name a few. A variety of methods and algorithms have been developed for clustering tasks in the last few decades. We observe that most of these algorithms define a cluster in terms of value of the attributes, density, distance etc. However these definitions fail to attach a clear meaning/semantics to the generated clusters. We argue that clusters having understandable and distinct semantics defined in terms of quartiles/halves are more appealing to business analysts than the clusters defined by data boundaries or prototypes. On the samepremise, we propose our new algorithm named as quartile clustering technique. Through a series of experiments we establish efficacy of this algorithm. We demonstrate that the quartile clusteri...

  20. 1-eV GaInNAs solar cells for ultrahigh-frequency multijunction devices

    Energy Technology Data Exchange (ETDEWEB)

    Friedman, D.J.; Geisz, J.F.; Kurtz, S.R.; Olson, J.M. [National Renewable Energy Lab., Golden, CO (United States)

    1998-09-01

    The authors demonstrate working prototypes of a GaInNAs-based solar cell lattice-matched to GaAs with photoresponse down to 1 eV. This device is intended for use as the third junction of future-generation ultrahigh-efficiency three- and four-junction devices. Under the AM1.5 direct spectrum with all the light higher in energy than the GaAs band gap filtered out, the prototypes have open-circuit voltages ranging from 0.35 to 0.44 V, short-circuit currents of 1.8 mA/cm{sup 2}, and fill factors from 61--66%. The short-circuit currents are of principal concern: the internal quantum efficiencies rise only to about 0.2. The authors discuss the short diffusion lengths which are the reason for this low photocurrent. As a partial workaround for the poor diffusion lengths, they demonstrate a depletion-width-enhanced variation of one of the prototype devices that grades off decreased voltage for increased photocurrent, with a short-circuit current of 6.5 mA/cm{sup 2} and an open-circuit voltage of 0.29 V.

  1. NuSTAR OBSERVATIONS OF THE MAGNETAR 1E 2259+586

    Energy Technology Data Exchange (ETDEWEB)

    Vogel, Julia K. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Hascoët, Romain [Columbia Univ., New York, NY (United States); Kaspi, Victoria M. [Univ. of Montreal, Quebec (Canada); An, Hongjun [Univ. of Montreal, Quebec (Canada); Archibald, Robert [Univ. of Montreal, Quebec (Canada); Beloborodov, Andrei M. [Columbia Univ., New York, NY (United States); Boggs, Steven E. [Univ. of California, Berkeley, CA (United States); Christensen, Finn E. [Technical Univ. of Denmark, Lyngby (Denmark); Craig, William W. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Gotthelf, Eric V. [Columbia Univ., New York, NY (United States); Grefenstette, Brian W. [California Inst. of Technology (CalTech), Pasadena, CA (United States); Hailey, Charles J. [Columbia Univ., New York, NY (United States); Harrison, Fiona A. [California Inst. of Technology (CalTech), Pasadena, CA (United States); Kennea, Jamie A. [Pennsylvania State Univ., State College, PA (United States); Madsen, Kristin K. [California Inst. of Technology (CalTech), Pasadena, CA (United States); Pivovaroff, Michael J. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Stern, Daniel [California Inst. of Technology (CalTech), Pasadena, CA (United States); Zhang, William W. [NASA Goddard Space Flight Center (GSFC), Greenbelt, MD (United States)

    2014-07-01

    We report on new broad band spectral and temporal observations of the magnetar 1E 2259+586, which is located in the supernova remnant CTB 109. Our data were obtained simultaneously with the Nuclear Spectroscopic Telescope Array (NuSTAR) and Swift, and cover the energy range from 0.5-79 keV. We present pulse profiles in various energy bands and compare them to previous RXTE results. The NuSTAR data show pulsations above 20 keV for the first time and we report evidence that one of the pulses in the double-peaked pulse profile shifts position with energy. The pulsed fraction of the magnetar is shown to increase strongly with energy. Our spectral analysis reveals that the soft X-ray spectrum is well characterized by an absorbed double blackbody or blackbody plus power-law model in agreement with previous reports. Our new hard X-ray data, however, suggest that an additional component, such as a power law, is needed to describe the NuSTAR and Swift spectrum. We also fit the data with the recently developed coronal outflow model by Beloborodov for hard X-ray emission from magnetars. The outflow from a ring on the magnetar surface is statistically preferred over outflow from a polar cap.

  2. NuSTAR Observations of the Magnetar 1E 2259+586

    CERN Document Server

    Vogel, Julia K; Kaspi, Victoria M; An, Hongjun; Archibald, Robert; Beloborodov, Andrei M; Boggs, Steven E; Christensen, Finn E; Craig, William W; Gotthelf, Eric V; Grefenstette, Brian W; Hailey, Charles J; Harrison, Fiona A; Kennea, Jamie A; Madsen, Kristin K; Pivovaroff, Michael J; Stern, Daniel; Zhang, William W

    2014-01-01

    We report on new broad band spectral and temporal observations of the magnetar 1E 2259+586, which is located in the supernova remnant CTB 109. Our data were obtained simultaneously with the Nuclear Spectroscopic Telescope Array (NuSTAR) and Swift, and cover the energy range from 0.5-79 keV. We present pulse profiles in various energy bands and compare them to previous RXTE results. The NuSTAR data show pulsations above 20 keV for the first time and we report evidence that one of the pulses in the double-peaked pulse profile shifts position with energy. The pulsed fraction of the magnetar is shown to increase strongly with energy. Our spectral analysis reveals that the soft X-ray spectrum is well characterized by an absorbed double-blackbody or blackbody plus power-law model in agreement with previous reports. Our new hard X-ray data, however, suggests that an additional component, such as a power-law, is needed to describe the NuSTAR and Swift spectrum. We also fit the data with the recently developed coronal...

  3. Leak testing of IR sensor dewars to 1E-15 std He/s

    Science.gov (United States)

    Sasaki, Y. Tito; Bergquist, Lyle E.

    1990-09-01

    The results of tests for leakage performed on ten IR sensor dewars are presented, and the design principles of the new testing devices are discussed. The ultrasensitive leak detector used for testing is compared to conventional detectors. The superfine leak calibrator consisting of a tracer gas supply, an aliquot volume, a pressure transducer, temperature gage, and valves was used to measure leak rates in the E-4 to E-12 std cc He/s range. The testing method is explained, including the gases used, the quadrupole mass analyzer, the reference leak calibration, and the temperature coefficient of the reference leak. The test results of the IR sensor dewars are shown: seven showed leak rates in the E-15 std cc He/s range, two had no detectable leaks, and one had a mid-range E-14 leak. The shelf lives of the dewars are calculated based on the results. The vacuum integrity of small IR sensor dewars can be reliably tested to the range of 1E-15 std cc He/s using the ultrasensitive leak detector and the superfine leak calibrator.

  4. Deep NuSTAR and Swift Monitoring Observations of the Magnetar 1E 1841-045

    CERN Document Server

    An, Hongjun; Hascoet, Romain; Archibald, Anne M; Beardmore, Andy; Boggs, Steven E; Christensen, Finn E; Craig, William W; Gehrels, Niel; Hailey, Charles J; Harrison, Fiona A; Kennea, Jamie; Kouveliotou, Chryssa; Stern, Daniel; Younes, George; Zhang, William W

    2015-01-01

    We report on a 350-ks NuSTAR observation of the magnetar 1E 1841-045 taken in 2013 September. During the observation, NuSTAR detected six bursts of short duration, with $T_{90}<1$ s. An elevated level of emission tail is detected after the brightest burst, persisting for $\\sim$1 ks. The emission showed a power-law decay with a temporal index of 0.5 before returning to the persistent emission level. The long observation also provided detailed phase-resolved spectra of the persistent X-ray emission of the source. By comparing the persistent spectrum with that previously reported, we find that the source hard-band emission has been stable over approximately 10 years. The persistent hard X-ray emission is well fitted by a coronal outflow model, where $e^{+/-}$ pairs in the magnetosphere upscatter thermal X-rays. Our fit of phase-resolved spectra allowed us to estimate the angle between the rotational and magnetic dipole axes of the magnetar, $\\alpha_{mag}=0.25$, the twisted magnetic flux, $2.5\\times10^{26}\\rm ...

  5. NuSTAR observations of the magnetar 1E 2259+586

    Energy Technology Data Exchange (ETDEWEB)

    Vogel, Julia K.; Craig, William W.; Pivovaroff, Michael J. [Physics Division, Physical and Life Sciences Directorate, Lawrence Livermore National Laboratory, Livermore, CA 94550 (United States); Hascoët, Romain; Beloborodov, Andrei M.; Gotthelf, Eric V.; Hailey, Charles J. [Physics Department and Columbia Astrophysics Laboratory, Columbia University, New York, NY 10027 (United States); Kaspi, Victoria M.; An, Hongjun; Archibald, Robert [Department of Physics, McGill University, Montreal, Quebec H3A 2T8 (Canada); Boggs, Steven E. [Space Sciences Laboratory, University of California, Berkeley, CA 94720 (United States); Christensen, Finn E. [DTU Space, National Space Institute, Technical University of Denmark, Elektrovej 327, DK-2800 Lyngby (Denmark); Grefenstette, Brian W.; Harrison, Fiona A.; Madsen, Kristin K. [Cahill Center for Astronomy and Astrophysics, California Institute of Technology, Pasadena, CA 91125 (United States); Kennea, Jamie A. [Department of Astronomy and Astrophysics, Pennsylvania State University, University Park, PA 16802 (United States); Stern, Daniel [Jet Propulsion Laboratory, California Institute of Technology, Pasadena, CA 91109 (United States); Zhang, William W. [Goddard Space Flight Center, Greenbelt, MD 20771 (United States)

    2014-07-01

    We report on new broad band spectral and temporal observations of the magnetar 1E 2259+586, which is located in the supernova remnant CTB 109. Our data were obtained simultaneously with the Nuclear Spectroscopic Telescope Array (NuSTAR) and Swift, and cover the energy range from 0.5-79 keV. We present pulse profiles in various energy bands and compare them to previous RXTE results. The NuSTAR data show pulsations above 20 keV for the first time and we report evidence that one of the pulses in the double-peaked pulse profile shifts position with energy. The pulsed fraction of the magnetar is shown to increase strongly with energy. Our spectral analysis reveals that the soft X-ray spectrum is well characterized by an absorbed double blackbody or blackbody plus power-law model in agreement with previous reports. Our new hard X-ray data, however, suggest that an additional component, such as a power law, is needed to describe the NuSTAR and Swift spectrum. We also fit the data with the recently developed coronal outflow model by Beloborodov for hard X-ray emission from magnetars. The outflow from a ring on the magnetar surface is statistically preferred over outflow from a polar cap.

  6. NuSTAR Observations of the Magnetar 1E 2259+586

    Science.gov (United States)

    Vogel, Julia K.; Hascoet, Romain; Kaspi, Victoria M.; An, Hongjun; Archibald, Robert; Beloborodov, Andrei M.; Boggs, Steven E.; Christensen, Finn E.; Craig, William W.; Gotthelf, Eric V.; Grefenstette, Brian W.; Hailey, Charles J.; Harrison, Fiona A.; Kennea, Jamie A.; Madsen, Kristin K.; Pivovaroff, Michael J.; Stern, Daniel; Zhang, William W.

    2014-01-01

    We report on new broad band spectral and temporal observations of the magnetar 1E 2259+586, which is located in the supernova remnant CTB 109. Our data were obtained simultaneously with the Nuclear Spectroscopic Telescope Array (NuSTAR) and Swift, and cover the energy range from 0.5-79 keV. We present pulse profiles in various energy bands and compare them to previous RXTE results. The NuSTAR data show pulsations above 20 keV for the first time and we report evidence that one of the pulses in the double-peaked pulse profile shifts position with energy. The pulsed fraction of the magnetar is shown to increase strongly with energy. Our spectral analysis reveals that the soft X-ray spectrum is well characterized by an absorbed double blackbody or blackbody plus power-law model in agreement with previous reports. Our new hard X-ray data, however, suggest that an additional component, such as a power law, is needed to describe the NuSTAR and Swift spectrum. We also fit the data with the recently developed coronal outflow model by Beloborodov for hard X-ray emission from magnetars. The outflow from a ring on the magnetar surface is statistically preferred over outflow from a polar cap.

  7. Structural analysis and evolution of specificity of the SUMO UFD E1-E2 interactions

    Science.gov (United States)

    Liu, Bing; Lois, L. Maria; Reverter, David

    2017-01-01

    SUMO belongs to the ubiquitin-like family (UbL) of protein modifiers. SUMO is conserved among eukaryotes and is essential for the regulation of processes such as DNA damage repair, transcription, DNA replication and mitosis. UbL modification of proteins occurs via a specific enzymatic cascade formed by the crosstalk between the E1-activating enzyme, the E2-conjugating enzyme and the E3-ligase. An essential discrimination step in all UbL modifiers corresponds to the interaction between E1 and E2 enzymes, which is mediated by the recruitment of the E2 to the UFD domain (Ubiquitin-Fold Domain) of the E1 enzyme. To gain insights in the properties of this interface, we have compared the structures of the complexes between E1 UFD domain and E2 in human and yeast, revealing two alternative UFD platforms that interact with a conserved E2. Comparative sequence analysis of the E1 UFD domain indicates that the E2 binding region has been conserved across phylogenetic closely related species, in which higher sequence conservation can be found in the E2 binding region than in the entire UFD domain. These distinctive strategies for E1-E2 interactions through the UFD domain might be the consequence of a high selective pressure to ensure specificity of each modifier conjugation system. PMID:28165030

  8. SPAK and OSR1 Sensitive Cell Membrane Protein Abundance and Activity of KCNQ1/E1 K+ Channels

    Directory of Open Access Journals (Sweden)

    Bernat Elvira

    2015-11-01

    Full Text Available Background/Aims: KCNQ1/E1 channels are expressed in diverse tissues and serve a variety of functions including endolymph secretion in the inner ear, cardiac repolarization, epithelial transport and cell volume regulation. Kinases involved in regulation of epithelial transport and cell volume include SPAK (SPS1-related proline/alanine-rich kinase and OSR1 (oxidative stress-responsive kinase 1, which are under control of WNK (with-no-K[Lys] kinases. The present study explored whether KCNQ1/E1 channels are regulated by SPAK and/or OSR1. Methods: cRNA encoding KCNQ1/E1 was injected into Xenopus oocytes with or without additional injection of cRNA encoding wild-type SPAK, constitutively active T233ESPAK, WNK insensitive T233ASPAK, catalytically inactive D212ASPAK, wild-type OSR1, constitutively active T185EOSR1, WNK insensitive T185AOSR1 and catalytically inactive D164AOSR1. Voltage gated K+ channel activity was quantified utilizing dual electrode voltage clamp and KCNQ1/E1 channel protein abundance in the cell membrane utilizing chemiluminescence of KCNQ1/E1 containing an extracellular Flag tag epitope (KCNQ1-Flag/E1. Results: KCNQ1/E1 activity and KCNQ1-Flag/E1 protein abundance were significantly enhanced by wild-type SPAK and T233ESPAK, but not by T233ASPAK and D212ASPAK. Similarly, KCNQ1/E1 activity and KCNQ1-Flag/E1 protein abundance were significantly increased by wild-type OSR1 and T185EOSR1, but not by T185AOSR1 and D164AOSR1. Conclusions: SPAK and OSR1 participate in the regulation of KCNQ1/E1 protein abundance and activity.

  9. Cluster-lensing: A Python Package for Galaxy Clusters & Miscentering

    OpenAIRE

    Ford, Jes; VanderPlas, Jake

    2016-01-01

    We describe a new open source package for calculating properties of galaxy clusters, including NFW halo profiles with and without the effects of cluster miscentering. This pure-Python package, cluster-lensing, provides well-documented and easy-to-use classes and functions for calculating cluster scaling relations, including mass-richness and mass-concentration relations from the literature, as well as the surface mass density $\\Sigma(R)$ and differential surface mass density $\\Delta\\Sigma(R)$...

  10. In Silico Prediction of Human Sulfotransferase 1E1 Activity Guided by Pharmacophores from Molecular Dynamics Simulations.

    Science.gov (United States)

    Rakers, Christin; Schumacher, Fabian; Meinl, Walter; Glatt, Hansruedi; Kleuser, Burkhard; Wolber, Gerhard

    2016-01-01

    Acting during phase II metabolism, sulfotransferases (SULTs) serve detoxification by transforming a broad spectrum of compounds from pharmaceutical, nutritional, or environmental sources into more easily excretable metabolites. However, SULT activity has also been shown to promote formation of reactive metabolites that may have genotoxic effects. SULT subtype 1E1 (SULT1E1) was identified as a key player in estrogen homeostasis, which is involved in many physiological processes and the pathogenesis of breast and endometrial cancer. The development of an in silico prediction model for SULT1E1 ligands would therefore support the development of metabolically inert drugs and help to assess health risks related to hormonal imbalances. Here, we report on a novel approach to develop a model that enables prediction of substrates and inhibitors of SULT1E1. Molecular dynamics simulations were performed to investigate enzyme flexibility and sample protein conformations. Pharmacophores were developed that served as a cornerstone of the model, and machine learning techniques were applied for prediction refinement. The prediction model was used to screen the DrugBank (a database of experimental and approved drugs): 28% of the predicted hits were reported in literature as ligands of SULT1E1. From the remaining hits, a selection of nine molecules was subjected to biochemical assay validation and experimental results were in accordance with the in silico prediction of SULT1E1 inhibitors and substrates, thus affirming our prediction hypotheses.

  11. AKT1E17K Is Oncogenic in Mouse Lung and Cooperates with Chemical Carcinogens in Inducing Lung Cancer

    Science.gov (United States)

    Malanga, Donatella; Belmonte, Stefania; Colelli, Fabiana; Scarfò, Marzia; De Marco, Carmela; Oliveira, Duarte Mendes; Mirante, Teresa; Camastra, Caterina; Gagliardi, Monica; Rizzuto, Antonia; Mignogna, Chiara; Paciello, Orlando; Papparella, Serenella; Fagman, Henrik; Viglietto, Giuseppe

    2016-01-01

    The hotspot AKT1E17K mutation in the pleckstrin homology domain of AKT1 occurs in approximately 0.6–2% of human lung cancers. Recently, we have demonstrated that AKT1E17K transforms immortalized human bronchial cells. Here by use of a transgenic Cre-inducible murine strain in the wild type Rosa26 (R26) locus (R26-AKT1E17K mice) we demonstrate that AKT1E17K is a bona-fide oncogene and plays a role in the development of lung cancer in vivo. In fact, we report that mutant AKT1E17K induces bronchial and/or bronchiolar hyperplastic lesions in murine lung epithelium, which progress to frank carcinoma at very low frequency, and accelerates tumor formation induced by chemical carcinogens. In conclusion, AKT1E17K induces hyperplasia of mouse lung epithelium in vivo and cooperates with urethane to induce the fully malignant phenotype. PMID:26859676

  12. The rotation of Galaxy Clusters

    CERN Document Server

    Tovmassian, Hrant M

    2015-01-01

    The method for detection of the galaxy cluster rotation based on the study of distribution of member galaxies with velocities lower and higher of the cluster mean velocity over the cluster image is proposed. The search for rotation is made for flat clusters with $a/b>1.8$ and BMI type clusters which are expected to be rotating. For comparison there were studied also round clusters and clusters of NBMI type, the second by brightness galaxy in which does not differ significantly from the cluster cD galaxy. Seventeen out of studied 65 clusters are found to be rotating. It was found that the detection rate is sufficiently high for flat clusters, over 60\\%, and clusters of BMI type with dominant cD galaxy, ~ 35%. The obtained results show that clusters were formed from the huge primordial gas clouds and preserved the rotation of the primordial clouds, unless they did not have merging with other clusters and groups of galaxies, in the result of which the rotation has been prevented.

  13. Photoionization of rare gas clusters

    Science.gov (United States)

    Zhang, Huaizhen

    This thesis concentrates on the study of photoionization of van der Waals clusters with different cluster sizes. The goal of the experimental investigation is to understand the electronic structure of van der Waals clusters and the electronic dynamics. These studies are fundamental to understand the interaction between UV-X rays and clusters. The experiments were performed at the Advanced Light Source at Lawrence Berkeley National Laboratory. The experimental method employs angle-resolved time-of-flight photoelectron spectrometry, one of the most powerful methods for probing the electronic structure of atoms, molecules, clusters and solids. The van der Waals cluster photoionization studies are focused on probing the evolution of the photoelectron angular distribution parameter as a function of photon energy and cluster size. The angular distribution has been known to be a sensitive probe of the electronic structure in atoms and molecules. However, it has not been used in the case of van der Waals clusters. We carried out outer-valence levels, inner-valence levels and core-levels cluster photoionization experiments. Specifically, this work reports on the first quantitative measurements of the angular distribution parameters of rare gas clusters as a function of average cluster sizes. Our findings for xenon clusters is that the overall photon-energy-dependent behavior of the photoelectrons from the clusters is very similar to that of the corresponding free atoms. However, distinct differences in the angular distribution point at cluster-size-dependent effects were found. For krypton clusters, in the photon energy range where atomic photoelectrons have a high angular anisotropy, our measurements show considerably more isotropic angular distributions for the cluster photoelectrons, especially right above the 3d and 4p thresholds. For the valence electrons, a surprising difference between the two spin-orbit components was found. For argon clusters, we found that the

  14. Single-cluster dynamics for the random-cluster model

    NARCIS (Netherlands)

    Deng, Y.; Qian, X.; Blöte, H.W.J.

    2009-01-01

    We formulate a single-cluster Monte Carlo algorithm for the simulation of the random-cluster model. This algorithm is a generalization of the Wolff single-cluster method for the q-state Potts model to noninteger values q>1. Its results for static quantities are in a satisfactory agreement with those

  15. Eclipsing binaries in open clusters

    DEFF Research Database (Denmark)

    Southworth, John; Clausen, J.V.

    2006-01-01

    Stars: fundamental parameters - Stars : binaries : eclipsing - Stars: Binaries: spectroscopic - Open clusters and ass. : general Udgivelsesdato: 5 August......Stars: fundamental parameters - Stars : binaries : eclipsing - Stars: Binaries: spectroscopic - Open clusters and ass. : general Udgivelsesdato: 5 August...

  16. Cluster Based Text Classification Model

    DEFF Research Database (Denmark)

    Nizamani, Sarwat; Memon, Nasrullah; Wiil, Uffe Kock

    2011-01-01

    We propose a cluster based classification model for suspicious email detection and other text classification tasks. The text classification tasks comprise many training examples that require a complex classification model. Using clusters for classification makes the model simpler and increases...

  17. Chemical evolution of star clusters

    CERN Document Server

    van Loon, Jacco Th

    2009-01-01

    I discuss the chemical evolution of star clusters, with emphasis on old globular clusters, in relation to their formation histories. Globular clusters clearly formed in a complex fashion, under markedly different conditions from any younger clusters presently known. Those special conditions must be linked to the early formation epoch of the Galaxy and must not have occurred since. While a link to the formation of globular clusters in dwarf galaxies has been suggested, present-day dwarf galaxies are not representative of the gravitational potential wells within which the globular clusters formed. Instead, a formation deep within the proto-Galaxy or within dark-matter minihaloes might be favoured. Not all globular clusters may have formed and evolved similarly. In particular, we may need to distinguish Galactic halo from Galactic bulge clusters.

  18. Nuclear Cluster Aspects in Astrophysics

    Science.gov (United States)

    Kubono, Shigeru

    2010-03-01

    The role of nuclear clustering is discussed for nucleosynthesis in stellar evolution with Cluster Nucleosynthesis Diagram (CND) proposed before. Special emphasis is placed on α-induced stellar reactions together with molecular states for O and C burning.

  19. Radio observations of Planck clusters

    CERN Document Server

    Kale, Ruta

    2012-01-01

    Recently, a number of new galaxy clusters have been detected by the ESA-Planck satellite, the South Pole Telescope and the Atacama Cosmology Telescope using the Sunyaev-Zeldovich effect. Several of the newly detected clusters are massive, merging systems with disturbed morphology in the X-ray surface brightness. Diffuse radio sources in clusters, called giant radio halos and relics, are direct probes of cosmic rays and magnetic fields in the intra-cluster medium. These radio sources are found to occur mainly in massive merging clusters. Thus, the new SZ-discovered clusters are good candidates to search for new radio halos and relics. We have initiated radio observations of the clusters detected by Planck with the Giant Metrewave Radio Telescope. These observations have already led to the detection of a radio halo in PLCKG171.9-40.7, the first giant halo discovered in one of the new Planck clusters.

  20. Hierarchical Formation of Galactic Clusters

    CERN Document Server

    Elmegreen, B G

    2006-01-01

    Young stellar groupings and clusters have hierarchical patterns ranging from flocculent spiral arms and star complexes on the largest scale to OB associations, OB subgroups, small loose groups, clusters and cluster subclumps on the smallest scales. There is no obvious transition in morphology at the cluster boundary, suggesting that clusters are only the inner parts of the hierarchy where stars have had enough time to mix. The power-law cluster mass function follows from this hierarchical structure: n(M_cl) M_cl^-b for b~2. This value of b is independently required by the observation that the summed IMFs from many clusters in a galaxy equals approximately the IMF of each cluster.

  1. Observations of Distant Clusters

    Science.gov (United States)

    Donahue, Megan

    2004-01-01

    The is the proceedings and papers supported by the LTSA grant: Homer, D. J.\\& Donahue, M. 2003, in "The Emergence of Cosmic Structure": 13'h Astrophysics Conference Proceedings, Vol. 666,3 1 1-3 14, (AIP). Baumgartner, W. H., Loewenstein, M., Horner, D. J., Mushotzky, R. F. 2003, HEAD- AAS, 35.3503. Homer, D. J. , Donahue, M., Voit G. M. 2003, HEAD-AAS, 35.1309. Nowak, M. A., Smith, B., Donahue, M., Stocke, J. 2003, HEAD-AAS, 35.1316. Scott, D., Borys, C., Chapman, S. C., Donahue, M., Fahlman, G. G., Halpem, M. Newbury, P. 2002, AAS, 128.01. Jones, L. R. et al. 2002, A new era in cosmology, ASP Conference Proceedings, Vol. 283, p. 223 Donahue, M., Daly, R. A., Homer, D. J. 2003, ApJ, 584, 643, Constraints on the Cluster Environments and Hotspot magnetic field strengths for radio sources 3280 and 3254. Donahue, M., et al. 2003, ApJ, 598, 190. The mass, baryonic fraction, and x-ray temperature of the luminous, high-redshift cluster of galaxies MS045 1.6-0305 Perlman, E. S. et al. 2002, ApJS, 140, 256. Smith, B. J., Nowak, M., Donahue, M., Stocke, J. 2003, AJ, 126, 1763. Chandra Observations of the Interacting NGC44 10 Group of Galaxies. Postman, M., Lauer, T. R., Oegerle, W., Donahue, M. 2002, ApJ, 579, 93. The KPNO/deep-range cluster survey I. The catalog and space density of intermediate-redshift clusters. Molnar, S. M., Hughes, J. P., Donahue, M., Joy, M. 2002, ApJ, 573, L91, Chandra Observations of Unresolved X-Ray Sources around Two Clusters of Galaxies. Donahue, M., Mack, J., 2002 NewAR, 46, 155, HST NIcmos and WFPC2 observations of molecular hydrogen and dust around cooling flows. Koekemoer, A. M. et al. 2002 NewAR, 46, 149, Interactions between the A2597 central radio source and dense gas host galaxy. Donahue, M. et al. 2002 ApJ, 569,689, Distant cluster hunting II.

  2. New Limits On Gamma-Ray Emission From Galaxy Clusters

    CERN Document Server

    Griffin, Rhiannon D; Kochanek, Christopher S

    2014-01-01

    Galaxy clusters are predicted to produce gamma-rays through cosmic ray interactions and/or dark matter annihilation, potentially detectable by the Fermi Large Area Telescope (Fermi-LAT). We present a new, independent stacking analysis of Fermi-LAT photon count maps using the 79 richest nearby clusters (z<0.12) from the Two Micron All-Sky Survey (2MASS) cluster catalog. We obtain the lowest limit on the photon flux to date, 1.1e-11 ph/s/cm^2 (95% confidence) per cluster in the 0.8--100~GeV band, which corresponds to a luminosity limit of 1.7e44 ph/s. We also constrain the emission limits in a range of narrower energy bands. Scaling to recent cosmic ray acceleration and gamma-ray emission models, we find that cosmic rays represent a negligible contribution to the intra-cluster energy density and gas pressure. Furthermore, either accretion shocks must have lower Mach numbers than usually assumed (2--4) or significantly less than 50% of the baryon mass has been processed through such shocks, and thus, the majo...

  3. Practical Introduction to Clustering Data

    CERN Document Server

    Hartmann, Alexander K

    2016-01-01

    Data clustering is an approach to seek for structure in sets of complex data, i.e., sets of "objects". The main objective is to identify groups of objects which are similar to each other, e.g., for classification. Here, an introduction to clustering is given and three basic approaches are introduced: the k-means algorithm, neighbour-based clustering, and an agglomerative clustering method. For all cases, C source code examples are given, allowing for an easy implementation.

  4. Textile Industrial Clusters in China

    Institute of Scientific and Technical Information of China (English)

    Nie Ting

    2010-01-01

    @@ "National Textile Industry Cluster Development Seminar" convened,held by China National Textile and Apparel Council,23 cities and towns were awarded as China's Textile Industry Cluster Pilot District.By far,China's textile industrial clusters have grown to 164,which indicate a quick and gorgeous development.These textile industrial clusters have a great impact on the local economy and even the whole national textile industry's development.

  5. The Assembly of Galaxy Clusters

    Energy Technology Data Exchange (ETDEWEB)

    Berrier, Joel C.; Stewart, Kyle R.; Bullock, James S.; Purcell, Chris W.; Barton, Elizabeth J.; Wechsler, Risa H.

    2008-05-16

    We study the formation of fifty-three galaxy cluster-size dark matter halos (M = 10{sup 14.0-14.76} M{sub {circle_dot}}) formed within a pair of cosmological {Lambda}CDM N-body simulations, and track the accretion histories of cluster subhalos with masses large enough to host {approx} 0.1L{sub *} galaxies. By associating subhalos with cluster galaxies, we find the majority of galaxies in clusters experience no 'pre-processing' in the group environment prior to their accretion into the cluster. On average, {approx} 70% of cluster galaxies fall into the cluster potential directly from the field, with no luminous companions in their host halos at the time of accretion; and less than {approx} 12% are accreted as members of groups with five or more galaxies. Moreover, we find that cluster galaxies are significantly less likely to have experienced a merger in the recent past ({approx}< 6 Gyr) than a field halo of the same mass. These results suggest that local, cluster processes like ram-pressure stripping, galaxy harassment, or strangulation play the dominant role in explaining the difference between cluster and field populations at a fixed stellar mass; and that pre-evolution or past merging in the group environment is of secondary importance for setting cluster galaxy properties for most clusters. The accretion times for z = 0 cluster members are quite extended, with {approx} 20% incorporated into the cluster halo more than 7 Gyr ago and {approx} 20% within the last 2 Gyr. By comparing the observed morphological fractions in cluster and field populations, we estimate an approximate time-scale for late-type to early-type transformation within the cluster environment to be {approx} 6 Gyr.

  6. Massive star clusters in galaxies

    CERN Document Server

    Harris, William E

    2009-01-01

    The ensemble of all star clusters in a galaxy constitutes its star cluster system. In this review, the focus of the discussion is on the ability of star clusters, particularly the systems of old massive globular clusters (GCSs), to mark the early evolutionary history of galaxies. I review current themes and key findings in GCS research, and highlight some of the outstanding questions that are emerging from recent work.

  7. NuSTAR observations of magnetar 1E 1841–045

    Energy Technology Data Exchange (ETDEWEB)

    An, Hongjun; Kaspi, Victoria M.; Dufour, François; Archibald, Robert [Department of Physics, McGill University, Montreal, Quebec H3A 2T8 (Canada); Hascoët, Romain; Beloborodov, Andrei M.; Gotthelf, Eric V.; Hailey, Charles J. [Columbia Astrophysics Laboratory, Columbia University, New York, NY 10027 (United States); Bachetti, Matteo [Université de Toulouse, UPS-OMP, IRAP, Toulouse (France); Boggs, Steven E.; Craig, William W. [Space Sciences Laboratory, University of California, Berkeley, CA 94720 (United States); Christensen, Finn E. [DTU Space, National Space Institute, Technical University of Denmark, Elektrovej 327, DK-2800 Lyngby (Denmark); Greffenstette, Brian W.; Harrison, Fiona A.; Madsen, Kristin K. [Cahill Center for Astronomy and Astrophysics, California Institute of Technology, Pasadena, CA 91125 (United States); Kitaguchi, Takao [RIKEN, 2-1 Hirosawa, Wako, Saitama 351-0198 (Japan); Kouveliotou, Chryssa [Space Science Office, ZP12, NASA Marshall Space Flight Center, Huntsville, AL 35812 (United States); Markwardt, Craig B. [Goddard Space Flight Center, Greenbelt, MD 20771 (United States); Stern, Daniel [Jet Propulsion Laboratory, California Institute of Technology, Pasadena, CA 91109 (United States); Vogel, Julia K. [Lawrence Livermore National Laboratory, Livermore, CA 94550 (United States); and others

    2013-12-20

    We report new spectral and temporal observations of the magnetar 1E 1841–045 in the Kes 73 supernova remnant obtained with the Nuclear Spectroscopic Telescope Array. Combined with new Swift and archival XMM-Newton and Chandra observations, the phase-averaged spectrum is well characterized by a blackbody plus double power law, in agreement with previous multimission X-ray results. However, we are unable to reproduce the spectral results reported based on Suzaku observations. The pulsed fraction of the source is found to increase with photon energy. The measured rms pulsed fractions are ∼12% and ∼17% at ∼20 and ∼50 keV, respectively. We detect a new feature in the 24-35 keV band pulse profile that is uniquely double peaked. This feature may be associated with a possible absorption or emission feature in the phase-resolved spectrum. We fit the X-ray data using the recently developed electron-positron outflow model by Beloborodov for the hard X-ray emission from magnetars. This produces a satisfactory fit, allowing a constraint on the angle between the rotation and magnetic axes of the neutron star of ∼20° and on the angle between the rotation axis and line of sight of ∼50°. In this model, the soft X-ray component is inconsistent with a single blackbody; adding a second blackbody or a power-law component fits the data. The two-blackbody interpretation suggests a hot spot of temperature kT ≈ 0.9 keV occupying ∼1% of the stellar surface.

  8. On clusters and clustering from atoms to fractals

    CERN Document Server

    Reynolds, PJ

    1993-01-01

    This book attempts to answer why there is so much interest in clusters. Clusters occur on all length scales, and as a result occur in a variety of fields. Clusters are interesting scientifically, but they also have important consequences technologically. The division of the book into three parts roughly separates the field into small, intermediate, and large-scale clusters. Small clusters are the regime of atomic and molecular physics and chemistry. The intermediate regime is the transitional regime, with its characteristics including the onset of bulk-like behavior, growth and aggregation, a

  9. Uncertainties in the cluster-cluster correlation function

    Energy Technology Data Exchange (ETDEWEB)

    Ling, E.N.; Barrow, J.D.; Frenk, C.S.

    1986-12-01

    The bootstrap resampling technique is applied to estimate sampling errors and significance levels of the two-point correlation functions determined for a subset of the CfA redshift survey of galaxies and a redshift sample of 104 Abell clusters. The angular correlation functions is also calculated for a sample of 1664 Abell clusters. The standard errors for the Abell data are found to be considerably larger than quoted 'Poisson errors'. The enhancement of cluster clustering over galaxy clustering is statistically significant in the presence of resampling errors.

  10. Recovery Rate of Clustering Algorithms

    NARCIS (Netherlands)

    Li, Fajie; Klette, Reinhard; Wada, T; Huang, F; Lin, S

    2009-01-01

    This article provides a simple and general way for defining the recovery rate of clustering algorithms using a given family of old clusters for evaluating the performance of the algorithm when calculating a family of new clusters. Under the assumption of dealing with simulated data (i.e., known old

  11. Geographic Projection of Cluster Composites

    NARCIS (Netherlands)

    Nerbonne, J.; Bosveld-de Smet, L.M.; Kleiweg, P.; Blackwell, A.; Marriott, K.; Shimojima, A.

    2004-01-01

    A composite cluster map displays a fuzzy categorisation of geographic areas. It combines information from several sources to provide a visualisation of the significance of cluster borders. The basic technique renders the chance that two neighbouring locations are members of different clusters as the

  12. Privacy-preserving distributed clustering

    NARCIS (Netherlands)

    Erkin, Z.; Veugen, T.; Toft, T.; Lagendijk, R.L.

    2013-01-01

    Clustering is a very important tool in data mining and is widely used in on-line services for medical, financial and social environments. The main goal in clustering is to create sets of similar objects in a data set. The data set to be used for clustering can be owned by a single entity, or in some

  13. Stellar populations in star clusters

    Science.gov (United States)

    Li, Cheng-Yuan; de Grijs, Richard; Deng, Li-Cai

    2016-12-01

    Stellar populations contain the most important information about star cluster formation and evolution. Until several decades ago, star clusters were believed to be ideal laboratories for studies of simple stellar populations (SSPs). However, discoveries of multiple stellar populations in Galactic globular clusters have expanded our view on stellar populations in star clusters. They have simultaneously generated a number of controversies, particularly as to whether young star clusters may have the same origin as old globular clusters. In addition, extensive studies have revealed that the SSP scenario does not seem to hold for some intermediate-age and young star clusters either, thus making the origin of multiple stellar populations in star clusters even more complicated. Stellar population anomalies in numerous star clusters are well-documented, implying that the notion of star clusters as true SSPs faces serious challenges. In this review, we focus on stellar populations in massive clusters with different ages. We present the history and progress of research in this active field, as well as some of the most recent improvements, including observational results and scenarios that have been proposed to explain the observations. Although our current ability to determine the origin of multiple stellar populations in star clusters is unsatisfactory, we propose a number of promising projects that may contribute to a significantly improved understanding of this subject.

  14. Clustering Objects from Multiple Collections

    NARCIS (Netherlands)

    Hollink, V.; Someren, M. van; Boer, V. de

    2009-01-01

    Clustering methods cluster objects on the basis of a similarity measure between the objects. In clustering tasks where the objects come from more than one collection often part of the similarity results from features that are related to the collections rather than features that are relevant for the

  15. Clustering objects from multiple collections

    NARCIS (Netherlands)

    Hollink, V.; van Someren, M.; de Boer, V.

    2009-01-01

    Clustering methods cluster objects on the basis of a similarity measure between the objects. In clustering tasks where the objects come from more than one collection often part of the similarity results from features that are related to the collections rather than features that are relevant for the

  16. Outskirts of Galaxy Clusters

    CERN Document Server

    Reiprich, Thomas H; Ettori, Stefano; Israel, Holger; Lovisari, Lorenzo; Molendi, Silvano; Pointecouteau, Etienne; Roncarelli, Mauro

    2013-01-01

    Until recently, only about 10% of the total intracluster gas volume had been studied with high accuracy, leaving a vast region essentially unexplored. This is now changing and a wide area of hot gas physics and chemistry awaits discovery in galaxy cluster outskirts. Also, robust large-scale total mass profiles and maps are within reach. First observational and theoretical results in this emerging field have been achieved in recent years with sometimes surprising findings. Here, we summarize and illustrate the relevant underlying physical and chemical processes and review the recent progress in X-ray, Sunyaev--Zel'dovich, and weak gravitational lensing observations of cluster outskirts, including also brief discussions of technical challenges and possible future improvements.

  17. Refractory chronic cluster headache

    DEFF Research Database (Denmark)

    Mitsikostas, Dimos D; Edvinsson, Lars; Jensen, Rigmor H

    2014-01-01

    Chronic cluster headache (CCH) often resists to prophylactic pharmaceutical treatments resulting in patients' life damage. In this rare but pragmatic situation escalation to invasive management is needed but framing criteria are lacking. We aimed to reach a consensus for refractory CCH definition...... for clinical and research use. The preparation of the final consensus followed three stages. Internal between authors, a larger between all European Headache Federation members and finally an international one among all investigators that have published clinical studies on cluster headache the last five years....... Eighty-five investigators reached by email. Proposed criteria were in the format of the International Classification of Headache Disorders III-beta (description, criteria, notes, comments and references). Following this evaluation eight drafts were prepared before the final. Twenty-four (28...

  18. Are megaquakes clustered?

    CERN Document Server

    Daub, Eric G; Guyer, Robert A; Johnson, Paul A

    2012-01-01

    We study statistical properties of the number of large earthquakes over the past century. We analyze the cumulative distribution of the number of earthquakes with magnitude larger than threshold M in time interval T, and quantify the statistical significance of these results by simulating a large number of synthetic random catalogs. We find that in general, the earthquake record cannot be distinguished from a process that is random in time. This conclusion holds whether aftershocks are removed or not, except at magnitudes below M = 7.3. At long time intervals (T = 2-5 years), we find that statistically significant clustering is present in the catalog for lower magnitude thresholds (M = 7-7.2). However, this clustering is due to a large number of earthquakes on record in the early part of the 20th century, when magnitudes are less certain.

  19. CSNK1E/CTNNB1 Are Synthetic Lethal To TP53 in Colorectal Cancer and Are Markers for Prognosis

    Directory of Open Access Journals (Sweden)

    Khong-Loon Tiong

    2014-05-01

    Full Text Available Two genes are called synthetic lethal (SL if their simultaneous mutations lead to cell death, but each individual mutation does not. Targeting SL partners of mutated cancer genes can kill cancer cells specifically, but leave normal cells intact. We present an integrated approach to uncovering SL pairs in colorectal cancer (CRC. Screening verified SL pairs using microarray gene expression data of cancerous and normal tissues, we first identified potential functionally relevant (simultaneously differentially expressed gene pairs. From the top-ranked pairs, ~20 genes were chosen for immunohistochemistry (IHC staining in 171 CRC patients. To find novel SL pairs, all 169 combined pairs from the individual IHC were synergistically correlated to five clinicopathological features, e.g. overall survival. Of the 11 predicted SL pairs, MSH2-POLB and CSNK1E-MYC were consistent with literature, and we validated the top two pairs, CSNK1E-TP53 and CTNNB1-TP53 using RNAi knockdown and small molecule inhibitors of CSNK1E in isogenic HCT-116 and RKO cells. Furthermore, synthetic lethality of CSNK1E and TP53 was verified in mouse model. Importantly, multivariate analysis revealed that CSNK1E-P53, CTNNB1-P53, MSH2-RB1, and BRCA1-WNT5A were independent prognosis markers from stage, with CSNK1E-P53 applicable to early-stage and the remaining three throughout all stages. Our findings suggest that CSNK1E is a promising target for TP53-mutant CRC patients which constitute ~40% to 50% of patients, while to date safety regarding inhibition of TP53 is controversial. Thus the integrated approach is useful in finding novel SL pairs for cancer therapeutics, and it is readily accessible and applicable to other cancers.

  20. Astrophysics of galaxy clusters

    Science.gov (United States)

    Ettori, Stefano

    2016-07-01

    As the nodes of the cosmic web, clusters of galaxies trace the large-scale distribution of matter in the Universe. They are thus privileged sites in which to investigate the complex physics of structure formation. However, the complete story of how these structures grow, and how they dissipate the gravitational and non-thermal components of their energy budget over cosmic time, is still beyond our grasp. Most of the baryons gravitationally bound to the cluster's halo is in the form of a diffuse, hot, metal-enriched plasma that radiates primarily in the X-ray band. X-ray observations of the evolving cluster population provide a unique opportunity to address such fundamental open questions as: How do hot diffuse baryons accrete and dynamically evolve in dark matter potentials? How and when was the energy that we observe in the ICM generated and distributed? Where and when are heavy elements produced and how are they circulated? We will present the ongoing activities to define the strategy on how an X-ray observatory with large collecting area and an unprecedented combination of high spectral and angular resolution, such as Athena, can address these questions.

  1. Support Policies in Clusters: Prioritization of Support Needs by Cluster Members According to Cluster Life Cycle

    Directory of Open Access Journals (Sweden)

    Gulcin Salıngan

    2012-07-01

    Full Text Available Economic development has always been a moving target. Both the national and local governments have been facing the challenge of implementing the effective and efficient economic policy and program in order to best utilize their limited resources. One of the recent approaches in this area is called cluster-based economic analysis and strategy development. This study reviews key literature and some of the cluster based economic policies adopted by different governments. Based on this review, it proposes “the cluster life cycle” as a determining factor to identify the support requirements of clusters. A survey, designed based on literature review of International Cluster support programs, was conducted with 30 participants from 3 clusters with different maturity stage. This paper discusses the results of this study conducted among the cluster members in Eskişehir- Bilecik-Kütahya Region in Turkey on the requirement of the support to foster the development of related clusters.

  2. Hipax Cluster PACS Server

    Directory of Open Access Journals (Sweden)

    Ramin Payrovi

    2007-08-01

    Full Text Available Best Performace: With our Hipax Cluster PACS Server solution we are introducing the parallel computing concept as an extremely fast software system to the PACS world. In contrast to the common PACS servers, the Hipax Cluster PACS software is not only restricted to one or two computers, but can be used on a couple of servers controlling each other."nThus, the same services can be run simultaneously on different computers. The scalable system can also be expanded subsequently without lost of per-formance by adding further processors or Hipax server units, for example, if new clients or modalities are to be connected."nMaximum Failure Security: The Cluster Server concept offers high failure security. If one of the server PCs breaks down, the services can be assumed by another Hipax server unit, temporarily. If the overload of one of the server PCs is imminent, the services will be carried out by another Hipax unit (load balancing. To increase the security, e.g. against fire, the single Hipax servers can also be located separately. This concept offers maximum security, flexibility, performance, redundancy and scalability."nThe Hipax Cluster PACS Server is easy to be administrated using a web interface. In the case of a system failure (e.g. overloading, breakdown of a server PC the system administrator receives a mes-sage via Email and is so enabled to solve the problem."nFeatures"n• Based on SQL database"n• Different services running on separate PCs"n• The Hipax Server unis are coordinated and able to control each other"n• Exponentiates the power of a cluster server to the whole PACS (more processors"n• Scalable to the demands"n• Maximum performance"n• Load balancing for optimum efficiency"n• Maximum failure security because of expo-nentiated redundancy"n• Warning Email automatically sent to the system administrator in the case of failure"n• Web interface for system configuration"n• Maintenance without shut down the system

  3. Tune Your Brown Clustering, Please

    DEFF Research Database (Denmark)

    Derczynski, Leon; Chester, Sean; Bøgh, Kenneth Sejdenfaden

    2015-01-01

    unexplored. Accordingly, we present information for practitioners on the behaviour of Brown clustering in order to assist hyper-parametre tuning, in the form of a theoretical model of Brown clustering utility. This model is then evaluated empirically in two sequence labelling tasks over two text types. We...... explore the dynamic between the input corpus size, chosen number of classes, and quality of the resulting clusters, which has an impact for any approach using Brown clustering. In every scenario that we examine, our results reveal that the values most commonly used for the clustering are sub-optimal....

  4. Garlic extract diallyl sulfide (DAS activates nuclear receptor CAR to induce the Sult1e1 gene in mouse liver.

    Directory of Open Access Journals (Sweden)

    Tatsuya Sueyoshi

    Full Text Available Constituent chemicals in garlic extract are known to induce phase I and phase II enzymes in rodent livers. Here we have utilized Car(+/+ and Car(-/- mice to demonstrate that the nuclear xenobiotic receptor CAR regulated the induction of the estrogen sulfotransferase Sult1e1 gene by diallyl sulfide (DAS treatment in mouse liver. DAS treatment caused CAR accumulation in the nucleus, resulting in a remarkable increase of SULT1E1 mRNA (3,200 fold and protein in the livers of Car(+/+ females but not of Car(-/- female mice. DAS also induced other CAR-regulated genes such as Cyp2b10, Cyp3a11 and Gadd45β. Compared with the rapid increase of these mRNA levels, which began as early as 6 hours after DAS treatment, the levels of SULT1E1 mRNA began increasing after 24 hours. This slow response to DAS suggested that CAR required an additional factor to activate the Sult1e1 gene or that this activation was indirect. Despite the remarkable induction of SULT1E1, there was no decrease in the serum levels of endogenous E2 or increase of estrone sulfate while the clearance of exogenously administrated E2 was accelerated in DAS treated mice.

  5. Stellar Snowflake Cluster

    Science.gov (United States)

    2005-01-01

    [figure removed for brevity, see original site] Figure 1 Stellar Snowflake Cluster Combined Image [figure removed for brevity, see original site] Figure 2 Infrared Array CameraFigure 3 Multiband Imaging Photometer Newborn stars, hidden behind thick dust, are revealed in this image of a section of the Christmas Tree cluster from NASA's Spitzer Space Telescope, created in joint effort between Spitzer's infrared array camera and multiband imaging photometer instruments. The newly revealed infant stars appear as pink and red specks toward the center of the combined image (fig. 1). The stars appear to have formed in regularly spaced intervals along linear structures in a configuration that resembles the spokes of a wheel or the pattern of a snowflake. Hence, astronomers have nicknamed this the 'Snowflake' cluster. Star-forming clouds like this one are dynamic and evolving structures. Since the stars trace the straight line pattern of spokes of a wheel, scientists believe that these are newborn stars, or 'protostars.' At a mere 100,000 years old, these infant structures have yet to 'crawl' away from their location of birth. Over time, the natural drifting motions of each star will break this order, and the snowflake design will be no more. While most of the visible-light stars that give the Christmas Tree cluster its name and triangular shape do not shine brightly in Spitzer's infrared eyes, all of the stars forming from this dusty cloud are considered part of the cluster. Like a dusty cosmic finger pointing up to the newborn clusters, Spitzer also illuminates the optically dark and dense Cone nebula, the tip of which can be seen towards the bottom left corner of each image. This combined image shows the presence of organic molecules mixed with dust as wisps of green, which have been illuminated by nearby star formation. The larger yellowish dots neighboring the baby red stars in the Snowflake Cluster are massive stellar infants forming from the same cloud. The blue dots

  6. Clustering Methodologies for Software Engineering

    Directory of Open Access Journals (Sweden)

    Mark Shtern

    2012-01-01

    Full Text Available The size and complexity of industrial strength software systems are constantly increasing. This means that the task of managing a large software project is becoming even more challenging, especially in light of high turnover of experienced personnel. Software clustering approaches can help with the task of understanding large, complex software systems by automatically decomposing them into smaller, easier-to-manage subsystems. The main objective of this paper is to identify important research directions in the area of software clustering that require further attention in order to develop more effective and efficient clustering methodologies for software engineering. To that end, we first present the state of the art in software clustering research. We discuss the clustering methods that have received the most attention from the research community and outline their strengths and weaknesses. Our paper describes each phase of a clustering algorithm separately. We also present the most important approaches for evaluating the effectiveness of software clustering.

  7. Optical radii of galaxy clusters

    CERN Document Server

    Girardi, M; Giuricin, G; Mardirossian, F; Mezzetti, M; Girardi, M; Biviano, A; Giuricin, G; Mardirossian, F; Mezzetti, M

    1994-01-01

    We analyze the density profiles and virial radii for a sample of 90 nearby clusters, using galaxies with available redshifts and positions. Each cluster has at least 20 redshifts measured within an Abell radius, and all the results come from galaxy sets of at least 20 members. Most of the density profiles of our clusters are well fitted by hydrostatic-isothermal-like profiles. The slopes we find for many cluster density profiles are consistent with the hypothesis that the galaxies are in equilibrium with the binding cluster potential. The virial radii correlate with the core radii at a very high significance level. The observed relationship between the two size estimates is in agreement with the theoretical one computed by using the median values of the density profile parameters fitted on our clusters. After correcting for incompleteness in our cluster sample, we provide the universal distributions functions of core and virial radii (obtained within half an Abell radius).

  8. Web Fuzzy Clustering and a Case Study

    Institute of Scientific and Technical Information of China (English)

    LIU Mao-fu; HE Jing; HE Yan-xiang; HU Hui-jun

    2004-01-01

    We combine the web usage mining and fuzzy clustering and give the concept of web fuzzy clustering, and then put forward the web fuzzy clustering processing model which is discussed in detail. Web fuzzy clustering can be used in the web users clustering and web pages clustering. In the end, a case study is given and the result has proved the feasibility of using web fuzzy clustering in web pages clustering.

  9. OS EFEITOS DO EXERCÍCIO AERÓBICO NO TRATAMENTO DO DIABETES MELLITUS TIPOS 1 E 2

    OpenAIRE

    da Silva Neto, João Henrique; Ex-aluno do Centro Universitário La Salle; Marques Toigo, Adriana

    2013-01-01

    O objetivo desse estudo foi revisar na literatura os efeitos do exercício aeróbico (especialmente na modalidade de dança) no tratamento do diabetes mellitus tipo 1 e tipo 2, apresentando resultados obtidos em pesquisa nacionais e internacionais. Inicialmente foram abordados aspectos conceituais sobre o diabetes mellitus tipos 1 e 2. Em seguida, verificou-se como o exercício aeróbico vem sendo utilizado como tratamento do diabetes e quais são seus benefícios em relação aos índices glicêmicos e...

  10. Hadoop cluster deployment

    CERN Document Server

    Zburivsky, Danil

    2013-01-01

    This book is a step-by-step tutorial filled with practical examples which will show you how to build and manage a Hadoop cluster along with its intricacies.This book is ideal for database administrators, data engineers, and system administrators, and it will act as an invaluable reference if you are planning to use the Hadoop platform in your organization. It is expected that you have basic Linux skills since all the examples in this book use this operating system. It is also useful if you have access to test hardware or virtual machines to be able to follow the examples in the book.

  11. Convex Decomposition Based Cluster Labeling Method for Support Vector Clustering

    Institute of Scientific and Technical Information of China (English)

    Yuan Ping; Ying-Jie Tian; Ya-Jian Zhou; Yi-Xian Yang

    2012-01-01

    Support vector clustering (SVC) is an important boundary-based clustering algorithm in multiple applications for its capability of handling arbitrary cluster shapes. However,SVC's popularity is degraded by its highly intensive time complexity and poor label performance.To overcome such problems,we present a novel efficient and robust convex decomposition based cluster labeling (CDCL) method based on the topological property of dataset.The CDCL decomposes the implicit cluster into convex hulls and each one is comprised by a subset of support vectors (SVs).According to a robust algorithm applied in the nearest neighboring convex hulls,the adjacency matrix of convex hulls is built up for finding the connected components; and the remaining data points would be assigned the label of the nearest convex hull appropriately.The approach's validation is guaranteed by geometric proofs.Time complexity analysis and comparative experiments suggest that CDCL improves both the efficiency and clustering quality significantly.

  12. Tribology. LC Science Tracer Bullet.

    Science.gov (United States)

    Havas, George D., Comp.

    Tribology is the science and technology of interacting surfaces in relative motion. It incorporates a number of scientific fields, including friction, wear, lubrication, materials science, and various branches of surface physics and surface chemistry. Tribology forms a vital part of engineering science. The interacting surfaces may be on machinery…

  13. Magnetic Bead—Magic Bullet

    Directory of Open Access Journals (Sweden)

    Christine Ruffert

    2016-01-01

    Full Text Available Microfluidics is assumed to be one of the leading and most promising areas of research since the early 1990s. In microfluidic systems, small spherical magnetic particles with superparamagnetic properties, called magnetic beads, play an important role in the design of innovative methods and tools, especially in bioanalysis and medical sciences. The intention of this review paper is to address main aspects from the state-of-the-art in the area of magnetic bead research, while demonstrating the broad variety of applications and the huge potential to solve fundamental biological and medical problems in the fields of diagnostics and therapy. Basic issues and demands related to the fabrication of magnetic particles and physical properties of nanosize magnets are discussed in Section 2. Of main interest are the control and adjustment of the nanoparticles’ properties and the availability of adequate approaches for particle detection via their magnetic field. Section 3 presents an overview of magnetic bead applications in nanomedicine. In Section 4, practical aspects of sample manipulation and separation employing magnetic beads are described. Finally, the benefits related to the use of magnetic bead-based microfluidic systems are summarized, illustrating ongoing questions and open tasks to be solved on the way to an approaching microfluidic age.

  14. Desalination. LC Science Tracer Bullet.

    Science.gov (United States)

    Buydos, John F., Comp.

    This guide provides a review of the relevant literature on desalination within the collections of the Library of Congress. While not intended as a comprehensive bibliography, this guide is designed as a quick and ready reference source for the reader, and includes the following sections: (1) articles that provide introductions to the topic of…

  15. Dolphins. LC Science Tracer Bullet.

    Science.gov (United States)

    Niskern, Diana, Comp.

    The family Delphinidae is the largest family of toothed whales. It includes not only those mammals commonly referred to as dolphins, such as the bottlenosed dolphin often seen in captivity, but also the killer whale. This literature and resources guide is not intended to be a comprehensive bibliography on dolphins; the guide is designed--as the…

  16. Asbestos. LC Science Tracer Bullet.

    Science.gov (United States)

    Evans, Joanna, Comp.

    Asbestos is a generic term that refers to several silicate materials occurring naturally as fibrous rocks. Insignificant amounts of asbestos fiber can be found in ambient air, but this, and materials containing hard asbestos, usually do not create problems. Soft materials, however, can release high amounts of asbestos fibers into the air, and…

  17. Brightest Cluster Galaxies and Core Gas Density in REXCESS Clusters

    CERN Document Server

    Haarsma, D B; Donahue, M; Bruch, S; Boehringer, H; Croston, J H; Pratt, G W; Voit, G M; Arnaud, M; Pierini, D

    2009-01-01

    We investigate the relationship between brightest cluster galaxies (BCGs) and their host clusters using a sample of nearby galaxy clusters from the Representative XMM-Newton Cluster Structure Survey (REXCESS). The sample was imaged with the Southern Observatory for Astrophysical Research (SOAR) in R band to investigate the mass of the old stellar population. Using a metric radius of 12h^-1 kpc, we find that the BCG luminosity depends weakly on overall cluster mass as L_BCG \\propto M_cl^0.18+-0.07, consistent with previous work. We found that 90% of the BCGs are located within 0.035 R_500 of the peak of the X-ray emission, including all of the cool core (CC) clusters. We also found an unexpected correlation between the BCG metric luminosity and the core gas density for non-cool core (non-CC) clusters, following a power law of n_e \\propto L_BCG^2.7+-0.4 (where n_e is measured at 0.008 R_500). The correlation is not easily explained by star formation (which is weak in non-CC clusters) or overall cluster mass (wh...

  18. Query Results Clustering by Extending SPARQL with CLUSTER BY

    Science.gov (United States)

    Ławrynowicz, Agnieszka

    The task of dynamic clustering of the search results proved to be useful in the Web context, where the user often does not know the granularity of the search results in advance. The goal of this paper is to provide a declarative way for invoking dynamic clustering of the results of queries submitted over Semantic Web data. To achieve this goal the paper proposes an approach that extends SPARQL by clustering abilities. The approach introduces a new statement, CLUSTER BY, into the SPARQL grammar and proposes semantics for such extension.

  19. Discovery of a pulsar wind nebula around the Magnetar Candidate AXP 1E1547.0-5408

    NARCIS (Netherlands)

    Vink, J.; Bamba, A.

    2009-01-01

    We report the detection of extended emission around the anomalous X-ray pulsar 1E1547.0-5408 using archival data of the Chandra X-ray satellite. The extended emission consists of an inner part, with an extent of 45 , and an outer part with an outer radius of 2. 9, which coincides with a supernova re

  20. The Relationship between Eating Disorders and ICAM-1, E-selection and Ghrelin Resting Level in Overweight People

    Directory of Open Access Journals (Sweden)

    Gholamreza Sharifi

    2014-11-01

    Full Text Available Introduction There is an agreement that eating disorder is related to psychological characteristics and on the other hand, level of ghrelin hormone, Intercellular adhesion molecule-1 (ICAM-1 and E-selection also change during eating disorders. We aimed to study the relationship between eating disorders and rest levels, ICAM-1, E-selection, and ghrelin hormone in obese people. Materials and Methods  In this quasi-experimental study, 120 obese men (25-30 years old were purposefully selected. Then the data about their eating disorders gathered with eating attitudes test (EAT-26 questionnaire. In the next phase in the rest condition and after overnight fasting, blood samples are collected for measurement of rest levels, ICAM-1, E-selection, and ghrelin hormone. Finally the data were analyzed with appropriate statistical tests in SPSS version 18. Results Mean and deviation of rest levels, ICAM-1, E-selection, and ghrelin hormone were respectively 3064.19, 61.5±19.7, and 2.5±1.5 and there was not any statistical significance relationship between eating disorders ICAM-1, E-selection, and ghrelin hormone in obese men (P