WorldWideScience

Sample records for brushtail possum trichosurus

  1. Food Preferences of the Brushtail Possum (Trichosurus vulpecula)

    OpenAIRE

    Cameron, Kristie E.; Bizo, Lewis A.; Starkey, Nicola J.

    2013-01-01

    The common brushtail possum (Trichosurus vulpecula) has been reported to eat vegetation, fruit, invertebrates, and occasionally fungi, eggs and meat. The relative preference between food types found in the wild, however, has not been investigated systematically in a controlled laboratory study. This research investigated captive possums’ food choice using two different methods of preference assessment. The first experiment involved a single stimulus assessment of possums’ (n = 20) consumption...

  2. Multisystemic Listeriosis in a Common Brushtail Possum (Trichosurus vulpecula) and Two Common Ringtail Possums (Pseudocheirus peregrinus).

    Science.gov (United States)

    Sangster, C R

    2016-05-01

    A single free-ranging common brushtail possum (Trichosurus vulpecula) and 2 captive sibling common ringtail possums (Pseudocheirus peregrinus)from a zoological facility in Sydney, Australia, were diagnosed with multisystemic listeriosis. The brushtail was found dead in an animal enclosure while the ringtails presented with signs of cardiovascular collapse and died shortly thereafter. All 3 animals were culture positive forListeria monocytogenesand demonstrated focal suppurative lesions within the brainstem in addition to fulminant disease in other areas of the thorax and/or abdomen. Listeriosis in phalangeriformes species has rarely been reported, and brainstem lesions have not previously been described. It is speculated that access to the brainstem by the organism may have occurred hematogenously or via retrograde migration along cranial nerves. Sources of infection and the possibility of transmission between animals are also discussed. PMID:26215760

  3. A study of the topography of the lymphatic system of the Australian brushtail possum (Trichosurus vulpecula).

    OpenAIRE

    R. Jackson; Morris, R S

    1996-01-01

    The superficial and deep lymphatic systems of the Australian brushtail possum (Trichosurus vulpecula) are described. In common with other marsupials studied to date and in contrast with most eutherians, there were no popliteal lymph nodes and efferent drainage from the inguinal lymph centre passed directly to the deep axillary group of lymph nodes via an inguinoaxillary trunk. Efferent vessels from the tonsil passed directly to the deep cervical lymph node, which was drained by the tracheal t...

  4. Endogenous Type D Retrovirus in a Marsupial, the Common Brushtail Possum (Trichosurus vulpecula)

    OpenAIRE

    Baillie, Gregory J.; Wilkins, Richard J.

    2001-01-01

    We have sequenced and characterized an endogenous type D retrovirus, which we have named TvERV(D), from the genome of an Australian marsupial, the common brushtail possum (Trichosurus vulpecula). Intact TvERV(D) gag, pro, pol, and env open reading frames were detected in the possum genome. TvERV(D) was classified as a type D retrovirus, most closely related to those of Old World monkeys, New World monkeys, and mice, based on phylogenetic analyses and genetic organization. Approximately 30 TvE...

  5. Assessing recombinant vaccinia virus as a delivery system for fertility control vaccines in the brushtail possum (Trichosurus vulpecula)

    OpenAIRE

    Duckworth, J.; Cross, M; Fleming, S.; Scobie, S.; Whelan, E.; Prada, D.; A. Mercer; Cowan, P.

    2011-01-01

    The introduced brushtail possum (Trichosurus vulpecula) is a major threat to native biodiversity and agricultural production in New Zealand. Research on non-lethal management methods is focussed on fertility control, and aims to develop zona pellucida (ZP) vaccines suitable for bait delivery to free-living possums. Vaccine delivery remains a challenge. One highly successful oral wildlife vaccine which has been widely used to control rabies in wildlife in the US and Europe, is based on a repli...

  6. Assessing stability of body weight in the brushtail possum (Trichosurus vulpecula).

    Science.gov (United States)

    Cameron, Kristie E; Bizo, Lewis A; Starkey, Nicola J

    2015-01-01

    When conducting controlled laboratory studies with non-traditional laboratory animals it is important that methods for determining body weight stability are reliable. This helps ensure the health and welfare of animals when they are maintained during periods of free feeding or food restriction. This study compared different methods for determining body weight stability in six common brushtail possums (Trichosurus vulpecula) maintained on a free-feeding diet under laboratory conditions. A criterion of five consecutive weighings with less than ±2.5% change across days and no more than two consecutive days of weight loss or weight gain was judged to be the most suitable criteria for determining stability. It is important to study non-traditional animals, especially endangered or pest species, under controlled laboratory conditions and to have robust methods for establishing body weight stability. PMID:24958547

  7. Angiotensin receptors in an Australian marsupial, the brushtail possum Trichosurus vulpecula

    Energy Technology Data Exchange (ETDEWEB)

    Sernia, C.; Lello, P.; Thomas, W.G. (Univ. of Queensland, St Lucia (Australia))

    1990-01-01

    In this study, the binding properties of angiotensin receptors were examined in the liver, adrenal, brain, and vascular tissue of the brushtail possum, Trichosurus vulpecula. With 125I-Ile5-angiotensin II as the radioligand, the binding affinity (Ka) and receptor number (R0) were estimated for the liver (Ka = 3.60 +/- 0.31 liters/nmol; R0 = 23.8 +/- 1.30 pmol/g tissue; n = 8) and adrenal (Ka = 1.68 +/- 0.29 liters/nmol; R0 = 1.67 +/- 0.23 pmol/g tissue; n = 8). Specific binding was not found in any of seven areas of the possum brain (n = 6), whereas the expected binding was present in similar areas of the rat brain. Using angiotensin III or the antagonist Sar1-Ala8-angiotensin II as radioligands or changing the composition of the incubation buffer did not alter the outcome. Moreover, the intracerebroventricular injection of 1 and 5 nmol of angiotensin II did not elicit an increase in blood pressure which could be attributed to brain angiotensin II (AII) receptors. Ligand affinities of the adrenal and liver receptors were found to be in the following decreasing order: Val5-AII greater than Ile5-AII = Ile5-AIII greater than Sar1-Ala8-AII greater than Sar1-Gly8-AII greater than Sar1-Leu8-AII greater than Ile5-AI greater than hexapeptide greater than Phe3-Tyr8-AII. The cardiovascular AII receptor was investigated by generating dose-response curves of the pressor activity of Ile5-AII and six AII analogs infused intravenously. It was concluded that liver, adrenal, and vascular AII receptors in the marsupial possum have characteristics similar to those in eutherian mammals. However, the failure to find brain AII receptors raises the possibility that those functions mediated by such receptors in the eutherian brain are absent in the possum and perhaps other marsupials.

  8. Angiotensin receptors in an Australian marsupial, the brushtail possum Trichosurus vulpecula

    International Nuclear Information System (INIS)

    In this study, the binding properties of angiotensin receptors were examined in the liver, adrenal, brain, and vascular tissue of the brushtail possum, Trichosurus vulpecula. With 125I-Ile5-angiotensin II as the radioligand, the binding affinity (Ka) and receptor number (R0) were estimated for the liver (Ka = 3.60 +/- 0.31 liters/nmol; R0 = 23.8 +/- 1.30 pmol/g tissue; n = 8) and adrenal (Ka = 1.68 +/- 0.29 liters/nmol; R0 = 1.67 +/- 0.23 pmol/g tissue; n = 8). Specific binding was not found in any of seven areas of the possum brain (n = 6), whereas the expected binding was present in similar areas of the rat brain. Using angiotensin III or the antagonist Sar1-Ala8-angiotensin II as radioligands or changing the composition of the incubation buffer did not alter the outcome. Moreover, the intracerebroventricular injection of 1 and 5 nmol of angiotensin II did not elicit an increase in blood pressure which could be attributed to brain angiotensin II (AII) receptors. Ligand affinities of the adrenal and liver receptors were found to be in the following decreasing order: Val5-AII greater than Ile5-AII = Ile5-AIII greater than Sar1-Ala8-AII greater than Sar1-Gly8-AII greater than Sar1-Leu8-AII greater than Ile5-AI greater than hexapeptide greater than Phe3-Tyr8-AII. The cardiovascular AII receptor was investigated by generating dose-response curves of the pressor activity of Ile5-AII and six AII analogs infused intravenously. It was concluded that liver, adrenal, and vascular AII receptors in the marsupial possum have characteristics similar to those in eutherian mammals. However, the failure to find brain AII receptors raises the possibility that those functions mediated by such receptors in the eutherian brain are absent in the possum and perhaps other marsupials

  9. Predicting summer site occupancy for an invasive species, the common brushtail possum (Trichosurus vulpecula, in an urban environment.

    Directory of Open Access Journals (Sweden)

    Amy L Adams

    Full Text Available Invasive species are often favoured in fragmented, highly-modified, human-dominated landscapes such as urban areas. Because successful invasive urban adapters can occupy habitat that is quite different from that in their original range, effective management programmes for invasive species in urban areas require an understanding of distribution, habitat and resource requirements at a local scale that is tailored to the fine-scale heterogeneity typical of urban landscapes. The common brushtail possum (Trichosurus vulpecula is one of New Zealand's most destructive invasive pest species. As brushtail possums traditionally occupy forest habitat, control in New Zealand has focussed on rural and forest habitats, and forest fragments in cities. However, as successful urban adapters, possums may be occupying a wider range of habitats. Here we use site occupancy methods to determine the distribution of brushtail possums across five distinguishable urban habitat types during summer, which is when possums have the greatest impacts on breeding birds. We collected data on possum presence/absence and habitat characteristics, including possible sources of supplementary food (fruit trees, vegetable gardens, compost heaps, and the availability of forest fragments from 150 survey locations. Predictive distribution models constructed using the programme PRESENCE revealed that while occupancy rates were highest in forest fragments, possums were still present across a large proportion of residential habitat with occupancy decreasing as housing density increased and green cover decreased. The presence of supplementary food sources was important in predicting possum occupancy, which may reflect the high nutritional value of these food types. Additionally, occupancy decreased as the proportion of forest fragment decreased, indicating the importance of forest fragments in determining possum distribution. Control operations to protect native birds from possum predation in

  10. Photoreceptor topography and spectral sensitivity in the common brushtail possum (Trichosurus vulpecula).

    Science.gov (United States)

    Vlahos, Lisa M; Knott, Ben; Valter, Krisztina; Hemmi, Jan M

    2014-10-15

    Marsupials are believed to be the only non-primate mammals with both trichromatic and dichromatic color vision. The diversity of color vision systems present in marsupials remains mostly unexplored. Marsupials occupy a diverse range of habitats, which may have led to considerable variation in the presence, density, distribution, and spectral sensitivity of retinal photoreceptors. In this study we analyzed the distribution of photoreceptors in the common brushtail possum (Trichosurus vulpecula). Immunohistochemistry in wholemounts revealed three cone subpopulations recognized within two spectrally distinct cone classes. Long-wavelength sensitive (LWS) single cones were the largest cone subgroup (67-86%), and formed a weak horizontal visual streak (peak density 2,106 ± 435/mm2) across the central retina. LWS double cones were strongly concentrated ventrally (569 ± 66/mm2), and created a "negative" visual streak (134 ± 45/mm2) in the central retina. The strong regionalization between LWS cone topographies suggests differing visual functions. Short-wavelength sensitive (SWS) cones were present in much lower densities (3-10%), mostly located ventrally (179 ± 101/mm2). A minority population of cones (0-2.4%) remained unlabeled by both SWS- and LWS-specific antibodies, and may represent another cone population. Microspectrophotometry of LWS cone and rod visual pigments shows peak spectral sensitivities at 544 nm and 500 nm, respectively. Cone to ganglion cell convergences remain low and constant across the retina, thereby maintaining good visual acuity, but poor contrast sensitivity during photopic vision. Given that brushtail possums are so strongly nocturnal, we hypothesize that their acuity is set by the scotopic visual system, and have minimized the number of cones necessary to serve the ganglion cells for photopic vision. PMID:24737644

  11. Assessing the Effectiveness of Tuberculosis Management in Brushtail Possums (Trichosurus vulpecula), through Indirect Surveillance of Mycobacterium bovis Infection Using Released Sentinel Pigs

    OpenAIRE

    Nugent, G.; Yockney, I. J.; E. J. Whitford; Cross, M. L.

    2014-01-01

    In New Zealand, wild pigs acquire Mycobacterium bovis infection by scavenging tuberculous carrion, primarily carcasses of the main disease maintenance host, the brushtail possum (Trichosurus vulpecula). We investigated the utility of captive-reared, purpose-released pigs as sentinels for tuberculosis (TB) following lethal possum control and subsequent population recovery. Within 2-3 years of possum control by intensive poisoning, TB prevalence and the incidence rate of M. bovis infection in r...

  12. Do free-ranging Common brushtail possums (Trichosurus vulpecula) play a role in the transmission of Toxoplasma gondii within a zoo environment?

    Science.gov (United States)

    To investigate the possible role of Common brushtail possums (Trichosurus vulpecula) in the transmission of Toxoplasma gondii within a zoo environment, a serological survey of a free-ranging population resident within Taronga Zoo, Sydney, Australia was undertaken using the modified agglutination tes...

  13. Epidemiology and control of Mycobacterium bovis infection in brushtail possums (Trichosurus vulpecula), the primary wildlife host of bovine tuberculosis in New Zealand

    OpenAIRE

    Nugent, G.; Buddle, BM; Knowles, G

    2015-01-01

    Abstract The introduced Australian brushtail possum (Trichosurus vulpecula) is a maintenance host for bovine tuberculosis (TB) in New Zealand and plays a central role in the TB problem in this country. The TB-possum problem emerged in the late 1960s, and intensive lethal control of possums is now used to reduce densities to low levels over 8 million ha of the country. This review summarises what is currently known about the pathogenesis and epidemiology of TB in possums, and how the disease r...

  14. Cortico-cortical connections of the motor cortex in the brushtailed possum (Trichosurus vulpecula).

    OpenAIRE

    Joschko, M A; Sanderson, K J

    1987-01-01

    Cortico-cortical connections of motor cortex in the marsupial brushtailed possum were traced by making injections of horseradish peroxidase (HRP) into two parts of motor cortex: the rostral agranular part which does not overlap somatosensory cortex, and the caudal part which does. Following injections in motor cortex, labelled neurons were observed on the same side of the brain within somatosensory areas 1 and 2 and in parietal cortex just caudal to S1, with most neurons in cortical Layers 2-...

  15. Cost-Effective Large-Scale Occupancy–Abundance Monitoring of Invasive Brushtail Possums (Trichosurus Vulpecula) on New Zealand’s Public Conservation Land

    OpenAIRE

    Gormley, Andrew M.; Forsyth, David M.; Wright, Elaine F.; Lyall, John; Elliott, Mike; Martini, Mark; Kappers, Benno; Perry, Mike; McKay, Meredith

    2015-01-01

    There is interest in large-scale and unbiased monitoring of biodiversity status and trend, but there are few published examples of such monitoring being implemented. The New Zealand Department of Conservation is implementing a monitoring program that involves sampling selected biota at the vertices of an 8-km grid superimposed over the 8.6 million hectares of public conservation land that it manages. The introduced brushtail possum (Trichosurus Vulpecula) is a major threat to some biota and i...

  16. Epidemiology and control of Mycobacterium bovis infection in brushtail possums (Trichosurus vulpecula), the primary wildlife host of bovine tuberculosis in New Zealand.

    Science.gov (United States)

    Nugent, G; Buddle, B M; Knowles, G

    2015-06-01

    The introduced Australian brushtail possum (Trichosurus vulpecula) is a maintenance host for bovine tuberculosis (TB) in New Zealand and plays a central role in the TB problem in this country. The TB-possum problem emerged in the late 1960s, and intensive lethal control of possums is now used to reduce densities to low levels over 8 million ha of the country. This review summarises what is currently known about the pathogenesis and epidemiology of TB in possums, and how the disease responds to possum control. TB in possums is a highly lethal disease, with most possums likely to die within 6 months of becoming infected. The mechanisms of transmission between possums remain unclear, but appear to require some form of close contact or proximity. At large geographic scales, TB prevalence in possum populations is usually low (1-5%), but local prevalence can sometimes reach 60%. Intensive, systematic and uniform population control has been highly effective in breaking the TB cycle in possum populations, and where that control has been sustained for many years the prevalence of TB is now zero or near zero. Although some uncertainties remain, local eradication of TB from possums appears to be straightforward, given that TB managers now have the ability to reduce possum numbers to near zero levels and to maintain them at those levels for extended periods where required. We conclude that, although far from complete, the current understanding of TB-possum epidemiology, and the current management strategies and tactics, are sufficient to achieve local, regional, and even national disease eradication from possums in New Zealand. PMID:25290902

  17. Triacylglycerol estolides, a new class of mammalian lipids, in the paracloacal gland of the brushtail possum (Trichosurus vulpecula).

    Science.gov (United States)

    McLean, Stuart; Davies, Noel W; Nichols, David S; Mcleod, Bernie J

    2015-06-01

    The paracloacal glands are the most prevalent scent glands in marsupials, and previous investigation of their secretions in the brushtail possum (Trichosurus vulpecula) has identified many odorous compounds together with large amounts of neutral lipids. We have examined the lipids by LC-MS, generating ammonium adducts of acylglycerols by electrospray ionisation. Chromatograms showed a complex mixture of coeluting acylglycerols, with m/z from about 404 to 1048. Plots of single [M + NH4](+) ions showed three groups of lipids clearly separated by retention time. MS-MS enabled triacylglycerols and diacylglycerol ethers to be identified from neutral losses and formation of diacylglycerols and other product ions. The earliest-eluting lipids were found to be triacylglycerol estolides, in which a fourth fatty acid forms an ester link with a hydroxy fatty acid attached to the glycerol chain. This is the first report of triacylglycerol estolides in animals. They form a complex mixture with the triacylglycerols and diacylglycerol ethers of lipids with short- and long-chain fatty acids with varying degrees of unsaturation. This complexity suggests a functional role, possibly in social communication. PMID:25916239

  18. Assessing Movements of Brushtail Possums (Trichosurus vulpecula) in Relation to Depopulated Buffer Zones for the Management of Wildlife Tuberculosis in New Zealand.

    Science.gov (United States)

    Byrom, Andrea E; Anderson, Dean P; Coleman, Morgan; Thomson, Caroline; Cross, Martin L; Pech, Roger P

    2015-01-01

    In New Zealand, managing the threat of bovine tuberculosis (TB) to livestock includes population reduction of potentially infectious wildlife, primarily the brushtail possum (Trichosurus vulpecula). Population control is often targeted on forested buffer zones adjacent to farmland, in order to limit movements of possums across the buffer and reduce the risk of disease transmission to livestock. To assess the effectiveness of buffers in protecting livestock we analysed GPS telemetry data from possums located in untreated forest adjacent to buffers, and used these data to characterise patterns of movement that could lead to possums reaching farmland during the season when most dispersal occurs. Analyses of movement data showed that the direction of dispersal by sub-adult and adult possums and the extent of long exploratory movements were not biased toward forest buffers, even though these provided vacant habitat as suitable for possums as untreated forest. Instead, dispersal and exploratory movements were uncommon even for sub-adult possums and such events typically lasted possums settled predominantly in river valleys. A simulation model was developed for the 3-6-month dispersal season; it demonstrated a probability of possum, originating from a low-density population with low disease prevalence in untreated forest, would move across 3 km of recently controlled forest buffer to reach farmland. Our results indicate short-term reduction in the risk of TB transmission from possums to livestock in New Zealand by the use of depopulated buffer zones, while acknowledging that the threat of disease spread from untreated forest is likely to increase over time as possum population density and, potentially, TB prevalence among those possums, increase in the buffer zone. PMID:26689918

  19. Assessing Movements of Brushtail Possums (Trichosurus vulpecula in Relation to Depopulated Buffer Zones for the Management of Wildlife Tuberculosis in New Zealand.

    Directory of Open Access Journals (Sweden)

    Andrea E Byrom

    Full Text Available In New Zealand, managing the threat of bovine tuberculosis (TB to livestock includes population reduction of potentially infectious wildlife, primarily the brushtail possum (Trichosurus vulpecula. Population control is often targeted on forested buffer zones adjacent to farmland, in order to limit movements of possums across the buffer and reduce the risk of disease transmission to livestock. To assess the effectiveness of buffers in protecting livestock we analysed GPS telemetry data from possums located in untreated forest adjacent to buffers, and used these data to characterise patterns of movement that could lead to possums reaching farmland during the season when most dispersal occurs. Analyses of movement data showed that the direction of dispersal by sub-adult and adult possums and the extent of long exploratory movements were not biased toward forest buffers, even though these provided vacant habitat as suitable for possums as untreated forest. Instead, dispersal and exploratory movements were uncommon even for sub-adult possums and such events typically lasted <10 days. Dispersing possums settled predominantly in river valleys. A simulation model was developed for the 3-6-month dispersal season; it demonstrated a probability of <0.001 that an infected possum, originating from a low-density population with low disease prevalence in untreated forest, would move across 3 km of recently controlled forest buffer to reach farmland. Our results indicate short-term reduction in the risk of TB transmission from possums to livestock in New Zealand by the use of depopulated buffer zones, while acknowledging that the threat of disease spread from untreated forest is likely to increase over time as possum population density and, potentially, TB prevalence among those possums, increase in the buffer zone.

  20. Influence of contact heterogeneity on TB reproduction ratio R$_0$ in a free-living brushtail possum Trichosurus vulpecula population

    OpenAIRE

    Porphyre, Thibaud; Stevenson, Mark; Jackson, Ron; McKenzie, Joanna

    2008-01-01

    Social network analyses were used to investigate contact patterns in a free-living possum Trichosurus vulpecula population and to estimate the influence of contact on $R_0$ for bovine tuberculosis (TB). Using data collected during a five-year capture-mark-recapture study of a free-living possum population, observed estimates of $R_0$ were computed and compared with $R_0$ computed from random networks of similar size that approximated a random mixing process. All networks displayed a heterogen...

  1. Taxonomy Icon Data: silver-gray brushtail possum [Taxonomy Icon

    Lifescience Database Archive (English)

    Full Text Available silver-gray brushtail possum Trichosurus vulpecula Chordata/Vertebrata/Mammalia/Theria/Metatheria Trichosur...us_vulpecula_L.png Trichosurus_vulpecula_NL.png Trichosurus_vulpecula_S.png Trichosur...us_vulpecula_NS.png http://biosciencedbc.jp/taxonomy_icon/icon.cgi?i=Trichosurus+vulpecula&t=L http://biosc...iencedbc.jp/taxonomy_icon/icon.cgi?i=Trichosurus+vulpecula&t=NL http://bioscience...dbc.jp/taxonomy_icon/icon.cgi?i=Trichosurus+vulpecula&t=S http://biosciencedbc.jp/taxonomy_icon/icon.cgi?i=Trichosurus+vulpecula&t=NS ...

  2. Cost-Effective Large-Scale Occupancy-Abundance Monitoring of Invasive Brushtail Possums (Trichosurus Vulpecula) on New Zealand's Public Conservation Land.

    Science.gov (United States)

    Gormley, Andrew M; Forsyth, David M; Wright, Elaine F; Lyall, John; Elliott, Mike; Martini, Mark; Kappers, Benno; Perry, Mike; McKay, Meredith

    2015-01-01

    There is interest in large-scale and unbiased monitoring of biodiversity status and trend, but there are few published examples of such monitoring being implemented. The New Zealand Department of Conservation is implementing a monitoring program that involves sampling selected biota at the vertices of an 8-km grid superimposed over the 8.6 million hectares of public conservation land that it manages. The introduced brushtail possum (Trichosurus Vulpecula) is a major threat to some biota and is one taxon that they wish to monitor and report on. A pilot study revealed that the traditional method of monitoring possums using leg-hold traps set for two nights, termed the Trap Catch Index, was a constraint on the cost and logistical feasibility of the monitoring program. A phased implementation of the monitoring program was therefore conducted to collect data for evaluating the trade-off between possum occupancy-abundance estimates and the costs of sampling for one night rather than two nights. Reducing trapping effort from two nights to one night along four trap-lines reduced the estimated costs of monitoring by 5.8% due to savings in labour, food and allowances; it had a negligible effect on estimated national possum occupancy but resulted in slightly higher and less precise estimates of relative possum abundance. Monitoring possums for one night rather than two nights would provide an annual saving of NZ$72,400, with 271 fewer field days required for sampling. Possums occupied 60% (95% credible interval; 53-68) of sampling locations on New Zealand's public conservation land, with a mean relative abundance (Trap Catch Index) of 2.7% (2.0-3.5). Possum occupancy and abundance were higher in forest than in non-forest habitats. Our case study illustrates the need to evaluate relationships between sampling design, cost, and occupancy-abundance estimates when designing and implementing large-scale occupancy-abundance monitoring programs. PMID:26029890

  3. Cost-Effective Large-Scale Occupancy-Abundance Monitoring of Invasive Brushtail Possums (Trichosurus Vulpecula on New Zealand's Public Conservation Land.

    Directory of Open Access Journals (Sweden)

    Andrew M Gormley

    Full Text Available There is interest in large-scale and unbiased monitoring of biodiversity status and trend, but there are few published examples of such monitoring being implemented. The New Zealand Department of Conservation is implementing a monitoring program that involves sampling selected biota at the vertices of an 8-km grid superimposed over the 8.6 million hectares of public conservation land that it manages. The introduced brushtail possum (Trichosurus Vulpecula is a major threat to some biota and is one taxon that they wish to monitor and report on. A pilot study revealed that the traditional method of monitoring possums using leg-hold traps set for two nights, termed the Trap Catch Index, was a constraint on the cost and logistical feasibility of the monitoring program. A phased implementation of the monitoring program was therefore conducted to collect data for evaluating the trade-off between possum occupancy-abundance estimates and the costs of sampling for one night rather than two nights. Reducing trapping effort from two nights to one night along four trap-lines reduced the estimated costs of monitoring by 5.8% due to savings in labour, food and allowances; it had a negligible effect on estimated national possum occupancy but resulted in slightly higher and less precise estimates of relative possum abundance. Monitoring possums for one night rather than two nights would provide an annual saving of NZ$72,400, with 271 fewer field days required for sampling. Possums occupied 60% (95% credible interval; 53-68 of sampling locations on New Zealand's public conservation land, with a mean relative abundance (Trap Catch Index of 2.7% (2.0-3.5. Possum occupancy and abundance were higher in forest than in non-forest habitats. Our case study illustrates the need to evaluate relationships between sampling design, cost, and occupancy-abundance estimates when designing and implementing large-scale occupancy-abundance monitoring programs.

  4. Lipid-formulated bcg as an oral-bait vaccine for tuberculosis: vaccine stability, efficacy, and palatability to brushtail possums (Trichosurus vulpecula) in New Zealand.

    Science.gov (United States)

    Cross, Martin L; Henderson, Ray J; Lambeth, Matthew R; Buddle, Bryce M; Aldwell, Frank E

    2009-07-01

    Bovine tuberculosis (Tb), due to infection with virulent Mycobacterium bovis, represents a threat to New Zealand agriculture due to vectorial transmission from wildlife reservoir species, principally the introduced Australian brushtail possum (Trichosurus vulpecula). An oral-delivery wildlife vaccine has been developed to immunize possums against Tb, based on formulation of the human Tb vaccine (M. bovis BCG) in edible lipid matrices. Here BCG bacilli were shown to be stable in lipid matrix formulation for over 8 mo in freezer storage, for 7 wk under room temperature conditions, and for 3-5 wk under field conditions in a forest/pasture margin habitat (when maintained in weatherproof bait-delivery sachets). Samples of the lipid matrix were flavored and offered to captive possums in a bait-preference study: a combination of 10% chocolate powder with anise oil was identified as the most effective attractant/palatability combination. In a replicated field study, 85-100% of wild possums were shown to access chocolate-flavored lipid pellets, when baits were applied to areas holding approximately 600-800 possums/km(2). Finally, in a controlled vaccination/challenge study, chocolate-flavored lipid vaccine samples containing 10(8) BCG bacilli were fed to captive possums, which were subsequently challenged via aerosol exposure to virulent M. bovis: vaccine immunogenicity was confirmed, and protection was identified by significantly reduced postchallenge weight loss in vaccinated animals compared to nonvaccinated controls. These studies indicate that, appropriately flavored, lipid delivery matrices may form effective bait vaccines for the control of Tb in wildlife. PMID:19617486

  5. Relationships of the visual cortex in the marsupial brush-tailed possum, Trichosurus vulpecula, a horseradish peroxidase and autoradiographic study

    International Nuclear Information System (INIS)

    The connections of the visual cortex in Trichosurus have been studied by observing the anterograde transport of tritiated amino acids leucine and proline and the retrograde transport of horseradish peroxidase (HRP) following small injections of these tracers into the cortex. (U.K.)

  6. Predicting Summer Site Occupancy for an Invasive Species, the Common Brushtail Possum (Trichosurus vulpecula), in an Urban Environment

    OpenAIRE

    Adams, Amy L.; Dickinson, Katharine J. M.; Robertson, Bruce C; van Heezik, Yolanda

    2013-01-01

    Invasive species are often favoured in fragmented, highly-modified, human-dominated landscapes such as urban areas. Because successful invasive urban adapters can occupy habitat that is quite different from that in their original range, effective management programmes for invasive species in urban areas require an understanding of distribution, habitat and resource requirements at a local scale that is tailored to the fine-scale heterogeneity typical of urban landscapes. The common brushtail ...

  7. Effect of stimulus and response separation in a matching-to-sample task in the brushtail possum (Trichosurus vulpecula).

    Science.gov (United States)

    Cameron, Kristie E; McEwan, James S A; Temple, Bill

    2015-09-01

    This study seeks to investigate the impact of changing the proximity of stimulus and response manipulanda on matching-to-sample performance in possums. Possums were presented with five rows of blue and yellow stimuli arranged vertically 25mm apart above response levers. Generally, peak performance occurred at the distance from the lever currently being trained. Performance generalized to distances close to the currently trained distance and decreased in accuracy at distances further from the trained level. The findings from this experiment provide evidence for placing stimuli and response manipulanda close together to improve acquisition of a task, and increase the responding accuracy in MTS experiments. This suggests that spatial contiguity in the relative location of stimuli and response manipulanda is critical to animals performing complex operant tasks. PMID:25979605

  8. Characterization of the hemoglobins of the neonatal brushtailed possum Trichosurus vulpecula (Kerr): evidence for a highly cooperative, aggregated isoform of hemoglobin.

    Science.gov (United States)

    Henty, Kristen; Wells, Rufus M G; Brittain, Thomas

    2008-05-01

    The red blood cells of the neonatal brushtailed possum exhibit unusually strong cooperativity at high levels of oxygen saturation (n=5.4) which appear to arise from a concentration dependent aggregation of one of the neonatal hemoglobin isoforms. Red blood cells from neonatal pouched young exhibit a Bohr factor of -0.36. Stripped hemolysate is sensitive to added 2,3-bisphosphoglycerate (BPG) (apparent binding constant K=35 micromol L(-1)) and ATP (K=180 micromol L(-1)), but is largely insensitive towards chloride ions. Five isoforms of non-adult hemoglobin were identified using isoelectric focusing. Mass spectrometry indicated that two early isoforms contain alpha chains identical to the adult alpha chain. The remaining three isoforms are composed of identical alpha type and beta type gene products, but differ in their isoelectric points due to differential post-translational modification. PMID:18420437

  9. Behavior-Based Assessment of the Auditory Abilities of Brushtail Possums

    Science.gov (United States)

    Osugi, Mizuho; Foster T. Mary; Temple, William; Poling, Alan

    2011-01-01

    Brushtail possums ("Trichosurus vulpecula") were trained to press a right lever when a tone was presented (a tone-on trial) and a left lever when a tone was not presented (a tone-off trial) to gain access to food. During training the tone was set at 80 dB(A), with a frequency of 0.88 kH for 3 possums and of 4 kH for the other 2. Once accuracy was…

  10. Osteogenesis in two marsupial species, the bandicoot Isoodon macrourus and the possum Trichosurus vulpecula.

    OpenAIRE

    Gemmell, R T; Johnston, G; Bryden, M M

    1988-01-01

    Skeletal development of two marsupial species, the bandicoot, Isoodon macrourus and the brushtail possum, Trichosurus vulpecula, has been examined in whole mount preparations using a technique of clearing and differential staining of cartilage and bone. Both marsupials possess a complete cartilaginous skeleton at birth and ossification begins in the maxilla, mandible and certain bones of the forelimb soon after birth. The general pattern of ossification in these marsupials is similar to that ...

  11. Mitochondrial genomes of a bandicoot and a brushtail possum confirm the monophyly of australidelphian marsupials.

    OpenAIRE

    Phillips, M J; Lin, Y. H.; Harrison, G L; PENNY, D

    2001-01-01

    Recent molecular analyses suggest that the position of bandicoots is the major difficulty in determining the root of the tree of extant marsupials. To resolve this, we analyse mitochondrial genome sequences of a bandicoot (Isoodon macrourus) and a brushtail possum (Trichosurus vulpecula) together with the previously available marsupial mitochondrial genomes, the Virginia opossum (Didelphis virginiana) and the wallaroo (Macropus robustus). Analyses of mitochondrial protein-coding and RNA genes...

  12. A quantitative study of the morphological development and bacterial colonisation of the gut of the tammar wallaby Macropus eugenii eugenii and brushtail possum Trichosurus vulpecula during in-pouch development.

    Science.gov (United States)

    Lentle, R G; Dey, D; Hulls, C; Mellor, D J; Moughan, P J; Stafford, K J; Nicholas, K

    2006-11-01

    We compared the rates of change of various morphological parameters of the stomach, small intestine, caecum and colon of tammar wallabies and brushtail possums with body mass during in-pouch development. These were correlated with changes in the numbers of bacterial species in the various gut segments. In the pouch-young of both species, the wet tissue masses of all gut segments increased with body mass in a positively allometric manner (i.e. with a body mass exponent > 1), suggesting that the mass of each component was disproportionately low at birth, but increased disproportionately rapidly postnatally. However, the lengths of the wallaby stomach and small intestine scaled isometrically with respect to body mass (i.e. with a body mass exponent around 0.33), which may indicate that the shape of these components changes to the adult form during early neonatal development. Conversely, the length of the caecum and colon of both wallabies and possums scaled in a positively allometric manner with respect to body mass, showing area to volume compensation. This may indicate a more general pattern of disproportionately rapid postnatal enlargement in areas that are distal to the principal sites of neonatal digestion (i.e. the stomach). The numbers of bacterial species present in the various gastrointestinal segments of both species were low in animals aged 100 days or less but there was a significant increase in microbial diversity in the caecum of brushtail possums aged over 100 days. The possum caecum also showed the greatest rate of increase in wet tissue mass relative to body mass. It is postulated that caecal development may act as a nidus for establishment of communities of commensal microflora in the developing marsupial. PMID:16819652

  13. Framing Possums : War, sport and patriotism in depictions of brushtail possums in New Zealand print media

    OpenAIRE

    Young, Ally McCrow; Linné, Tobias; Potts, Annie

    2015-01-01

    There is a common saying in Aotearoa New Zealand: ‘the only good possum is a dead possum’. This colloquialism demonstrates much about the negative reputation and maltreatment of brushtail possums in New Zealand. Introduced to this country from their native Australia in the 1800s, possums thrived in their new predator-free environment. Possums' adaptability has since proved to be problematic, not least for the nation's lucrative meat and dairy industries. In the past few decades a conc...

  14. Nonlinearity and seasonal bias in an index of brushtail possum abundance

    Science.gov (United States)

    Forsyth, D.M.; Link, W.A.; Webster, R.; Nugent, G.; Warburton, B.

    2005-01-01

    Introduced brushtail possums (Trichosurus vulpecula) are a widespread pest of conservation and agriculture in New Zealand, and considerable effort has been expended controlling populations to low densities. A national protocol for monitoring the abundance of possums, termed trap catch index (TCI), was adopted in 1996. The TCI requires that lines of leghold traps set at 20-m spacing are randomly located in a management area. The traps are set for 3 fine nights and checked daily, and possums are killed and traps reset. The TCI is the mean percentage of trap nights that possums were caught, corrected for sprung traps and nontarget captures, with trap line as the sampling unit. We studied I forest and I farmland area in the North Island, New Zealand, to address concerns that TCI estimates may not be readily comparable because of seasonal changes in the capture probability of possums. We located blocks of 6 trap lines at each area and randomly trapped I line in each block in 3 seasons (summer, winter, and spring) in 2000 and 2001. We developed a model to allow for variation in local population size and nightly capture probability, and fitted the model using the Bayesian analysis software BUGS. Capture probability declined with increasing abundance of possums, generating a nonlinear TCI. Capture probability in farmland was lower during spring relative to winter and summer, and to forest during summer. In the absence of a proven and cost-effective alternative, our results support the continued use of the TCI for monitoring the abundance of possums in New Zealand. Seasonal biases in the TCI should be minimized by conducting repeat sampling in the same season.

  15. Creating new evolutionary pathways through bioinvasion: the population genetics of brushtail possums in New Zealand.

    Science.gov (United States)

    Sarre, Stephen D; Aitken, Nicola; Adamack, Aaron T; MacDonald, Anna J; Gruber, Bernd; Cowan, Phil

    2014-07-01

    Rapid increases in global trade and human movement have created novel mixtures of organisms bringing with them the potential to rapidly accelerate the evolution of new forms. The common brushtail possum (Trichosurus vulpecula), introduced into New Zealand from Australia in the 19th century, is one such species having been sourced from multiple populations in its native range. Here, we combine microsatellite DNA- and GIS-based spatial data to show that T. vulpecula originating from at least two different Australian locations exhibit a population structure that is commensurate with their introduction history and which cannot be explained by landscape features alone. Most importantly, we identify a hybrid zone between the two subspecies which appears to function as a barrier to dispersal. When combined with previous genetic, morphological and captive studies, our data suggest that assortative mating between the two subspecies may operate at a behavioural or species recognition level rather than through fertilization, genetic incompatibility or developmental inhibition. Nevertheless, hybridization between the two subspecies of possum clearly occurs, creating the opportunity for novel genetic combinations that would not occur in their natural ranges and which is especially likely given that multiple contact zones occur in New Zealand. This discovery has implications for wildlife management in New Zealand because multiple contact zones are likely to influence the dispersal patterns of possums and because differential susceptibility to baiting with sodium fluoroacetate between possums of different origins may promote novel genetic forms. PMID:24943509

  16. Determination of villous rigidity in the distal ileum of the possum (Trichosurus vulpecula.

    Directory of Open Access Journals (Sweden)

    Yuen Feung Lim

    Full Text Available We investigated the passive mechanical properties of villi in ex vivo preparations of sections of the wall of the distal ileum from the brushtail possum (Trichosurus vulpecula by using a flow cell to impose physiological and supra-physiological levels of shear stress on the tips of villi. We directly determined the stress applied from the magnitude of the local velocities in the stress inducing flow and additionally mapped the patterns of flow around isolated villi by tracking the trajectories of introduced 3 µm microbeads with bright field micro particle image velocimetry (mPIV. Ileal villi were relatively rigid along their entire length (mean 550 µm, and exhibited no noticeable bending even at flow rates that exceeded calculated normal physiological shear stress (>0.5 mPa. However, movement of villus tips indicated that the whole rigid structure of a villus could pivot about the base, likely from laxity at the point of union of the villous shaft with the underlying mucosa. Flow moved upward toward the tip on the upper portions of isolated villi on the surface facing the flow and downward toward the base on the downstream surface. The fluid in sites at distances greater than 150 µm below the villous tips was virtually stagnant indicating that significant convective mixing in the lower intervillous spaces was unlikely. Together the findings indicate that mixing and absorption is likely to be confined to the tips of villi under conditions where the villi and intestinal wall are immobile and is unlikely to be greatly augmented by passive bending of the shafts of villi.

  17. Structure and Innervation of the Extrahepatic Biliary System in the Australian Possum, Trichosurus Vulpecula

    OpenAIRE

    R. T. A. Padbury; Baker, R. A.; Messenger, J. P.; Toouli, J.; Furness, J B

    1993-01-01

    The morphology, microanatomy and innervation of the biliary tree of the Australian possum, Trichosurus vulpecula, was examined. The gross morphology of the gallbladder, hepatic and cystic ducts, and the course of the common bile duct, conforms to those of other species. The sphincter of Oddi has an extraduodenal segment that extends 15mm from the duodenal wall; within this segment the pancreatic and common bile ducts are ensheathed together by sphincter muscle. Their lumens unite to form a co...

  18. COST-EFFECTIVE CONTROL OF 1080 BAIT-SHY POSSUMS

    OpenAIRE

    James G. Ross; Bicknell, Kathryn; Hickling, G.J.

    1999-01-01

    The brushtail possum (Trichosurus vulpecula), introduced to New Zealand in 1858, is a significant conservation pest and a major vector of bovine tuberculosis (Tb; Mycobacterium bovis). Consequently, central and local government agencies now spend more than $30 million (NZD) each year on possum management activities. The current objective of this effort is selective, sustained control to eliminate the transmission of Tb to domestic livestock (which is assumed to require a 60% reduction in poss...

  19. The aetiology of wobbly possum disease: Reproduction of the disease with purified nidovirus.

    Science.gov (United States)

    Giles, Julia; Perrott, Matthew; Roe, Wendi; Dunowska, Magdalena

    2016-04-01

    The objective of this study was to investigate a role of a recently discovered marsupial nidovirus in the development of a neurological disease, termed wobbly possum disease (WPD), in the Australian brushtail possum (Trichosurus vulpecula). Four possums received 1mL of a standard inoculum that had been prepared from tissues of WPD-affected possums, 4 possums received 1.8mL (1×10(6) TCID50) of a cell lysate from inoculated cultures, and 4 possums received 1mL (×10(7) TCID50) of a purified WPD isolate. All but one possum that received infectious inocula developed neurological disease and histopathological lesions characteristic for WPD. High levels of viral RNA were detected in livers from all possums that received infectious inocula, but not from control possums. Altogether, our data provide strong experimental evidence for the causative involvement of WPD virus in development of a neurological disease in infected animals. PMID:26874014

  20. Concurrent progressive-ratio and fixed-ratio schedule performance under geometric and arithmetic progressions by brushtail possums.

    Science.gov (United States)

    Cameron, Kristie E; Clarke, Katrina H; Bizo, Lewis A; Starkey, Nicola J

    2016-05-01

    The aim of this study was to compare the demand for food under concurrent progressive- and fixed-ratio schedules. Twelve brushtail possums participated in 16 conditions where schedule, progression and food type were varied. An incrementing schedule increased the fixed-ratio requirement within and across sessions and was arranged as either a geometric sequence (base 2), or an arithmetic sequence (step 5). Two foods were tested: a flaked barley and coco-pop(®) mix versus rolled oats. Overall, performance was similar for most possums in the within- and across-session incrementing schedules. An analysis of the estimates of essential value and break point produced the same account of demand for foods under the geometric or arithmetic progressions and within- and across-session procedures for 8 of 12 possums. Six possums showed higher demand for rolled oats compared to flaked barley, and two possums showed higher demand for flaked barley compared to rolled oats. Incrementing ratios within, rather than between sessions using an arithmetic progression was demonstrated to be a time efficient procedure for investigating demand for different food types without affecting conclusions about the relative demand for those foods. PMID:27032293

  1. Second-Generation Recombinant Hemoglobin Molecules Do Not Stimulate Sphincter of Oddi, Gallbladder, or Duodenal Motility in the Australian Brush-Tailed Possum

    OpenAIRE

    2004-01-01

    BACKGROUND: Several studies have investigated the effects of hemoglobin-based oxygen carriers on gastrointestinal motility. Diaspirin cross-linked hemoglobin reduces sphincter of Oddi trans-sphincteric flow and increases duodenal motility in the Australian brush-tailed possum, effects attributed to nitric oxide (NO) scavenging. Recently, second-generation recombinant hemoglobin molecules with reduced NO scavenging ability have been developed.AIM: To determine the effects of two second-generat...

  2. Clinical, microbiological and pathological findings of Mycobacterium ulcerans infection in three Australian Possum species.

    Directory of Open Access Journals (Sweden)

    Carolyn R O'Brien

    Full Text Available BACKGROUND: Buruli ulcer (BU is a skin disease caused by Mycobacterium ulcerans, with endemicity predominantly in sub-Saharan Africa and south-eastern Australia. The mode of transmission and the environmental reservoir(s of the bacterium and remain elusive. Real-time PCR investigations have detected M. ulcerans DNA in a variety of Australian environmental samples, including the faeces of native possums with and without clinical evidence of infection. This report seeks to expand on previously published findings by the authors' investigative group with regards to clinical and subclinical disease in selected wild possum species in BU-endemic areas of Victoria, Australia. METHODOLOGY/PRINCIPAL FINDINGS: Twenty-seven clinical cases of M. ulcerans infection in free-ranging possums from southeastern Australia were identified retrospectively and prospectively between 1998-2011. Common ringtail possums (Pseudocheirus peregrinus, a common brushtail possum (Trichosurus vulpecula and a mountain brushtail possum (Trichosurus cunninghami were included in the clinically affected cohort. Most clinically apparent cases were adults with solitary or multiple ulcerative cutaneous lesions, generally confined to the face, limbs and/or tail. The disease was minor and self-limiting in the case of both Trichosurus spp. possums. In contrast, many of the common ringtail possums had cutaneous disease involving disparate anatomical sites, and in four cases there was evidence of systemic disease at post mortem examination. Where tested using real-time PCR targeted at IS2404, animals typically had significant levels of M. ulcerans DNA throughout the gut and/or faeces. A further 12 possums without cutaneous lesions were found to have PCR-positive gut contents and/or faeces (subclinical cases, and in one of these the organism was cultured from liver tissue. Comparisons were made between clinically and subclinically affected possums, and 61 PCR-negative, non-affected individuals

  3. An investigation by LA-ICP-MS of possum tooth enamel as a model for identifying childhood geographical locations of historical and archaeological human remains from New Zealand

    International Nuclear Information System (INIS)

    LA-ICP-MS (laser ablation-inductively coupled plasma-mass spectrometry) has been used to analyse enamel from the teeth of brushtail possum (Trichosurus vulpecula) in order to model a method for identifying the childhood geographical origin of human remains within New Zealand. The model application of the method is promising for establishing locations of historical and archaeological human remains, including preserved heads, upoko tuhi. (author). 30 refs., 5 figs., 6 tabs.

  4. Primary possum macrophage cultures support the growth of a nidovirus associated with wobbly possum disease.

    Science.gov (United States)

    Giles, Julia C; Perrott, Matthew R; Dunowska, Magdalena

    2015-09-15

    The objective of the study was to establish a system for isolation of a recently described, thus far uncultured, marsupial nidovirus associated with a neurological disease of possums, termed wobbly possum disease (WPD). Primary cultures of possum macrophages were established from livers of adult Australian brushtail possums (Trichosurus vulpecula). High viral copy numbers (up to 6.9×10(8)/mL of cell lysate) were detected in infected cell culture lysates from up to the 5th passage of the virus, indicating that the putative WPD virus (WPDV) was replicating in cultured cells. A purified virus stock with a density of 1.09 g/mL was prepared using iodixanol density gradient ultracentrifugation. Virus-like particles approximately 60 nm in diameter were observed using electron microscopy in negatively stained preparations of the purified virus. The one-step growth curve of WPDV in macrophage cultures showed the highest increase in intracellular viral RNA between 6 and 12h post-infection. Maximum levels of cell-associated viral RNA were detected at 24h post-infection, followed by a decline. Levels of extracellular RNA increased starting at 9h post-infection, with maximum levels detected at 48 h post-infection. The establishment of the in vitro system to culture WPDV will facilitate further characterisation of this novel nidovirus. PMID:26028426

  5. Cadmium toxicity and its effect on the testes of an Australian marsupial (Trichosurus vulpecula)

    Energy Technology Data Exchange (ETDEWEB)

    Rose, R.W.; Swain, R.; Whitten, W.K.

    1981-02-01

    The selective toxic effects of cadmium on the testes of eutherian mammals have been well documented. A single subcutaneous or intraperitoneal injection of cadmium (as CdCl/sub 2/) results in testicular necrosis in most eutherian species. Some comparative work has also been carried out on other vertebrate groups, but studies of the effects of cadmium salts on the testes of non-eutherian mammals (monotremes and marsupials) are limited to two brief reports. The present paper reports the results following the injection of cadmium into another marsupial, the common Australian brush-tail possum (Trichosurus vulpecula). Sperm are found throughout the year in this species but breeding is mainly limited to the winter months with secondary peak in spring.

  6. Odour Preferences and Discrimination in Captive Ringtail Possums (Pseudocheirus peregrinus)

    OpenAIRE

    Walker, Linda V.; Croft, David B.

    1990-01-01

    Olfactory communication has been shown to be important in marsupials and, specifically, in Trichosurus vulpecula and Petaurus breviceps. Despite its commonality, little is known about the communication in the ringtail possum, Pseudocheirus peregrines. Therefore, to investigate olfactory communication in the ringtail possum, two experiments were conducted. The odour preference experiment examined the importance of fur, salivary, faecal and urinary odours in ringtail possum olfactory communicat...

  7. Combining Aspirin with Cholecalciferol (Vitamin D3) – A Potential New Tool for Controlling Possum Populations

    OpenAIRE

    Morgan, David R.; Arrow, Jane; Smith, Mark P.

    2013-01-01

    The introduced Australian brushtail possum is a major vertebrate pest in New Zealand, with impacts on conservation and agriculture being managed largely through poisoning operations. Cholecalciferol (vitamin D3) is registered for use in controlling possums and despite its many advantages it is expensive and relatively inhumane. Combination of a high proportion of aspirin with a low proportion of cholecalciferol was effective in killing high proportions of groups of acclimatised, caged possums...

  8. Incorporating Field Studies into Species Distribution and Climate Change Modelling: A Case Study of the Koomal Trichosurus vulpecula hypoleucus (Phalangeridae).

    Science.gov (United States)

    Molloy, Shaun W; Davis, Robert A; van Etten, Eddie J B

    2016-01-01

    Species distribution models (SDMs) are an effective way of predicting the potential distribution of species and their response to environmental change. Most SDMs apply presence data to a relatively generic set of predictive variables such as climate. However, this weakens the modelling process by overlooking the responses to more cryptic predictive variables. In this paper we demonstrate a means by which data gathered from an intensive animal trapping study can be used to enhance SDMs by combining field data with bioclimatic modelling techniques to determine the future potential distribution for the koomal (Trichosurus vulpecula hypoleucus). The koomal is a geographically isolated subspecies of the common brushtail possum, endemic to south-western Australia. Since European settlement this taxon has undergone a significant reduction in distribution due to its vulnerability to habitat fragmentation, introduced predators and tree/shrub dieback caused by a virulent group of plant pathogens of the genus Phytophthora. An intensive field study found: 1) the home range for the koomal rarely exceeded 1 km in in length at its widest point; 2) areas heavily infested with dieback were not occupied; 3) gap crossing between patches (>400 m) was common behaviour; 4) koomal presence was linked to the extent of suitable vegetation; and 5) where the needs of koomal were met, populations in fragments were demographically similar to those found in contiguous landscapes. We used this information to resolve a more accurate SDM for the koomal than that created from bioclimatic data alone. Specifically, we refined spatial coverages of remnant vegetation and dieback, to develop a set of variables that we combined with selected bioclimatic variables to construct models. We conclude that the utility value of an SDM can be enhanced and given greater resolution by identifying variables that reflect observed, species-specific responses to landscape parameters and incorporating these responses

  9. Incorporating Field Studies into Species Distribution and Climate Change Modelling: A Case Study of the Koomal Trichosurus vulpecula hypoleucus (Phalangeridae)

    Science.gov (United States)

    Davis, Robert A.; van Etten, Eddie J. B.

    2016-01-01

    Species distribution models (SDMs) are an effective way of predicting the potential distribution of species and their response to environmental change. Most SDMs apply presence data to a relatively generic set of predictive variables such as climate. However, this weakens the modelling process by overlooking the responses to more cryptic predictive variables. In this paper we demonstrate a means by which data gathered from an intensive animal trapping study can be used to enhance SDMs by combining field data with bioclimatic modelling techniques to determine the future potential distribution for the koomal (Trichosurus vulpecula hypoleucus). The koomal is a geographically isolated subspecies of the common brushtail possum, endemic to south-western Australia. Since European settlement this taxon has undergone a significant reduction in distribution due to its vulnerability to habitat fragmentation, introduced predators and tree/shrub dieback caused by a virulent group of plant pathogens of the genus Phytophthora. An intensive field study found: 1) the home range for the koomal rarely exceeded 1 km in in length at its widest point; 2) areas heavily infested with dieback were not occupied; 3) gap crossing between patches (>400 m) was common behaviour; 4) koomal presence was linked to the extent of suitable vegetation; and 5) where the needs of koomal were met, populations in fragments were demographically similar to those found in contiguous landscapes. We used this information to resolve a more accurate SDM for the koomal than that created from bioclimatic data alone. Specifically, we refined spatial coverages of remnant vegetation and dieback, to develop a set of variables that we combined with selected bioclimatic variables to construct models. We conclude that the utility value of an SDM can be enhanced and given greater resolution by identifying variables that reflect observed, species-specific responses to landscape parameters and incorporating these responses

  10. The Tale of the Possum.

    Science.gov (United States)

    Billy, Zonie; And Others

    The story is about how Possum wanted a beautiful tail like Raccoon. Raccoon jokingly tells Possum how he got his pretty black stripes by wrapping his tail with hickory bark and singing it in hot ashes. As a result of Possum doing as Raccoon told him, oppossums today have no hair on their tails, travel at night because of embarrassment, and "play…

  11. Combining aspirin with cholecalciferol (vitamin D3--a potential new tool for controlling possum populations.

    Directory of Open Access Journals (Sweden)

    David R Morgan

    Full Text Available The introduced Australian brushtail possum is a major vertebrate pest in New Zealand, with impacts on conservation and agriculture being managed largely through poisoning operations. Cholecalciferol (vitamin D3 is registered for use in controlling possums and despite its many advantages it is expensive and relatively inhumane. Combination of a high proportion of aspirin with a low proportion of cholecalciferol was effective in killing high proportions of groups of acclimatised, caged possums: this is attributed to both an unexpectedly high toxicity of the type of cholecalciferol used, and a proposed synergistic mechanism between the two compounds. Death was caused by localised damage to heart ventricles by aspirin, and inhibition of tissue repair by both aspirin and cholecalciferol. The observed toxicosis had lower impact on the welfare of possums than either compound administered alone, particularly aspirin alone. Residue analyses of bait remains in the GI tract suggested a low risk of secondary poisoning by either compound. The combination of cholecalciferol and aspirin has the potential to meet key requirements of cost-effectiveness and humaneness in controlling possum populations, but the effect of the combination in non-target species has yet to be tested.

  12. Managing and eradicating wildlife tuberculosis in New Zealand

    OpenAIRE

    Warburton, B.; Livingstone, P

    2015-01-01

    Abstract Tuberculosis (TB) due to Mycobacterium bovis infection was first identified in brushtail possums (Trichosurus vulpecula) in New Zealand in the late 1960s. Since the early 1970s, possums in New Zealand have been controlled as part of an ongoing strategy to manage the disease in livestock. The TB management authority (TBfree New Zealand) currently implements three strategic choices for disease-related possum control: firstly TB eradication in areas selected for eradication of the disea...

  13. The Ambiguous Voices of Possum

    DEFF Research Database (Denmark)

    Have, Iben

    A categorization of the levels of the soundtrack will provide the foundation for analytical notions on how the soundtrack of Possum challenges the recipient by operating in a field between diegetic and nondiegetic, realistic and supernatural, and human and animal sounds....

  14. Comparative audit: the trouble with POSSUM

    OpenAIRE

    Bann, Simon D; Sarin, Sanjeev

    2001-01-01

    The Physiological and Operative Severity Score for the enUmeration of Mortality and Morbidity (POSSUM) has been proposed for use in comparative audit between surgeons and between hospitals. To assess its feasibility, POSSUM scoring was attempted on admission in all patients under the care of two consultant surgeons over a six-month period. Scores were awarded only if all investigations necessary for POSSUM were performed; investigations unnecessary for effective treatm...

  15. Epidemiology, diagnostics, and management of tuberculosis in domestic cattle and deer in New Zealand in the face of a wildlife reservoir

    OpenAIRE

    Buddle, BM; de Lisle, GW; Griffin, JFT; Hutchings, SA

    2015-01-01

    Abstract The control of tuberculosis (TB) in cattle and farmed deer in New Zealand has been greatly influenced by the existence of a wildlife reservoir of Mycobacterium bovis infection, principally the Australian brushtail possum (Trichosurus vulpecula). The reduction in possum numbers in areas with endemic M. bovis infection through vigorous vector control operations has been a major contributor to the marked reduction in the number of infected cattle and farmed deer herds in the past two de...

  16. An evaluation of POSSUM and P-POSSUM scoring in predicting post-operative mortality in a level 1 critical care setting

    OpenAIRE

    Scott, Sarah; Lund, Jonathan N; Gold, Stuart; Elliott, Richard; Vater, Mair; Chakrabarty, Mallicka P; Heinink, Thomas P; Williams, John P

    2014-01-01

    Background POSSUM and P-POSSUM are used in the assessment of outcomes in surgical patients. Neither scoring systems’ accuracy has been established where a level 1 critical care facility (level 1 care ward) is available for perioperative care. We compared POSSUM and P-POSSUM predicted with observed mortality on a level 1 care ward. Methods A prospective, observational study was performed between May 2000 and June 2008. POSSUM and P-POSSUM scores were calculated for all postoperative patients w...

  17. Evaluation of POSSUM and P-POSSUM as a tool for prediction of surgical outcomes in the Indian population

    OpenAIRE

    Yadav K; Singh M; Griwan MS; Mishra TS; Kumar N; Kumar H

    2011-01-01

    BackgroundIncreased scrutiny and the need to institute a truly patientcentered approach to surgical care has motivated thegrowing interest in measuring the quality of surgical carethrough comparative surgical audit. This study aimed toassess the validity of the POSSUM (Physiological andOperative Severity Score for enumeration of Mortality andMorbidity) and P-POSSUM (Portsmouth-POSSUM) score inpredicting the risk of morbidity and mortality respectively ingeneral surgical patients presenting wi...

  18. Evaluation of POSSUM for Patients Undergoing Pancreatoduodenectomy

    OpenAIRE

    Castro,, A.J.; Houwert, J. T.; Lagarde, S. M.; Reitsma, J.B.; Busch, O.R.C.; Gulik, van, T.M.; Obertop, H.; Gouma, D. J.

    2009-01-01

    Comparison of operative morbidity rates after pancreatoduodenectomy between units may be misleading because it does not take into account the physiological variable of the condition of the patients. The aim of the present study was to evaluate the Physiological and Operative Severity Score for the enUmeration of Mortality and Morbidity (POSSUM) for pancreatoduodenectomy patients and to look for risk factors associated with morbidity in a high-volume center. Between January 1993 and April 2006...

  19. Evaluation of POSSUM for Patients Undergoing Pancreatoduodenectomy

    OpenAIRE

    Castro,, A.J.; Houwert, J. T.; Lagarde, S. M.; Reitsma, J.B.; Busch, O.R.C.; Gulik, van, T.M.; Obertop, H.; Gouma, D. J.

    2009-01-01

    Background Comparison of operative morbidity rates after pancreatoduodenectomy between units may be misleading because it does not take into account the physiological variable of the condition of the patients. The aim of the present study was to evaluate the Physiological and Operative Severity Score for the enUmeration of Mortality and Morbidity (POSSUM) for pancreatoduodenectomy patients and to look for risk factors associated with morbidity in a high-volume center. Methods Between January ...

  20. Evaluation of POSSUM and P-POSSUM as a tool for prediction of surgical outcomes in the Indian population

    Directory of Open Access Journals (Sweden)

    Yadav K

    2011-07-01

    Full Text Available BackgroundIncreased scrutiny and the need to institute a truly patientcentered approach to surgical care has motivated thegrowing interest in measuring the quality of surgical carethrough comparative surgical audit. This study aimed toassess the validity of the POSSUM (Physiological andOperative Severity Score for enumeration of Mortality andMorbidity and P-POSSUM (Portsmouth-POSSUM score inpredicting the risk of morbidity and mortality respectively ingeneral surgical patients presenting with conditions ofvarious operative severities at a tertiary care centre inHaryana, a northern state of India.MethodA prospective study was performed in 100 general surgicalpatients including an equal number of patients in each ofthe four groups of operative severity i.e. minor, moderate,major, major plus. The risks of mortality and morbidity werecalculated by using the POSSUM equation for morbidity andthe P-POSSUM equation for mortality in each patient. Thepredicted risks were compared with the observed risks ofmortality and morbidity and statistically analysed.ResultsThe difference in p value of predicted risk of morbidity byPOSSUM equation and observed morbidity; calculated bychi square test was 0.756 which was not statisticallysignificant. The difference in p value of predicted mortalityby P-POSSUM equation and observed mortality; calculatedby chi square test was 0.472 which was also not statisticallysignificant.ConclusionPOSSUM and P-POSSUM appear to be good and validindices for use in the risk prediction of morbidity andmortality in the north Indian population.

  1. Optimising the Application of Multiple-Capture Traps for Invasive Species Management Using Spatial Simulation

    OpenAIRE

    Warburton, Bruce; Gormley, Andrew M.

    2015-01-01

    Internationally, invasive vertebrate species pose a significant threat to biodiversity, agricultural production and human health. To manage these species a wide range of tools, including traps, are used. In New Zealand, brushtail possums (Trichosurus vulpecula), stoats (Mustela ermine), and ship rats (Rattus rattus) are invasive and there is an ongoing demand for cost-effective non-toxic methods for controlling these pests. Recently, traps with multiple-capture capability have been developed ...

  2. Masticatory Motor Patterns in Six Herbivorous Australian Marsupials

    OpenAIRE

    Crompton, Alfred; Skinner, John; Lieberman, Daniel; Owerkovicz, Tomasz

    2007-01-01

    Electomyograms of the adductor muscles of the hairy-nosed wombat (Lasiorhinus latifrons), red kangaroo (Macropus rufus), Tammar wallaby (M. eugenii), koala (Phascolarctos cinereus), potoroo (Potorous tridactylus) and the brush-tailed possum (Trichosurus vulpecula) were analyzed and compared with those of placental herbivores. Marsupials have developed several different and distinct masticatory motor patterns that are all fundamentally different from those of placental herbivores where jaw mov...

  3. Development of the New Zealand strategy for local eradication of tuberculosis from wildlife and livestock

    OpenAIRE

    Livingstone, PG; Hancox, N; Nugent, G.; Mackereth, G; Hutchings, SA

    2015-01-01

    Abstract We describe the progressive development of New Zealand's national strategy for control of tuberculosis (TB) in its agricultural sector over the last four decades. The strategy is globally unique, reflecting the need for effective and co-ordinated management of TB in a wildlife maintenance host, the brushtail possum (Trichosurus vulpecula), in addition to controlling infection in cattle and farmed deer herds. Since the early 1990s, the strategy has been developed by the Animal Health ...

  4. Risk Assessment of Mortality Following Intraoperative Cardiac Arrest Using POSSUM and P-POSSUM in Adults Undergoing Non-Cardiac Surgery

    OpenAIRE

    Kim, Shin Hyung; Kil, Hae Keum; Kim, Hye Jin; Koo, Bon-Nyeo

    2015-01-01

    Purpose The Physiological and Operative Severity Score for enUmeration of Mortality and morbidity (POSSUM) and its Portsmouth modification (P-POSSUM) are comprehensive assessment methods for evaluating patient and surgical factors widely used to predict 30-day mortality rates. In this retrospective study, we evaluated the usefulness of POSSUM and P-POSSUM in predicting 30-day mortality after intraoperative cardiac arrests in adult patients undergoing non-cardiac surgery. Materials and Methods...

  5. Potentiele puntemissies van gewasbeschermingsmiddelen naar oppervlaktewater berekend met POSSUM

    OpenAIRE

    Beltman, W.H.J.; Werd, de, H.A.E.

    2013-01-01

    Activiteiten met gewasbeschermingsmiddelen kunnen leiden tot puntemissies naar oppervlaktewater met als gevolg overschrijdingen van normen. Voor drie voorbeeld bedrijven is de potentiële emissie van gewasbeschermingsmiddelen naar oppervlaktewater berekend met het POSSUM model (POint Sources SUrface water Model)

  6. Evaluation of the POSSUM, P-POSSUM and E-PASS scores in the surgical treatment of hilar cholangiocarcinoma

    OpenAIRE

    Wang, Hui; Wang, Haolu; Tao CHEN; Liang, Xiaowen; Song, Yanyan; Wang, Jian

    2014-01-01

    Background The Physiological and Operative Severity Score for the enUmeration of Mortality and morbidity (POSSUM) model, its Portsmouth (P-POSSUM) modification and the Estimation of physiologic ability and surgical stress (E-PASS) are three surgical risk scoring systems used extensively to predict postoperative morbidity and mortality in general surgery. The aim was to undertake the first study of the predictive value of these models in patients undergoing surgical treatment of hilar cholangi...

  7. Analysis of POSSUM score and postoperative morbidity in patients with rectal cancer undergoing surgery

    OpenAIRE

    Valenti, V.; Hernandez-Lizoain, J.L. (José Luis); J. Baixauli; Pastor, C.; Martinez-Regueira, F. (Fernando); Beunza, J J; Aristu, J. (Javier); J.A. Cienfuegos

    2009-01-01

    The Physiological and Operative Severity Score for the enUmeration of Mortality and morbidity (POSSUM) and later modifications (P-POSSUM y CR-POSSUM) have been used to predict morbidity and mortality rates among patients with rectal cancer undergoing surgery. These calculations need some adjustment, however. The aim of this study was to assess the applicability of POSSUM to a group of patients with rectal cancer undergoing surgery, analysing surgic...

  8. Predictive Value of POSSUM and ACPGBI Scoring in Mortality and Morbidity of Colorectal Resection: A Case–Control Study

    OpenAIRE

    Teeuwen, Pascal H. E.; Bremers, A.J.A.; Groenewoud, J.M.M.; van Laarhoven, C. J. H. M.; Bleichrodt, R.P.

    2010-01-01

    Background Preoperative risk prediction to assess mortality and morbidity may be helpful to surgical decision making. The aim of this study was to compare mortality and morbidity of colorectal resections performed in a tertiary referral center with mortality and morbidity as predicted with physiological and operative score for enumeration of mortality and morbidity (POSSUM), Portsmouth POSSUM (P-POSSUM), and colorectal POSSUM (CR-POSSUM). The second aim of this study was to analyze the accura...

  9. PoSSUM: Polar Suborbital Science in the Upper Mesosphere

    Science.gov (United States)

    Reimuller, J. D.; Fritts, D. C.; Thomas, G. E.; Taylor, M. J.; Mitchell, S.; Lehmacher, G. A.; Watchorn, S. R.; Baumgarten, G.; Plane, J. M.

    2013-12-01

    Project PoSSUM (www.projectpossum.org) is a suborbital research project leveraging imaging and remote sensing techniques from Reusable Suborbital Launch Vehicles (rSLVs) to gather critical climate data through use of the PoSSUM Observatory and the PoSSUM Aeronomy Laboratory. An acronym for Polar Suborbital Science in the Upper Mesosphere, PoSSUM grew from the opportunity created by the Noctilucent Cloud Imagery and Tomography Experiment, selected by the NASA Flight Opportunities Program as Experiment 46-S in March 2012. This experiment will employ an rSLV (e.g. the XCOR Lynx Mark II) launched from a high-latitude spaceport (e.g. Eielson AFB, Alaska or Kiruna, Sweden) during a week-long deployment scheduled for July 2015 to address critical questions concerning noctilucent clouds (NLCs) through flights that transition the cloud layer where the clouds will be under direct illumination from the sun. The 2015 Project PoSSUM NLC campaign will use the unique capability of rSLVs to address key under-answered questions pertaining to NLCs. Specifically, PoSSUM will answer: 1) What are the small-scale dynamics of NLCs and what does this tell us about the energy and momentum deposition from the lower atmosphere? 2) What is the seasonal variability of NLCs, mesospheric dynamics, and temperatures? 3) Are structures observed in the OH layer coupled with NLC structures? 4) How do NLCs nucleate? and 5) What is the geometry of NLC particles and how do they stratify? Instrumentation will include video and still-frame visible cameras (PoSSUMCam), infrared cameras, a mesospheric temperatures experiment, a depolarization LiDAR, a mesospheric density and temperatures experiment (MCAT), a mesospheric winds experiment, and a meteoric smoke detector (MASS). The instrument suite used on PoSSUM will mature through subsequent campaigns to develop an integrated, modular laboratory (the ';PoSSUM Observatory') that will provide repeatable, low cost, in-situ NLC and aeronomy observations as well

  10. Assessment of surgical outcome in general surgery using Portsmouth possum scoring

    OpenAIRE

    Tejaswini Vallabha; Manish Pangi

    2013-01-01

    Objective: The Physiological and Operative Severity Score for the enUmeration of Mortality and morbidity (POSSUM) and its modification, Portsmouth POSSUM, are considered as methods of risk scoring. Application of this scoring system helps in assessing the quality of the health care provided& surgical outcome. Its utilization in our country where the level of healthcare and resources differ is limited. Hence, a prospective study to assess the outcome of surgeries using P Possum scoring system ...

  11. Rapid loss of genetic variation in an endangered possum

    OpenAIRE

    Mitrovski, P.; HOFFMANN, A.A.; Heinze, D.A; Weeks, A R

    2007-01-01

    The endangered mountain pygmy possum is the only Australian marsupial that hibernates under snow cover. Most of its alpine habitat was burnt by a rare fire in 2003, and habitat loss and disturbance have also occurred owing to ski resort development. Here we show that there has been a rapid loss of genetic variation following habitat loss associated with resort development, but no detectable loss of alleles or decrease in heterozygosity following the fire.

  12. Comparative vascular audit using the POSSUM scoring system.

    OpenAIRE

    Copeland, G P; Jones, D.; Wilcox, A.; Harris, P. L.

    1993-01-01

    Comparative audit using overall mortality and morbidity figures can be misleading as they do not take into account variations in surgical procedure and patient fitness. To examine these effects we have compared vascular surgery in two differing hospitals, during a similar 9-month period, using the POSSUM scoring system. In one unit, 255 patients underwent vascular surgery with an operative mortality of 9.4%, and morbidity of 37.3%. In the other unit, 89 patients underwent vascular procedures ...

  13. POSSUM escore como preditor de mortalidade em pacientes cirúrgicos Utilizacion del puntaje POSSUM como indicador de la mortalidad en pacientes quirúrgicos POSSUM scoring system for predicting mortality in surgical patients

    Directory of Open Access Journals (Sweden)

    Adriana Cristina Galbiatti Parminondi Elias

    2009-03-01

    Full Text Available O estudo avaliou a utilização do escore POSSUM (Physiological and Operative Severity Score for Enumeration of Mortality and Morbidity para predizer a mortalidade na prática cirúrgica.Foram analisados 416 pacientes cirúrgicos com internação na UTI para cuidados de pós-operatório. Foram realizadas comparações entre as taxas de mortalidade predita e observada de acordo com 4 grupos de risco: 0-4%, 5-14%, 15-49%, 50% ou mais, e calculada a área sob a curva ROC do escore POSSUM e APACHE II para a mortalidade. A taxa de mortalidade foi de 22,4%. O escores POSSUM e APACHE II superestimaram o risco de morte, e a área sob a curva ROC do POSSUM foi de 0,762 e a do APACHE II de 0,737, sugerindo a utilização do POSSUM como ferramenta auxiliar na predição de risco de morte em pacientes cirúrgicos.El estudio evaluó la utilización del puntaje POSSUM (Physiological and Operative Severity Score for Enumeration of Mortality and Morbity para predecir la mortalidad en la práctica quirúrgica. Fueron analizados 416 pacientes quirúrgicos internados en la UTI para cuidados postoperatorios. Fueron realizadas comparaciones entre las tasas de mortalidad estimada y observada, de acuerdo con 4 grupos de riesgo: 0-4%, 5-14%, 15-49%, 50% o más, y calculada el área debajo de la curva ROC del puntaje POSSUM y APACHE II para la mortalidad. La tasa de mortalidad fue de 2,4%. Los puntajes POSSUM y APACHE II superestimaron el riesgo de muerte, y el área debajo de la curva ROC del POSSUM fue de 0,762 y la del APACHE II de 0,737, lo que sugiere la utilización del POSSUM como herramienta auxiliar en la predicción de riesgo de muerte en pacientes quirúrgicos.This study evaluated the use of the POSSUM (Physiological and Operative Severity Score for Enumeration of Mortality and Morbidity score for predicting mortality in surgical practice. In this study, 416 surgical patients admitted into ICUs for post-surgical care were analyzed. Both predicted and actual

  14. Quantifying short-term foraging movements in a marsupial pest to improve targeted lethal control and disease surveillance.

    Science.gov (United States)

    Yockney, Ivor J; Latham, M Cecilia; Rouco, Carlos; Cross, Martin L; Nugent, Graham

    2015-01-01

    In New Zealand, the introduced marsupial brushtail possum (Trichosurus vulpecula) is a pest species subject to control measures, primarily to limit its ability to transmit bovine tuberculosis (TB) to livestock and for conservation protection. To better define parameters for targeted possum control and TB surveillance, we here applied a novel approach to analyzing GPS data obtained from 44 possums fitted with radio-tracking collars, producing estimates of the animals' short-term nocturnal foraging patterns based on 1-, 3- or 5-nights' contiguous data. Studies were conducted within two semi-arid montane regions of New Zealand's South Island High Country: these regions support low-density possum populations (control) or monitoring devices (for TB surveillance), set for > 3 consecutive nights at 150 m interval spacings, would likely place >95% of the possums in this type of habitat at risk of encountering these devices, year-round. Modelling control efficacy against operational expenditure, based on these estimations, identified the relative cost-effectiveness of various strategies that could be applied to a typical aerial poisoning operation, to reduce the ongoing TB vectorial risk that possums pose in the High Country regions. These habitat-specific findings are likely to be more relevant than the conventional pest control and monitoring methodologies developed for possums in their more typical forested habitat. PMID:25811977

  15. Value of Modified Possum Scoring System on Predicting Operation Risk 
in Elderly NSCLC Patients

    Directory of Open Access Journals (Sweden)

    Rong WANG

    2014-09-01

    Full Text Available Background and objective For the assessment of elderly patients can tolerate lung cancer operation, there is no clear standard. To evaluate the clinical validity of POSSUM (Physiological and Operative Severity Score for the Umeration of Mortality and Morbidity in elderly non-small cell lung cancer (NSCLC surgery patients, we want to provide an important basis for operation treatment decisions. Methods A total of 138 patients, with 88 males and 50 females, with elderly NSCLC surgery between December 2007 and December 2013, are included in PLA general hospital. Using the multivariate Logistic regression analysis, we evaluate the value of each factor on the actual postoperative complications mortality and morbidity. The scorings on standard POSSUM and modified POSSUM in the complication group are compared with the non-complication group using the group t test. Drawing receiver operating characteristic (ROC curve in standard POSSUM group and modified POSSUM group, calculating the area under the curve (AUC, AUC in standard group is compared with modified group using t test. Judge if the modified POSSUM prediction is consistent with the actual mortality and morbidity. Results Among 138 patients, there were 77 postoperative complications in 59 patients, 2 cases of death. According to the Logistic regression analysis, 17 of 18 factors in standard POSSUM, pulmonary function, different TNM stage are predictors for postoperative complications (P<0.05. Age is a predictor for postoperative death (P<0.05. In the standard POSSUM scoring, actual complication group compared with non-complication group, the difference is statistically significant (P<0.01. In the modified POSSUM scoring, complication group is compared with non-complication group, the difference is statistically significant (P<0.01. Compared with the standard POSSUM, the modified POSSUM has better predictive value on postoperative morbidity, and the comparison of AUC between the two groups is

  16. POSSUM escore como preditor de mortalidade em pacientes cirúrgicos Utilizacion del puntaje POSSUM como indicador de la mortalidad en pacientes quirúrgicos POSSUM scoring system for predicting mortality in surgical patients

    OpenAIRE

    Adriana Cristina Galbiatti Parminondi Elias; Tiemi Matsuo; Cíntia Magalhães Carvalho Grion; Lucienne Tibery Queiroz Cardoso; Paulo Henrique Verri

    2009-01-01

    O estudo avaliou a utilização do escore POSSUM (Physiological and Operative Severity Score for Enumeration of Mortality and Morbidity) para predizer a mortalidade na prática cirúrgica.Foram analisados 416 pacientes cirúrgicos com internação na UTI para cuidados de pós-operatório. Foram realizadas comparações entre as taxas de mortalidade predita e observada de acordo com 4 grupos de risco: 0-4%, 5-14%, 15-49%, 50% ou mais, e calculada a área sob a curva ROC do escore POSSUM e APACHE II para a...

  17. Estimation of mortality and morbidity risk of radical cystectomy using POSSUM and the Portsmouth predictor equation

    OpenAIRE

    Masago, Toshihiko; Morizane, Shuichi; Honda, Masashi; Isoyama, Tadahiro; Koumi, Tsutomu; Ono, Kouji; Kadowaki, Hiroyuki; Sejima, Takehiro; Takenaka, Atsushi

    2015-01-01

    Introduction The Physiological and Operative Severity Score for the enumeration of Mortality and Morbidity (POSSUM) and the Portsmouth predictor equation (P-POSSUM) are simple scoring systems used to estimate the risk of complications and death postoperatively. We investigated the use of these scores to predict the postoperative risk in patients undergoing radical cystectomy (RC). Material and methods In this retrospective study, we enrolled 280 patients who underwent RC for invasive bladder ...

  18. Validation of the use of POSSUM score in enteric perforation peritonitis - results of a prospective study

    OpenAIRE

    Sunil KUMAR; Gupta, Amit; Chaudhary, Sujata; Agrawal, Neeraj

    2011-01-01

    Introduction The objective of the study was to present our last 5-years experience of peritonitis and validate POSSUM score in predicting mortality and morbidity in patients of enteric perforation (EP) peritonitis. Methods Data was collected prospectively for all peritonitis cases admitted in single surgical unit from January 2005 to December 2009. Parameters for calculating POSSUM were also retrieved; in these patients, O:E (Observed vs. Expected) ratio of mortality and morbidity were estima...

  19. Evaluation of POSSUM scoring system in patients with gastric cancer undergoing D2-gastrectomy

    OpenAIRE

    Monig Stefan P; Lubke Thomas; Bollschweiler Elfriede; Holscher Arnulf H

    2005-01-01

    Abstract Background Risk adjustment and stratification play an important role in quality assurance and in clinical research. The Physiological and Operative Severity Score for the enUmeration of Mortality and morbidity (POSSUM) is a patient risk prediction model based on 12 patient characteristics and 6 characteristics of the surgery performed. However, because the POSSUM was developed for quality assessment in general surgical units, its performance within specific subgroups still requires e...

  20. Validación de los índices POSSUM Y Portsmouth-POSSUM en cirugía general en dos instituciones de segundo nivel: estudio analítico tipo corte transversal

    OpenAIRE

    Héctor J. Meléndez; José R Contreras

    2008-01-01

    Introducción. Los índices POSSUM y Portsmouth-POSSUM se basan en variables antes y durante la cirugía y no sólo predicen la morbimortalidad, sino que también son útiles para valorar la calidad de la atención en salud. Son de amplia difusión en Inglaterra y casi desconocidos entre nosotros. Son prácticos, económicos, sencillos y rápidos de ejecutar. Objetivos. Validar estos índices, POSSUM y Portsmouth-POSSUM, en dos instituciones de segundo nivel. métodos. Mediante un estudio tipo corte trasv...

  1. Efficacy of Possum Score in Predicting the Outcome in Patients Undergoing Emergency Laparotomy

    Directory of Open Access Journals (Sweden)

    Sreeharsha Harinatha

    2014-04-01

    Full Text Available Monitoring of surgical outcome is increasingly important part of governance of surgical activity. The aim of the study. POSSUM scoring system was applied prospectively to determine how it performed in predicting morbidity and mortality in patients undergoing emergency laparotomy in our hospital, a group known to be at high risk of complications and death. Material and methods. A total of 100 cases of emergency laparotomies were studied in patients admitted in general surgery department during the period of May 2008 to August 2010. The study group consisted of the following cases. Duodenal perforation (37 cases, intestinal obstruction (27 cases, gastric perforation (8 cases, ileal perforation (8 cases, appendicular perforation (7 cases, blunt trauma (4 cases and others (9 cases. They were scored using POSSUM scoring system. Physiological scoring was done at the time of admission and operative scoring was done intraoperatively. They were followed up for the first 30 day post operative period for any complications and the outcome was noted. The observed morbidity and mortality rates were compared with the POSSUM predicted morbidity and mortality rates. Results. 15 patients died (mortality rate of 15%. The POSSUM predicted mortality was 20 deaths. O:E ratio of 0.71 was obtained. There was no statistically significant difference between the observed and predicted mortality rates (χ2=1.72, p=0.974. 71 patients experienced complications. The POSSUM predicted morbidity was 61 patients. O:E ratio of 1.19 was obtained. There was no statistically significant difference between the observed and predicted morbidity rates (χ2=1.594, p=0.991. Conclusions. POSSUM scoring is an accurate predictor of mortality and morbidity following emergency laparotomy and is a valid means of assessing adequacy of care provided to the patient. POSSUM can be used for surgical audit to assess and improve the quality of surgical care and helps in better outcome to the patient

  2. The P-POSSUM scoring systems for predicting the mortality of neurosurgical patients undergoing craniotomy: Further validation of usefulness and application across healthcare systems

    OpenAIRE

    Mercer, S. J.; Arpan Guha; V J Ramesh

    2013-01-01

    Background and Aims: Continuous audit of clinical practice is an essential part of making improvements in medicine and enhancing patient care. Validated tools are needed to gather evidence for comparisons. Recently, Physiological and Operative Severity Score for the enumeration of Mortality and morbidity (POSSUM) and Portsmouth-POSSUM (P-POSSUM) scores were evaluated in Indian patients undergoing elective craniotomy and it was concluded that P-POSSUM was highly accurate in predicting overall ...

  3. Assessment of surgical outcome in general surgery using Portsmouth possum scoring

    Directory of Open Access Journals (Sweden)

    Tejaswini Vallabha

    2013-01-01

    Full Text Available Objective: The Physiological and Operative Severity Score for the enUmeration of Mortality and morbidity (POSSUM and its modification, Portsmouth POSSUM, are considered as methods of risk scoring. Application of this scoring system helps in assessing the quality of the health care provided& surgical outcome. Its utilization in our country where the level of healthcare and resources differ is limited. Hence, a prospective study to assess the outcome of surgeries using P Possum scoring system in a teaching hospital at district level and compare with other health care facilities with similar and different settings was taken up. Methods: 175 major surgeries were studied. Using P-POSSUM equation, predicted mortality rates were calculated & compared with the actual outcome. The predicted mortality & actual outcome was compared with other studies done in similar and different health care levels. Results: An observed to expected ratio of 0.96 was obtained, indicating there was no significant difference between expected to observed mortality rates suggesting a reasonably good quality of outcome in comparison with other health care systems. Conclusion: The quality of surgical care provided and surgical outcome are comparable to other health care systems with observed to expected mortality ratio being nearly same. P Possum can be used as a tool for outcome audits.

  4. Penerapan Metode Possum Pada Penderita Yang Menjalani Laparotomi Emergensi Di Rumah Sakit Tempat Pendidikan FK Usu Tahun 2008

    OpenAIRE

    T. Mahdi Syafri

    2009-01-01

    Latar belakang Kemampuan memprediksi morbiditas dan mortalitas pasca tindakan operasi merupakan bagian yang esensial dari keseluruhan penatalaksanaan bedah karena morbiditas dan terutama mortalitas merupakan hasil yang penting dan objektif. Possum sebagai alat ukur untuk mengkoreksi hasil pembedahan dan sebagai prediksi untuk laju morbiditas dan mortalitas yang mengikuti suatu analisis yang berbasis pada tingkatan dari penyakit. Dengan studi ini, kebenaran dari Possum dapat diaplikasikan p...

  5. Evaluation of POSSUM scoring system in patients with gastric cancer undergoing D2-gastrectomy

    Directory of Open Access Journals (Sweden)

    Monig Stefan P

    2005-04-01

    Full Text Available Abstract Background Risk adjustment and stratification play an important role in quality assurance and in clinical research. The Physiological and Operative Severity Score for the enUmeration of Mortality and morbidity (POSSUM is a patient risk prediction model based on 12 patient characteristics and 6 characteristics of the surgery performed. However, because the POSSUM was developed for quality assessment in general surgical units, its performance within specific subgroups still requires evaluation. The aim of the present study was to assess the accuracy of POSSUM in predicting mortality and morbidity in patients with gastric cancer undergoing D2-gastrectomy. Methods 137 patients with gastric cancer undergoing gastrectomy were included in this study. Detailed, standardized risk assessments and thorough documentation of the post-operative courses were performed prospectively, and the POSSUM scores were then calculated. Results The 30- and 90- day mortality rates were 3.6% (n = 5 and 5.8% (n = 8, respectively. 65.7% (n = 90 of patients had normal postoperative courses without major complications, 14.6% (n = 20 had moderate and 13.9% (n = 19 had severe complications. The number of mortalities predicted by the POSSUM-Mortality Risk Score (R1 was double the actual number of mortalities occurring in the median and high-risk groups, and was more than eight times the actual number of mortalities occurring in the low-risk group (R1 p Conclusion The POSSUM Score may be beneficial and can be used for assessment of the peri- and post-operative courses of patients with gastric carcinoma undergoing D2-gastrectomy. However, none of the scores examined here are useful for preoperative prediction of postoperative course.

  6. A major role for mammals in the ecology of Mycobacterium ulcerans.

    Directory of Open Access Journals (Sweden)

    Janet A M Fyfe

    Full Text Available BACKGROUND: Mycobacterium ulcerans is the causative agent of Buruli ulcer (BU, a destructive skin disease found predominantly in sub-Saharan Africa and south-eastern Australia. The precise mode(s of transmission and environmental reservoir(s remain unknown, but several studies have explored the role of aquatic invertebrate species. The purpose of this study was to investigate the environmental distribution of M. ulcerans in south-eastern Australia. METHODOLOGY/PRINCIPAL FINDINGS: A range of environmental samples was collected from Point Lonsdale (a small coastal town southwest of Melbourne, Australia, endemic for BU and from areas with fewer or no reported incident cases of BU. Mycobacterium ulcerans DNA was detected at low levels by real-time PCR in soil, sediment, water residue, aquatic plant biofilm and terrestrial vegetation collected in Point Lonsdale. Higher levels of M. ulcerans DNA were detected in the faeces of common ringtail (Pseudocheirus peregrinus and common brushtail (Trichosurus vulpecula possums. Systematic testing of possum faeces revealed that M. ulcerans DNA could be detected in 41% of faecal samples collected in Point Lonsdale compared with less than 1% of faecal samples collected from non-endemic areas (p<0.0001. Capture and clinical examination of live possums in Point Lonsdale validated the accuracy of the predictive value of the faecal surveys by revealing that 38% of ringtail possums and 24% of brushtail possums had laboratory-confirmed M. ulcerans skin lesions and/or M. ulcerans PCR positive faeces. Whole genome sequencing revealed an extremely close genetic relationship between human and possum M. ulcerans isolates. CONCLUSIONS/SIGNIFICANCE: The prevailing wisdom is that M. ulcerans is an aquatic pathogen and that BU is acquired by contact with certain aquatic environments (swamps, slow-flowing water. Now, after 70 years of research, we propose a transmission model for BU in which terrestrial mammals are implicated as

  7. Managing and eradicating wildlife tuberculosis in New Zealand.

    Science.gov (United States)

    Warburton, B; Livingstone, P

    2015-06-01

    Tuberculosis (TB) due to Mycobacterium bovis infection was first identified in brushtail possums (Trichosurus vulpecula) in New Zealand in the late 1960s. Since the early 1970s, possums in New Zealand have been controlled as part of an ongoing strategy to manage the disease in livestock. The TB management authority (TBfree New Zealand) currently implements three strategic choices for disease-related possum control: firstly TB eradication in areas selected for eradication of the disease from livestock and wildlife, secondly Free Area Protection in areas in which possums are maintained at low densities, normally along a Vector Risk Area (VRA) boundary, and thirdly Infected Herd Suppression, which includes the remaining parts of VRA where possums are targeted to minimise the infection risk to livestock. Management is primarily through a range of lethal control options. The frequency and intensity of control is driven by a requirement to reduce populations to very low levels (usually to a trap-catch index below 2%), then to hold them at or below this level for 5-10 years to ensure disease eradication.Lethal possum control is implemented using aerial- and ground-based applications, under various regulatory and operational constraints. Extensive research has been undertaken aimed at improving the efficacy and efficiency of control. Aerial applications use sodium fluoroacetate (1080) bait for controlling possums over extensive and rugged areas of forest that are difficult to access by foot. Ground-based control uses a range of toxins (primarily, a potassium cyanide-based product) and traps. In the last 5 years there has been a shift from simple possum population control to the collection of spatial data on possum presence/absence and relative density, using simple possum detection devices using global positioning system-supported data collection tools, with recovery of possum carcasses for diagnostic necropsy. Such data provide information subsequently used in predictive

  8. Dallong – Possum Skin Rugs: A Study of an Inter-Cultural Trade Item in Victoria

    Directory of Open Access Journals (Sweden)

    Fred Cahir

    2005-10-01

    Full Text Available The purpose of this article is to describe and understand the ethno-historical evidence for inter-cultural exchange, specifically in possum skins, that existed between some Indigenous groups and the non-Indigenous colonists of Victoria between 1835 and 1900.

  9. Dallong – Possum Skin Rugs: A Study of an Inter-Cultural Trade Item in Victoria

    OpenAIRE

    Fred Cahir

    2005-01-01

    The purpose of this article is to describe and understand the ethno-historical evidence for inter-cultural exchange, specifically in possum skins, that existed between some Indigenous groups and the non-Indigenous colonists of Victoria between 1835 and 1900.

  10. An immunohistochemical study of gastrointestinal endocrine cells in a nectarivorous marsupial, the honey possum (Tarsipes rostratus).

    OpenAIRE

    Yamada, J.; Richardson, K C; Wooller, R D

    1989-01-01

    The distribution and relative frequency of occurrence of gastrointestinal endocrine cells exhibiting immunoreactivity to eleven peptides and one amine were examined immunohistochemically in the gastrointestinal mucosa of the adult honey possum which feeds almost exclusively on nectar and pollen. Seven types of endocrine cells, immunoreactive for serotonin, somatostatin, gastrin, motilin, enteroglucagon, neurotensin and gastric inhibitory peptide (GIP), were detected in the gastrointestinal mu...

  11. Biparental care and obligate monogamy in the rock-haunting possum, Petropseudes dahli, from tropical Australia.

    Science.gov (United States)

    Runcie

    2000-05-01

    Monogamy is rare among mammals, including marsupials. I studied the social organization of the little-known rock-haunting possum in Kakadu National Park in Northern Australia. Preliminary field observations revealed that the majority of possums live in cohesive groups consisting of a female-male pair and young, suggesting a monogamous mating system. I used radiotracking to determine home range patterns, and observations to measure the degree of symmetry between the sexes in maintaining the pair bond and initiating changes in group activity. I also measured the extent of maternal and paternal indirect and direct care. Nocturnal observations and radiotelemetric data from 3 years showed that six possum groups maintained nonoverlapping home ranges with long-term consorts and young sharing dens. Males contributed more than females to maintaining the pair bond but they contributed equally to parental care. For the first time, the parental behaviours of bridge formation, embracing, marshalling of young, sentinel behaviour and tail beating are reported in a marsupial. Males participated to a high degree in maintaining relationships with one mate and their offspring. Collectively, these results suggest that the mating system of this wild population of rock-haunting possums is obligate social monogamy. Copyright 2000 The Association for the Study of Animal Behaviour. PMID:10860527

  12. Dicty_cDB: SHF845 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SH (Link to library) SHF845 (Link to dictyBase) - - - Contig-U11241-1 - (Link to Original site) ... its) Value N DY614703 |DY614703.1 IMMUNEF045805H24 POSSUM _01-C-POSSUM -IMMUNE-2KB Trichosurus vulpecula cDNA ... e. 40 0.68 2 DY596878 |DY596878.1 KIDNEYF074988H10 POSSUM _01-POSSUM -KIDNEY-2KB Trichosurus vulpecula cDNA cl ... ence. 40 0.76 2 DY593007 |DY593007.1 GUTF031289C19 POSSUM _01-POSSUM -GUT-2KB Trichosurus vulpecula cDNA clone ...

  13. Dicty_cDB: VHD263 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHD263 (Link to dictyBase) - - - Contig-U16438-1 VHD263P (Link to Original ... . 36 0.033 3 DY606328 |DY606328.1 IMMUNEF045811F15 POSSUM _01-C-POSSUM -IMMUNE-2KB Trichosurus vulpecula cDNA ... e. 52 0.044 1 DY601389 |DY601389.1 LIVERF074993O11 POSSUM _01-POSSUM -LIVER-2KB Trichosurus vulpecula cDNA clo ... e. 52 0.044 1 DY600634 |DY600634.1 LIVERF074991B17 POSSUM _01-POSSUM -LIVER-2KB Trichosurus vulpecula cDNA clo ...

  14. Does adding ICU data to the POSSUM score improve the prediction of outcomes following surgery for upper gastrointestinal malignancies?

    Science.gov (United States)

    Butterfield, R; Stedman, W; Herod, R; Aneman, A

    2015-07-01

    Surgery for upper gastrointestinal malignancy carries a high postoperative mortality and morbidity risk. The importance of preoperative physiological reserve and intraoperative events in determining clinical outcomes is recognised in the Physiological and Operative Severity Score for the enUmeration of Mortality and Morbidity (POSSUM) score that comprises variables relevant to both phases. Whether adding variables linked to ICU admission characteristics improves the predictive capacity of POSSUM is unclear, especially in an Australian/New Zealand healthcare context. This study aimed to evaluate the predictive capacity of the POSSUM score for 30-day mortality and in-hospital morbidity in 80 patients undergoing resection of oesophageal (28%), gastric (26%) or pancreatic (46%) malignancies and admitted to ICU. The 30-day mortality was 8.8% and 65% of patients developed some postoperative complication. Receiver operating characteristics generated an area under the curve (95% CI) to predict mortality by Portsmouth POSSUM of 0.87 (0.77 to 0.93) and morbidity by POSSUM of 0.67 (0.55 to 0.77). Multiple regression analysis including biochemical variables and vital signs on admission to ICU identified renal function parameters, fluid balance and need for cardiorespiratory support beyond the first postoperative day as independent factors associated with mortality and morbidity (in addition to the POSSUM score) but the inclusion of these variables in a logistic regression model did not significantly improve the predictive capacity for mortality (to area under the curve 0.93 [0.85 to 0.97]) or morbidity (to area under the curve 0.67 [0.55 to 0.78]). In conclusion, the POSSUM score provides clinically useful predictive capacity in patients undergoing surgery for upper gastrointestinal malignancies. The incorporation of ICU admission variables to the pre- and intraoperative POSSUM variables did not significantly enhance the precision. PMID:26099762

  15. P-POSSUM - Preditor de mortalidade e morbilidade em cistectomias radicais?

    OpenAIRE

    Calixto, L.; Areias, A.; Amadeu, E.

    2013-01-01

    Introdução: A predição do risco pré-operatório pode ser um dado útil na tomada da decisão cirúrgica. O P-POSSUM (Portsmouth POSSUM - Physiological and Operative Severity Score for the enUmeration of Mortality and morbidity) é um sistema baseado em variáveis fisiológicas e cirúrgicas, validado para cirurgia geral, que estima a mortalidade e morbilidade de cada doente aos 30 dias após a cirurgia (1). Em grandes séries de doentes submetidos a cistectomia radical estão descritas taxas de 2,5 e 28...

  16. Value of Modified Possum Scoring System on Predicting Operation Risk 
in Elderly NSCLC Patients

    OpenAIRE

    Wang, Rong; Dewei GAO; Gong, Weiqin; Zhiru LIANG

    2014-01-01

    Background and objective For the assessment of elderly patients can tolerate lung cancer operation, there is no clear standard. To evaluate the clinical validity of POSSUM (Physiological and Operative Severity Score for the Umeration of Mortality and Morbidity) in elderly non-small cell lung cancer (NSCLC) surgery patients, we want to provide an important basis for operation treatment decisions. Methods A total of 138 patients, with 88 males and 50 females, with elderly NSCLC surgery between ...

  17. Predictive value of POSSUM score in surgery of acute abdomen in cirrhotic patients

    OpenAIRE

    Banu, P; Popa, F; Constantin, VD; Balalau, C

    2013-01-01

    Abstract Introduction: As liver cirrhosis has an increasing incidence in the general population and the life expectancy for these patients has increased, surgery procedures practiced for acute abdomen in such category of patients are more frequent. Aim: To evaluate the predictive value of POSSUM score in cirrhotic patients undergoing abdominal surgery in emergency cases. Material and method: A prospective study based on 115 consecutive patients with liver cirrhosis hospitalized and operated i...

  18. Evaluation of a Modified POSSUM Scoring System for Predicting the Morbidity in Patients Undergoing Lumbar Surgery

    OpenAIRE

    Ying, Li; Bo, Bai; Huo-yan, Wu; Hong, Zhuang

    2013-01-01

    For most spine surgeons, operative intervention is common for the treatment of lumbar disc herniation, lumbar stenosis, lumbar fracture or lumbar spondylolisthesis. However, with the increase in lumbar surgery, the complication rate increases accordingly. Whereas the Physiological and Operative Severity Score for the enUmeration of Mortality and Morbidity (POSSUM) scoring system has been widely used to predict morbidity in various surgical fields, the application of this system in lumbar surg...

  19. Efficacy of Possum Score in Predicting the Outcome in Patients Undergoing Emergency Laparotomy

    OpenAIRE

    Sreeharsha Harinatha; Sp Rai; Sreekar Harinatha; Reddy Ravi

    2014-01-01

    Monitoring of surgical outcome is increasingly important part of governance of surgical activity. The aim of the study. POSSUM scoring system was applied prospectively to determine how it performed in predicting morbidity and mortality in patients undergoing emergency laparotomy in our hospital, a group known to be at high risk of complications and death. Material and methods. A total of 100 cases of emergency laparotomies were studied in patients admitted in general surgery department during...

  20. oPOSSUM: integrated tools for analysis of regulatory motif over-representation

    OpenAIRE

    Ho Sui, Shannan J; Fulton, Debra L.; Arenillas, David J.; Kwon, Andrew T.; Wasserman, Wyeth W.

    2007-01-01

    The identification of over-represented transcription factor binding sites from sets of co-expressed genes provides insights into the mechanisms of regulation for diverse biological contexts. oPOSSUM, an internet-based system for such studies of regulation, has been improved and expanded in this new release. New features include a worm-specific version for investigating binding sites conserved between Caenorhabditis elegans and C. briggsae, as well as a yeast-specific version for the analysis ...

  1. The Use of Polyethylene Glycol in Mammalian Herbivore Diet Studies: What Are We Measuring?

    Science.gov (United States)

    Windley, Hannah R; Wigley, Hannah J; Ruscoe, Wendy A; Foley, William J; Marsh, Karen J

    2016-06-01

    Polyethylene glycol (PEG) has been used to study the intake and digestion of tannin-rich plants by mammalian herbivores because it preferentially binds to tannins. However, it is not clear whether the responses of herbivores to dietary PEG is due to increased protein availability from the release of tannin-bound protein, amelioration of tannin effects, or whether PEG also may bind to other compounds and change their activity in the gut. We used three native New Zealand tree species to measure the effect of PEG on the amount of foliage eaten by invasive common brushtail possums (Trichosurus vulpecula) and on in vitro digestible nitrogen (available N). The addition of PEG increased the in vitro available N content of Weinmannia racemosa foliage, and possums ate significantly more PEG-treated foliage than untreated foliage. However, possums also ate more PEG-treated Fuchsia excorticata foliage, even though PEG did not increase in vitro available N in this species. Possums ate very little Melicytus ramiflorus, regardless of PEG treatment, even though M. ramiflorus contained the highest concentration of in vitro available N. These results prompted us to use PEG and a protein supplement, casein, to manipulate the available N concentration of diets containing ground eucalypt foliage, a well-studied food species for possums. Again, the response of possums to PEG was independent of changes in in vitro available N. In addition, altering the protein content of the diet via the addition of casein did not affect how much food the possums consumed. We conclude that the effects of PEG on dry matter intake by mammalian herbivores are not due solely to the release of tannin-bound protein. There is need for a better understanding of PEG-tannin interactions in order to ensure that the use of PEG in nutritional studies does not outstrip an understanding of its mechanisms of action. PMID:27256074

  2. Survey Science with ASKAP: Polarization Sky Survey of the Universe's Magnetism (POSSUM)

    Science.gov (United States)

    Gaensler, Bryan M.; Landecker, T. L.; Taylor, A. R.; POSSUM Collaboration

    2010-01-01

    The Australian Square Kilometre Array Pathfinder (ASKAP) is a next-generation radio telescope currently under construction in Western Australia. ASKAP will consist of an array of 36 12-meter antennas, each equipped with a phased-array feed. ASKAP's large instantaneous field-of-view will allow us to survey the whole sky much faster than is possible with existing radio telescopes, and its combination of survey speed and sensitivity will allow astronomers to explore the radio sky in novel ways. After an open international competitive process, ten major surveys have been selected to proceed to a design study phase. At least 75% of ASKAP observing time in the first five years of operation (starting in 2013) will be devoted to pursuing such surveys. Here we present POSSUM, the Polarization Sky Survey of the Universe's Magnetism (POSSUM), which is one of the surveys now beginning a design study. In POSSUM, we propose to use ASKAP's unique survey capabilities to measure the Faraday rotation of three million extragalactic radio sources over 30,000 square degrees, thereby dramatically improve our understanding of astrophysical magnetism. The resulting data-set will revolutionise our understanding of the ordered and turbulent components of the Milky Way's magnetic field, can test dynamo and other models for magnetic field generation in galaxies and clusters, and can carry out a comprehensive census of magnetic fields as a function of redshift in galaxies, active galactic nuclei, galaxy clusters and the overall intergalactic medium.

  3. Relaxation of risk-sensitive behaviour of prey following disease-induced decline of an apex predator, the Tasmanian devil.

    Science.gov (United States)

    Hollings, Tracey; McCallum, Hamish; Kreger, Kaely; Mooney, Nick; Jones, Menna

    2015-07-01

    Apex predators structure ecosystems through lethal and non-lethal interactions with prey, and their global decline is causing loss of ecological function. Behavioural changes of prey are some of the most rapid responses to predator decline and may act as an early indicator of cascading effects. The Tasmanian devil (Sarcophilus harrisii), an apex predator, is undergoing progressive and extensive population decline, of more than 90% in long-diseased areas, caused by a novel disease. Time since local disease outbreak correlates with devil population declines and thus predation risk. We used hair traps and giving-up densities (GUDs) in food patches to test whether a major prey species of devils, the arboreal common brushtail possum (Trichosurus vulpecula), is responsive to the changing risk of predation when they forage on the ground. Possums spend more time on the ground, discover food patches faster and forage more to a lower GUD with increasing years since disease outbreak and greater devil population decline. Loss of top-down effects of devils with respect to predation risk was evident at 90% devil population decline, with possum behaviour indistinguishable from a devil-free island. Alternative predators may help to maintain risk-sensitive anti-predator behaviours in possums while devil populations remain low. PMID:26085584

  4. Dicty_cDB: SHL853 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SH (Link to library) SHL853 (Link to dictyBase) - - - Contig-U11096-1 SHL853P (Link to Original ... e. 107 1e-30 4 EC289560 |EC289560.1 BRAINF089623B7 POSSUM _01-POSSUM -C-BRAIN-2KB Trichosurus vulpecula cDNA c ... ce. 88 5e-28 3 EC286335 |EC286335.1 BRAINF089834J4 POSSUM _01-POSSUM -C-BRAIN-2KB Trichosurus vulpecula cDNA c ... . 88 5e-28 3 EC364387 |EC364387.1 IMMUNEF093542N20 POSSUM _01-C-POSSUM -IMMUNE-2KB Trichosurus vulpecula cDNA ... . 98 1e-27 3 DY611266 |DY611266.1 IMMUNEF045822K24 POSSUM _01-C-POSSUM -IMMUNE-2KB Trichosurus vulpecula cDNA ...

  5. Dicty_cDB: VHB738 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB738 (Link to dictyBase) - - - Contig-U11096-1 | Contig-U12663-1 VHB738P ... 3. 109 9e-44 3 EC286335 |EC286335.1 BRAINF089834J4 POSSUM _01-POSSUM -C-BRAIN-2KB Trichosurus vulpecula cDNA c ... . 92 8e-40 4 EC364387 |EC364387.1 IMMUNEF093542N20 POSSUM _01-C-POSSUM -IMMUNE-2KB Trichosurus vulpecula cDNA ... ce. 92 1e-39 4 EC289560 |EC289560.1 BRAINF089623B7 POSSUM _01-POSSUM -C-BRAIN-2KB Trichosurus vulpecula cDNA c ... 100 1e-32 5 DY611266 |DY611266.1 IMMUNEF045822K24 POSSUM _01-C-POSSUM -IMMUNE-2KB Trichosurus vulpecula cDNA ...

  6. Dicty_cDB: VHB845 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB845 (Link to dictyBase) - - - Contig-U16216-1 - (Link to Original site) ... s. 40 0.77 4 DY605186 |DY605186.1 IMMUNEF045816M22 POSSUM _01-C-POSSUM -IMMUNE-2KB Trichosurus vulpecula cDNA ... nce. 46 1.3 1 EC307169 |EC307169.1 OVARYF089559N15 POSSUM _01-POSSUM -C-OVARY-2KB Trichosurus vulpecula cDNA c ...

  7. Dicty_cDB: VHE125 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHE125 (Link to dictyBase) - - - Contig-U10968-1 VHE125P (Link to Original ... . 52 0.036 1 EG629938 |EG629938.1 EMBRYOF088217M13 POSSUM _01-POSSUM -C-EMBRYO-2KB Trichosurus vulpecula cDNA ... s. 34 0.32 2 EC319940 |EC319940.1 EMBRYOF088886F18 POSSUM _01-POSSUM -C-EMBRYO-2KB Trichosurus vulpecula cDNA ...

  8. oPOSSUM-3: Advanced Analysis of Regulatory Motif Over-Representation Across Genes or ChIP-Seq Datasets

    OpenAIRE

    Kwon, Andrew T.; Arenillas, David J.; Hunt, Rebecca Worsley; Wasserman, Wyeth W.

    2012-01-01

    oPOSSUM-3 is a web-accessible software system for identification of over-represented transcription factor binding sites (TFBS) and TFBS families in either DNA sequences of co-expressed genes or sequences generated from high-throughput methods, such as ChIP-Seq. Validation of the system with known sets of co-regulated genes and published ChIP-Seq data demonstrates the capacity for oPOSSUM-3 to identify mediating transcription factors (TF) for co-regulated genes or co-recovered sequences. oPOSS...

  9. Pharmacokinetics of enrofloxacin following oral and subcutaneous administration in the common ringtail possum (Pseudocheirus peregrinus).

    Science.gov (United States)

    Scheelings, T F; Devi, J L; Woodward, A P; Whittem, T

    2015-10-01

    [Correction added on 23 March 2015, after first online publication: Terminal half-life values of enrofloxacin is corrected in the fourth sentence of the abstract] Clinically healthy common ringtail possums (n = 5) received single doses of 10 mg/kg enrofloxacin orally and then 2 weeks later subcutaneously. Serial plasma samples were collected over 24 h for each treatment phase, and enrofloxacin concentrations were determined using a validated HPLC assay. Pharmacokinetic parameters were determined by noncompartmental analysis. Following oral administration, plasma concentrations were of therapeutic relevance (Cmax median 5.45 μg/mL, range 2.98-6.9 μg/mL), with terminal-phase half-life (t½ ) shorter than in other species (median 3.09 h, range 1.79-5.30 h). In contrast, subcutaneous administration of enrofloxacin did not achieve effective plasma concentrations, with plasma concentrations too erratic to fit the noncompartmental model except in one animal. On the basis of the AUC:MIC, enrofloxacin administered at 10 mg/kg orally, but not subcutaneously, is likely to be effective against a range of bacterial species that have been reported in common ringtail possums. PMID:25622984

  10. Possum-A Framework for Three-Dimensional Reconstruction of Brain Images from Serial Sections.

    Science.gov (United States)

    Majka, Piotr; Wójcik, Daniel K

    2016-07-01

    Techniques based on imaging serial sections of brain tissue provide insight into brain structure and function. However, to compare or combine them with results from three dimensional imaging methods, reconstruction into a volumetric form is required. Currently, there are no tools for performing such a task in a streamlined way. Here we propose the Possum volumetric reconstruction framework which provides a selection of 2D to 3D image reconstruction routines allowing one to build workflows tailored to one's specific requirements. The main components include routines for reconstruction with or without using external reference and solutions for typical issues encountered during the reconstruction process, such as propagation of the registration errors due to distorted sections. We validate the implementation using synthetic datasets and actual experimental imaging data derived from publicly available resources. We also evaluate efficiency of a subset of the algorithms implemented. The Possum framework is distributed under MIT license and it provides researchers with a possibility of building reconstruction workflows from existing components, without the need for low-level implementation. As a consequence, it also facilitates sharing and data exchange between researchers and laboratories. PMID:26687079

  11. PoSSuM v.2.0: data update and a new function for investigating ligand analogs and target proteins of small-molecule drugs

    OpenAIRE

    Ito, Jun-ichi; Ikeda, Kazuyoshi; Yamada, Kazunori; Mizuguchi, Kenji; Tomii, Kentaro

    2014-01-01

    PoSSuM (http://possum.cbrc.jp/PoSSuM/) is a database for detecting similar small-molecule binding sites on proteins. Since its initial release in 2011, PoSSuM has grown to provide information related to 49 million pairs of similar binding sites discovered among 5.5 million known and putative binding sites. This enlargement of the database is expected to enhance opportunities for biological and pharmaceutical applications, such as predictions of new functions and drug discovery. In this releas...

  12. Evaluation of POSSUM scoring system in the treatment of osteoporotic fracture of the hip in elder patients

    Institute of Scientific and Technical Information of China (English)

    WANG Tie-jun; ZHANG Bo-hao; GU Gui-shan

    2008-01-01

    To evaluate the applicability of the modified physiological and operative severity score for enumeration of mortality and morbidity(POSSUM)scoring system in predicting mortality in the patients undergoing hip joint arthroplasty.Methods:A total of 295 patients with hip fractures were analyzed using the modified POSSUM surgical scoring system. The mean ages of the patients were 66.59 years in the complicative group,62.28 years in noncomplicative group,77.89 years in the death group and 63.25 years in the living group,respectively. The comparisons between the observed and predicted morbidity,between the observed and predicted mortality were made within 30 days after operation.Results:The average physiological scores and operative severity scores was 18.96±4.83 and 13.47±2.01 in compticative group, while 15.65±3.66 and 11.74±2.26 in noncomplicative group(P<0.05).The average physiological scores and operative severity scores was 25.56±3.78 and 14.22±0.67 in death group,while 16.46±4.09 and 12.25 ±2.33 in living group (P<0.05).Though POSSUM scoring system over-predicted the overall risk of death,its estimate was very close in the high risk groups(>10%). There was perfect consistence between the observed and the predicted morbidity as calculated by published predictor equation for morbidity,and consistence for mortality in the high risk band.Conclusions:Modified POSSUM scoring system may be used to predict the morbidity in patients with hip fracture.Furthermore,POSSUM scoring system overpredicts the overall risk of death, but its estimate iS close to the actual data in the high risk band(>10%).

  13. Species- and site-specific impacts of an invasive herbivore on tree survival in mixed forests.

    Science.gov (United States)

    Holland, E Penelope; Gormley, Andrew M; Pech, Roger P

    2016-04-01

    Invasive herbivores are often managed to limit their negative impact on plant populations, but herbivore density - plant damage relationships are notoriously spatially and temporally variable. Site and species characteristics (both plant and herbivore) must be considered when assessing the potential for herbivore damage, making it difficult to set thresholds for efficient management. Using the invasive brushtail possum Trichosurus vulpecula in New Zealand as a case study, we parameterized a generic model to predict annual probability of browse-induced mortality of five tree species at 12 sites. We compared predicted and observed tree mortality for each species + site combination to establish herbivore abundance - tree mortality thresholds for each site on a single and combined tree species basis. Model results indicated it is likely that possum browse was the primary cause of all tree mortality at nine of the 12 species-site combinations, allowing us to estimate site-specific thresholds below which possum population numbers should be reduced and maintained to keep tree mortality under a predetermined level, for example 0.5% per year. The browse model can be used to set site- and species-specific management action thresholds, and can be adapted easily for other plant or herbivore species. Results for multiple plant or herbivore species at a single site can be combined to create conservative, site-wide management strategies, and used to: determine which sites will be affected most by changes in herbivore abundance; quantify thresholds for herbivore management; and justify expenditure on herbivore control. PMID:27066221

  14. Four species of arboreal folivore show differential tolerance to a secondary metabolite.

    Science.gov (United States)

    Jensen, Lora M; Wallis, Ian R; Marsh, Karen J; Moore, Ben D; Wiggins, Natasha L; Foley, William J

    2014-09-01

    The marsupials that eat Eucalyptus in south-eastern Australia provide an example of animals with similar niche requirements occurring sympatrically. They certainly differ in size, ranging from about 1 kg in the greater glider (Petauroides volans) and the closely related common ringtail possum (Pseudocheirus peregrinus), to 4 kg (common brushtail possum, Trichosurus vulpecula) and up to 15 kg in the koala (Phascolarctos cinereus). All species, however, may eat considerable amounts of eucalypt foliage, often favouring the same species, and thus appear to compete for food. In order to better understand the degree of competition for food, we measured feeding by the greater glider in response to increasing concentrations of a specific group of eucalypt plant secondary metabolites (PSM), the sideroxylonals, and then compared it to results published for the other species. The greater glider was more resilient than the other species to increasing concentrations of sideroxylonals. We suggest this allows gliders to feed on leaves from the eucalypt subgenus, Symphyomyrtus, while its small size and gliding ability allow it to feed where koalas cannot, on the young leaves on top of the canopy. In contrast, the common ringtail possum is well adapted to feeding from species of the subgenus Eucalyptus, which do not produce sideroxylonals but contain less available nitrogen (AvailN) than do the symphyomyrtles. These 'nutritional niches' segregate the forest and along with other factors, such as generalist and specialist feeding strategies and differences in body size and requirements for shelter, presumably minimise competition between the marsupial species. PMID:24974269

  15. Application of Portsmouth modification of physiological and operative severity scoring system for enumeration of morbidity and mortality (P-POSSUM) in pancreatic surgery

    OpenAIRE

    Tamijmarane Appou; Bhati Chandra S; Mirza Darius F; Bramhall Simon R; Mayer David A; Wigmore Stephen J; Buckels John AC

    2008-01-01

    Abstract Background Pancreatoduodenectomy (PD) is associated with high incidence of morbidity and mortality. We have applied P-POSSUM in predicting the incidence of outcome after PD to identify those who are at the highest risk of developing complications. Method A prospective database of 241 consecutive patients who had PD from January 2002 to September 2005 was retrospectively updated and analysed. P-POSSUM score was calculated for each patient and correlated with observed morbidity and mor...

  16. PoSSuM v.2.0: data update and a new function for investigating ligand analogs and target proteins of small-molecule drugs.

    Science.gov (United States)

    Ito, Jun-ichi; Ikeda, Kazuyoshi; Yamada, Kazunori; Mizuguchi, Kenji; Tomii, Kentaro

    2015-01-01

    PoSSuM (http://possum.cbrc.jp/PoSSuM/) is a database for detecting similar small-molecule binding sites on proteins. Since its initial release in 2011, PoSSuM has grown to provide information related to 49 million pairs of similar binding sites discovered among 5.5 million known and putative binding sites. This enlargement of the database is expected to enhance opportunities for biological and pharmaceutical applications, such as predictions of new functions and drug discovery. In this release, we have provided a new service named PoSSuM drug search (PoSSuMds) at http://possum.cbrc.jp/PoSSuM/drug_search/, in which we selected 194 approved drug compounds retrieved from ChEMBL, and detected their known binding pockets and pockets that are similar to them. Users can access and download all of the search results via a new web interface, which is useful for finding ligand analogs as well as potential target proteins. Furthermore, PoSSuMds enables users to explore the binding pocket universe within PoSSuM. Additionally, we have improved the web interface with new functions, including sortable tables and a viewer for visualizing and downloading superimposed pockets. PMID:25404129

  17. A remarkably quick habituation and high use of a rope bridge by an endangered marsupial, the western ringtail possum

    Directory of Open Access Journals (Sweden)

    Kaori Yokochi

    2015-07-01

    Full Text Available Rope bridges are being increasingly installed worldwide to mitigate the negative impacts of roads on arboreal animals. However, monitoring of these structures is still limited and an assessment of factors influencing the crossing behaviours is lacking. We monitored the use of a rope bridge near Busselton, Western Australia by the endangered western ringtail possums (Pseudocheirus occidentalis in order to identify the patterns of use and factors influencing the crossings. We installed motion sensor cameras and microchip readers on the bridge to record the crossings made by individual animals, and analysed these crossing data using generalised linear models that included factors such as days since the installation of the bridge, breeding season, wind speed, minimum temperature and moonlight. Possums started investigating the bridge even before the installation was completed, and the first complete crossing was recorded only 36 days after the installation, which is remarkably sooner than arboreal species studied in other parts of Australia. The possums crossed the bridge increasingly over 270 days of monitoring at a much higher rate than we expected (8.87 ± 0.59 complete crossings per night. Possums crossed the bridge less on windy nights and warm nights probably due to the risk of being blown away and heat stress on warmer days. Crossings also decreased slightly on brighter nights probably due to the higher risk of predation. Breeding season did not influence the crossings. Pseudocheirus occidentalis habituated to the bridge very quickly, and our results demonstrate that rope bridges have a potential as an effective mitigation measure against the negative impacts of roads on this species. More studies and longer monitoring, as well as investigating whether crossing results in the restoration of gene flow are then needed in order to further assess the true conservation value of these crossing structures.

  18. Remote Sensing of PMCs with the Polar Suborbital Science in the Upper Mesosphere (PoSSUM) Lidar

    Science.gov (United States)

    Mitchell, S.; Thayer, J. P.; Reimuller, J. D.

    2013-12-01

    The Polar Suborbital Science in the Upper Mesosphere (PoSSUM) experiment is a modular observatory readily integrated into commercial manned Reusable Suborbital Launch Vehicles (RSLV) for aeronomy, remote sensing, solar physics, astronomy/astrophysics, and Earth observations. The proposed observatory, scheduled for deployment in July 2015, is being designed to operate onboard the XCOR Lynx and Virgin Galactic SpaceShipTwo vehicles. The observatory will enable unprecedented capabilities to dedicate low-cost suborbital campaigns for the study of the small-scale dynamics of polar mesospheric clouds (PMC) by obtaining imagery and remotely sensed data from apogee altitudes in excess of 100 km. A key component of the observatory is the PoSSUM Lidar, a Rayleigh/Mie backscatter lidar currently being designed at the University of Colorado at Boulder. The proposed instrument transmitter consists of a 532 nm linearly polarized laser coupled with conditioning and steering optics. The receiver employs a photon counting approach to detect the received optical signals backscattered from PMCs during flight operations. The design of the PoSSUM Lidar will be presented, including the unique challenges associated with developing a lidar instrument for operations onboard a RSLV. Initial simulation data will be explored, including a discussion of the expected science products output by the lidar, such as PMC height and density, as well as the potential for depolarization measurements to evaluate PMC asphericity.

  19. An immunohistochemical study of endocrine cells in the proximal duodenum of eight marsupial species.

    OpenAIRE

    Takagi, C; Yamada, J.; Krause, W J; Kitamura, N; Yamashita, T

    1990-01-01

    The proximal duodenum of eight marsupial species, (koala, common brushtail possum, ring-tailed possum, common wombat, great grey kangaroo, parma wallaby, short-nosed bandicoot and tiger cat) were investigated immunohistochemically using 12 specific antisera for gut hormones. Several types of immunoreactive cells were seen on the intestinal villi and in crypts of these species: 9 types in the koala; 8 types in the common brushtail possum; 7 types in the common wombat; 6 types in the short-nose...

  20. The P-POSSUM scoring systems for predicting the mortality of neurosurgical patients undergoing craniotomy: Further validation of usefulness and application across healthcare systems

    Directory of Open Access Journals (Sweden)

    S J Mercer

    2013-01-01

    Full Text Available Background and Aims: Continuous audit of clinical practice is an essential part of making improvements in medicine and enhancing patient care. Validated tools are needed to gather evidence for comparisons. Recently, Physiological and Operative Severity Score for the enumeration of Mortality and morbidity (POSSUM and Portsmouth-POSSUM (P-POSSUM scores were evaluated in Indian patients undergoing elective craniotomy and it was concluded that P-POSSUM was highly accurate in predicting overall mortality. We wished to study whether this system could be used in a different country and health care system [United Kingdom, UK]. We have evaluated these scores in patients undergoing elective and emergency craniotomies in a tertiary centre in the UK. Methods: Data was collected from all neurosurgical patients who underwent craniotomy overone year. Preoperative variables were collected prior to induction of anaesthesia, and operative variables were also collected. Chi-square test was used for expected and actual mortality differences. Survivor and non-survivor demographics were compared by one-way ANOVA for continuous and Chi-square for categorical variables. Results: One hundred and forty-five patients were studied. Mean [SD] physiologic score of the patients was 18.83 [5.07], and mean [SD] operative score was 18.09 [3.75]. P-POSSUM was a better predictor for elective patients and for those undergoing immediate life-saving surgery. Conclusion: This study confirms and validates the findings of previous work that P-POSSUM is an accurate and reliable tool for estimating in-hospital mortality. It also confirms its usefulness in comparison of results across healthcare systems internationally. Larger scale evaluations may be needed to examine its usefulness in emergency procedures.

  1. Development of integrated surveillance systems for the management of tuberculosis in New Zealand wildlife.

    Science.gov (United States)

    Anderson, D P; Ramsey, D S L; de Lisle, G W; Bosson, M; Cross, M L; Nugent, G

    2015-06-01

    Disease surveillance for the management of bovine tuberculosis (TB) in New Zealand has focussed, to a large extent, on the development of tools specific for monitoring Mycobacterium bovis infection in wildlife. Diagnostic techniques have been modified progressively over 30 years of surveillance of TB in wildlife, from initial characterisation of gross TB lesions in a variety of wildlife, through development of sensitive culture techniques to identify viable mycobacteria, to molecular identification of individual M. bovis strains. Of key importance in disease surveillance has been the elucidation of the roles that different wildlife species play in the transmission of infection, specifically defining brushtail possums (Trichosurus vulpecula) as true maintenance hosts compared to those that are predominantly spillover hosts, but which may serve as useful sentinel species to indicate TB persistence. Epidemiological modelling has played a major role in TB surveillance, initially providing the theoretical support for large-scale possum population control and setting targets at which control effort should be deployed to ensure disease eradication. As TB prevalence in livestock and wildlife declined throughout the 2000s, more varied field tools were developed to gather surveillance data from the diminishing possum populations, and to provide information on changing TB prevalence. Accordingly, ever more precise (but disparate) surveillance information began to be integrated into multi-faceted decision-assist models to support TB management decisions, particularly to provide informed parameters at which control effort could be halted, culminating in the Proof of Freedom modelling framework that now allows an area to be declared TB-free within chosen confidence limits. As New Zealand moves from large-scale TB control to regional eradication of disease in the coming years, further integrative models will need to be developed to support management decisions, based on combined

  2. Dicty_cDB: VHA852 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHA852 (Link to dictyBase) - - - Contig-U11096-1 VHA852P (Link to Original ... in. 76 7e-37 8 EC286335 |EC286335.1 BRAINF089834J4 POSSUM _01-POSSUM -C-BRAIN-2KB Trichosurus vulpecula cDNA c ... . 92 8e-36 4 EC364387 |EC364387.1 IMMUNEF093542N20 POSSUM _01-C-POSSUM -IMMUNE-2KB Trichosurus vulpecula cDNA ... ce. 92 1e-35 4 EC289560 |EC289560.1 BRAINF089623B7 POSSUM _01-POSSUM -C-BRAIN-2KB Trichosurus vulpecula cDNA c ...

  3. Application of Portsmouth modification of physiological and operative severity scoring system for enumeration of morbidity and mortality (P-POSSUM in pancreatic surgery

    Directory of Open Access Journals (Sweden)

    Tamijmarane Appou

    2008-04-01

    Full Text Available Abstract Background Pancreatoduodenectomy (PD is associated with high incidence of morbidity and mortality. We have applied P-POSSUM in predicting the incidence of outcome after PD to identify those who are at the highest risk of developing complications. Method A prospective database of 241 consecutive patients who had PD from January 2002 to September 2005 was retrospectively updated and analysed. P-POSSUM score was calculated for each patient and correlated with observed morbidity and mortality. Results 30 days mortality was 7.8% and morbidity was 44.8%. Mean physiological score was 16.07 ± 3.30. Mean operative score was 13.67 ± 3.42. Mean operative score rose to 20.28 ± 2.52 for the complex major operation (p 18, the O:P ratio was nearer to 1. Physiological score and white cell count were significant in a multivariate model. Conclusion P-POSSUM underestimated the mortality rate. While P-POSSUM analysis gave a truer prediction of morbidity, underestimation of morbidity and potential for systematic inaccuracy in prediction of complications at lower risk levels is a significant issue for pancreatic surgery

  4. Personality affects the foraging response of a mammalian herbivore to the dual costs of food and fear.

    Science.gov (United States)

    Mella, Valentina S A; Ward, Ashley J W; Banks, Peter B; McArthur, Clare

    2015-01-01

    Predators attack and plants defend, so herbivores face the dilemma of how to eat enough without being eaten. But do differences in the personality of herbivores affect the foraging choices of individuals? We explored the ecological impact of personality in a generalist herbivore, the brushtail possum (Trichosurus vulpecula). After quantifying personality traits in wild individuals brought temporarily into captivity, we tested how these traits altered foraging by individuals when free-ranging in their natural habitat. To measure their responses to the dual costs of predation risk and plant toxin, we varied the toxin concentration of food in safe foraging patches against paired, non-toxic risky patches, and used a novel synthesis of a manipulative Giving-Up-Density (GUD) experiment and video behavioural analysis. At the population level, the cost of safe patches pivoted around that of risky patches depending on food toxin concentration. At the individual level, boldness affected foraging at risky high-quality food patches (as behavioural differences between bold and shy), and at safe patches only when food toxin concentration was low (as differences in foraging outcome). Our results ecologically validate the personality trait of boldness, in brushtail possums. They also reveal, for the first time, a nuanced link between personality and the way in which individuals balance the costs of food and fear. Importantly, they suggest that high plant defence effectively attenuates differences in foraging behaviour arising from variation in personality, but poorly defended plants in safe areas should be differentially subject to herbivory depending on the personality of the herbivore. PMID:25294220

  5. The effects of wildfire on mortality and resources for an arboreal marsupial: resilience to fire events but susceptibility to fire regime change.

    Directory of Open Access Journals (Sweden)

    Sam C Banks

    Full Text Available BACKGROUND: Big environmental disturbances have big ecological effects, yet these are not always what we might expect. Understanding the proximate effects of major disturbances, such as severe wildfires, on individuals, populations and habitats will be essential for understanding how predicted future increases in the frequency of such disturbances will affect ecosystems. However, researchers rarely have access to data from immediately before and after such events. Here we report on the effects of a severe and extensive forest wildfire on mortality, reproductive output and availability of key shelter resources for an arboreal marsupial. We also investigated the behavioural response of individuals to changed shelter resource availability in the post-fire environment. METHODOLOGY/PRINCIPAL FINDINGS: We fitted proximity-logging radiotransmitters to mountain brushtail possums (Trichosurus cunninghami before, during and after the 2009 wildfires in Victoria, Australia. Surprisingly, we detected no mortality associated with the fire, and despite a significant post-fire decrease in the proportion of females carrying pouch young in the burnt area, there was no short-term post-fire population decline. The major consequence of this fire for mountain brushtail possums was the loss of over 80% of hollow-bearing trees. The types of trees preferred as shelter sites (highly decayed dead standing trees were those most likely to collapse after fire. Individuals adapted to resource decline by being more flexible in resource selection after the fire, but not by increased resource sharing. CONCLUSIONS/SIGNIFICANCE: Despite short-term demographic resilience and behavioural adaptation following this fire, the major loss of decayed hollow trees suggests the increased frequency of stand-replacing wildfires predicted under climate change will pose major challenges for shelter resource availability for hollow-dependent fauna. Hollow-bearing trees are typically biological

  6. Dicty_cDB: VHA695 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHA695 (Link to dictyBase) - G20703 DDB0205913 Contig-U12390-1 VHA695P (Lin ... e. 46 0.68 1 DY595807 |DY595807.1 KIDNEYF031279L21 POSSUM _01-POSSUM -KIDNEY-2KB Trichosurus vulpecula cDNA cl ... nce. 44 2.7 1 EC298388 |EC298388.1 OVARYF092732B16 POSSUM _01-POSSUM -C-OVARY-2KB Trichosurus vulpecula cDNA c ...

  7. Dicty_cDB: Contig-U11191-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U11191-1 gap included 1407 5 756357 757767 PLUS 4 6 U11191 0 0 0 2 0 0 0 0 2 0 0 0 0 0 Sh ... nt US 6677731. 46 2.3 2 ( DY590886 ) GUTF074975L17 POSSUM _01-POSSUM -GUT-2KB Trichosuru... 34 2.4 2 ( DY58882 ... 3 ) GUTF074980I1 POSSUM _01-POSSUM -GUT-2KB Trichosurus... 34 2.4 2 ( DY5983 ... 20 ) KIDNEYF031280A11 POSSUM _01-POSSUM -KIDNEY-2KB Tric... 34 2.5 2 ( AC219211 ) ...

  8. A modelling framework for predicting the optimal balance between control and surveillance effort in the local eradication of tuberculosis in New Zealand wildlife.

    Science.gov (United States)

    Gormley, Andrew M; Holland, E Penelope; Barron, Mandy C; Anderson, Dean P; Nugent, Graham

    2016-03-01

    Bovine tuberculosis (TB) impacts livestock farming in New Zealand, where the introduced marsupial brushtail possum (Trichosurus vulpecula) is the wildlife maintenance host for Mycobacterium bovis. New Zealand has implemented a campaign to control TB using a co-ordinated programme of livestock diagnostic testing and large-scale culling of possums, with the long-term aim of TB eradication. For management of the disease in wildlife, methods that can optimise the balance between control and surveillance effort will facilitate the objective of eradication on a fixed or limited budget. We modelled and compared management options to optimise the balance between the two activities necessary to achieve and verify eradication of TB from New Zealand wildlife: the number of lethal population control operations required to halt the M. bovis infection cycle in possums, and the subsequent surveillance effort needed to confidently declare TB freedom post-control. The approach considered the costs of control and surveillance, as well as the potential costs of re-control resulting from false declaration of TB freedom. The required years of surveillance decreased with increasing numbers of possum lethal control operations but the overall time to declare TB freedom depended on additional factors, such as the probability of freedom from disease after control and the probability of success of mop-up control, i.e. retroactive culling following detection of persistent disease in the residual possum population. The total expected cost was also dependent on a number of factors, many of which had wide cost ranges, suggesting that an optimal strategy is unlikely to be singular and fixed, but will likely vary for each different area being considered. Our approach provides a simple framework that considers the known and potential costs of possum control and TB surveillance, enabling managers to optimise the balance between these two activities to achieve and prove eradication of a wildlife

  9. A serological survey of Australian wildlife for antibodies to Leptospires of the Hebdomadis serogroup.

    Science.gov (United States)

    Durfee, P T; Presidente, P J

    1979-04-01

    A serological survey for antibodies to Leptospira interrograns serovar hardjo was conducted on 574 serum samples from 10 native and 4 introduced wildlife species in south-eastern Australia. The microscopic agglutination (MA) test was used, and titres to hardjo antigen were detected in 33.5% of 352 brushtailed possums (Trichosurus vulpecula) sampled in several areas of Victoria. Prevalence of reactors ranged from 14 to 66% in 4 populations examined intensively. Serovar balcanica was isolated from possums with hardjo antibodies from two different areas. Of 20 wombats Vombatus ursinus) examined in Victoria, antibodies to hardjo were found in sera from 4 and titres to Pyrogenes and Pomona serogroups were detected in another. Hardjo antibodies were demonstrated in sera from 13 of 19 rusa deer (Cervus timorensis). Negative MA test results to hardjo antigens were recorded in 55 mountain possums (T. caninus), 63 macropods (Macropus spp.), 17 water rats (Hydrmys chrysogaster), 39 fallow deer (Dama dama), 2 hog deer (Axis porcinus) and 2 water buffalo (Bubalus bubalus). No MA antibodies to any of 16 leptospiral serogroups were detected in 17 water rats tested. Kidneys were examined from 330 of these animals and focal interstitial nephritis suggestive of leptospirosis was found in kidneys of 63 of 169 T. vulpecula, 3 of 55 T. caninus, 12 of 18 V. ursinus, 6 of 22 Macropus spp., 9 of 16 H. chrysogaster, 5 of 11 C. timorensis and 3 of 39 D. dama. A statistical association between focal interstitial nephritis and MA antibodies to hardjo was found in T. vulpecula. PMID:485984

  10. Frequency of dysmorphological signs by possum at the home for developmentally handicapped children and adults in Veternik-Novi Sad

    Directory of Open Access Journals (Sweden)

    Stojanović Slobodan

    2002-01-01

    Full Text Available The authors have examined frequency of dysmorphological signs by POSSUM at the Home for developmentally handicapped children and adults in Vetemik Novi Sad. The aim was to establish possible different hereditary and congenital skin diseases and genetic syndromes in this population. The study was based on the following methods: method of family history including genealogy; dermatoglyphic methods; screening tests methodology in medical genetics; method of cytogenetic analysis; histo-pathological analysis method of dermatovenerologic, genetic and dysmorphologic examinations of skin diseases by analysis of dysmorphological signs on the skin using a special computer programme. The study s, Novi Sad included 504 wards with 269 males and 235 females, and sex ratio of 1:1.14 in favour to males. Non-parametric statistics and Log-linear analysis revealed a statistically significant difference between the incidence of dysmorphological signs in the studied group and the Vojvodina population. The obtained incidence of dysmorphological signs in the examined group is presented in tables. Our results regarding the incidence of dysmorphological signs in the examined group showed significantly increased values in comparison to the population of Vojvodina.

  11. Effects of nutrient enrichment on Prymnesium parvum population dynamics and toxicity: Results from field experiments, Lake Possum Kingdom, USA

    Science.gov (United States)

    Roelke, D.L.; Errera, R.M.; Riesling, R.; Brooks, B.W.; Grover, J.P.; Schwierzke, L.; Urena-Boeck, F.; Baker, J.; Pinckney, J.L.

    2007-01-01

    Large fish kills associated with toxic populations of the haptophyte Prymnesium parvum occur worldwide. In the past 5 yr, incidences of P. parvum blooms in inland water bodies of Texas (USA) have increased dramatically, where cell densities in excess of 1 ?? 107 cells l-1 are typically observed. We conducted field experiments (Lake Possum Kingdom) during the fall and early spring of 28 d duration using 24 enclosures of 1.57 m 3 each. The experiments investigated the effect of nutrient enrichment, immigration of P. parvum and addition of barley straw extract on phytoplankton biomass and assemblage structure, P. parvum population density, zooplankton biomass and assemblage structure, bacteria, and toxicity. Nutrient enrichment stimulated P. parvum population growth beyond bloom proportions (>1 ?? 107 cells l-1). However, P. parvum did not dominate the assemblage under these conditions, as it does during natural blooms. Instead, euglenophytes and chlorophytes dominated. Toxicity, estimated using fish (Pimephales promelas) and cladoceran (Daphnia magna) bioassays and which is linked to P. parvum's allelopathic and mixotrophic effectiveness, was greatly reduced (eliminated in many cases) under conditions of nutrient enrichment. The suppression of toxicity by nutrient addition suggested that targeted and time-limited nutrient manipulations might be used to mitigate the effects of P. parvum blooms. Immigration of P. parvum into natural assemblages and addition of barley straw extract had no significant effect on plankton dynamics. ?? Inter-Research 2007.

  12. Dicty_cDB: VHA295 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHA295 (Link to dictyBase) - - - Contig-U16508-1 - (Link to Original site) ... 25. 40 0.10 2 EG619833 |EG619833.1 EMBRYOF088227O8 POSSUM _01-POSSUM -C-EMBRYO-2KB Trichosurus vulpecula cDNA ...

  13. Dicty_cDB: SHJ595 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SH (Link to library) SHJ595 (Link to dictyBase) - - - Contig-U11096-1 - (Link to Original site) ... 109 3e-44 3 DY611266 |DY611266.1 IMMUNEF045822K24 POSSUM _01-C-POSSUM -IMMUNE-2KB Trichosurus vulpecula cDNA ...

  14. Dicty_cDB: SHF717 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SH (Link to library) SHF717 (Link to dictyBase) - - - Contig-U11096-1 | Contig-U12663-1 SHF717P ... . 98 5e-24 2 DY611266 |DY611266.1 IMMUNEF045822K24 POSSUM _01-C-POSSUM -IMMUNE-2KB Trichosurus vulpecula cDNA ...

  15. Dicty_cDB: SHK754 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SH (Link to library) SHK754 (Link to dictyBase) - - - Contig-U16328-1 - (Link to Original site) ... ce. 30 1.2 3 EC323760 |EC323760.1 EMBRYOF091721H18 POSSUM _01-POSSUM -C-EMBRYO-2KB Trichosurus vulpecula cDNA ...

  16. Dicty_cDB: VFM744 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFM744 (Link to dictyBase) - - - Contig-U15065-1 - (Link to Original site) ... S-30-02-01-1... 42 4.5 1 ( EC327637 ) GUTF089831J6 POSSUM _01-POSSUM -GUT-2KB Trichosurus... 42 4.5 1 dna upda ...

  17. Dicty_cDB: SHL832 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SH (Link to library) SHL832 (Link to dictyBase) - - - Contig-U16508-1 - (Link to Original site) ... 5. 40 0.093 2 EG619833 |EG619833.1 EMBRYOF088227O8 POSSUM _01-POSSUM -C-EMBRYO-2KB Trichosurus vulpecula cDNA ...

  18. Dicty_cDB: VHD473 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHD473 (Link to dictyBase) - - - Contig-U11851-1 - (Link to Original site) ... 18. 38 0.33 5 EC346097 |EC346097.1 LIVERF089543E18 POSSUM _01-POSSUM -LIVER-2KB Trichosurus vulpecula cDNA clo ...

  19. Dicty_cDB: VHA237 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHA237 (Link to dictyBase) - - - Contig-U16508-1 - (Link to Original site) ... 25. 40 0.11 2 EG619833 |EG619833.1 EMBRYOF088227O8 POSSUM _01-POSSUM -C-EMBRYO-2KB Trichosurus vulpecula cDNA ...

  20. Dicty_cDB: SHK647 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SH (Link to library) SHK647 (Link to dictyBase) - - - Contig-U15541-1 - (Link to Original site) ... nce. 42 3.9 2 EC346836 |EC346836.1 LIVERF089543J15 POSSUM _01-POSSUM -LIVER-2KB Trichosurus vulpecula cDNA clo ...

  1. Dicty_cDB: SHL768 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SH (Link to library) SHL768 (Link to dictyBase) - - - Contig-U16508-1 - (Link to Original site) ... 5. 40 0.097 2 EG619833 |EG619833.1 EMBRYOF088227O8 POSSUM _01-POSSUM -C-EMBRYO-2KB Trichosurus vulpecula cDNA ...

  2. Dicty_cDB: SHF290 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SH (Link to library) SHF290 (Link to dictyBase) - - - Contig-U11096-1 - (Link to Original site) ... . 60 8e-30 5 DY611266 |DY611266.1 IMMUNEF045822K24 POSSUM _01-C-POSSUM -IMMUNE-2KB Trichosurus vulpecula cDNA ...

  3. Dicty_cDB: SHK720 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SH (Link to library) SHK720 (Link to dictyBase) - - - Contig-U12076-1 SHK720P (Link to Original ... 36 0.38 5 EC313449 |EC313449.1 REPROTRACTF081141I8 POSSUM _01-POSSUM -C-REPROTRACT-2KB Trichosurus vulpecula c ...

  4. Dicty_cDB: SHL742 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SH (Link to library) SHL742 (Link to dictyBase) - - - Contig-U16508-1 - (Link to Original site) ... /7. 44 0.97 2 EG619833 |EG619833.1 EMBRYOF088227O8 POSSUM _01-POSSUM -C-EMBRYO-2KB Trichosurus vulpecula cDNA ...

  5. Dicty_cDB: SLD224 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLD224 (Link to dictyBase) - - - Contig-U01201-1 SLD224P (Link to Original ... 27k12, 5' ... 80 6e-27 2 ( DY588947 ) GUTF074981O3 POSSUM _01-POSSUM -GUT-2KB Trichosurus... 50 0.13 1 ( AM488 ...

  6. Dicty_cDB: SHL252 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SH (Link to library) SHL252 (Link to dictyBase) - - - Contig-U10968-1 SHL252P (Link to Original ... e. 42 0.26 7 EC319940 |EC319940.1 EMBRYOF088886F18 POSSUM _01-POSSUM -C-EMBRYO-2KB Trichosurus vulpecula cDNA ...

  7. Dicty_cDB: SHK558 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SH (Link to library) SHK558 (Link to dictyBase) - - - Contig-U16304-1 - (Link to Original site) ... e. 50 0.058 1 DY611260 |DY611260.1 IMMUNEF045817H8 POSSUM _01-C-POSSUM -IMMUNE-2KB Trichosurus vulpecula cDNA ...

  8. Dicty_cDB: VHA110 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHA110 (Link to dictyBase) - - - Contig-U16508-1 - (Link to Original site) ... ce. 32 0.12 8 EG619833 |EG619833.1 EMBRYOF088227O8 POSSUM _01-POSSUM -C-EMBRYO-2KB Trichosurus vulpecula cDNA ...

  9. Dicty_cDB: SHK804 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SH (Link to library) SHK804 (Link to dictyBase) - - - Contig-U11514-1 - (Link to Original site) ... ce. 36 0.43 3 EC358866 |EC358866.1 IMMUNEF088882D5 POSSUM _01-C-POSSUM -IMMUNE-2KB Trichosurus vulpecula cDNA ...

  10. Dicty_cDB: SHL684 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SH (Link to library) SHL684 (Link to dictyBase) - - - Contig-U16508-1 - (Link to Original site) ... 25. 40 0.10 2 EG619833 |EG619833.1 EMBRYOF088227O8 POSSUM _01-POSSUM -C-EMBRYO-2KB Trichosurus vulpecula cDNA ...

  11. Dicty_cDB: SHL750 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SH (Link to library) SHL750 (Link to dictyBase) - - - Contig-U16471-1 SHL750P (Link to Original ... nce. 34 0.33 7 EG609925 |EG609925.1 BRAINF100765M9 POSSUM _01-POSSUM -C-BRAIN-2KB Trichosurus vulpecula cDNA c ...

  12. Dicty_cDB: VHA326 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHA326 (Link to dictyBase) - - - Contig-U16508-1 - (Link to Original site) ... 25. 40 0.11 2 EG619833 |EG619833.1 EMBRYOF088227O8 POSSUM _01-POSSUM -C-EMBRYO-2KB Trichosurus vulpecula cDNA ...

  13. Dicty_cDB: SHL810 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SH (Link to library) SHL810 (Link to dictyBase) - - - Contig-U16508-1 - (Link to Original site) ... 5. 40 0.097 2 EG619833 |EG619833.1 EMBRYOF088227O8 POSSUM _01-POSSUM -C-EMBRYO-2KB Trichosurus vulpecula cDNA ...

  14. Optimising the application of multiple-capture traps for invasive species management using spatial simulation.

    Science.gov (United States)

    Warburton, Bruce; Gormley, Andrew M

    2015-01-01

    Internationally, invasive vertebrate species pose a significant threat to biodiversity, agricultural production and human health. To manage these species a wide range of tools, including traps, are used. In New Zealand, brushtail possums (Trichosurus vulpecula), stoats (Mustela ermine), and ship rats (Rattus rattus) are invasive and there is an ongoing demand for cost-effective non-toxic methods for controlling these pests. Recently, traps with multiple-capture capability have been developed which, because they do not require regular operator-checking, are purported to be more cost-effective than traditional single-capture traps. However, when pest populations are being maintained at low densities (as is typical of orchestrated pest management programmes) it remains uncertain if it is more cost-effective to use fewer multiple-capture traps or more single-capture traps. To address this uncertainty, we used an individual-based spatially explicit modelling approach to determine the likely maximum animal-captures per trap, given stated pest densities and defined times traps are left between checks. In the simulation, single- or multiple-capture traps were spaced according to best practice pest-control guidelines. For possums with maintenance densities set at the lowest level (i.e. 0.5/ha), 98% of all simulated possums were captured with only a single capacity trap set at each site. When possum density was increased to moderate levels of 3/ha, having a capacity of three captures per trap caught 97% of all simulated possums. Results were similar for stoats, although only two potential captures per site were sufficient to capture 99% of simulated stoats. For rats, which were simulated at their typically higher densities, even a six-capture capacity per trap site only resulted in 80% kill. Depending on target species, prevailing density and extent of immigration, the most cost-effective strategy for pest control in New Zealand might be to deploy several single

  15. Optimising the application of multiple-capture traps for invasive species management using spatial simulation.

    Directory of Open Access Journals (Sweden)

    Bruce Warburton

    Full Text Available Internationally, invasive vertebrate species pose a significant threat to biodiversity, agricultural production and human health. To manage these species a wide range of tools, including traps, are used. In New Zealand, brushtail possums (Trichosurus vulpecula, stoats (Mustela ermine, and ship rats (Rattus rattus are invasive and there is an ongoing demand for cost-effective non-toxic methods for controlling these pests. Recently, traps with multiple-capture capability have been developed which, because they do not require regular operator-checking, are purported to be more cost-effective than traditional single-capture traps. However, when pest populations are being maintained at low densities (as is typical of orchestrated pest management programmes it remains uncertain if it is more cost-effective to use fewer multiple-capture traps or more single-capture traps. To address this uncertainty, we used an individual-based spatially explicit modelling approach to determine the likely maximum animal-captures per trap, given stated pest densities and defined times traps are left between checks. In the simulation, single- or multiple-capture traps were spaced according to best practice pest-control guidelines. For possums with maintenance densities set at the lowest level (i.e. 0.5/ha, 98% of all simulated possums were captured with only a single capacity trap set at each site. When possum density was increased to moderate levels of 3/ha, having a capacity of three captures per trap caught 97% of all simulated possums. Results were similar for stoats, although only two potential captures per site were sufficient to capture 99% of simulated stoats. For rats, which were simulated at their typically higher densities, even a six-capture capacity per trap site only resulted in 80% kill. Depending on target species, prevailing density and extent of immigration, the most cost-effective strategy for pest control in New Zealand might be to deploy several

  16. Development of the New Zealand strategy for local eradication of tuberculosis from wildlife and livestock.

    Science.gov (United States)

    Livingstone, P G; Hancox, N; Nugent, G; Mackereth, G; Hutchings, S A

    2015-06-01

    We describe the progressive development of New Zealand's national strategy for control of tuberculosis (TB) in its agricultural sector over the last four decades. The strategy is globally unique, reflecting the need for effective and co-ordinated management of TB in a wildlife maintenance host, the brushtail possum (Trichosurus vulpecula), in addition to controlling infection in cattle and farmed deer herds. Since the early 1990s, the strategy has been developed by the Animal Health Board (AHB), formed to empower the farming industry to take the leadership role in funding of TB control, policy development and administration. The AHB became the first non-government organisation to develop and gain acceptance by the funders (farming industry and government) of a National Pest Management Strategy (NPMS) under the Biosecurity Act 1993. A key outcome of the NPMS for TB control was the development and inclusion of very challenging objectives that provided direction for management, research and possum control. This paper describes the process whereby the NPMS was revised twice, following achievement of each successive set of strategy objectives within budget. Success was based on firstly, reorganisation of the AHB and its operational systems to achieve increased efficiency; secondly, improved efficiency through contracting possum and disease control, and thirdly research delivering effective and practical applications, while also providing a scientific basis for setting directions for future control strategies. The last revision of the NPMS was implemented in 2011, and included objectives to eradicate Mycobacterium bovis-infected wildlife populations over 2.5 million hectares by 2026. This ambitious objective was adopted only after extensive forecast modelling enabled stakeholders to identify and select the most cost-effective long-term solution for the management of M. bovis-infected possum populations. The accomplishment of New Zealand's TB control programme, in meeting

  17. Dicty_cDB: Contig-U05475-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U05475-1 no gap 510 3 5027720 5028230 PLUS 1 1 U05475 0 0 0 0 0 0 1 0 0 0 0 0 0 0 Show Co ... inserti... 46 1.3 1 ( EC357677 ) IMMUNEF088892L14 POSSUM _01-C-POSSUM -IMMUNE-2KB Tr... 46 1.3 1 ( EC349399 ) ... LIVERF091705C8 POSSUM _01-POSSUM -LIVER-2KB Trichos... 46 1.3 1 ( EC331530 ... ) GUTF091686D9 POSSUM _01-POSSUM -GUT-2KB Trichosurus... 46 1.3 1 ( EC2795 ... 54 ) BRAINF089465G13 POSSUM _01-POSSUM -C-BRAIN-2KB Tric... 46 1.3 1 ( DY607748 ...

  18. The prevalence of anti-leptospiral agglutinins in sera of wildlife in southeastern Australia.

    Science.gov (United States)

    Milner, A R; Wilks, C R; Spratt, D M; Presidente, P J

    1981-04-01

    Anti-leptospiral agglutinins were found in the serum from 18 (7 species) of 419 (25 species) animals sampled from various areas of southeastern Australia. Positive serologic reactions were observed in 5 of 25 (20%) brush-tailed possum (Trichosurus vulpecula), 1 of 26 (3.8%) tammar wallaby (Macropus eugenii), 2 of 12 (16.7%) swamp wallaby (Wallabia bicolor), 1 of 3 (33.3%) koala (Phascolarctos cinereus), 3 of 41 (7.3%) common wombat (Vombatus ursinus), 2 of 100 (2%) bush rat (Rattus fuscipes) and 4 of 12 (25%) rusa deer (Cervus timorensis). The majority (55.5%) of serologic reactions were to serovar hardjo. No serologic reactions were observed in samples from echidna (Tachyglossus aculeatus), brown antechinus (Antechinus stuartii), swainson's antechinus (Antechinus swaisonsii), long-nosed bandicoot (Perameles nasuta), brown bandicoot(Isoodon obesulus), common ringtail (Pseudocheirus peregrinus), greater glider (Schoinobates volans), eastern grey kangaroo (Macropus giganteus), red-necked wallaby (Macropus rufogriseus), rabbit (Oryctolagus cuniculus), water rat (Hydromys chrysogaster), black rat (Rattus rattus), eastern swamp rat (Rattus lutreolus), broad-toothed rat (Mastacomys fuscus), fox (Vulpes vulpes), sambar deer (Cervus unicolor), hog deer (Axis porcinus) and fallow deer (Dama dama). PMID:7241704

  19. Using probability modelling and genetic parentage assignment to test the role of local mate availability in mating system variation.

    Science.gov (United States)

    Blyton, Michaela D J; Banks, Sam C; Peakall, Rod; Lindenmayer, David B

    2012-02-01

    The formal testing of mating system theories with empirical data is important for evaluating the relative importance of different processes in shaping mating systems in wild populations. Here, we present a generally applicable probability modelling framework to test the role of local mate availability in determining a population's level of genetic monogamy. We provide a significance test for detecting departures in observed mating patterns from model expectations based on mate availability alone, allowing the presence and direction of behavioural effects to be inferred. The assessment of mate availability can be flexible and in this study it was based on population density, sex ratio and spatial arrangement. This approach provides a useful tool for (1) isolating the effect of mate availability in variable mating systems and (2) in combination with genetic parentage analyses, gaining insights into the nature of mating behaviours in elusive species. To illustrate this modelling approach, we have applied it to investigate the variable mating system of the mountain brushtail possum (Trichosurus cunninghami) and compared the model expectations with the outcomes of genetic parentage analysis over an 18-year study. The observed level of monogamy was higher than predicted under the model. Thus, behavioural traits, such as mate guarding or selective mate choice, may increase the population level of monogamy. We show that combining genetic parentage data with probability modelling can facilitate an improved understanding of the complex interactions between behavioural adaptations and demographic dynamics in driving mating system variation. PMID:21899620

  20. Epidemiology, diagnostics, and management of tuberculosis in domestic cattle and deer in New Zealand in the face of a wildlife reservoir.

    Science.gov (United States)

    Buddle, B M; de Lisle, G W; Griffin, J F T; Hutchings, S A

    2015-06-01

    The control of tuberculosis (TB) in cattle and farmed deer in New Zealand has been greatly influenced by the existence of a wildlife reservoir of Mycobacterium bovis infection, principally the Australian brushtail possum (Trichosurus vulpecula). The reduction in possum numbers in areas with endemic M. bovis infection through vigorous vector control operations has been a major contributor to the marked reduction in the number of infected cattle and farmed deer herds in the past two decades. Management of TB in cattle and farmed deer in New Zealand has involved a combination of vector control, regionalisation of diagnostic testing of cattle and deer herds, abattoir surveillance and movement control from vector risk areas. Accurate diagnosis of infected cattle and deer has been a crucial component in the control programme. As the control programme has evolved, test requirements have changed and new tests have been introduced or test interpretations modified. Subspecific strain typing of M. bovis isolates has proved to be a valuable component in the epidemiological investigation of herd breakdowns to identify whether the source of infection was domestic livestock or wildlife. New initiatives will include the use of improved models for analysing diagnostic test data and characterising disease outbreaks leading to faster elimination of infection from herds. The introduction of the National Animal Identification Tracing programme will allow better risk profiling of individual herds and more reliable tracing of animal movements. TB in cattle and farmed deer in New Zealand can only be controlled by eliminating the disease in both domestic livestock and the wildlife reservoir. PMID:24992203

  1. Performance Characteristics of Small Global-Positioning-System Tracking Collars

    Directory of Open Access Journals (Sweden)

    T. Dennis

    2010-06-01

    Full Text Available Recent technological advances have made possible the development of animal-tracking devices based on the global positioning system (GPS that are much smaller than what were available previously. However, potential limitations in size-dependent technologies and differences in patterns of behavior between small and large animals could mean that miniaturized GPS tracking devices may not function as well as their larger counterparts. Here, we evaluate the performance characteristics of 105-g GPS collars suitable for prolonged use on animals weighing as little as 2.5 kg. We tested 9 collars in stationary trials at a single reference site and in field deployments on common brushtail possums ( Trichosurus vulpecula/ , a semi-arboreal, nocturnal marsupial. We found in both trials that individual collars differed in several measures of positional accuracy and precision, yet overall the small collars compared favorably with published results of larger devices in similar habitats. Differences in operational characteristics between the two trials were mainly in the number and spatial configuration of satellites used to calculate position fixes, resulting in an increase in median location error from 9.8 m in the stationary tests to an estimated 14.7 m in the field trials. Most probably, these effects were due to dissimilarities in microhabitat features and variation in the orientation of GPS antennae which occurred when the possums changed their body posture during movement. The collars evaluated in this study promise to be a valuable tool for the study of the ecology, behavior, and conservation of many small-to-medium sized animals.

  2. An Endangered Arboreal Specialist, the Western Ringtail Possum (Pseudocheirus occidentalis), Shows a Greater Genetic Divergence across a Narrow Artificial Waterway than a Major Road.

    Science.gov (United States)

    Yokochi, Kaori; Kennington, Winn Jason; Bencini, Roberta

    2016-01-01

    The fragmentation of habitats by roads and other artificial linear structures can have a profound effect on the movement of arboreal species due to their strong fidelity to canopies. Here, we used 12 microsatellite DNA loci to investigate the fine-scale spatial genetic structure and the effects of a major road and a narrow artificial waterway on a population of the endangered western ringtail possum (Pseudocheirus occidentalis) in Busselton, Western Australia. Using spatial autocorrelation analysis, we found positive genetic structure in continuous habitat over distances up to 600 m. These patterns are consistent with the sedentary nature of P. occidentalis and highlight their vulnerability to the effects of habitat fragmentation. Pairwise relatedness values and Bayesian cluster analysis also revealed significant genetic divergences across an artificial waterway, suggesting that it was a barrier to gene flow. By contrast, no genetic divergences were detected across the major road. While studies often focus on roads when assessing the effects of artificial linear structures on wildlife, this study provides an example of an often overlooked artificial linear structure other than a road that has a significant impact on wildlife dispersal leading to genetic subdivision. PMID:26784921

  3. An Endangered Arboreal Specialist, the Western Ringtail Possum (Pseudocheirus occidentalis, Shows a Greater Genetic Divergence across a Narrow Artificial Waterway than a Major Road.

    Directory of Open Access Journals (Sweden)

    Kaori Yokochi

    Full Text Available The fragmentation of habitats by roads and other artificial linear structures can have a profound effect on the movement of arboreal species due to their strong fidelity to canopies. Here, we used 12 microsatellite DNA loci to investigate the fine-scale spatial genetic structure and the effects of a major road and a narrow artificial waterway on a population of the endangered western ringtail possum (Pseudocheirus occidentalis in Busselton, Western Australia. Using spatial autocorrelation analysis, we found positive genetic structure in continuous habitat over distances up to 600 m. These patterns are consistent with the sedentary nature of P. occidentalis and highlight their vulnerability to the effects of habitat fragmentation. Pairwise relatedness values and Bayesian cluster analysis also revealed significant genetic divergences across an artificial waterway, suggesting that it was a barrier to gene flow. By contrast, no genetic divergences were detected across the major road. While studies often focus on roads when assessing the effects of artificial linear structures on wildlife, this study provides an example of an often overlooked artificial linear structure other than a road that has a significant impact on wildlife dispersal leading to genetic subdivision.

  4. High levels of variation despite genetic fragmentation in populations of the endangered mountain pygmy-possum, Burramys parvus, in alpine Australia.

    Science.gov (United States)

    Mitrovski, P; Heinze, D A; Broome, L; Hoffmann, A A; Weeks, A R

    2007-01-01

    In endangered mammals, levels of genetic variation are often low and this is accompanied by genetic divergence among populations. The mountain pygmy-possum (Burramys parvus) is an endangered marsupial restricted to the alpine region of Victoria and New South Wales, Australia. By scoring variation at eight microsatellite loci, we found that B. parvus populations exhibit high levels of genetic divergence and fall into three distinct groups from the northern, central and southern areas of the distribution of this species, consistent with previous assessments of mitochondrial DNA variation. F(ST) values between populations from these regions ranged from 0.19 to 0.54. Within the central area, there was further genetic fragmentation, and a linear association between genetic and geographical distance. This pattern is likely to reflect limited dispersal across barriers despite the fact that individual B. parvus can move several kilometres. Levels of genetic variation within populations were high with the exception of a southern population where there was evidence of inbreeding. From a conservation perspective, all three areas where B. parvus are found should be considered as separate gene pools; management of populations within these areas needs to take into account the low gene flow between populations, as well as threats posed by roads, resorts and other developments in the alpine region. The low genetic variability and inbreeding in the southern population is of particular concern given the high levels of variability in other B. parvus populations. PMID:17181722

  5. Potential Wildlife Sentinels for Monitoring the Endemic Spread of Human Buruli Ulcer in South-East Australia

    OpenAIRE

    Carson, Connor; Lavender, Caroline J.; Handasyde, Kathrine A.; O'Brien, Carolyn R.; Hewitt, Nick; Johnson, Paul D.R.; Fyfe, Janet A. M.

    2014-01-01

    The last 20 years has seen a significant series of outbreaks of Buruli/Bairnsdale Ulcer (BU), caused by Mycobacterium ulcerans, in temperate south-eastern Australia (state of Victoria). Here, the prevailing view of M. ulcerans as an aquatic pathogen has been questioned by recent research identifying native wildlife as potential terrestrial reservoirs of infection; specifically, tree-dwelling common ringtail and brushtail possums. In that previous work, sampling of environmental possum faeces ...

  6. Vascular and avascular retinae in mammals. A funduscopic and fluorescein angiographic study.

    Science.gov (United States)

    Buttery, R G; Haight, J R; Bell, K

    1990-01-01

    Intraretinal blood vessels are present in some and absent in other vertebrate species, including the mammals. Among the marsupials, both vascular and avascular retinae are seen. We determined the funduscopic appearance of the eye, investigated the functional aspects of ocular blood flow in both types of retina in marsupials and compared our results with known patterns in placental mammals. The Australian polyprotodont marsupials, the Tasmanian devil, Sarcophilus harrisii, and the quoll, Dasyurus viverrinus, together with an American polyprotodont, the Virginia opossum, Didelphis virginiana, demonstrate variable degrees of tapetal differentiation, pigmentation and a very close parallel course of their intraretinal arteries and veins over considerable distances. Using the technique of fluorescein angiography, we found that retinal blood flow in the 3 vascular Australian species commenced with arterial filling. Early venous was seen next, followed by the capillary blush. This unusual sequence of vascular flow differs from that of the arterial-capillary-venous filling seen in placental mammals. This difference is most likely a consequence of the known looped, end artery organisation found within marsupial nervous systems, of which the retinae are a part. The 2 diprotodont marsupials examined, the brushtail possum, Trichosurus vulpecula, and the sugar glider, Petaurus breviceps, possess avascular retinae. Only a small residual tuft of fluorescein-impermeable vessels projects from the optic disc into the vitreous. Interestingly, the structural complexity of the central visual system in diprotodonts all of whom possess avascular retinae) is commonly accepted as being greater than that of the stem polyprotodont line (which possess vascular retinae). If retinal function matches this internal complexity, then retinal avascularity may, as in birds, be associated with superior vision. However, as the retinae of these mammals clearly lack any nutritive mechanisms directly

  7. Density-dependent home-range size revealed by spatially explicit capture–recapture

    Science.gov (United States)

    Efford, M.G.; Dawson, Deanna K.; Jhala, Y.V.; Qureshi, Q.

    2016-01-01

    The size of animal home ranges often varies inversely with population density among populations of a species. This fact has implications for population monitoring using spatially explicit capture–recapture (SECR) models, in which both the scale of home-range movements σ and population density D usually appear as parameters, and both may vary among populations. It will often be appropriate to model a structural relationship between population-specific values of these parameters, rather than to assume independence. We suggest re-parameterizing the SECR model using kp = σp √Dp, where kp relates to the degree of overlap between home ranges and the subscript p distinguishes populations. We observe that kp is often nearly constant for populations spanning a range of densities. This justifies fitting a model in which the separate kp are replaced by the single parameter k and σp is a density-dependent derived parameter. Continuous density-dependent spatial variation in σ may also be modelled, using a scaled non-Euclidean distance between detectors and the locations of animals. We illustrate these methods with data from automatic photography of tigers (Panthera tigris) across India, in which the variation is among populations, from mist-netting of ovenbirds (Seiurus aurocapilla) in Maryland, USA, in which the variation is within a single population over time, and from live-trapping of brushtail possums (Trichosurus vulpecula) in New Zealand, modelling spatial variation within one population. Possible applications and limitations of the methods are discussed. A model in which kp is constant, while density varies, provides a parsimonious null model for SECR. The parameter k of the null model is a concise summary of the empirical relationship between home-range size and density that is useful in comparative studies. We expect deviations from this model, particularly the dependence of kp on covariates, to be biologically interesting.

  8. Refining Operational Practice for Controlling Introduced European Rabbits on Agricultural Lands in New Zealand

    Science.gov (United States)

    Latham, A. David M.; Latham, M. Cecilia; Nugent, Graham; Smith, James; Warburton, Bruce

    2016-01-01

    European rabbits (Oryctolagus cuniculus) pose a major threat to agricultural production and conservation values in several countries. In New Zealand, population control via poisoning is a frontline method for limiting rabbit damage, with large areas commonly treated using the metabolic toxin sodium fluoroacetate (‘1080’) delivered in bait via aerial dispersal. However, this method is expensive and the high application rates of the active ingredient cause public antipathy towards it. To guide reductions in cost and toxin usage, we evaluated the economics and efficacy of rabbit control using an experimental approach of sowing 1080-bait in strips instead of the commonly-used broadcast sowing method (i.e. complete coverage). Over a 4-year period we studied aerial delivery of 0.02% 1080 on diced carrot bait over ~3500 ha of rabbit-prone land in the North and South islands. In each case, experimental sowing via strip patterns using 10–15 kg of bait per hectare was compared with the current best practice of aerial broadcast sowing at 30–35 kg/ha. Operational kill rates exceeded 87% in all but one case and averaged 93–94% across a total of 19 treatment replicates under comparable conditions; there was no statistical difference in overall efficacy observed between the two sowing methods. We project that strip-sowing could reduce by two thirds the amount of active 1080 applied per hectare in aerial control operations against rabbits, both reducing the non-target poisoning risk and promoting cost savings to farming operations. These results indicate that, similarly to the recently-highlighted benefits of adopting strip-sowing for poison control of introduced brushtail possums (Trichosurus vulpecula) in New Zealand, aerial strip-sowing of toxic bait could also be considered a best practice method for rabbit control in pest control policy. PMID:27341209

  9. Interspecific and geographic variation in the diets of sympatric carnivores: dingoes/wild dogs and red foxes in south-eastern Australia.

    Directory of Open Access Journals (Sweden)

    Naomi E Davis

    Full Text Available Dingoes/wild dogs (Canis dingo/familiaris and red foxes (Vulpes vulpes are widespread carnivores in southern Australia and are controlled to reduce predation on domestic livestock and native fauna. We used the occurrence of food items in 5875 dingo/wild dog scats and 11,569 fox scats to evaluate interspecific and geographic differences in the diets of these species within nine regions of Victoria, south-eastern Australia. The nine regions encompass a wide variety of ecosystems. Diet overlap between dingoes/wild dogs and foxes varied among regions, from low to near complete overlap. The diet of foxes was broader than dingoes/wild dogs in all but three regions, with the former usually containing more insects, reptiles and plant material. By contrast, dingoes/wild dogs more regularly consumed larger mammals, supporting the hypothesis that niche partitioning occurs on the basis of mammalian prey size. The key mammalian food items for dingoes/wild dogs across all regions were black wallaby (Wallabia bicolor, brushtail possum species (Trichosurus spp., common wombat (Vombatus ursinus, sambar deer (Rusa unicolor, cattle (Bos taurus and European rabbit (Oryctolagus cuniculus. The key mammalian food items for foxes across all regions were European rabbit, sheep (Ovis aries and house mouse (Mus musculus. Foxes consumed 6.1 times the number of individuals of threatened Critical Weight Range native mammal species than did dingoes/wild dogs. The occurrence of intraguild predation was asymmetrical; dingoes/wild dogs consumed greater biomass of the smaller fox. The substantial geographic variation in diet indicates that dingoes/wild dogs and foxes alter their diet in accordance with changing food availability. We provide checklists of taxa recorded in the diets of dingoes/wild dogs and foxes as a resource for managers and researchers wishing to understand the potential impacts of policy and management decisions on dingoes/wild dogs, foxes and the food

  10. Interspecific and geographic variation in the diets of sympatric carnivores: dingoes/wild dogs and red foxes in south-eastern Australia.

    Science.gov (United States)

    Davis, Naomi E; Forsyth, David M; Triggs, Barbara; Pascoe, Charlie; Benshemesh, Joe; Robley, Alan; Lawrence, Jenny; Ritchie, Euan G; Nimmo, Dale G; Lumsden, Lindy F

    2015-01-01

    Dingoes/wild dogs (Canis dingo/familiaris) and red foxes (Vulpes vulpes) are widespread carnivores in southern Australia and are controlled to reduce predation on domestic livestock and native fauna. We used the occurrence of food items in 5875 dingo/wild dog scats and 11,569 fox scats to evaluate interspecific and geographic differences in the diets of these species within nine regions of Victoria, south-eastern Australia. The nine regions encompass a wide variety of ecosystems. Diet overlap between dingoes/wild dogs and foxes varied among regions, from low to near complete overlap. The diet of foxes was broader than dingoes/wild dogs in all but three regions, with the former usually containing more insects, reptiles and plant material. By contrast, dingoes/wild dogs more regularly consumed larger mammals, supporting the hypothesis that niche partitioning occurs on the basis of mammalian prey size. The key mammalian food items for dingoes/wild dogs across all regions were black wallaby (Wallabia bicolor), brushtail possum species (Trichosurus spp.), common wombat (Vombatus ursinus), sambar deer (Rusa unicolor), cattle (Bos taurus) and European rabbit (Oryctolagus cuniculus). The key mammalian food items for foxes across all regions were European rabbit, sheep (Ovis aries) and house mouse (Mus musculus). Foxes consumed 6.1 times the number of individuals of threatened Critical Weight Range native mammal species than did dingoes/wild dogs. The occurrence of intraguild predation was asymmetrical; dingoes/wild dogs consumed greater biomass of the smaller fox. The substantial geographic variation in diet indicates that dingoes/wild dogs and foxes alter their diet in accordance with changing food availability. We provide checklists of taxa recorded in the diets of dingoes/wild dogs and foxes as a resource for managers and researchers wishing to understand the potential impacts of policy and management decisions on dingoes/wild dogs, foxes and the food resources they

  11. Development of the spinal cord and peripheral nervous system in platypus (Ornithorhynchus anatinus) and short-beaked echidna (Tachyglossus aculeatus).

    Science.gov (United States)

    Ashwell, Ken W S

    2012-01-01

    The modern monotremes (platypus and echidnas) are characterized by development of their young in a leathery egg that is laid into a nest or abdominal pouch. At hatching, the young are externally immature, with forelimbs capable of digitopalmar prehension, but hindlimbs little advanced beyond limb buds. The embryological collections at the Museum für Naturkunde in Berlin were used to examine the development of the spinal cord and early peripheral nervous system in developing monotremes and to correlate this with known behavioural development. Ventral root outgrowth to the bases of both the fore- and hindlimbs occurs at 6.0 mm crown-rump length (CRL), but invasion of both limbs does not happen until about 8.0-8.5 mm CRL. Differentiation of the ventral horn precedes the dorsal horn during incubation and separate medial and lateral motor columns can be distinguished before hatching. Rexed's laminae begin to appear in the dorsal horn in the first week after hatching, and gracile and cuneate fasciculi emerge during the first two post-hatching months. Qualitative and quantitative comparisons of the structure of the cervicothoracic junction spinal cord in the two monotremes with that in a diprotodont marsupial (the brush-tailed possum, Trichosurus vulpecula) of similar size at birth, did not reveal any significant structural differences between the monotremes and the marsupial. The precocious development of motor systems in the monotreme spinal cord is consistent with the behavioural requirements of the peri-hatching period, that is, rupture of embryonic membranes and egg, and digitopalmar prehension to grasp maternal hair or nest material. PMID:22401666

  12. Fine-scale refuges can buffer demographic and genetic processes against short-term climatic variation and disturbance: a 22-year case study of an arboreal marsupial.

    Science.gov (United States)

    Banks, Sam C; Lorin, Thibault; Shaw, Robyn E; McBurney, Lachlan; Blair, David; Blyton, Michaela D J; Smith, Annabel L; Pierson, Jennifer C; Lindenmayer, David B

    2015-08-01

    Ecological disturbance and climate are key drivers of temporal dynamics in the demography and genetic diversity of natural populations. Microscale refuges are known to buffer species' persistence against environmental change, but the effects of such refuges on demographic and genetic patterns in response to short-term environmental variation are poorly understood. We quantified demographic and genetic responses of mountain brushtail possums (Trichosurus cunninghami) to rainfall variability (1992-2013) and to a major wildfire. We hypothesized that there would be underlying differences in demographic and genetic processes between an unburnt mesic refuge and a topographically exposed zone that was burnt in 2009. Fire caused a 2-year decrease in survival in the burnt zone, but the population grew after the fire due to immigration, leading to increased expected heterozygosity. We documented a fire-related behavioural shift, where the rate of movement by individuals in the unburnt refuge to the burnt zone decreased after fire. Irrespective of the fire, there were long-term differences in demographic and genetic parameters between the mesic/unburnt refuge and the nonmesic/burnt zone. Survival was high and unaffected by rainfall in the refuge, but lower and rainfall-dependent in the nonmesic zone. Net movement of individuals was directional, from the mesic refuge to the nonmesic zone, suggesting fine-scale source-sink dynamics. There were higher expected heterozygosity (HE ) and temporal genetic stability in the refuge, but lower HE and marked temporal genetic structure in the exposed habitat, consistent with reduced generational overlap caused by elevated mortality and immigration. Thus, fine-scale refuges can mediate the short-term demographic and genetic effects of climate and ecological disturbance. PMID:26089175

  13. Linking bovine tuberculosis on cattle farms to white-tailed deer and environmental variables using Bayesian hierarchical analysis.

    Directory of Open Access Journals (Sweden)

    W David Walter

    Full Text Available Bovine tuberculosis is a bacterial disease caused by Mycobacterium bovis in livestock and wildlife with hosts that include Eurasian badgers (Meles meles, brushtail possum (Trichosurus vulpecula, and white-tailed deer (Odocoileus virginianus. Risk-assessment efforts in Michigan have been initiated on farms to minimize interactions of cattle with wildlife hosts but research on M. bovis on cattle farms has not investigated the spatial context of disease epidemiology. To incorporate spatially explicit data, initial likelihood of infection probabilities for cattle farms tested for M. bovis, prevalence of M. bovis in white-tailed deer, deer density, and environmental variables for each farm were modeled in a Bayesian hierarchical framework. We used geo-referenced locations of 762 cattle farms that have been tested for M. bovis, white-tailed deer prevalence, and several environmental variables that may lead to long-term survival and viability of M. bovis on farms and surrounding habitats (i.e., soil type, habitat type. Bayesian hierarchical analyses identified deer prevalence and proportion of sandy soil within our sampling grid as the most supported model. Analysis of cattle farms tested for M. bovis identified that for every 1% increase in sandy soil resulted in an increase in odds of infection by 4%. Our analysis revealed that the influence of prevalence of M. bovis in white-tailed deer was still a concern even after considerable efforts to prevent cattle interactions with white-tailed deer through on-farm mitigation and reduction in the deer population. Cattle farms test positive for M. bovis annually in our study area suggesting that the potential for an environmental source either on farms or in the surrounding landscape may contributing to new or re-infections with M. bovis. Our research provides an initial assessment of potential environmental factors that could be incorporated into additional modeling efforts as more knowledge of deer herd

  14. Animal-side Serologic Assay for Rapid Detection of Mycobacterium bovis Infection in Multiple Species of Free-ranging Wildlife

    Science.gov (United States)

    Numerous species of wild mammals are susceptible to Mycobacterium bovis, a cause of bovine tuberculosis (TB). Eurasian badgers, white-tailed deer, brushtail possums, and wild boar are implicated in the maintenance of wildlife reservoirs of M. bovis infection in different countries, fueling bovine TB...

  15. Duration of one-lung ventilation stage, POSSUM value and the quality of post-operative analgesia significantly affect survival and length of stay on intensive care unit of patients undergoing two-stage esophagectomy

    Directory of Open Access Journals (Sweden)

    Yasin Said AlMakadma

    2013-01-01

    Full Text Available Purpose: To analyze different factors affecting the outcome of patients undergoing Two Stage Esophagectomy (TSE for the treatment of esophageal carcinoma (EC while relating these factors to the length of stay on Intensive Care Unit (ILOS, mortality, and morbidity. Methods: Retrospective study of case-notes of 45 patients who underwent a TSE for resection of EC at a general district hospital in the United Kingdom (UK. These procedures were performed by the same surgical team and followed same approach, known as the Ivor-Lewis procedure. Results: The duration of One Lung Ventilation (OLV during TSE was found to be critical for patient′s outcome. Statistical analysis suggested a potentially strong effect of the duration of OLV (range: 90-320 minutes on the ILOS (P=0.001. The ratio OLV: Total duration of surgery (TOT was significantly different in early post-operative (PO deaths (within 3 months and late deaths after the third month (P=0.032. The POSSUM value (Physiological and Operative Severity Score for Enumeration of Mortality correlated well with ILOS (P=0.05. Regression analysis showed a strong relationship between the two variables (P=0.03. An excellent to good quality of PO analgesia allowed for shorter ILOS (P=0.023. Conclusions: Duration of the OLV appears as an important factor in the outcome of patients. POSSUM value could help in planning the post-operative critical care need of patients undergoing TSE. A well managed post-operative pain allowed to reduce the ILOS.

  16. POSSUM collaborative artificially joint replacement therapy senile osteoporosis sex of intertrochanteric unstable fractures%POSSUM协同人工关节置换治疗高龄骨质疏松性股骨粗隆间不稳定骨折

    Institute of Scientific and Technical Information of China (English)

    沈光银

    2011-01-01

    目的:探讨人工关节置换治疗高龄骨质疏松性股骨粗隆间不稳定骨折的方法及疗效.方法:在生理学与手术严重程度评分系统(POSSUM)协同下应用长柄双极人工股骨头置换治疗高龄骨质疏松性不稳定粗隆间骨折37例.骨折类型按Evans-Jenson分类,ⅢA:13例,ⅢB:16例,Ⅳ:8例.结果:本组患者术后切口均Ⅰ期愈合,并发症发生率与POSSUM预测一致.34例患者均获得随访,平均随访时间15个月(12~ 24个月).术后12个月Harris髋关节评分,优良率83.78%.结论:POSSUM评分系统协同下应用人工股骨头置换治疗高龄患者股骨粗隆间不稳定骨折是一种安全有效的方法.

  17. EAT, SLEEP AND REPRODUCE... EVOLUTION OF REPRODUCTIVE HORMONES AND RECEPTORS IN THE KOALA: NEW SEQUENCES AND PHYLOGENY

    OpenAIRE

    Ellen R. Busby; Stephen D. Johnston

    2011-01-01

    Studies of the hypothalamic-pituitary-gonadal axis in marsupials are limited to in vivo studies of the brushtail possum and in silico studies of the sequenced genome for the grey short-tailed opossum, so that knowledge of the mechanisms that regulate reproduction in this taxon is incomplete. To further appreciate the unique reproductive biology of marsupials (koala), there is a need to develop tools that allow the measurement and alteration of the hypothalamic and adenohypophysial hormones a...

  18. Assessing Animals’ Preferences: Concurrent Schedules of Reinforcement

    OpenAIRE

    Sumpter, Catherine E.; Foster, Mary T.; Temple, William

    2002-01-01

    Three methods of assessing animals’ preferences are outlined: free-access, two-choice (e.g., T maze), and concurrent-schedules. While all give indications of relative preference between the choices, freeaccess and discrete-trial procedures tend to give exclusive preference and so do not indicate the degree of preference. Concurrent schedules give at least ordinal measures of the degree of preference. Data from cows, hens, and brushtail possums are used to illustrate the use of concurrent sche...

  19. Surveillance and movements of Virginia opossum (Didelphis virginiana) in the bovine tuberculosis region of Michigan.

    Science.gov (United States)

    Walter, W D; Fischer, J W; Anderson, C W; Marks, D R; Deliberto, T; Robbe-Austerman, S; Vercauteren, K C

    2013-07-01

    Wildlife reservoir hosts of bovine tuberculosis (bTB) include Eurasian badgers (Meles meles) and brushtail possum (Trichosurus vulpecula) in the UK and New Zealand, respectively. Similar species warrant further investigation in the northern lower peninsula of Michigan, USA due to the continued presence of bTB on cattle farms. Most research in Michigan, USA has focused on interactions between white-tailed deer (Odocoileus virginianus) and cattle (Bos taurus) for the transmission of the infectious agent of bTB, Mycobacterium bovis, due to high deer densities and feeding practices. However, limited data are available on medium-sized mammals such as Virginia opossum (Didelphis virginiana; hereafter referred to as opossum) and their movements and home range in Michigan near cattle farms. We conducted surveillance of medium-sized mammals on previously depopulated cattle farms for presence of M. bovis infections and equipped opossum with Global Positioning System (GPS) technology to assess potential differences in home range between farms inside and outside the bTB core area that has had cattle test positive for M. bovis. On farms inside the bTB core area, prevalence in opossum was comparable [6%, 95% confidence interval (CI) 2.0-11.0] to prevalence in raccoon (Procyon lotor; 4%, 95% CI 1.0-9.0, P=0.439) whereas only a single opossum tested positive for M. bovis on farms outside the bTB core area. The prevalence in opossum occupying farms that had cattle test positive for M. bovis was higher (6.4%) than for opossum occupying farms that never had cattle test positive for M. bovis (0.9%, P=0.01). Mean size of home range for 50% and 95% estimates were similar by sex (P=0.791) both inside or outside the bTB core area (P=0.218). Although surveillance efforts and home range were not assessed on the same farms, opossum use of farms near structures was apparent as was selection for farms over surrounding forested habitats. The use of farms, stored feed, and structures by opossum

  20. The epidemiology of Mycobacterium bovis in wild deer and feral pigs and their roles in the establishment and spread of bovine tuberculosis in New Zealand wildlife.

    Science.gov (United States)

    Nugent, G; Gortazar, C; Knowles, G

    2015-06-01

    In New Zealand, wild deer and feral pigs are assumed to be spillover hosts for Mycobacterium bovis, and so are not targeted in efforts aimed at locally eradicating bovine tuberculosis (TB) from possums (Trichosurus vulpecula), the main wildlife host. Here we review the epidemiology of TB in deer and pigs, and assess whether New Zealand's TB management programme could be undermined if these species sometimes achieve maintenance host status. In New Zealand, TB prevalences of up to 47% have been recorded in wild deer sympatric with tuberculous possums. Patterns of lesion distribution, age-specific prevalences and behavioural observations suggest that deer become infected mainly through exposure to dead or moribund possums. TB can progress rapidly in some deer (possums, is likely. That creates a small spillback risk that could persist for a decade after transmission of new infection to wild deer has been halted. Tuberculosis prevalence in New Zealand feral pigs can reach 100%. Infections in lymph nodes of the head and alimentary tract predominate, indicating that TB is mostly acquired through scavenging tuberculous carrion, particularly possums. Infection is usually well contained, and transmission between pigs is rare. Large reductions in local possum density result in gradual declines (over 10 years) in TB prevalence among sympatric wild deer, and faster declines in feral pigs. Elimination of TB from possums (and livestock) therefore results in eventual disappearance of TB from feral pigs and wild deer. However, the risk of spillback infection from deer to possums substantially extends the time needed to locally eradicate TB from all wildlife (compared to that which would be required to eradicate disease from possums alone), while dispersal or translocation of pigs (e.g. by hunters) creates a risk of long-distance spread of disease. The high rate at which pigs acquire M. bovis infection from dead possums makes them useful as sentinels for detecting TB in wildlife. It

  1. Toward eradication: the effect of Mycobacterium bovis infection in wildlife on the evolution and future direction of bovine tuberculosis management in New Zealand.

    Science.gov (United States)

    Livingstone, P G; Hancox, N; Nugent, G; de Lisle, G W

    2015-06-01

    New Zealand's bovine tuberculosis (TB) control programme has greatly reduced the burden of tuberculosis on the farming industry, from 11% of mature cattle found with TB at slaughter in 1905 to possum (Trichosurus vulpecula), which also triggered a wildlife disease complex involving a range of introduced species. This paper reviews the progressive elucidation of the epidemiology of Mycobacterium bovis in New Zealand's wildlife and farmed livestock, and the parallel development of research-led, multi-faceted TB control strategies required to protect New Zealand's livestock industries from damaging infection levels. The adoption of coordinated national pest management strategies, with increasingly ambitious objectives agreed between government and industry funders, has driven a costly but very successful management regime targeted at controlling TB in the possum maintenance host. This success has led to initiation of a strategy designed to eradicate TB from New Zealand's livestock and wildlife, which is considered a realistic long-term prospect. PMID:25273888

  2. Chemical characterization of milk oligosaccharides of the eastern quoll (Dasyurus viverrinus).

    Science.gov (United States)

    Urashima, Tadasu; Sun, Yiliang; Fukuda, Kenji; Hirayama, Kentaro; Taufik, Epi; Nakamura, Tadashi; Saito, Tadao; Merchant, Jim; Green, Brian; Messer, Michael

    2015-08-01

    Structural characterizations of marsupial milk oligosaccharides have been performed in four species to date: the tammar wallaby (Macropus eugenii), the red kangaroo (Macropus rufus), the koala (Phascolarctos cinereus) and the common brushtail possum (Trichosurus vulpecula). To clarify the homology and heterogeneity of milk oligosaccharides among marsupials, the oligosaccharides in the carbohydrate fraction of eastern quoll milk were characterized in this study. Neutral and acidic oligosaccharides were separated and characterized by (1)H-nuclear magnetic resonance spectroscopy and matrix-assisted laser desorption/ionization time-of-flight mass spectrometry. The structures of the neutral oligosaccharides were Gal(β1-3)Gal(β1-4)Glc (3'-galactosyllactose), Gal(β1-3)Gal(β1-3)Gal(β1-4)Glc (3",3'-digalactosyllactose), Gal(β1-3)[Gal(β1-4)GlcNAc(β1-6)]Gal(β1-4)Glc (lacto-N-novopentaose I), Gal(β1-3)Gal(β1-3)[Gal(β1-4)GlcNAc(β1-6)]Gal(β1-4)Glc (galactosyl lacto-N-novopentaose I), Gal(β1-3)[Gal(β1-4)GlcNAc(β1-6)]Gal(β1-3)Gal(β1-4)Glc (galactosyl lacto-N-novopentaose II), Gal(β1-3)[Gal(β1-3)Gal(β1-4)GlcNAc(β1-6)]Gal(β1-4)Glc (galactosyl lacto-N-novopentaose III) and Gal(β1-3)[Gal(β1-4)GlcNAc(β1-6)]Gal(β1-3)[Gal(β1-4)GlcNAc(β1-6)]Gal(β1-4)Glc (lacto-N-novooctaose). The structures of the acidic oligosaccharides detected are Neu5Ac(α2-3)Gal(β1-4)Glc (3'-sialyllactose), Gal(β1-3)(O-3-sulfate)[Gal(β1-4)GlcNAc(β1-6)]Gal(β1-4)Glc (lacto-N-novopentaose I sulfate a), Gal(β1-3)[Gal(β1-4)(O-3-sulfate)GlcNAc(β1-6)]Gal(β1-4)Glc (lacto-N-novopentaose I sulfate b), Neu5Ac(α2-3)Gal(β1-3)[Gal(β1-4)GlcNAc(β1-6)]Gal(β1-4)Glc (sialyl lacto-N-novopentaose a), Gal(β1-3)[Neu5Ac(α2-3)Gal(β1-4)GlcNAc(β1-6)]Gal(β1-4)Glc (sialyl lacto-N-novopentaose c), Neu5Ac(α2-3) Gal(β1-3)[Gal(β1-4)GlcNAc(β1-6)]Gal(β1-3)[Gal(β1-4)GlcNAc(β1-6)]Gal(β1-4)Glc, and Gal(β1-3)[Gal(β1-4)GlcNAc(β1-6)]Gal(β1-3)[Gal(β1-4)GlcNAc(β1-6)]Gal(β1-4)Glc with an α(2

  3. The Possum Story: Reflections of an Early Childhood Drama Teacher

    Science.gov (United States)

    Deans, Jan; Brown, Robert; Young, Sarah

    2007-01-01

    Support for reflective practice (Dewey, 1910; Schon, 1983) as a way of reviewing, articulating and informing practice, is well-established within teacher education and research, though there is still much to learn from the individual experience of the practitioner who grapples with the reflective process. This paper highlights the deliberations of…

  4. "Playing Possum": A Young Child's Responses to Information Books.

    Science.gov (United States)

    Maduram, Ida

    2000-01-01

    Examines the author's daughter's spontaneous responses to information books, especially those responses that occurred outside book-sharing sessions. Investigates response episodes as: casual conversations, a reevaluation of facts, reflections of complex thinking, transactions between life and literature, and portraits of personal inquiry. (SR)

  5. Can individual and social patterns of resource use buffer animal populations against resource decline?

    Science.gov (United States)

    Banks, Sam C; Lindenmayer, David B; Wood, Jeff T; McBurney, Lachlan; Blair, David; Blyton, Michaela D J

    2013-01-01

    Species in many ecosystems are facing declines of key resources. If we are to understand and predict the effects of resource loss on natural populations, we need to understand whether and how the way animals use resources changes under resource decline. We investigated how the abundance of arboreal marsupials varies in response to a critical resource, hollow-bearing trees. Principally, we asked what mechanisms mediate the relationship between resources and abundance? Do animals use a greater or smaller proportion of the remaining resource, and is there a change in cooperative resource use (den sharing), as the availability of hollow trees declines? Analyses of data from 160 sites surveyed from 1997 to 2007 showed that hollow tree availability was positively associated with abundance of the mountain brushtail possum, the agile antechinus and the greater glider. The abundance of Leadbeater's possum was primarily influenced by forest age. Notably, the relationship between abundance and hollow tree availability was significantly less than 1:1 for all species. This was due primarily to a significant increase by all species in the proportional use of hollow-bearing trees where the abundance of this resource was low. The resource-sharing response was weaker and inconsistent among species. Two species, the mountain brushtail possum and the agile antechinus, showed significant but contrasting relationships between the number of animals per occupied tree and hollow tree abundance. The discrepancies between the species can be explained partly by differences in several aspects of the species' biology, including body size, types of hollows used and social behaviour as it relates to hollow use. Our results show that individual and social aspects of resource use are not always static in response to resource availability and support the need to account for dynamic resource use patterns in predictive models of animal distribution and abundance. PMID:23320100

  6. Can individual and social patterns of resource use buffer animal populations against resource decline?

    Directory of Open Access Journals (Sweden)

    Sam C Banks

    Full Text Available Species in many ecosystems are facing declines of key resources. If we are to understand and predict the effects of resource loss on natural populations, we need to understand whether and how the way animals use resources changes under resource decline. We investigated how the abundance of arboreal marsupials varies in response to a critical resource, hollow-bearing trees. Principally, we asked what mechanisms mediate the relationship between resources and abundance? Do animals use a greater or smaller proportion of the remaining resource, and is there a change in cooperative resource use (den sharing, as the availability of hollow trees declines? Analyses of data from 160 sites surveyed from 1997 to 2007 showed that hollow tree availability was positively associated with abundance of the mountain brushtail possum, the agile antechinus and the greater glider. The abundance of Leadbeater's possum was primarily influenced by forest age. Notably, the relationship between abundance and hollow tree availability was significantly less than 1:1 for all species. This was due primarily to a significant increase by all species in the proportional use of hollow-bearing trees where the abundance of this resource was low. The resource-sharing response was weaker and inconsistent among species. Two species, the mountain brushtail possum and the agile antechinus, showed significant but contrasting relationships between the number of animals per occupied tree and hollow tree abundance. The discrepancies between the species can be explained partly by differences in several aspects of the species' biology, including body size, types of hollows used and social behaviour as it relates to hollow use. Our results show that individual and social aspects of resource use are not always static in response to resource availability and support the need to account for dynamic resource use patterns in predictive models of animal distribution and abundance.

  7. Not all types of host contacts are equal when it comes to E. coli transmission.

    Science.gov (United States)

    Blyton, Michaela D J; Banks, Sam C; Peakall, Rod; Lindenmayer, David B; Gordon, David M

    2014-08-01

    The specific processes that facilitate pathogen transmission are poorly understood, particularly for wild animal populations. A major impediment for investigating transmission pathways is the need for simultaneous information on host contacts and pathogen transfer. In this study, we used commensal Escherichia coli strains as a model system for gastrointestinal pathogens. We combined strain-sharing information with detailed host contact data to investigate transmission routes in mountain brushtail possums. Despite E. coli being transmitted via the faecal-oral route, we revealed that, strain-sharing among possums was better explained by host contacts than spatial proximity. Furthermore, and unexpectedly, strain-sharing was more strongly associated with the duration of brief nocturnal associations than day-long den-sharing. Thus, the most cryptic and difficult associations to measure were the most relevant connections for the transmission of this symbiont. We predict that future studies that employ similar approaches will reveal the importance of previously overlooked associations as key transmission pathways. PMID:24861219

  8. Assessment of surgical risk in colo-rectal cancer patients: POSSUM or ACPGBI?

    OpenAIRE

    Goulart, A; Martins, S

    2013-01-01

    Introduction: Several models have been developed with the purpose of predicting surgical risk of patients submitted to colorectal cancer surgery. However, to date, there isn’t any model that fulfills this purpose in a satisfactory manner. Methods: We consulted the clinical processes of 345 patients, who were submitted to surgical colorectal cancer treatment at the General Surgery department in Hospital de Braga, and calculated surgical risk based on the following risk assessment scal...

  9. PoSSuM: a database of similar protein–ligand binding and putative pockets

    OpenAIRE

    Ito, Jun-ichi; Tabei, Yasuo; Shimizu, Kana; Tsuda, Koji; Tomii, Kentaro

    2011-01-01

    Numerous potential ligand-binding sites are available today, along with hundreds of thousands of known binding sites observed in the PDB. Exhaustive similarity search for such vastly numerous binding site pairs is useful to predict protein functions and to enable rapid screening of target proteins for drug design. Existing databases of ligand-binding sites offer databases of limited scale. For example, SitesBase covers only ∼33 000 known binding sites. Inferring protein function and drug disc...

  10. Assessment of surgical risk in colo-rectal cancer patients : POSSUM vs. ACPGBI?

    OpenAIRE

    Goulart, André; Martins, Sandra

    2013-01-01

    Diversos modelos têm sido desenvolvidos para prever o risco cirúrgico dos doentes submetidos a cirurgia por cancro colo- -rectal (CCR), contudo actualmente ainda não existe nenhum que responda satisfatoriamente a essa necessidade. Material e métodos: Foram analisados os processos de 345 doentes submetidos a tratamento cirúrgico por CCR no Serviço de Cirurgia Geral do Hospital de Braga e calculado o risco cirúrgico previsto pelas escalas Physiological and Operative Severity Score for ...

  11. The metapopulation dynamics of an infectious disease: a case study of tuberculosis in possums

    NARCIS (Netherlands)

    Fulford, G.R.; Roberts, M.G.; Heesterbeek, J.A.P.

    2002-01-01

    An SEI metapopulation model is developed for the spread of an infectious agent by migration. The model portrays two age classes on a number of patches connected by migration routes which are used as host animals mature. A feature of this model is that the basic reproduction ratio may be computed dir

  12. Neurogenesis in the brain auditory pathway of a marsupial, the northern native cat (Dasyurus hallucatus)

    International Nuclear Information System (INIS)

    Neurogenesis in the auditory pathway of the marsupial Dasyurus hallucatus was studied. Intraperitoneal injections of tritiated thymidine (20-40 microCi) were made into pouch-young varying from 1 to 56 days pouch-life. Animals were killed as adults and brain sections were prepared for autoradiography and counterstained with a Nissl stain. Neurons in the ventral cochlear nucleus were generated prior to 3 days pouch-life, in the superior olive at 5-7 days, and in the dorsal cochlear nucleus over a prolonged period. Inferior collicular neurogenesis lagged behind that in the medial geniculate, the latter taking place between days 3 and 9 and the former between days 7 and 22. Neurogenesis began in the auditory cortex on day 9 and was completed by about day 42. Thus neurogenesis was complete in the medullary auditory nuclei before that in the midbrain commenced, and in the medial geniculate before that in the auditory cortex commenced. The time course of neurogenesis in the auditory pathway of the native cat was very similar to that in another marsupial, the brushtail possum. For both, neurogenesis occurred earlier than in eutherian mammals of a similar size but was more protracted

  13. Neurogenesis in the brain auditory pathway of a marsupial, the northern native cat (Dasyurus hallucatus)

    Energy Technology Data Exchange (ETDEWEB)

    Aitkin, L.; Nelson, J.; Farrington, M.; Swann, S. (Department of Physiology, Monash University, Melbourne (Australia))

    1991-07-08

    Neurogenesis in the auditory pathway of the marsupial Dasyurus hallucatus was studied. Intraperitoneal injections of tritiated thymidine (20-40 microCi) were made into pouch-young varying from 1 to 56 days pouch-life. Animals were killed as adults and brain sections were prepared for autoradiography and counterstained with a Nissl stain. Neurons in the ventral cochlear nucleus were generated prior to 3 days pouch-life, in the superior olive at 5-7 days, and in the dorsal cochlear nucleus over a prolonged period. Inferior collicular neurogenesis lagged behind that in the medial geniculate, the latter taking place between days 3 and 9 and the former between days 7 and 22. Neurogenesis began in the auditory cortex on day 9 and was completed by about day 42. Thus neurogenesis was complete in the medullary auditory nuclei before that in the midbrain commenced, and in the medial geniculate before that in the auditory cortex commenced. The time course of neurogenesis in the auditory pathway of the native cat was very similar to that in another marsupial, the brushtail possum. For both, neurogenesis occurred earlier than in eutherian mammals of a similar size but was more protracted.

  14. THE SUGAR GLIDER (PETAURUS BREVICEPS): A LABORATORY HOST FOR THE NEMATODE PARASTRONGYLOIDES TRICHOSURI

    Science.gov (United States)

    Nolan, Thomas J.; Zhu, Xiaodong; Ketschek, Andrea; Cole, Joan; Grant, Warwick; Lok, James B.; Schad, Gerhard A.

    2011-01-01

    Parastrongyloides trichosuri is a nematode parasite of the Australian brush-tailed possums that can be propagated through many generations in vitro. This makes P. trichosuri uniquely suited for genetic investigations, including those involving transgenesis. However, an obstacle to its use as an experimental model has been the fact that its host is limited to Australia and New Zealand and that it cannot be exported because of its status as a protected species or agricultural pest, respectively. In previous studies, conventional laboratory animals such as rats, mice, rabbits, ferrets, and chickens have failed to support infections. In the present study, gerbils and short-tailed opossums proved similarly refractory to infection. In contrast, the sugar glider (Petaurus breviceps, family Petauridae) proved to be a good host for P. trichosuri. Patent infections resulted using as few as 6 infective larvae (L3i) and as many as 2,000 L3i. Large numbers of L3i (1,000–2,000) produced patent infections of much shorter duration than those seen when 100 L3i were initially given to the sugar glider. In one case, an infection initiated with 100 L3i was patent for over 1 yr. Parastrongyloides trichosuri is easily cryopreserved using a method developed for Strongyloides stercoralis. Thus, we have identified an experimental host for P. trichosuri that will make it possible to conduct research on this parasite in laboratories outside the endemic sites. PMID:18163342

  15. Avaliação do risco cirúrgico nos doentes com cancro colo-rectal: POSSUM ou ACPGBI

    OpenAIRE

    Goulart, A; Martins, S

    2013-01-01

    Introduction: Several models have been developed with the purpose of predicting surgical risk of patients submitted to colorectal cancer surgery. However, to date, there isn’t any model that fulfills this purpose in a satisfactory manner. Methods: We consulted the clinical processes of 345 patients, who were submitted to surgical colorectal cancer treatment at the General Surgery department in Hospital de Braga, and calculated surgical risk based on the following risk assessment scal...

  16. oPOSSUM: identification of over-represented transcription factor binding sites in co-expressed genes

    OpenAIRE

    Ho Sui, Shannan J; Mortimer, James R.; Arenillas, David J.; Brumm, Jochen; Walsh, Christopher J.; Kennedy, Brian P; Wasserman, Wyeth W.

    2005-01-01

    Targeted transcript profiling studies can identify sets of co-expressed genes; however, identification of the underlying functional mechanism(s) is a significant challenge. Established methods for the analysis of gene annotations, particularly those based on the Gene Ontology, can identify functional linkages between genes. Similar methods for the identification of over-represented transcription factor binding sites (TFBSs) have been successful in yeast, but extension to human genomics has la...

  17. Epigenetic modifications on X chromosomes in marsupial and monotreme mammals and implications for evolution of dosage compensation.

    Science.gov (United States)

    Rens, Willem; Wallduck, Margaret S; Lovell, Frances L; Ferguson-Smith, Malcolm A; Ferguson-Smith, Anne C

    2010-10-12

    X chromosome dosage compensation in female eutherian mammals is regulated by the noncoding Xist RNA and is associated with the differential acquisition of active and repressive histone modifications, resulting in repression of most genes on one of the two X chromosome homologs. Marsupial mammals exhibit dosage compensation; however, they lack Xist, and the mechanisms conferring epigenetic control of X chromosome dosage compensation remain elusive. Oviparous mammals, the monotremes, have multiple X chromosomes, and it is not clear whether they undergo dosage compensation and whether there is epigenetic dimorphism between homologous pairs in female monotremes. Here, using antibodies against DNA methylation, eight different histone modifications, and HP1, we conduct immunofluorescence on somatic cells of the female Australian marsupial possum Trichosurus vulpecula, the female platypus Ornithorhynchus anatinus, and control mouse cells. The two marsupial X's were different for all epigenetic features tested. In particular, unlike in the mouse, both repressive modifications, H3K9me3 and H4K20Me3, are enriched on one of the X chromosomes, and this is associated with the presence of HP1 and hypomethylation of DNA. Using sequential labeling, we determine that this DNA hypomethylated X correlates with histone marks of inactivity. These results suggest that female marsupials use a repressive histone-mediated inactivation mechanism and that this may represent an ancestral dosage compensation process that differs from eutherians that require Xist transcription and DNA methylation. In comparison to the marsupial, the monotreme exhibited no epigenetic differences between homologous X chromosomes, suggesting the absence of a dosage compensation process comparable to that in therians. PMID:20861449

  18. Species of Angiostrongylus (Nematoda: Metastrongyloidea) in wildlife: A review.

    Science.gov (United States)

    Spratt, David M

    2015-08-01

    Twenty-one species of Angiostrongylus plus Angiostrongylus sp. (Nematoda: Metastrongyloidea) are known currently in wildlife. These occur naturally in rodents, tupaiids, mephitids, mustelids, procyonids, felids, and canids, and aberrantly in a range of avian, marsupial and eutherian hosts including humans. Adults inhabit the pulmonary arteries and right atrium, ventricle and vena cava, bronchioles of the lung or arteries of the caecum and mesentery. All species pass first-stage larvae in the faeces of the host and all utilise slugs and/or aquatic or terrestrial snails as intermediate hosts. Gastropods are infected by ingestion or penetration of first-stage larvae; definitive hosts by ingestion of gastropods or gastropod slime. Transmission of at least one species may involve ingestion of paratenic hosts. Five developmental pathways are identified in these life cycles. Thirteen species, including Angiostrongylus sp., are known primarily from the original descriptions suggesting limited geographic distributions. The remaining species are widespread either globally or regionally, and are continuing to spread. Small experimental doses of infective larvae (ca. 20) given to normal or aberrant hosts are tolerated, although generally eliciting a granulomatous histopathological response; large doses (100-500 larvae) often result in clinical signs and/or death. Two species, A. cantonensis and A. costaricensis, are established zoonoses causing neurological and abdominal angiostrongliasis respectively. The zoonotic potential of A. mackerrasae, A. malaysiensis and A. siamensis particularly warrant investigation. Angiostrongylus cantonensis occurs in domestic animals, mammalian and avian wildlife and humans in the metropolitan areas of Brisbane and Sydney, Australia, where it has been suggested that tawny frogmouths and brushtail possums may serve as biosentinels. A major conservation issue is the devastating role A. cantonensis may play around zoos and fauna parks where captive

  19. Immunome database for marsupials and monotremes

    Directory of Open Access Journals (Sweden)

    Papenfuss Anthony T

    2011-08-01

    Full Text Available Abstract Background To understand the evolutionary origins of our own immune system, we need to characterise the immune system of our distant relatives, the marsupials and monotremes. The recent sequencing of the genomes of two marsupials (opossum and tammar wallaby and a monotreme (platypus provides an opportunity to characterise the immune gene repertoires of these model organisms. This was required as many genes involved in immunity evolve rapidly and fail to be detected by automated gene annotation pipelines. Description We have developed a database of immune genes from the tammar wallaby, red-necked wallaby, northern brown bandicoot, brush-tail possum, opossum, echidna and platypus. The resource contains 2,235 newly identified sequences and 3,197 sequences which had been described previously. This comprehensive dataset was built from a variety of sources, including EST projects and expert-curated gene predictions generated through a variety of methods including chained-BLAST and sensitive HMMER searches. To facilitate systems-based research we have grouped sequences based on broad Gene Ontology categories as well as by specific functional immune groups. Sequences can be extracted by keyword, gene name, protein domain and organism name. Users can also search the database using BLAST. Conclusion The Immunome Database for Marsupials and Monotremes (IDMM is a comprehensive database of all known marsupial and monotreme immune genes. It provides a single point of reference for genomic and transcriptomic datasets. Data from other marsupial and monotreme species will be added to the database as it become available. This resource will be utilized by marsupial and monotreme immunologists as well as researchers interested in the evolution of mammalian immunity.

  20. Dicty_cDB: Contig-U02566-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U02566-1 no gap 111 2 7759614 7759725 PLUS 1 1 U02566 0 0 0 0 1 0 0 0 0 0 0 0 0 0 Show Co ... c clone ... 42 3.7 1 ( EG628233 ) EMBRYOF101125O10 POSSUM _01-POSSUM -C-EMBRYO-2KB Tr... 42 3.7 1 ( EG624142 ) ... EMBRYOF095453K19 POSSUM _01-POSSUM -C-EMBRYO-2KB Tr... 42 3.7 1 ( DY613010 ) ... IMMUNEF078647L21 POSSUM _01-C-POSSUM -IMMUNE-2KB Tr... 42 3.7 1 ( CR543861 ) ...

  1. Dicty_cDB: Contig-U00893-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U00893-1 no gap 656 2 1029468 1028812 MINUS 1 1 U00893 0 0 0 0 0 0 0 0 1 0 0 0 0 0 Show C ... Osmerus m... 44 6.6 1 ( EG623890 ) EMBRYOF095453A3 POSSUM _01-POSSUM -C-EMBRYO-2KB Tri... 44 6.6 1 ( EG623706 ... ) EMBRYOF088231O18 POSSUM _01-POSSUM -C-EMBRYO-2KB Tr... 44 6.6 1 ( EG618529 ) ... REPROTRACTF101157L7 POSSUM _01-POSSUM -C-REPROTRACT... 44 6.6 1 ( DR179511 ) RT ...

  2. Dicty_cDB: Contig-U07063-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U07063-1 no gap 396 3 5243640 5243244 MINUS 1 2 U07063 1 0 0 0 0 0 0 0 0 0 0 0 0 0 Show C ... VS... 125 8e-56 4 ( EG612682 ) REPROTRACTF093614K4 POSSUM _01-POSSUM -C-REPROTRACT... 54 0.004 1 ( EC364269 ) ... IMMUNEF093542B2 POSSUM _01-C-POSSUM -IMMUNE-2KB Tri... 54 0.004 1 ( EC35672 ... 1 ) LIVERF089486O14 POSSUM _01-POSSUM -LIVER-2KB Tricho... 54 0.004 1 ( EX20337 ...

  3. Dicty_cDB: Contig-U00581-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U00581-1 gap included 1235 6 1897684 1896416 MINUS 3 5 U00581 1 0 0 0 1 1 0 0 0 0 0 0 0 0 ... 7_F,... 48 0.82 1 ( EG612703 ) REPROTRACTF093614O6 POSSUM _01-POSSUM -C-REPROTRACT... 48 0.82 1 ( EC345872 ) K ... IDNEYF091703B2 POSSUM _01-POSSUM -KIDNEY-2KB Trich... 48 0.82 1 ( EC336574 ... ) KIDNEYF089536B24 POSSUM _01-POSSUM -KIDNEY-2KB Tric... 48 0.82 1 ( BP876916 ...

  4. Pogo the Possum Lives, or We Have Met the Enemy, and They Still Are Us: A Response to Frana and Wallmark.

    Science.gov (United States)

    Sodikow, Richard B.

    Debate is structured argumentation consisting of four elements: a resolution or proposition; an affirmative position, speaker, or team supporting the proposition; a negative position, speaker, or team responsible for attacking the proposition; and a judge or group of judges who determines which position has better achieved its purpose. Debate as a…

  5. Dicty_cDB: Contig-U05425-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U05425-1 no gap 162 3 1253638 1253800 PLUS 1 1 U05425 0 0 0 0 0 0 1 0 0 0 0 0 0 0 Show Co ... -107N06.... 44 1.5 1 ( EG602887 ) EMBRYOF101124L12 POSSUM _01-POSSUM -C-EMBRYO-2KB Tr... 44 1.5 1 ( EC825194 ) ... DNA,... 44 1.5 1 ( EC324427 ) REPROTRACTF089704D20 POSSUM _01-POSSUM -C-REPROTRAC... 44 1.5 1 ( EC291005 ) BRA ... INF089532F3 POSSUM _01-POSSUM -C-BRAIN-2KB Trich... 44 1.5 1 ( EB581531 ... phila an... 44 1.5 1 ( DY594958 ) KIDNEYF074982A24 POSSUM _01-POSSUM -KIDNEY-2KB Tric... 44 1.5 1 ( CV126118 ) ...

  6. Dicty_cDB: Contig-U14731-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U14731-1 no gap 492 2 6394207 6393732 MINUS 10 15 U14731 8 1 0 0 0 0 1 0 0 0 0 0 0 0 Show ... -3077O12, W... 44 4.6 1 ( EC333049 ) GUTF089627D16 POSSUM _01-POSSUM -GUT-2KB Trichosuru... 44 4.6 1 ( EC32638 ... 7 ) GUTF089550P21 POSSUM _01-POSSUM -GUT-2KB Trichosuru... 44 4.6 1 ( DY61001 ... 8 ) IMMUNEF045823F18 POSSUM _01-C-POSSUM -IMMUNE-2KB Tr... 44 4.6 1 ( DY593895 ) ... GUTF054259J17 POSSUM _01-POSSUM -GUT-2KB Trichosuru... 44 4.6 1 ( DY59262 ...

  7. Dicty_cDB: Contig-U09201-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U09201-1 gap included 592 4 1644222 1643632 MINUS 1 2 U09201 0 0 0 0 0 1 0 0 0 0 0 0 0 0 ... nds Sol... 44 0.001 2 ( EC361575 ) IMMUNEF091726O1 POSSUM _01-C-POSSUM -IMMUNE-2KB Tri... 56 0.001 1 ( EC36146 ... 7 ) IMMUNEF091726I13 POSSUM _01-C-POSSUM -IMMUNE-2KB Tr... 56 0.001 1 ( EC361425 ... ) IMMUNEF091726G15 POSSUM _01-C-POSSUM -IMMUNE-2KB Tr... 56 0.001 1 ( DY614609 ... ) IMMUNEF045805E21 POSSUM _01-C-POSSUM -IMMUNE-2KB Tr... 56 0.001 1 ( DY595914 ...

  8. Dicty_cDB: Contig-U13332-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U13332-1 no gap 672 4 4309799 4309127 MINUS 4 4 U13332 0 0 2 0 0 2 0 0 0 0 0 0 0 0 Show C ... e SLD882. 539 e-149 1 ( EG610177 ) KIDNEYF100760M6 POSSUM _01-POSSUM -KIDNEY-2KB Trich... 54 0.007 1 ( EC35459 ... 9 ) LIVERF089697J9 POSSUM _01-POSSUM -LIVER-2KB Trichos... 54 0.007 1 ( EC3514 ... 71 ) LIVERF091688E7 POSSUM _01-POSSUM -LIVER-2KB Trichos... 54 0.007 1 ( EC2975 ... 48 ) OVARYF092731J1 POSSUM _01-POSSUM -C-OVARY-2KB Trich... 54 0.007 1 ( CN2264 ...

  9. Dicty_cDB: Contig-U15226-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U15226-1 no gap 583 2 6548160 6547712 MINUS 3 3 U15226 0 0 0 0 0 0 1 0 0 0 0 0 1 1 Show C ... mic ... 44 5.5 1 ( EG612916 ) REPROTRACTF093614F20 POSSUM _01-POSSUM -C-REPROTRAC... 44 5.5 1 ( EC301391 ) OVA ... RYF089558C18 POSSUM _01-POSSUM -C-OVARY-2KB Tric... 44 5.5 1 ( DX402309 ...

  10. Dicty_cDB: Contig-U04194-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U04194-1 no gap 298 M 22794 23014 PLUS 2 2 U04194 0 0 0 0 0 2 0 0 0 0 0 0 0 0 Show Contig ... ary Spiro... 44 2.9 1 ( DY613410 ) IMMUNEF045815C5 POSSUM _01-C-POSSUM -IMMUNE-2KB Tri... 44 2.9 1 ( DY590767 ... ) GUTF074984M23 POSSUM _01-POSSUM -GUT-2KB Trichosuru... 44 2.9 1 ( BY71659 ...

  11. Dicty_cDB: Contig-U06349-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U06349-1 no gap 444 4 719249 718805 MINUS 1 1 U06349 1 0 0 0 0 0 0 0 0 0 0 0 0 0 Show Con ... hus ... 44 4.1 1 ( EG612332 ) REPROTRACTF095448J11 POSSUM _01-POSSUM -C-REPROTRAC... 44 4.1 1 ( EC281616 ) BRA ... INF089465F8 POSSUM _01-POSSUM -C-BRAIN-2KB Trich... 44 4.1 1 ( DY774601 ...

  12. Barking up the Right Tree

    Science.gov (United States)

    Houston, Paul D.

    2006-01-01

    There is a childhood saying about a confused dog who thinks he sees a possum in a tree. The problem is that the possum is actually in a different tree so the dog barks up the wrong tree. American education is constantly playing both dog and possum. Sometimes they are the prey, and sometimes they are just confused about what and where the prey is.…

  13. Risk in Major Surgery

    OpenAIRE

    Moonesinghe, S. R.

    2014-01-01

    A qualitative systematic review was conducted to assess the performance of tools which have been validated for the prediction of morbidity and/or mortality, in heterogeneous cohorts of surgical (non-cardiac, non-neurological) patients. The Portsmouth- Physiological and Operative Severity Score for the enUmeration of Mortality and morbidity (P-POSSUM) and the Surgical Risk Scale (SRS) were found to be the most widely validated and accurate risk stratification tools. The POSSUM, P-POSSUM and SR...

  14. Dicty_cDB: Contig-U13174-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U13174-1 no gap 503 2 7306678 7307165 PLUS 1 1 U13174 0 0 0 0 0 0 0 0 1 0 0 0 0 0 Show Co ... anis lup... 44 4.7 1 ( EG629460 ) EMBRYOF088225D16 POSSUM _01-POSSUM -C-EMBRYO-2KB Tr... 44 4.7 1 ( EC311545 ) ... OVARYF092730P18 POSSUM _01-POSSUM -C-OVARY-2KB Tric... 44 4.7 1 ( CJ468522 ...

  15. Dicty_cDB: Contig-U15996-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U15996-1 gap included 635 5 1522642 1523218 PLUS 1 2 U15996 0 0 0 0 0 0 0 0 0 0 0 0 1 0 S ... -329G13.... 46 1.6 1 ( EG604748 ) EMBRYOF099519D21 POSSUM _01-POSSUM -C-EMBRYO-2KB Tr... 46 1.6 1 ( DR944471 ) ... A clone 73... 44 6.3 1 ( DY602846 ) LIVERF031277D9 POSSUM _01-POSSUM -LIVER-2KB Trichos... 44 6.3 1 ( CO340232 ...

  16. Dicty_cDB: Contig-U14782-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U14782-1 no gap 557 - - - - 1 2 U14782 0 1 0 0 0 0 0 0 0 0 0 0 0 0 Show Contig-U14782-1 C ... ary Ear... 52 0.022 1 ( EG629704 ) EMBRYOF088225P4 POSSUM _01-POSSUM -C-EMBRYO-2KB Tri... 48 0.030 2 ( FD77681 ... UENCIN... 48 0.049 2 ( EC319804 ) EMBRYOF088886F13 POSSUM _01-POSSUM -C-EMBRYO-2KB Tr... 48 0.050 2 ( AL607025 ...

  17. Dicty_cDB: Contig-U13280-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U13280-1 no gap 618 4 1103604 1104212 PLUS 1 1 U13280 0 0 0 0 0 0 0 1 0 0 0 0 0 0 Show Co ... 2, comple... 36 1.0 6 ( EC291472 ) BRAINF089693H14 POSSUM _01-POSSUM -C-BRAIN-2KB Tric... 34 1.0 3 ( BX470210 ... 6900016. 32 3.8 5 ( EG614715 ) REPROTRACTF088211J5 POSSUM _01-POSSUM -C-REPROTRACT... 34 3.9 2 ( AL445069 ) Hu ...

  18. Validación y estudio prospectivo comparativo de la aplicabilidad de seis índices pronóstico internacionales de morbilidad y mortalidad en pacientes intervenidos de forma programada en un servicio de cirugía general y digestiva

    OpenAIRE

    Campillo Soto, Álvaro

    2010-01-01

    Las tasas brutas de morbi-mortalidad no son indicadores fiables del resultado del producto sanitario, siendo necesario el uso de escalas de riesgo adjustadas por paciente y gravedad. En nuestro estudio se validaron 5 escalas de riesgo para predecir morbilidad y mortalidad en nuestros pacientes sometidos a cirugía programada (POSSUM, P-POSSUM, SAPS II, APACHE II, MODS y MPM). Tras la validación se aplicaron prospectivamente, demostrándose la utilidad de POSSUM y P-POSSUM para predecir morbilid...

  19. Duration of one-lung ventilation stage, POSSUM value and the quality of post-operative analgesia significantly affect survival and length of stay on intensive care unit of patients undergoing two-stage esophagectomy

    OpenAIRE

    Yasin Said AlMakadma; Tamer Hunein Riad; Ayad, Ismaei I.; Tamer Hussein Ibrahim

    2013-01-01

    Purpose: To analyze different factors affecting the outcome of patients undergoing Two Stage Esophagectomy (TSE) for the treatment of esophageal carcinoma (EC) while relating these factors to the length of stay on Intensive Care Unit (ILOS), mortality, and morbidity. Methods: Retrospective study of case-notes of 45 patients who underwent a TSE for resection of EC at a general district hospital in the United Kingdom (UK). These procedures were performed by the same surgical team and followed s...

  20. Dicty_cDB: AFL661 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AF (Link to library) AFL661 (Link to dictyBase) - G22646 DDB0231091 - AFL661P (Link to Original ... 8, 3' ... 276 2e-69 1 ( DY609791 ) IMMUNEF045809L7 POSSUM _01-C-POSSUM -IMMUNE-2KB Tri... 52 0.056 1 ( CZ12667 ...

  1. Dicty_cDB: VSH834 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VS (Link to library) VSH834 (Link to dictyBase) - - - - VSH834P (Link to Original site) VSH834F ... AFT SEQU... 46 0.28 1 ( EC354008 ) LIVERF089487P19 POSSUM _01-POSSUM -LIVER-2KB Tricho... 46 0.28 1 ( AC188118 ...

  2. Dicty_cDB: VSH234 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VS (Link to library) VSH234 (Link to dictyBase) - G21453 DDB0220111 Contig-U06849-1 VSH234P (Lin ... eve... 48 0.37 1 ( EC313530 ) REPROTRACTF081141F16 POSSUM _01-POSSUM -C-REPROTRAC... 48 0.37 1 dna update 2009 ...

  3. Dicty_cDB: SFK304 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SF (Link to library) SFK304 (Link to dictyBase) - - - Contig-U03225-1 SFK304F (Link to Original ... 118c07.q1k. 44 0.002 3 ( EC301176 ) OVARYF091722F5 POSSUM _01-POSSUM -C-OVARY-2KB Trich... 42 0.008 3 dna upda ...

  4. Prognostic scoring systems-validation and their utility in patients with abdominal sepsis in colon peritonitis

    OpenAIRE

    Teleanu, G; Iordache, F; Beuran, M

    2014-01-01

    Aim: The purpose of this article is to analyze and validate the CR-POSSUM score in patients with peritonitis of colonic origin, considering mortality forecasting ability. Methods: We conducted a prospective longitudinal study of the Surgery Clinic in the Emergency Hospital in Bucharest in January 2008-December 2011. Patients operated on for peritonitis of colonic origin were included in this study. The prognostic CR-POSSUM scores and Mannheim peritonitis index were calculated by using data fr...

  5. Risk assessment and decision-making for patients undergoing orthopedic surgery

    OpenAIRE

    Bao, De-ming; Li, Ning; Xia, Lei

    2015-01-01

    Purpose Physical and operative severity score for the enumeration of mortality and morbidity (POSSUM) scoring system was designed to predict the postoperative morbidity and mortality mainly in general surgery. The purpose of this study was to assess the value of POSSUM scoring system in predicting outcomes of patients undergoing orthopedic surgery, and to do some modifications to make the system more accurate in predicting postoperative complication rates. Methods This is a retrospective clin...

  6. Comparison of different risk-adjustment models in assessing short-term surgical outcome after transthoracic esophagectomy in patients with esophageal cancer

    OpenAIRE

    Bosch, D. J.; Pultrum, B.B.; de Bock, G H; Oosterhuis, J. K.; Rodgers, M. G. G.; Plukker, J.T.M.

    2011-01-01

    BACKGROUND: Different risk-prediction models have been developed, but none is generally accepted in selecting patients for esophagectomy. This study evaluated 5 most frequently used risk-prediction models, including the American Society of Anesthesiologists, Portsmouth-modified Physiological and Operative Severity Score for the enUmeration of Mortality and morbidity (P-POSSUM), and the adjusted version for Oesophagogastric surgery (O-POSSUM), Charlson and the Age adjusted Charlson score to as...

  7. Morbid obesity: postsurgical predictive factors and prioritization of the waiting list Obesidad mórbida: factores predictivos postquirúrgicos y priorización de la lista de espera

    OpenAIRE

    F. Sabench Pereferrer; M. Hernández González; M. Abelló Salas; J. Domènech Calvet; S. Blanco Blasco; D. del Castillo Déjardin

    2005-01-01

    Aim: to study a sample of patients with morbid obesity who are on the waiting list for a surgical intervention, to establish various scores of surgical risk (Possum and severity score), and to assess potential criteria for list prioritization. Design: we calculated physiological and surgical Possum scores for every patient, and analysed comorbidities and other associated factors to calculate the severity score. Likewise, we calculated the predictive rates of morbimortality. Differences betwee...

  8. The role of multiple wildlife hosts in the persistence and spread of bovine tuberculosis in New Zealand

    OpenAIRE

    Barron, MC; Tompkins, DM; Ramsey, DSL; Bosson, MAJ

    2015-01-01

    Abstract AIM: To explore how the inclusion of multi-host dynamics affects the predicted prevalence of bovine tuberculosis (TB) in possums and other host species following the current best practice for control of TB in large difficult and remote areas, to identify which host species are responsible for changes in predicted prevalence, and whether TB can persist in possum-free host communities. METHODS: Multi-host TB models were constructed, comprising three host species with density-dependent ...

  9. Post-operative complications of gastric cancer surgery: female gender at high risk

    OpenAIRE

    Sah, BK; ZHU, ZG; Wang, XY; YANG, QM; CHEN, MM; Xiang, M.; Chen, J.; Yan, M

    2009-01-01

    We applied physiological and operative severity score for the enumeration of morbidity and mortality (POSSUM) to evaluate overall surgical outcome and investigated the role of gender for early post-operative complications in gastric cancer surgery. The data from a total of 357 patients of gastric cancer were analysed by univariate and multivariate analysis. Post-operative complications were recorded according to definition of POSSUM. Post-operative complications of male and female patients we...

  10. Economics of an ecotourism operation in Belize

    Science.gov (United States)

    Kangas, Patrick; Shave, Mary; Shave, Paul

    1995-09-01

    The economic inputs and outputs for the Possum Point Biological Station in Belize during 1990 1992 are described to illustrate some aspects of an ecotourism operation. Eight hundred fifty-four people in 59 groups visited Possum Point during the study period to tour rain forests, estuaries, and coral reefs. The economic input to Possum Point from these groups increased from 74,552 in 1990 to 166,268 in 1992. Outputs were for license fees, capital improvements, goods and services, labor, fossil fuels, and development of a historic sugar mill site. An annual donation was also made to a scholarship fund for local Belizean students. The net cash balance of income and outputs changed from negative (-6678) in 1990 to positive (+4811) in 1992, suggesting development of the economic operation. Possum Point meets the economic criteria for ecotourism by feeding back some tourist monies for community and environmental support, particularly donations for the sugar mill site and the scholarship fund. Most of the outputs from Possum Point (about 80%) were retained in the local economy through employment and purchases, which have a positive influence on the local community. We conclude that ecotourism operations, such as Possum Point, offer important sustainable development opportunities for Belize.

  11. A reliable auditing of postop complication in gastric cancer surgery

    Institute of Scientific and Technical Information of China (English)

    Birendra Kumar SAH; WANG Xiao-Yan; ZHU Zheng-Gang; YAN-Min; CHEN Jun; XIANG Ming

    2007-01-01

    Background Auditing of surgical outcome is controversial due to lack of standard auditing system. POSSUM (Physiological and Operative Severity Score for the enUmeration of Morbidity and mortality)system provides a risk adjusted auditing in surgical practice, which is a reliable scoring system. However it has not been generalized in China, especially in gastric surgery. Present study evaluates the application of POSSUM system to compare surgical outcome of malignant gastric disease between specialized unit and general unit. Methods Retrospective study was performed on 394 patients who underwent surgical intervention for gastric cancer and malignant gastric lymphoma. POSSUM data were collected according to standard criteria described by its original authors. Exponential analysis method was used for data analysis. Observed to Expected morbidity (O:E) ratio was calculated for each unit to give risk adjusted comparison. All the complications were categorized into minor to severe to give an objective view of complications. Results There was significant difference in surgical outcome between specialized unit and general unit. POSSUM predicted morbidity well and O: E ratio of specialized unit was better than general unit. Further more postop stay wassignificantly shorter(P <0.001 ) in specialized unit and number of moderate and severe morbidity was significantly lower (P<0.001) than general unit. Conclusions Surgical outcome of specialized unit was better than general unit. POSSUM can be used for risk adjusted auditing of postop complications in malignant gastric disease, which provides a reliable audit. However morbidity definition in POSSUM should be amended and modification in POSSUM formula may be necessary to fit major surgical interventions like gastric cancer surgery.

  12. Development of thermodynamically-based models for simulation of hydrogeochemical processes coupled to channel flow processes in abandoned underground mines

    Energy Technology Data Exchange (ETDEWEB)

    Kruse, N.A., E-mail: natalie.kruse@ncl.ac.uk [Sir Joseph Swan Institute for Energy Research, Newcastle University, Newcastle upon Tyne NE1 7RU (United Kingdom); Younger, P.L. [Sir Joseph Swan Institute for Energy Research, Newcastle University, Newcastle upon Tyne NE1 7RU (United Kingdom)

    2009-07-15

    Accurate modeling of changing geochemistry in mine water can be an important tool in post-mining site management. The Pollutant Sources and Sinks in Underground Mines (POSSUM) model and Pollutant Loadings Above Average Pyrite Influenced Geochemistry POSSUM (PLAYING POSSUM) model were developed using object-oriented programming techniques to simulate changing geochemistry in abandoned underground mines over time. The conceptual model was created to avoid significant simplifying assumptions that decrease the accuracy and defensibility of model solutions. POSSUM and PLAYING POSSUM solve for changes in flow rate and depth of flow using a finite difference hydrodynamics model then, subsequently, solve for geochemical changes at distinct points along the flow path. Geochemical changes are modeled based on a suite of 28 kinetically controlled mineral weathering reactions. Additional geochemical transformations due to reversible sorption, dissolution and precipitation of acid generating salts and mineral precipitation are also simulated using simplified expressions. Contaminant transport is simulated using a novel application of the Random-Walk method. By simulating hydrogeochemical changes with a physically and thermodynamically controlled model, the 'state of the art' in post-mining management can be advanced.

  13. Development of thermodynamically-based models for simulation of hydrogeochemical processes coupled to channel flow processes in abandoned underground mines

    International Nuclear Information System (INIS)

    Accurate modeling of changing geochemistry in mine water can be an important tool in post-mining site management. The Pollutant Sources and Sinks in Underground Mines (POSSUM) model and Pollutant Loadings Above Average Pyrite Influenced Geochemistry POSSUM (PLAYING POSSUM) model were developed using object-oriented programming techniques to simulate changing geochemistry in abandoned underground mines over time. The conceptual model was created to avoid significant simplifying assumptions that decrease the accuracy and defensibility of model solutions. POSSUM and PLAYING POSSUM solve for changes in flow rate and depth of flow using a finite difference hydrodynamics model then, subsequently, solve for geochemical changes at distinct points along the flow path. Geochemical changes are modeled based on a suite of 28 kinetically controlled mineral weathering reactions. Additional geochemical transformations due to reversible sorption, dissolution and precipitation of acid generating salts and mineral precipitation are also simulated using simplified expressions. Contaminant transport is simulated using a novel application of the Random-Walk method. By simulating hydrogeochemical changes with a physically and thermodynamically controlled model, the 'state of the art' in post-mining management can be advanced.

  14. Morbid obesity: postsurgical predictive factors and prioritization of the waiting list Obesidad mórbida: factores predictivos postquirúrgicos y priorización de la lista de espera

    Directory of Open Access Journals (Sweden)

    F. Sabench Pereferrer

    2005-03-01

    Full Text Available Aim: to study a sample of patients with morbid obesity who are on the waiting list for a surgical intervention, to establish various scores of surgical risk (Possum and severity score, and to assess potential criteria for list prioritization. Design: we calculated physiological and surgical Possum scores for every patient, and analysed comorbidities and other associated factors to calculate the severity score. Likewise, we calculated the predictive rates of morbimortality. Differences between associated comorbidities in body mass index (BMI were also analyzed. The correlation between Possum score, prediction rates, and severity score were analyzed. Patients: fifty-two patients on the surgical waiting list in our institution (San Juan University Hospital, Reus from 26/4/02 to 5/03/04. Results: the mean qualitative score is significantly higher in the female sex. Invalidating arthropathy and socio-occupational and/or psychiatric criteria are significantly higher in women. There is a significant correlation between the severity score and Possum score. Age does not correlate with any of the variables studied. Conclusions: possum scores are significantly related to BMI, particularly in terms of morbidity rates. The degree of correlation between the Possum score and the qualitative score tells how useful the latter is to cover other determinant factors in the severity of this condition. Socio-occupational and psychiatric criteria, and invalidating arthropathy are the main variables to be taken into account for postsurgical prediction, and are directly related to BMI degree.Objetivo: estudio de una muestra de pacientes afectos de obesidad mórbida y en lista de espera para intervención quirúrgica, determinar el riesgo quirúrgico según diferentes scores (Possum y score de gravedad y valorar los posibles criterios en la priorización de dicha lista. Diseño: cálculo del Possum fisiológico y quirúrgico para cada paciente y análisis de las

  15. Cirurgia colorectal urgente: modelos de morbimortalidade cirúrgica no adulto oncológico idoso e muito idoso

    OpenAIRE

    Gomes, A.; Batista, H.; Sousa, M; R. Rocha; R Marinho; C. Carneiro; Pignatelli, N; Nunes, V

    2013-01-01

    INTRODUÇÃO: A população idosa que recorre ao Serviço de Urgência tem vindo a aumentar. É uma população com características fisiopatológicas específicas que coloca dilemas sobre o risco/benefício da cirurgia urgente. OBJECTIVOS: Comparar os scores P-POSSUM, CR-POSSUM e ACPGBI enquanto modelos de morbimortalidade cirúrgica nos idosos e muito idosos submetidos a cirurgia coloretal urgente por doença maligna. MATERIAL E MÉTODOS: Estudo longitudinal retrospectivo. Foram incluídos doentes c...

  16. Product Operations Status Summary Metrics

    Science.gov (United States)

    Takagi, Atsuya; Toole, Nicholas

    2010-01-01

    The Product Operations Status Summary Metrics (POSSUM) computer program provides a readable view into the state of the Phoenix Operations Product Generation Subsystem (OPGS) data pipeline. POSSUM provides a user interface that can search the data store, collect product metadata, and display the results in an easily-readable layout. It was designed with flexibility in mind for support in future missions. Flexibility over various data store hierarchies is provided through the disk-searching facilities of Marsviewer. This is a proven program that has been in operational use since the first day of the Phoenix mission.

  17. Evolutionary anticipation of the human heart.

    OpenAIRE

    Victor, S; Nayak, V. M.

    2000-01-01

    We have studied the comparative anatomy of hearts from fish, frog, turtle, snake, crocodile, birds (duck, chicken, quail), mammals (elephant, dolphin, sheep, goat, ox, baboon, wallaby, mouse, rabbit, possum, echidna) and man. The findings were analysed with respect to the mechanism of evolution of the heart.

  18. Eliot's "Cats" and a CATalog of Language Arts Activities.

    Science.gov (United States)

    Stoeberl, Susan M.

    Inspired by the Broadway musical "Cats" and by T. S. Eliot's collection of poems, "Old Possum's Book of Practical Cats," this language arts teaching unit for seventh grade includes a variety of activities using the poems and musical as focal points. Activity types include the following: (1) reading, listening, and singing activities in which…

  19. Rocks of Ages, a Poem for T.S. Eliot

    OpenAIRE

    Michael D. Sollars

    2012-01-01

    I Old Possum1—I first found you in my early college days,A poetry reading in a most curious place,Resurrection of gone-by verse in Poets’ Corner,Where the Abbey’s storied plots run thick,With...

  20. 76 FR 10253 - Final Flood Elevation Determinations

    Science.gov (United States)

    2011-02-24

    ... Executive Order 12866 of September 30, 1993, Regulatory Planning and Review, 58 FR 51735. Executive Order... FR 19367, 3 CFR, 1979 Comp., p. 376. Sec. 67.11 0 2. The tables published under the authority of Sec... and FEMA-B-1085 Possum Run Approximately 900 feet +931 City of Centerville. downstream of...

  1. 75 FR 4683 - Amendment of Class E Airspace; Graford, TX

    Science.gov (United States)

    2010-01-29

    ... controlled airspace at Possum Kingdom Airport (74 FR 57620) Docket No. FAA-2009-0927. Interested parties were... ``significant rule'' under DOT Regulatory Policies and Procedures (44 FR 11034; February 26, 1979); and (3) does... continues to read as follows: Authority: 49 U.S.C. 106(g), 40103, 40113, 40120; E.O. 10854, 24 FR 9565,...

  2. Relationscapes: How Contemporary Aboriginal Art Moves Beyond the Map

    Directory of Open Access Journals (Sweden)

    Erin Manning

    2011-05-01

    Full Text Available This article discusses landscape art of Australian Aboriginal landscape paintings since the 1970s, particualry that of  Emily Kngwarreye, Dorothy Napangardi, Kathleen Petyarre and Clifford Possum. The author explores how modern materials and techniques are used to convey traditional stories, topographies and cosmologies, using Deleuzian analysis.

  3. Fear-related confirmation bias in children: a comparison between neutral- and dangerous-looking animals.

    Science.gov (United States)

    Dibbets, Pauline; Fliek, Lorraine; Meesters, Cor

    2015-06-01

    The purpose of this study was to examine confirmation bias in children without explicitly inducing fear. Eighty non-clinical children (7-13 years) were shown pictures of a neutral animal (quokka) and two dangerous-looking animals (aye aye and possum). For each animal, levels of perceived fear, threat and request for additional threatening or non-threatening information were obtained. A behavioral approach test (BAT) was included as behavioral measure of fear. The results indicated that the aye aye and possum were rated as more threatening and fearful than the quokka. For the aye aye and possum higher fear levels coincided with search for more threatening than non-threatening information. This pattern was absent in non-fearful children and for the non-threatening quokka. During the BAT the quokka was more often approached first compared to the aye aye and possum. Our findings suggest that confirmation bias in children can be observed without using verbal fear induction. PMID:25096507

  4. 75 FR 916 - Standard Instrument Approach Procedures, and Takeoff Minimums and Obstacle Departure Procedures...

    Science.gov (United States)

    2010-01-07

    ... Policies and Procedures (44 FR 11034; February 26,1979); and (3) does not warrant preparation of a..., 2009 (74 FR 224) The FAA published an Amendment in Docket No. 30697; Amdt No. 3348 to Part 97 of the..., Orig Walterboro, SC, Lowcountry Rgnl, RNAV (GPS) RWY 35, Orig Graford, TX, Possum Kingdom, NDB OR...

  5. Scoringssystemer til vurdering af 30-dagesmortaliteten efter kolorektalcancerkirurgi

    DEFF Research Database (Denmark)

    Degett, Thea Helene; Iversen, Lene Hjerrild; Gögenur, Ismail

    2015-01-01

    Portsmouth Physiolo-gical and Operative Severity Score for the enUmeration of Mor-tality (P-POSSUM) model and a revised Association of Colo-proctology of Great Britian and Ireland (ACPGBI) model are the most accurate predictors in colorectal cancer surgery. No scoring systems have been validated in the...

  6. 75 FR 19328 - Proposed Flood Elevation Determinations

    Science.gov (United States)

    2010-04-14

    ..., 1978 Comp., p. 329; E.O. 12127, 44 FR 19367, 3 CFR, 1979 Comp., p. 376. Sec. 67.4 2. The tables.... River to approximately 0.6 mile downstream of CSX Railroad. Possum Run (Backwater effects from From...

  7. The Mississippi Junior College Creative Writing Association: A Decade of Progress.

    Science.gov (United States)

    Jones, Emory D., Ed.

    This booklet contains a capsule history of the Mississippi Junior College Creative Writing Association (MJCCWA), its constitution, and the following selected student manuscripts from the past ten years of the MJCCWA's journal, "The Junior College Writer": (1) "Chronology of a Hunt" (William Patrick Story); (2) "House of the 'Possum Hunter" (N. A.…

  8. The Gang's All Here: Grammar Goes Global for Purdue, Unisa and Adelaide University

    Science.gov (United States)

    Duff, Andrea; Spangenberg, Brady; Carter, Susanna; Miller, Julia

    2010-01-01

    The University of South Australia and Purdue University (Indiana) launched the "Grammar Gang Blog" in June 2008, as a collaborative forum for talking about language. The blog reaches a far-flung community of learners from Australia to the United States, Brisbane to Bangalore and Ghana to Germany. The Grammar Gang--where Owls meet Possums--started…

  9. Into the Wild: Dissemination of Antibiotic Resistance Determinants via a Species Recovery Program

    OpenAIRE

    Power, Michelle L.; Emery, Samantha; Gillings, Michael R.

    2013-01-01

    Management strategies associated with captive breeding of endangered species can establish opportunities for transfer of pathogens and genetic elements between human and animal microbiomes. The class 1 integron is a mobile genetic element associated with clinical antibiotic resistance in gram-negative bacteria. We examined the gut microbiota of endangered brush-tail rock wallabies Petrogale penicillata to determine if they carried class 1 integrons. No integrons were detected in 65 animals fr...

  10. Risk adjustment is crucial in comparing outcomes of various surgical modalities in patients with ileal perforation

    Directory of Open Access Journals (Sweden)

    Arya Satyavrat

    2008-11-01

    Full Text Available Abstract Background Using crude mortality and morbidity rates for comparing outcomes can be misleading. The aim of the present study was to compare the outcome of various surgical modalities without and with risk adjustment using Physiologic and Operative Severity Scoring for the enUmeration of Mortality and morbidity (POSSUM score in cases of ileal perforations. Methods Prospective study on 125 patients of ileal perforations. Resection anastamosis (Group I was done in 38 patients, primary repair (Group II in 42 patients and 45 patients had an ileostomy (Group III. The disease severity was assessed in all patients using POSSUM score. The odds of death without and with risk adjustment using POSSUM mortality score were calculated for all groups Results Seventeen patients (14% patients died and 99 (79% developed postoperative complications. Using crude mortality rates Group I appeared to be the best treatment option with only 2 (5% deaths followed by Group II with 5 (12% deaths where as Group III had the worst outcome with 10 deaths (22%. However, Group III (ileostomy patients had higher mean POSSUM mortality and morbidity score (55.55%, 91.33% than Group I (28%, 75.26% and Group II (27%, 73.59%. Taking Group I as the reference (odds ratio, OR1 odds of death were greatest in Group III (OR 5.14, p = 0.043 followed by Group II (OR 2.43, p = 0.306. With risk adjustment using POSSUM mortality score the odds of death decreased in Group III (OR 1.16 p = 0.875. For the whole group, there was a significant association between the POSSUM score and postoperative complications and deaths. Mean POSSUM mortality and morbidity score of those who died (63.40 vs.33.68, p = 0.001 and developed complications (66.32 vs.84.20, p = 0.001 was significantly higher. For every percent increase in severity score the risk of postoperative complications and death increased by 1.10 (p = 0.001 and1.06 (p = 0.001 respectively. Conclusion Despite ileostomy patients having highest

  11. Oxygen concentrations by nuclear reaction analysis on the new STAR accelerator

    International Nuclear Information System (INIS)

    The new HVEE 2MV STAR accelerator was used to measure small concentrations of oxygen in blood samples taken from honey possums, an endangered marsupial from Western Australia. Samples were prepared by injecting the animals with a small (∼3ml/kg) amount of 97% 18O-enriched water (1H218O). After 24h, the animals were recaptured, and a small (∼60 micro-l) amount of blood was extracted, diluted and used for oxidising Ta plates, following an anodic oxidation process. The amount of 18O present in the blood samples was determined using the 18O(p,α)15N nuclear reaction, which has a resonance at 846keV. The results of 18O measurements were used to calculate the metabolic rate of honey possums, and thus gather additional information which will be used in the fight to save this endangered native animal. (author)

  12. Coordinating perioperative care for the 'high risk' general surgical patient using risk prediction scoring.

    Science.gov (United States)

    Hafiz, Shaziz; Lees, Nicholas Peter

    2016-01-01

    Identifying 'high risk' (> 5% mortality score) emergency general surgical patients early, allows appropriate perioperative care to be allocated by securing critical care beds and ensuring the presence of senior surgeons and senior anesthetists intraoperatively. Scoring systems can be used to predict perioperative risk and coordinate resources perioperatively. Currently it is unclear which estimate of risk correlates with current resource deployment. A retrospective study was undertaken assessing the relationship between deployment of perioperative resources: senior surgeon, senior anesthetist and critical care bed. The study concluded that almost all high risk patients with high POSSUM mortality and morbidity scores had a consultant senior surgeon present intraoperatively. Critically unwell patients with higher operative severity and perioperative morbidity scores received higher care (HDU/ICU) beds postoperatively, ensuring that they received appropriate care if their condition deteriorated. Therefore POSSUM scoring should be used perioperatively in emergency cases to coordinate appropriate perioperative care for high risk general surgical patients. PMID:26901929

  13. Dicty_cDB: Contig-U16587-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available :none) Shewanella frigidimarina NCIMB ... 135 4e-30 CP000472_109( CP000472 |pid:none) Shewanella piezotolera...ssa cDNA - 1 hour He... 48 1.3 1 ( EY388804 ) CAXA7502.rev CAXA Helobdella robusta Subtracted ...L... 48 1.3 1 ( EY372846 ) CAXA14231.rev CAXA Helobdella robusta Subtracted ... 48 1.3 1 ( EY357254 ) CAWZ4802.fwd CAWZ Helobdella... 46 5.3 1 ( FE234358 ) CAPG2779.rev CAPG Naegleria gruberi amoeba stage ... 46 5.3 1 ( EY366075 ) CAXA1054.rev CAXA Helobdella...ACTF091692C23 POSSUM_01-POSSUM-C-REPROTRAC... 44 8.5 2 ( EY375669 ) CAXA1575.fwd CAXA Helobdella robusta Subtra

  14. Diversity of Color Vision: Not All Australian Marsupials Are Trichromatic

    OpenAIRE

    Ebeling, Wiebke; Natoli, Riccardo C.; Hemmi, Jan M

    2010-01-01

    Color vision in marsupials has recently emerged as a particularly interesting case among mammals. It appears that there are both dichromats and trichromats among closely related species. In contrast to primates, marsupials seem to have evolved a different type of trichromacy that is not linked to the X-chromosome. Based on microspectrophotometry and retinal whole-mount immunohistochemistry, four trichromatic marsupial species have been described: quokka, quenda, honey possum, and fat-tailed d...

  15. Implications of Marsupial Births for an Understanding of Behavioural Development

    OpenAIRE

    Nelson, John; Gemmell, Robert

    2004-01-01

    A review of birthing in marsupials shows that there are at least three distinct methods. In the opossums (Didelphidae), possums, and kangaroos (Phalangeroidea), the expelled newborns crawl from the urogenital sinus to the pouch. In the bandicoots (Peramelidae), the expelled newborn remain attached to the placenta via the umbilical cord while they swim from the urogenital sinus to the pouch. In the carnivorous Dasyuridae, the newborn are expelled in a column of viscous fluid in which they “swi...

  16. Evaluation von präoperativem Risikopotential und postoperativer Morbidität bei Patienten mit Chronisch Entzündlichen Darmerkrankungen

    OpenAIRE

    Ströh, Antje

    2012-01-01

    Ziel der Studie war die Erfassung der Morbidität und Mortalität nach operativer Therapie von Patienten mit Chronisch Entzündlichen Darmerkrankungen mit speziellem Fokus auf die Anwendbarkeit eines Risiko-Score-Systems, dem POSSUM score (Physiological and Operative Severity Score for the Enumeration of Mortality and Morbidity) zur präoperativen Risikoabschätzung und Prognose der postoperativen Morbidität

  17. Risk adjustment is crucial in comparing outcomes of various surgical modalities in patients with ileal perforation

    OpenAIRE

    Arya Satyavrat; Singh Tanveer; Mohil Ravindra; Bhatnagar Dinesh

    2008-01-01

    Abstract Background Using crude mortality and morbidity rates for comparing outcomes can be misleading. The aim of the present study was to compare the outcome of various surgical modalities without and with risk adjustment using Physiologic and Operative Severity Scoring for the enUmeration of Mortality and morbidity (POSSUM) score in cases of ileal perforations. Methods Prospective study on 125 patients of ileal perforations. Resection anastamosis (Group I) was done in 38 patients, primary ...

  18. Enhanced Recovery After Surgery (ERAS) Versus Conventional Postoperative Care in Colorectal Surgery

    OpenAIRE

    2009-01-01

    Background Enhanced Recovery After Surgery (ERAS) programs are associated with reduced hospital morbidity and mortality. The aim of the present study was to evaluate whether the introduction of ERAS care improved the adverse events in colorectal surgery. In a cohort study, mortality, morbidity, and length of stay were compared between ERAS patients and carefully matched historical controls. Methods Patients were matched for their type of disease, the type of surgery, P-Possum (Portsmouth-Poss...

  19. Outchasing climate change

    Science.gov (United States)

    Showstack, Randy

    Pygmy possums, monarch butterflies, spoon-billed sandpipers, and a number of trees and other plants could be among the species unable to migrate fast enough to new habitat in the face of potential global climate changes, according to an August 30 report by the Switzerland-based World Wide Fund for Nature (WWF) and the U.S. based Clean-Air-Cool Planet (CACP), two conservation organizations.

  20. Risk-adjustment in hepatobiliarypancreatic surgery

    Institute of Scientific and Technical Information of China (English)

    Hemant M Kocher; Paris P Tekkis; Palepu Gopal; Ameet G Patel; Simon Cottam; Irving S Benjamin

    2005-01-01

    AIM: The present study evaluates the performance of the POSSUM, the American Society of Anesthetists (ASA),APACHE and Childs classification in predicting mortality and morbidity in hepatopancreaticobiliary (HPB) surgery.We describe especially the limitations and advantages of risk in stratifying the patients.METHODS: We investigated 177 randomly chosen patients undergoing eledive complex HPB surgery in a single institution with a total of 71 pre-operative and intra-operative risk factors.Primary endpoint was in-hospital mortality and morbidity.Ordered logistic regression analysis was used to identify individual predictors of operative morbidity and mortality.RESULTS: The operative mortality in the series was 3.95% .This compared well with the p-POSSUM and APACHE predicted mortality of 4.31% and 4.29% respectively. Postoperative complications amounted to 45% with 24 (13.6%)patients having a major adverse event. On multivariate analysis the pre-operative POSSUM physiological score (OR = 1.18,P = 0.009) was superior in predicting complications compared to the ASA (P = 0.108), APACHE (P = 0.117)or Childs classification (P = 0.136). In addition, serum sodium, creatinine, international normalized ratio (INR),pulse rate, and intra-operative blood loss were independent risk factors. A combination of the POSSUM variables and INR offered the optimal combination of risk factors for risk prognostication in HPB surgery.CONCLUSION: Morbidity for elective HPB surgery can be accurately predicted and applied in everyday surgical practice as an adjunct in the process of informed consent and for effective allocation of resources for intensive and high-dependency care facilities.

  1. Delayed stoma formation in Fournier's gangrene.

    Science.gov (United States)

    Bronder, C S; Cowey, A; Hill, J

    2004-11-01

    Fournier's gangrene is traditionally treated with prompt surgical debridement and in many cases a diverting colostomy is also fashioned during the same procedure. We present four cases where stoma formation was delayed until the second look procedure. The physiological states at the time of either procedure were compared using POSSUM. The results showed an improvement in the physiological condition in all patients at the time of the second operation, suggesting that a delay can potentially improve prognosis in such cases. PMID:15521946

  2. Correcting ionospheric Faraday rotation for ASKAP

    Science.gov (United States)

    O'Sullivan, Shane; Gaensler, Bryan; Landecker, Tom L.; Willis, Tony

    2012-10-01

    Next-generation polarisation surveys, such as the POSSUM survey on ASKAP, aim to measure weak, statistical, cosmological effects associated with weak magnetic fields, and so will require unprecedented accuracy and stability for measuring polarisation vectors and their Faraday rotation measures (RMs). Ionospheric Faraday rotation (IFR) corrupts polarization observations and cannot be ignored at mid to low frequencies. In aperture-synthesis polarimetry IFR rotates individual visibilities and leads to a loss of coherence and accuracy of polarization angle determination. Through the POSSUM survey science team we have been involved in developing detailed ionospheric prediction software (POSSUM memos #10a,b) that will be used to correct the observed visibilities on ASKAP before imaging to obtain sufficiently accurate polarization and RM data. To provide a stringent test of this software, we propose a continuous 24 hr observing block using the 1.1-3.1 GHz band to monitor the variations caused by the time-variable ionosphere in the polarization angle and RM of a strongly polarized calibrator source, PKS B1903-802. We request a total of 96 hrs (4 x 24 hrs) to monitor the changes in the ionosphere every 3 to 6 months until BETA/ASKAP-12 is taking reliable polarization data.

  3. Modified physiological and operative severity score for risk assessment in patient of perforation peritonitis

    Directory of Open Access Journals (Sweden)

    Gopal Tak

    2014-05-01

    Full Text Available Aim: To establish a scoring system for predicting the incidence of postoperative complications and mortality in patients with perforation peritonitis based on the modified physiological and operative severity score for the enumeration of mortality and morbidity (M-POSSUM, and to evaluate its efficacy. Methods: Patients under study, were grouped as those with postoperative complications (n = 35 and those without postoperative complications (n = 35. The period of study was 12 months and the data was analysed retrospectively and prospectively for logistical regression. Patients with age less than 12 years were excluded. Modified POSSUM (M-POSSUM was used and its efficacy evaluated. Fifteen indices were assessed as part of the scoring system such as age, cardiovascular function, respiratory function, blood test results, endocrine function, central nervous system function, hepatic function, renal function, nutritional status, extent of operative trauma, and course of anaesthesia. Results: Logistic regression analysis yielded statistically significant equations for both morbidity and mortality for comparison of both groups. The predictive accuracy of morbidity equation and mortality equation was 83.6% and 94.1%, respectively. Significant risk factors were found to be age, cardiovascular function, respiratory function, hepatic function, renal function, blood test results, endocrine function, nutritional status, duration of operation, intra-operative blood loss, and course of anaesthesia. These factors were all included in the scoring system. There was significant difference in the scores between the patients with and without postoperative complications, between the patients who died and those who survived with complications, and between the patients who died and those who survived without complications. Conclusion: Our study validates the main perioperative complications of surgery for perforation peritonitis and influencing and non-influencing risk

  4. Short and medium-term outcomes for general surgery in nonagenarian patients in a district general hospital.

    Science.gov (United States)

    Hayes, A J; Davda, A; El-Hadi, M; Murphy, P; Papettas, T

    2016-07-01

    Introduction Surgeons are increasingly performing surgery on older patients. There are currently no tools specifically for risk prediction in this group. The aim of this study was to review general surgical operations carried out on patients aged over 90 years and their outcome, before comparing these with predictors of morbidity and mortality. Methods A retrospective review was carried out at our district general hospital of all general surgery patients aged over 90 years who underwent a general surgical operation over a period of 14 years. Information collected included demographics, details of procedures, P-POSSUM (Portsmouth Physiological and Operative Severity Score for the enUmeration of Mortality and morbidity), complications and outcomes. Results A total of 119 procedures were carried out, 72 involving entry into the peritoneal cavity. Overall, 14 patients (12%) died within 30 days and 34 (29%) died within one year. Postoperative complications included infection (56%), renal failure (24%), need for transfusion (17%) and readmission within 30 days (11%). Logistical regression analysis showed that the P-POSSUM correlated well with observed mortality and infection was a significant predictor of in-hospital mortality (p=0.003). Conclusions The P-POSSUM correlates significantly with outcome and should be used when planning major elective or emergency surgery in patients over 90 years of age. Infective complications appear to be a significant predictor of postoperative mortality. This study supports operative intervention as an option in this extreme age group but we emphasise the importance of appropriate patient selection and judicious clinical care. PMID:27138856

  5. Factors predicting mortality in emergency abdominal surgery in the elderly

    Directory of Open Access Journals (Sweden)

    Fukuda Naoto

    2012-05-01

    Full Text Available Abstract Objective This study aimed to investigate clinical features of abdominal emergency surgery in elderly patients, and to determine factors predicting mortality in these patients. Methods The study population included 94 patients aged 80 years or older who underwent emergency surgery for acute abdominal diseases between 2000 and 2010. Thirty-six patients (38.3% were male and fifty-eight patients (61.7% were female (mean age, 85.6 years. Main outcome measures included background of the patient’s physical condition (concomitant medical disease, and performance status, cause of disease, morbidity and mortality, and disease scoring system (APACHE II, and POSSUM. Prognostic factors affecting mortality of the patient were also evaluated by univariate analysis using Fisher’s exact test and Mann–Whitney U–test, and by multivariate analysis using multiple logistic regression analysis. Results Of the 94 patients, 71 (75.5% had a co-existing medical disease; most patients had hypertension (46.8%. The most frequent surgical indications were acute cholecystitis in 23 patients (24.5%, followed by intestinal obstruction in 18 patients (19.1%. Forty-one patients (43.6% had complications during hospital stay; the most frequent were surgical site infection (SSI in 21 patients (22.3% and pneumonia in 12 patients (12.8%. Fifteen patients died (overall mortality, 16% within 1 month after operation. The most common causes of death were sepsis related to pan-peritonitis in 5 patients (5.3%, and pneumonia in 4 patients (4.3%. Multiple logistic regression analysis showed that time from onset of symptoms to hospital admission and the POSSUM scoring system could be prognostic factors for mortality. Conclusions Mortality in elderly patients who underwent emergency surgery for acute abdominal disease can be predicted using the disease scoring system (POSSUM and on the basis of delay in hospital admission.

  6. Hypermorphic mutation of the voltage-gated sodium channel encoding gene Scn10a causes a dramatic stimulus-dependent neurobehavioral phenotype

    OpenAIRE

    Blasius, Amanda L.; Dubin, Adrienne E.; Petrus, Matt J.; Lim, Byung-Kwan; Narezkina, Anna; Criado, José R.; Wills, Derek N.; Xia, Yu; Moresco, Eva Marie Y.; Ehlers, Cindy; Knowlton, Kirk U.; Patapoutian, Ardem; Beutler, Bruce

    2011-01-01

    The voltage-gated sodium channel Nav1.8 is known to function in the transmission of pain signals induced by cold, heat, and mechanical stimuli. Sequence variants of human Nav1.8 have been linked to altered cardiac conduction. We identified an allele of Scn10a encoding the α-subunit of Nav1.8 among mice homozygous for N-ethyl-N-nitrosourea-induced mutations. The allele creates a dominant neurobehavioral phenotype termed Possum, characterized by transient whole-body tonic immobility induced by ...

  7. A prospective evaluation of Preoperative Risk Evaluation System for Geriatric Orthopedic Patients%老年骨科患者围手术期风险评分的评价研究

    Institute of Scientific and Technical Information of China (English)

    安帅; 沈惠良; 曹光磊; 王玮

    2011-01-01

    目的 通过比较分析老年骨科患者围手术期风险评分( PRESGOP)与急性生理及慢性健康状况评分(APACHE)、计数死亡率和发病率的生理学和手术严重性评分(POSSUM)的有效性、相关性及预测的准确性,探讨PRESGOP评分在预测老年骨科患者术后并发症和死亡率方面的效能。方法 2009年1月至2010年2月,收集所有入骨科的65岁以上患者资料,按照PRESGOP、APACHE、POSSUM评分表分别计算评分结果。剔除未进行手术治疗的患者,再记录术后预后情况,共纳入401例患者。按照有无并发症、有无死亡分别分成2组,依次对PRESGOP、APACHE、POSSUM评分结果进行分析,另比较3种评分结果间的相关性以及预测术后并发症和死亡率ROC曲线的曲线下面积的差异。结果 有并发症组和无并发症组比较,3种评分结果差异均有统计学意义(P<0.05)。死亡组和存活组比较,仅PRESGOP评分差异有统计学意义(P<0.05)。3种评分间两两相关(P<0.05)。PRESGOP、APACHE、POSSUM 3种评分总分与不良预后所得ROC曲线下面积分别为0.771、0.634、0.751,3种评分差异均有统计学意义(P<0.05)。预测死亡率ROC曲线下面积分别为0.920、0.877、0.836,仅PRESGOP评分差异有统计学意义(P<0.05)。结论 PRESGOP、APACHE、POSSUM 3种评分在老年骨科患者评价方面具有良好相关性,在预测骨科老年手术后并发症和死亡率方面同样有效,PRESGOP的效能相对更加准确。%ObjectiveTo evaluate the correlation and efficacy of Preoperative Risk Evaluation System for Geriatric Orthopedic Patients (PRESGOP), Acute Physiology and Chronic Health Evaluation (APACHE) and Physiological and Operative Score for the Enumeration of Mortality and Morbidity (POSSUM)in predicting the postoperative complications and mortality in old orthopedic patients.Methods From January, 2009 to February, 2010, 401 geriatric orthopedic patients who

  8. Distinguishing succulent plants from crop and woody plants

    Science.gov (United States)

    Gausman, H. W.; Escobar, D. E.; Everitt, J. H.; Richardson, A. J.; Rodriguez, R. R.

    1978-01-01

    We compared laboratory spectrophotometrically measured leaf reflectances of six succulents (peperomia, possum-grape, prickly pear, spiderwort, Texas tuberose, wolfberry) with those of four nonsucculents (cenizo, honey mesquite, cotton, sugarcane) for plant species discrimination. Succulents (average leaf water content of 92.2 percent) could be distinguished from nonsucculents (average leaf water content of 71.2 percent) within the near-infrared water absorption waveband (1.35 to 2.5 microns). This was substantiated by field spectrophotometric reflectances of plant canopies. Sensor bands encompassing either the 1.6- or 2.2-wavelengths may be useful to distinguish succulent from nonsucculent plant species.

  9. [Scoring systems for assessment of 30-day mortality after colorectal cancer surgery].

    Science.gov (United States)

    Degett, Thea Helene; Iversen, Lene Hjerrild; Gögenur, Ismail

    2015-03-01

    Post-operative mortality from colorectal cancer depends on multiple factors and varies across countries and hospitals. Pre-operative risk prediction can be helpful in surgical decision-making. Several scoring systems have been developed to predict the risk of post-operative mortality. The Portsmouth Physiological and Operative Severity Score for the enUmeration of Mortality (P-POSSUM) model and a revised Association of Colo-proctology of Great Britan and Ireland (ACPGBI) model are the most accurate predictors in colorectal cancer surgery. No scoring systems have been validated in the Danish population. PMID:25786698

  10. Dicty_cDB: Contig-U12787-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available letters) Database: CSM 6905 sequences; 5,674,871 total letters Score E Sequences producing significant alignments: (bits) Value Cont...E Sequences producing significant alignments: (bits) Value N ( BJ337618 ) Dictyos...-POSSUM-C-BRAIN-2KB Tric... 46 1.5 1 ( CK427170 ) rl72e04.y1 Meloidogyne javanica J2 SL1 pGEM Meloi... 46 1....vnqqfitieltipimill q*kqqkivqkl*illlvdihinfitv*villiiaqikwsqfqvliiklanisavllfksv v...ig/Contig-U10504-1Q.Seq.d Length = 1261 Score = 85.7 bits (43), Expect = 5e-17 Identities = 55/59 (93%) Stran

  11. Morphological aspects of the salivary glands of Crab-eating racoon (Procyon cancrivorus - doi: 10.4025/actascibiolsci.v35i1.12675

    Directory of Open Access Journals (Sweden)

    Eugênio Gonçalves de Araújo

    2012-12-01

    Full Text Available Procyon cancrivorus is a wild mammal from the Procyonidae family, being one of the least studied Brazilian carnivores. The aim of this study was to describe the morphological aspects of the salivary glands of Procyon cancrivorus, and to compare with literature data on the morphology of domestic animals and wilds animals, such as coatis and possums. Three adult animals were collected on highways (roadkilled, fixed 10% formaldehyde aqueous solution and submitted to desiccation. The salivary glands of the crab-eating raccoon are formed by the parotid, mandibular, sublingual and zygomatic glands. The parotid gland shows irregularly triangular shape with its respective duct. The mandible gland shows rounded outline surrounded by a fibrous capsule with its respective duct. The sublingual gland is divided into two parts: the caudal part, located in the occiptomandibular region of the digastric muscle and the rostral part between the tunica mucosa of the mouth and the mylohyoid muscle with its respective duct. The zygomatic gland is small and rounded, located in the rostral part of the pterygopalatine fossa with its respective duct. The morphology of the salivary glands of crab-eating raccoon presents great similarity in shape and arrangement with the glands of dog, cat, coatis and possum.  

  12. Yearlong hibernation in a marsupial mammal

    Science.gov (United States)

    Geiser, Fritz

    2007-11-01

    Many mammals hibernate each year for about 6 months in autumn and winter and reproduce during spring and summer when they are generally not in torpor. I tested the hypothesis that the marsupial pygmy-possum ( Cercartetus nanus), an opportunistic nonseasonal hibernator with a capacity for substantial fattening, would continue to hibernate well beyond winter. I also quantified how long they were able to hibernate without access to food before their body fat stores were depleted. Pygmy-possums exhibited a prolonged hibernation season lasting on average for 310 days. The longest hibernation season in one individual lasted for 367 days. For much of this time, despite periodic arousals after torpor bouts of ˜12.5 days, energy expenditure was reduced to only ˜2.5% of that predicted for active individuals. These observations represent the first report on body-fat-fuelled hibernation of up to an entire year and provide new evidence that prolonged hibernation is not restricted to placental mammals living in the cold.

  13. Sodium monofluoroacetate (1080) risk assessment and risk communication

    International Nuclear Information System (INIS)

    Sodium monofluoroacetate (1080) is a vertebrate pesticide widely used for possum control in New Zealand. Fluoroacetate is also a toxic component of poisonous plants found in Australia, South Africa, South America, and India. Because of its importance and effectiveness in pest control and the highly toxic nature of this compound, its acute sub-lethal and target organ toxicity have been extensively studied. In relation to its use as a pesticide its environmental fate, persistence, non-target impacts and general toxicology have been and continue to be extensively studied. Toxic baits must be prepared and used with extreme care, otherwise humans, livestock, and non-target wildlife will be put at risk. The high risk of secondary poisoning of dogs is a cause for concern. 1080 acts by interfering with cellular energy production. Possums die from heart failure, usually within 6-18 h of eating baits. Long-term exposure to sub-lethal doses can have harmful effects and strict safety precautions are enforced to protect contractors and workers in the bait manufacturing industry. Considerable care is taken when using 1080 to ensure that the risks of using it are outweighed by the ecological benefits achieved from its use. When its use is controversial, risk communicators must take care not to trivialise the toxicity of the compound. The benefits of 1080 use in conservation, pest control, and disease control should be weighed up alongside the risks of using 1080 and other techniques for pest control

  14. Meta-analysis of cancer transcriptomes: A new approach to uncover molecular pathological events in different cancer tissues

    Directory of Open Access Journals (Sweden)

    Sundus Iqbal

    2014-03-01

    Full Text Available To explore secrets of metastatic cancers, individual expression of true sets of respective genes must spread across the tissue. In this study, meta-analysis for transcriptional profiles of oncogenes was carried out to hunt critical genes or networks helping in metastasizing cancers. For this, transcriptomic analysis of different cancerous tissues causing leukemia, lung, liver, spleen, colorectal, colon, breast, bladder, and kidney cancers was performed by extracting microarray expression data from online resource; Gene Expression Omnibus. A newly developed bioinformatics technique; Dynamic Impact Approach (DIA was applied for enrichment analysis of transcriptional profiles using Database for Annotation Visualization and Integrated Discovery (DAVID. Furthermore, oPOSSUM (v. 2.0 and Cytoscape (v. 2.8.2 were used for in-depth analysis of transcription factors and regulatory gene networks respectively. DAVID analysis uncovered the most significantly enriched pathways in molecular functions that were 'Ubiquitin thiolesterase activity' up regulated in blood, breast, bladder, colorectal, lung, spleen, prostrate cancer. 'Transforming growth factor beta receptor activity' was inhibited in all cancers except leukemia, colon and liver cancer. oPOSSUM further revealed highly over-represented Transcription Factors (TFs; Broad-complex_3, Broad-complex_4, and Foxd3 except for leukemia and bladder cancer. From these findings, it is possible to target genes and networks, play a crucial role in the development of cancer. In the future, these transcription factors can serve as potential candidates for the therapeutic drug targets which can impede the deadly spread.

  15. Reorganization and expansion of the nidoviral family Arteriviridae.

    Science.gov (United States)

    Kuhn, Jens H; Lauck, Michael; Bailey, Adam L; Shchetinin, Alexey M; Vishnevskaya, Tatyana V; Bào, Yīmíng; Ng, Terry Fei Fan; LeBreton, Matthew; Schneider, Bradley S; Gillis, Amethyst; Tamoufe, Ubald; Diffo, Joseph Le Doux; Takuo, Jean Michel; Kondov, Nikola O; Coffey, Lark L; Wolfe, Nathan D; Delwart, Eric; Clawson, Anna N; Postnikova, Elena; Bollinger, Laura; Lackemeyer, Matthew G; Radoshitzky, Sheli R; Palacios, Gustavo; Wada, Jiro; Shevtsova, Zinaida V; Jahrling, Peter B; Lapin, Boris A; Deriabin, Petr G; Dunowska, Magdalena; Alkhovsky, Sergey V; Rogers, Jeffrey; Friedrich, Thomas C; O'Connor, David H; Goldberg, Tony L

    2016-03-01

    The family Arteriviridae presently includes a single genus Arterivirus. This genus includes four species as the taxonomic homes for equine arteritis virus (EAV), lactate dehydrogenase-elevating virus (LDV), porcine respiratory and reproductive syndrome virus (PRRSV), and simian hemorrhagic fever virus (SHFV), respectively. A revision of this classification is urgently needed to accommodate the recent description of eleven highly divergent simian arteriviruses in diverse African nonhuman primates, one novel arterivirus in an African forest giant pouched rat, and a novel arterivirus in common brushtails in New Zealand. In addition, the current arterivirus nomenclature is not in accordance with the most recent version of the International Code of Virus Classification and Nomenclature. Here we outline an updated, amended, and improved arterivirus taxonomy based on current data. Taxon-specific sequence cut-offs are established relying on a newly established open reading frame 1b phylogeny and pairwise sequence comparison (PASC) of coding-complete arterivirus genomes. As a result, the current genus Arterivirus is replaced by five genera: Equartevirus (for EAV), Rodartevirus (LDV + PRRSV), Simartevirus (SHFV + simian arteriviruses), Nesartevirus (for the arterivirus from forest giant pouched rats), and Dipartevirus (common brushtail arterivirus). The current species Porcine reproductive and respiratory syndrome virus is divided into two species to accommodate the clear divergence of the European and American "types" of PRRSV, both of which now receive virus status. The current species Simian hemorrhagic fever virus is divided into nine species to accommodate the twelve known simian arteriviruses. Non-Latinized binomial species names are introduced to replace all current species names to clearly differentiate them from virus names, which remain largely unchanged. PMID:26608064

  16. Dicty_cDB: Contig-U14051-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available M_01-POSSUM-C-EMBRYO-2KB Tr... 44 6.3 1 ( EC744997 ) PSE00005251 rw_mgpallid Polysphondylium pallidum ... 44...kdqhhyshhylknhkii*fhhrmhnninnnnndqy hqf*qnhnhynnnnnhf*iktkiiiiiyqhnqif*qlcklnlilkknyyfn*lhqsnfhv rthkiqyle...e CH211-171A11 in... 34 3.1 2 ( BX571871 ) Photorhabdus luminescens subsp. laumond...3 1 ( CU101031 ) Equus caballus GSS, BAC clone CH241-205H7, T7 end... 44 6.3 1 ( EL697186 ) CF_WO0_31c11_SP6 Copepod Whole... Homo sapiens meltrin-L precursor (... 33 7.4 AF172604_1( AF172604 |pid:none) Plasmodium vinckei circumspo

  17. A Search for Primary Polarization Calibrators for ASKAP

    Science.gov (United States)

    O'Sullivan, Shane; Gaensler, Bryan; McClure-Griffiths, Naomi; Carretti, Ettore; Harvey-Smith, Lisa; Landecker, Tom L.; Taylor, Russ; Robishaw, Timothy; Clarke, Tracy; Schnitzeler, Dominic; Brown, Shea; Possum Collaboration

    2010-10-01

    We request 120 hrs of observing time in the 6 km array configuration using the 1 to 3 GHz receiver to image 10 x 1.22 square degree fields centred on bright, compact, primary polarization calibrator candidates for ASKAP down to an rms sensitivity of 60 microJy. These observations are required to achieve the goals of the POSSUM Design Study, namely the full-Stokes calibration of the ASKAP array along with testing of algorithms for accurate polarization and RM extraction that will make full use of the wide observing bandwidth and field of view. Due to the current receiver upgrade, which restricts the ATCA to only 5 antennas, we ask that these observations are not conducted until all 6 antennas are available.

  18. Wide field polarimetry and cosmic magnetism

    CERN Document Server

    Beck, Rainer

    2009-01-01

    The SKA and its precursors will open a new era in the observation of cosmic magnetic fields and help to understand their origin. In the SKADS polarization simulation project, maps of polarized intensity and RM of the Milky Way, galaxies and halos of galaxy clusters were constructed, and the possibilities to measure the evolution of magnetic fields in these objects were investigated. The SKA will map interstellar magnetic fields in nearby galaxies and intracluster fields in nearby clusters in unprecedented detail. All-sky surveys of Faraday rotation measures (RM) towards a dense grid of polarized background sources with the SKA and ASKAP (POSSUM) are dedicated to measure magnetic fields in distant intervening galaxies, cluster halos and intergalactic filaments, and will be used to model the overall structure and strength of the magnetic fields in the Milky Way and beyond. Simple patterns of regular fields in galaxies or cluster relics can be recognized to about 100 Mpc distance, ordered fields in unresolved ga...

  19. Wildlife Tunnel Enhances Population Viability

    Directory of Open Access Journals (Sweden)

    Michael McCarthy

    2009-12-01

    Full Text Available Roads and traffic are pervasive components of landscapes throughout the world: they cause wildlife mortality, disrupt animal movements, and increase the risk of extinction. Expensive engineering solutions, such as overpasses and tunnels, are increasingly being adopted to mitigate these effects. Although some species readily use such structures, their success in preventing population extinction remains unknown. Here, we use population viability modeling to assess the effectiveness of tunnels for the endangered Mountain Pygmy-possum (Burramys parvus in Australia. The underpasses reduced, but did not completely remove, the negative effects of a road. The expected minimum population size of a “reconnected” population remained 15% lower than that of a comparable “undivided” population. We propose that the extent to which the risk of extinction decreases should be adopted as a measure of effectiveness of mitigation measures and that the use of population modeling become routine in these evaluations.

  20. Risk assessment tools validated for patients undergoing emergency laparotomy: a systematic review.

    Science.gov (United States)

    Oliver, C M; Walker, E; Giannaris, S; Grocott, M P W; Moonesinghe, S R

    2015-12-01

    Emergency laparotomies are performed commonly throughout the world, but one in six patients die within a month of surgery. Current international initiatives to reduce the considerable associated morbidity and mortality are founded upon delivering individualised perioperative care. However, while the identification of high-risk patients requires the routine assessment of individual risk, no method of doing so has been demonstrated to be practical and reliable across the commonly encountered spectrum of presentations, co-morbidities and operative procedures. A systematic review of Embase and Medline identified 20 validation studies assessing 25 risk assessment tools in patients undergoing emergency laparotomy. The most frequently studied general tools were APACHE II, ASA-PS and P-POSSUM. Comparative, quantitative analysis of tool performance was not feasible due to the heterogeneity of study design, poor reporting and infrequent within-study statistical comparison of tool performance. Reporting of calibration was notably absent in many prognostic tool validation studies. APACHE II demonstrated the most consistent discrimination of individual outcome across a variety of patient groups undergoing emergency laparotomy when used either preoperatively or postoperatively (area under the curve 0.76-0.98). While APACHE systems were designed for use in critical care, the ability of APACHE II to generate individual risk estimates from objective, exclusively preoperative data items may lead to better-informed shared decisions, triage and perioperative management of patients undergoing emergency laparotomy. Future endeavours should include the recalibration of APACHE II and P-POSSUM in contemporary cohorts, modifications to enable prediction of morbidity and assessment of the impact of adoption of these tools on clinical practice and patient outcomes. PMID:26537629

  1. Strict Selection Criteria During Surgical Training Ensures Good Outcomes in Laparoscopic Omental Patch Repair (LOPR) for Perforated Peptic Ulcer (PPU).

    Science.gov (United States)

    Shelat, Vishal G; Ahmed, Saleem; Chia, Clement L K; Cheah, Yee Lee

    2015-02-01

    Application of minimal access surgery in acute care surgery is limited due to various reasons. Laparoscopic omental patch repair (LOPR) for perforated peptic ulcer (PPU) surgery is safe and feasible but not widely implemented. We report our early experience of LOPR with emphasis on strict selection criteria. This is a descriptive study of all patients operated on for PPU at academic university-affiliated institutes from December 2010 to February 2012. All the patients who were operated on for LOPR were included as the study population and their records were studied. Perioperative outcomes, Boey score, Mannheim Peritonitis Index (MPI), and physiologic and operative severity scores for enumeration of mortality and morbidity (POSSUM) scores were calculated. All the data were tabulated in a Microsoft Excel spreadsheet and analyzed using Stata Version 8.x. (StataCorp, College Station, TX, USA). Fourteen patients had LOPR out of a total of 45 patients operated for the PPU. Mean age was 46 years (range 22-87 years). Twelve patients (86%) had a Boey score of 0 and all patients had MPI POSSUM morbidity and mortality were 36% and 7%, respectively. Mean ulcer size was 5 mm (range 2-10 mm), mean operating time was 100 minutes (range 70-123 minutes) and mean length of hospital stay was 4 days (range 3-6 days). There was no morbidity or mortality pertaining to LOPR. LOPR should be offered by acute care surgical teams when local expertise is available. This can optimize patient outcomes when strict selection criteria are applied. PMID:25692444

  2. Dental fluorosis and skeletal fluoride content as biomarkers of excess fluoride exposure in marsupials.

    Science.gov (United States)

    Death, Clare; Coulson, Graeme; Kierdorf, Uwe; Kierdorf, Horst; Morris, William K; Hufschmid, Jasmin

    2015-11-15

    Particulate and gaseous fluoride emissions contaminate vegetation near fluoride-emitting industries, potentially impacting herbivorous wildlife in neighboring areas. Dental fluorosis has been associated with consumption of fluoride-contaminated foliage by juvenile livestock and wildlife in Europe and North America. For the first time, we explored the epidemiology and comparative pathology of dental fluorosis in Australian marsupials residing near an aluminium smelter. Six species (Macropus giganteus, Macropus rufogriseus, Wallabia bicolor, Phascolarctos cinereus, Trichosurus vulpecula, Pseudocheirus peregrinus) demonstrated significantly higher bone fluoride levels in the high (n=161 individuals), compared to the low (n=67 individuals), fluoride areas (p<0.001). Necropsy examinations of all six species from the high-fluoride area near the smelter revealed dental lesions considered characteristic of dental fluorosis in eutherian mammals. Within the high-fluoride area, 67% of individuals across the six species showed dental enamel lesions, compared to 3% in the low-fluoride areas. Molars that erupted before weaning were significantly less likely to display pathological lesions than those developing later, and molars in the posterior portion of the dental arcade were more severely fluorotic than anterior molars in all six species. The severity of dental lesions was positively associated with increasing bone fluoride levels in all species, revealing a potential biomarker of excess fluoride exposure. PMID:26188404

  3. Vertebrate diet decreases winter torpor use in a desert marsupial

    Science.gov (United States)

    Pavey, Chris R.; Burwell, Chris J.; Körtner, Gerhard; Geiser, Fritz

    2009-06-01

    One of the energetic benefits of daily torpor over prolonged hibernation is that it enables animals to regularly forage and, therefore, replenish food reserves between bouts of torpor. However, little is known about the diet of predators undergoing torpor or whether differences in prey composition among individuals influence torpor characteristics. Here, we test the hypothesis that prey composition affects winter torpor use and patterns of a population of carnivorous marsupial, the brush-tailed mulgara ( Dasycercus blythi), in the Great Sandy Desert, Australia. Mulgaras in the study population captured a wide range of prey including vertebrates (mammals, reptiles, birds), seven insect orders, spiders and centipedes. The proportion of vertebrates in the diet was negatively correlated with both frequency of torpor use and maximum bout duration. This variation in torpor use with diet can be explained by the higher energetic content of vertebrates as well as their larger size. Even assuming uniform intake of prey biomass among individuals, those that subsisted on an invertebrate-dominated diet during winter apparently suffered energetic shortages as a result of the scarcity of invertebrate taxa with high energy content (such as insect larvae). Our study is the first to demonstrate a link between diet composition and daily torpor use in a free-ranging mammal.

  4. Evaluation of next generation sequencing for the analysis of Eimeria communities in wildlife.

    Science.gov (United States)

    Vermeulen, Elke T; Lott, Matthew J; Eldridge, Mark D B; Power, Michelle L

    2016-05-01

    Next-generation sequencing (NGS) techniques are well-established for studying bacterial communities but not yet for microbial eukaryotes. Parasite communities remain poorly studied, due in part to the lack of reliable and accessible molecular methods to analyse eukaryotic communities. We aimed to develop and evaluate a methodology to analyse communities of the protozoan parasite Eimeria from populations of the Australian marsupial Petrogale penicillata (brush-tailed rock-wallaby) using NGS. An oocyst purification method for small sample sizes and polymerase chain reaction (PCR) protocol for the 18S rRNA locus targeting Eimeria was developed and optimised prior to sequencing on the Illumina MiSeq platform. A data analysis approach was developed by modifying methods from bacterial metagenomics and utilising existing Eimeria sequences in GenBank. Operational taxonomic unit (OTU) assignment at a high similarity threshold (97%) was more accurate at assigning Eimeria contigs into Eimeria OTUs but at a lower threshold (95%) there was greater resolution between OTU consensus sequences. The assessment of two amplification PCR methods prior to Illumina MiSeq, single and nested PCR, determined that single PCR was more sensitive to Eimeria as more Eimeria OTUs were detected in single amplicons. We have developed a simple and cost-effective approach to a data analysis pipeline for community analysis of eukaryotic organisms using Eimeria communities as a model. The pipeline provides a basis for evaluation using other eukaryotic organisms and potential for diverse community analysis studies. PMID:26944624

  5. Transfusão sangüínea no intra-operatório, complicações e prognóstico Transfusión sanguínea en el intraoperatorio, complicaciones y pronóstico Complications and prognosis of intraoperative blood transfusion

    Directory of Open Access Journals (Sweden)

    João Manoel Silva Junior

    2008-10-01

    Full Text Available JUSTIFICATIVA E OBJETIVOS: Transfusões sangüíneas no intra-operatório estão associadas a aumento de complicações no pós-operatório e custos hospitalares. Portanto, este estudo avaliou as características, complicações e possíveis fatores de riscos para morte em pacientes cirúrgicos que necessitaram de transfusões sangüíneas no intra-operatório. MÉTODO: Coorte prospectiva, durante período de um ano, no centro cirúrgico de hospital terciário. Incluíram-se pacientes com idade acima de 18 anos que necessitaram de transfusões sangüíneas no intra-operatório. Testemunhas de Jeová, pacientes que receberam transfusões prévias, falência coronariana e lesão encefálica aguda foram excluídos. RESULTADOS: O estudo envolveu 80 pacientes, com idade média de 68,4 ± 14,1 anos. Os pacientes ASA II foram prevalentes com 69,6% dos casos, os escores APACHE II e POSSUM foram em média, respectivamente, 13,6 ± 4,4 e 37,5 ± 11,4. A hemoglobina média no momento da transfusão era 8,2 ± 1,8 g.dL-1 e 19% dos pacientes apresentavam hemoglobina maior que 10 g.dL-1. Os pacientes receberam em média 2,2 ± 0,9 UI de concentrados de hemácias. A mortalidade hospitalar foi 26,3%. As complicações pós-transfusões totalizaram 57,5% dos casos no pós-operatório e a mais freqüente foi infecção. Foram fatores independentes de morte na regressão logística os escores APACHE II (OR = 1,34; IC 95% 1,102 - 1,622, POSSUM (OR = 1,08; IC 95% 1,008 - 1,150 e número de unidades de concentrados de hemácias recebidas (OR = 2,22; IC 95% 1,100 - 4,463. Quanto maior o número de transfusões sangüíneas, maiores as incidências de complicações e mortalidade. CONCLUSÕES: O valor de hemoglobina e o número de unidades de concentrados de hemácias utilizados foram elevados comparados com os estudos que preconizam estratégias restritivas. Foi encontrada nesta amostra alta incidência de complicações, principalmente infecções, e elevada

  6. Testing an Alternative Method for Estimating the Length of Fungal Hyphae Using Photomicrography and Image Processing

    Science.gov (United States)

    Kirschbaum, Miko U. F.; Hedley, Mike J.; Camps Arbestain, Marta

    2016-01-01

    This study aimed to develop and test an unbiased and rapid methodology to estimate the length of external arbuscular mycorrhizal fungal (AMF) hyphae in soil. The traditional visual gridline intersection (VGI) method, which consists in a direct visual examination of the intersections of hyphae with gridlines on a microscope eyepiece after aqueous extraction, membrane-filtration, and staining (e.g., with trypan blue), was refined. For this, (i) images of the stained hyphae were taken by using a digital photomicrography technique to avoid the use of the microscope and the method was referred to as “digital gridline intersection” (DGI) method; and (ii), the images taken in (i) were processed and the hyphal length was measured by using ImageJ software, referred to as the “photomicrography–ImageJ processing” (PIP) method. The DGI and PIP methods were tested using known grade lengths of possum fur. Then they were applied to measure the hyphal lengths in soils with contrasting phosphorus (P) fertility status. Linear regressions were obtained between the known lengths (Lknown) of possum fur and the values determined by using either the DGI (LDGI) (LDGI = 0.37 + 0.97 × Lknown, r2 = 0.86) or PIP (LPIP) methods (LPIP = 0.33 + 1.01 × Lknown, r2 = 0.98). There were no significant (P > 0.05) differences between the LDGI and LPIP values. While both methods provided accurate estimation (slope of regression being 1.0), the PIP method was more precise, as reflected by a higher value of r2 and lower coefficients of variation. The average hyphal lengths (6.5–19.4 m g–1) obtained by the use of these methods were in the range of those typically reported in the literature (3–30 m g–1). Roots growing in P-deficient soil developed 2.5 times as many hyphae as roots growing in P-rich soil (17.4 vs 7.2 m g–1). These tests confirmed that the use of digital photomicrography in conjunction with either the grid–line intersection principle or image processing is a suitable

  7. Comparison of algorithms for determination of rotation measure and Faraday structure. I. 1100–1400 MHz

    Energy Technology Data Exchange (ETDEWEB)

    Sun, X. H.; Akahori, Takuya; Anderson, C. S.; Farnes, J. S.; O’Sullivan, S. P. [Sydney Institute for Astronomy, School of Physics, The University of Sydney, NSW 2006 (Australia); Rudnick, L.; O’Brien, T. [Minnesota Institute for Astrophysics, School of Physics and Astronomy, University of Minnesota, 116 Church Street SE, Minneapolis, MN 55455 (United States); Bell, M. R. [Max Planck Institute for Astrophysics, Karl-Schwarzschild-Str. 1, D-85748 Garching (Germany); Bray, J. D.; Scaife, A. M. M. [Department of Physics and Astronomy, University of Southampton, Highfield, Southampton SO17 1BJ (United Kingdom); Ideguchi, S.; Kumazaki, K. [University of Nagoya, Furo-cho, Chikusa-ku, Nagoya 464-8601 (Japan); Stepanov, R. [Institute of Continuous Media Mechanics, Korolyov str. 1, 614061 Perm (Russian Federation); Stil, J.; Wolleben, M. [Department of Physics and Astronomy, University of Calgary, 2500 University Drive NW, Calgary AB T2 N 1N4 (Canada); Takahashi, K. [University of Kumamoto, 2–39-1, Kurokami, Kumamoto 860-8555 (Japan); Weeren, R. J. van, E-mail: x.sun@physics.usyd.edu.au, E-mail: larry@umn.edu [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States)

    2015-02-01

    Faraday rotation measures (RMs) and more general Faraday structures are key parameters for studying cosmic magnetism and are also sensitive probes of faint ionized thermal gas. A definition of which derived quantities are required for various scientific studies is needed, as well as addressing the challenges in determining Faraday structures. A wide variety of algorithms has been proposed to reconstruct these structures. In preparation for the Polarization Sky Survey of the Universe's Magnetism (POSSUM) to be conducted with the Australian Square Kilometre Array Pathfinder and the ongoing Galactic Arecibo L-band Feeds Array Continuum Transit Survey (GALFACTS), we run a Faraday structure determination data challenge to benchmark the currently available algorithms, including Faraday synthesis (previously called RM synthesis in the literature), wavelet, compressive sampling, and QU-fitting. The input models include sources with one Faraday thin component, two Faraday thin components, and one Faraday thick component. The frequency set is similar to POSSUM/GALFACTS with a 300 MHz bandwidth from 1.1 to 1.4 GHz. We define three figures of merit motivated by the underlying science: (1) an average RM weighted by polarized intensity, RM{sub wtd}, (2) the separation Δϕ of two Faraday components, and (3) the reduced chi-squared χ{sub r}{sup 2}. Based on the current test data with a signal-to-noise ratio of about 32, we find the following. (1) When only one Faraday thin component is present, most methods perform as expected, with occasional failures where two components are incorrectly found. (2) For two Faraday thin components, QU-fitting routines perform the best, with errors close to the theoretical ones for RM{sub wtd} but with significantly higher errors for Δϕ. All other methods, including standard Faraday synthesis, frequently identify only one component when Δϕ is below or near the width of the Faraday point-spread function. (3) No methods as currently

  8. ПРОГНОСТИЧЕСКАЯ ЦЕННОСТЬ ШКАЛ В ОПРЕДЕЛЕНИИ ЛЕТАЛЬНОСТИ У БОЛЬНЫХ С ОСТРОЙ ТОЛСТОКИШЕЧНОЙ НЕПРОХОДИМОСТЬЮ

    OpenAIRE

    Стаканов, А.; Поцелуев, Е.; Зиборова, Л.; Мусаева, Т.

    2012-01-01

    Цель исследования оценить прогностическую способность основных шкал тяжести состояния (CR-POSSUM, APACHE III и SAPS II) у больных с острой толстокишечной непроходимостью. Материал исследования ретроспективный анализ историй болезней пациентов, подвергающихся оперативному лечению по поводу ОТКН, обусловленной раком толстой кишки. Наиболее точный прогноз летального исхода, по статистике Хосмера Лемешова, отмечен при оценке по шкале CR-POSSUM, обладающей хорошей калибровкой (p>0,05) и разреша...

  9. Comparison of Algorithms for Determination of Rotation Measure and Faraday Structure. I. 1100-1400 MHz

    Science.gov (United States)

    Sun, X. H.; Rudnick, L.; Akahori, Takuya; Anderson, C. S.; Bell, M. R.; Bray, J. D.; Farnes, J. S.; Ideguchi, S.; Kumazaki, K.; O'Brien, T.; O'Sullivan, S. P.; Scaife, A. M. M.; Stepanov, R.; Stil, J.; Takahashi, K.; van Weeren, R. J.; Wolleben, M.

    2015-02-01

    Faraday rotation measures (RMs) and more general Faraday structures are key parameters for studying cosmic magnetism and are also sensitive probes of faint ionized thermal gas. A definition of which derived quantities are required for various scientific studies is needed, as well as addressing the challenges in determining Faraday structures. A wide variety of algorithms has been proposed to reconstruct these structures. In preparation for the Polarization Sky Survey of the Universe's Magnetism (POSSUM) to be conducted with the Australian Square Kilometre Array Pathfinder and the ongoing Galactic Arecibo L-band Feeds Array Continuum Transit Survey (GALFACTS), we run a Faraday structure determination data challenge to benchmark the currently available algorithms, including Faraday synthesis (previously called RM synthesis in the literature), wavelet, compressive sampling, and QU-fitting. The input models include sources with one Faraday thin component, two Faraday thin components, and one Faraday thick component. The frequency set is similar to POSSUM/GALFACTS with a 300 MHz bandwidth from 1.1 to 1.4 GHz. We define three figures of merit motivated by the underlying science: (1) an average RM weighted by polarized intensity, R{{M}wtd}, (2) the separation Δφ of two Faraday components, and (3) the reduced chi-squared χ r2. Based on the current test data with a signal-to-noise ratio of about 32, we find the following. (1) When only one Faraday thin component is present, most methods perform as expected, with occasional failures where two components are incorrectly found. (2) For two Faraday thin components, QU-fitting routines perform the best, with errors close to the theoretical ones for R{{M}wtd} but with significantly higher errors for Δφ . All other methods, including standard Faraday synthesis, frequently identify only one component when Δφ is below or near the width of the Faraday point-spread function. (3) No methods as currently implemented work well for

  10. Comparison of algorithms for determination of rotation measure and Faraday structure. I. 1100–1400 MHz

    International Nuclear Information System (INIS)

    Faraday rotation measures (RMs) and more general Faraday structures are key parameters for studying cosmic magnetism and are also sensitive probes of faint ionized thermal gas. A definition of which derived quantities are required for various scientific studies is needed, as well as addressing the challenges in determining Faraday structures. A wide variety of algorithms has been proposed to reconstruct these structures. In preparation for the Polarization Sky Survey of the Universe's Magnetism (POSSUM) to be conducted with the Australian Square Kilometre Array Pathfinder and the ongoing Galactic Arecibo L-band Feeds Array Continuum Transit Survey (GALFACTS), we run a Faraday structure determination data challenge to benchmark the currently available algorithms, including Faraday synthesis (previously called RM synthesis in the literature), wavelet, compressive sampling, and QU-fitting. The input models include sources with one Faraday thin component, two Faraday thin components, and one Faraday thick component. The frequency set is similar to POSSUM/GALFACTS with a 300 MHz bandwidth from 1.1 to 1.4 GHz. We define three figures of merit motivated by the underlying science: (1) an average RM weighted by polarized intensity, RMwtd, (2) the separation Δϕ of two Faraday components, and (3) the reduced chi-squared χr2. Based on the current test data with a signal-to-noise ratio of about 32, we find the following. (1) When only one Faraday thin component is present, most methods perform as expected, with occasional failures where two components are incorrectly found. (2) For two Faraday thin components, QU-fitting routines perform the best, with errors close to the theoretical ones for RMwtd but with significantly higher errors for Δϕ. All other methods, including standard Faraday synthesis, frequently identify only one component when Δϕ is below or near the width of the Faraday point-spread function. (3) No methods as currently implemented work well for

  11. Urbanization impacts on mammals across urban-forest edges and a predictive model of edge effects.

    Science.gov (United States)

    Villaseñor, Nélida R; Driscoll, Don A; Escobar, Martín A H; Gibbons, Philip; Lindenmayer, David B

    2014-01-01

    With accelerating rates of urbanization worldwide, a better understanding of ecological processes at the wildland-urban interface is critical to conserve biodiversity. We explored the effects of high and low-density housing developments on forest-dwelling mammals. Based on habitat characteristics, we expected a gradual decline in species abundance across forest-urban edges and an increased decline rate in higher contrast edges. We surveyed arboreal mammals in sites of high and low housing density along 600 m transects that spanned urban areas and areas turn on adjacent native forest. We also surveyed forest controls to test whether edge effects extended beyond our edge transects. We fitted models describing richness, total abundance and individual species abundance. Low-density housing developments provided suitable habitat for most arboreal mammals. In contrast, high-density housing developments had lower species richness, total abundance and individual species abundance, but supported the highest abundances of an urban adapter (Trichosurus vulpecula). We did not find the predicted gradual decline in species abundance. Of four species analysed, three exhibited no response to the proximity of urban boundaries, but spilled over into adjacent urban habitat to differing extents. One species (Petaurus australis) had an extended negative response to urban boundaries, suggesting that urban development has impacts beyond 300 m into adjacent forest. Our empirical work demonstrates that high-density housing developments have negative effects on both community and species level responses, except for one urban adapter. We developed a new predictive model of edge effects based on our results and the literature. To predict animal responses across edges, our framework integrates for first time: (1) habitat quality/preference, (2) species response with the proximity to the adjacent habitat, and (3) spillover extent/sensitivity to adjacent habitat boundaries. This framework will

  12. Urbanization impacts on mammals across urban-forest edges and a predictive model of edge effects.

    Directory of Open Access Journals (Sweden)

    Nélida R Villaseñor

    Full Text Available With accelerating rates of urbanization worldwide, a better understanding of ecological processes at the wildland-urban interface is critical to conserve biodiversity. We explored the effects of high and low-density housing developments on forest-dwelling mammals. Based on habitat characteristics, we expected a gradual decline in species abundance across forest-urban edges and an increased decline rate in higher contrast edges. We surveyed arboreal mammals in sites of high and low housing density along 600 m transects that spanned urban areas and areas turn on adjacent native forest. We also surveyed forest controls to test whether edge effects extended beyond our edge transects. We fitted models describing richness, total abundance and individual species abundance. Low-density housing developments provided suitable habitat for most arboreal mammals. In contrast, high-density housing developments had lower species richness, total abundance and individual species abundance, but supported the highest abundances of an urban adapter (Trichosurus vulpecula. We did not find the predicted gradual decline in species abundance. Of four species analysed, three exhibited no response to the proximity of urban boundaries, but spilled over into adjacent urban habitat to differing extents. One species (Petaurus australis had an extended negative response to urban boundaries, suggesting that urban development has impacts beyond 300 m into adjacent forest. Our empirical work demonstrates that high-density housing developments have negative effects on both community and species level responses, except for one urban adapter. We developed a new predictive model of edge effects based on our results and the literature. To predict animal responses across edges, our framework integrates for first time: (1 habitat quality/preference, (2 species response with the proximity to the adjacent habitat, and (3 spillover extent/sensitivity to adjacent habitat boundaries. This

  13. The structure and distribution of nasal glands in four marsupial species.

    Science.gov (United States)

    Kratzing, J E

    1984-10-01

    The structure and distribution of nasal glands in four marsupial species were studied by light and electron microscopy. The species studied were the honey possum (Tarsipes rostratus), the bandicoot (Isoodon macrourus), the koala (Phascolarctos cinereus) and the agile wallaby (Macropus agilis). Glands were grouped and described according to their location. Those of general distribution (goblet cells and olfactory glands) were similar in structures and distribution in all specimens. Glands of the lateral nasal wall include the lateral nasal, maxillary sinus and turbinate glands. The lateral nasal and maxillary sinus glands were absent in the adult koala but occupied large areas in the other species. Turbinate glands were best developed rostrally and ventrally in the nasal cavity. On the nasal septum, Tarsipes and Isoodon had well developed glands associated with vascular 'swell bodies'. These were poorly developed to Macropus though septal glands were abundant. 'Swell bodies' were absent in Phascolarctos and glands were sparse. Tubular vomeronasal glands were present in all species and most extensive in Tarsipes. In Isoodon, there was a posterior ventral septal gland associated with the septal olfactory organ. The fine structural features of secretory cells and ducts are described and their potential role discussed in terms of chemoreception and temperature and humidity control. PMID:6490535

  14. [Mycobacterium bovis in wildlife of the dairy regions of Santa Fe (Argentina)].

    Science.gov (United States)

    Abdala, Alejandro A; Garbaccio, Sergio; Zumárraga, Martín; Tarabla, Héctor D

    2015-01-01

    Control eradication campaigns of bovine tuberculosis based on the «test and slaughter» approach were successful in many countries and regions; however, in some areas the infection persists and one of the main reasons is Mycobacterium bovis infection in wild life species. Argentina has applied the same approach since 1999, achieving progress in dairy cattle herds. Nonetheless, the wildlife role has never been investigated. The objective of this study was to determine if wildlife from the Santa Fe dairy area is infected with M. bovis. Wildlife species having a positive tuberculin skin test were captured in five dairy farms. Ninety five wildlife mammals were captured; M. bovis was recovered from 7 possums (Didelphys albiventris), from one fox (Lycolapex gimnocercus) and from one rat (Rattus norvegicus). None of the animals exhibited macroscopic lesions. The most frequently isolated M. bovis spoligotypes were types 34 (4 isolates) and 12 (3 isolates). Spoligotype 34 is the most frequently isolated type in Argentine cattle. The role of D. albiventris as spillover host of M. bovis is discussed in this study. PMID:26376835

  15. Mycobacterium ulcerans DNA not detected in faecal samples from Buruli ulcer patients: results of a pilot study.

    Directory of Open Access Journals (Sweden)

    Fred S Sarfo

    Full Text Available It has recently been shown that in a Buruli ulcer (BU endemic region of southeastern Australia, significant numbers of possums (native tree-dwelling marsupials have clinical BU disease. Furthermore, based on quantitative PCR (qPCR analysis, animals with BU lesions (and some without shed M. ulcerans DNA in their faeces, indicative of bacterial loads of up to 10(8 organisms/gram. These findings led us to propose that humans might also harbour M. ulcerans in their gastrointestinal tract and shed the bacterium in their faeces. We conducted a pilot study and collected faecal swabs from 26 patients with confirmed BU and 31 healthy household controls. Faecal samples were also collected from 10 healthy controls from non-endemic regions in Ghana. All 67 specimens were negative when tested by IS2404 PCR. The detection sensitivity of this method was ≥10(4 bacteria per gram (wet-weight of human faecal material. We conclude that the human gastrointestinal tract is unlikely to be a significant reservoir of M. ulcerans.

  16. Advances in molecular diagnostics for Mycobacterium bovis.

    Science.gov (United States)

    Collins, Desmond M

    2011-07-01

    The two most important molecular diagnostic techniques for bovine tuberculosis are the polymerase chain reaction (PCR) because of its rapid determination of infection, and DNA strain typing because of its ability to answer important epidemiological questions. PCR tests for Mycobacterium bovis have been improved through recent advances in PCR technology, but still lack the sensitivity of good culture methods, and in some situations are susceptible to giving both false negative and false positive results. Therefore, PCR does not usually replace the need for culture, but is used to provide fast preliminary results. DNA typing of M. bovis isolates by restriction endonuclease analysis (REA) was developed 25 years ago in New Zealand, and remains an important tool in the New Zealand control scheme, where the typing results are combined with other information to determine large and expensive possum poisoning operations. A range of other DNA typing systems developed for M. bovis in the 1990 s have assisted epidemiological investigations in some countries but are now less commonly used. Variable number tandem repeat (VNTR) typing and spoligotyping, either alone or together, have now become the preferred approaches as they are robust and amenable to electronic analysis and comparison. Spoligotyping gives only moderate discrimination but can be easily applied to large numbers of isolates, and VNTR typing provides better discrimination than all other methods except for REA. While the current typing techniques are sufficient for most epidemiological purposes, more discriminating methods are likely to become available in the near future. PMID:21420257

  17. The distribution of polarized radio sources $>$15$\\mu$Jy in GOODS-N

    CERN Document Server

    Rudnick, Lawrence

    2014-01-01

    We present deep VLA observations of the polarization of radio sources in the GOODS-N field at 1.4 GHz at resolutions of 1.6" and 10". At 1.6", we find that the cumulative number count distribution is N($>$p) $\\sim$ 45 * (p/30$\\mu$Jy)$^{-0.6}$ per square degree above a detection threshold of 14.5 $\\mu$Jy. This represents a break from the steeper slopes at higher flux densities, resulting in fewer sources predicted for future surveys with the SKA and its precursors. It provides a significant challenge for using background RMs to study clusters of galaxies or individual galaxies. Most of the polarized sources are well above our detection limit, and are radio galaxies which are well-resolved even at 10", with redshifts from $\\sim$0.2 - 1.9. We determined a total polarized flux for each source by integrating the 10" polarized intensity maps, as will be done by upcoming surveys such as POSSUM. These total polarized fluxes are a factor of 2 higher, on average, than the peak polarized flux at 1.6"; this would increas...

  18. Comparison of algorithms for determination of rotation measure and Faraday structure I. 1100 - 1400 MHz

    CERN Document Server

    Sun, X H; Akahori, Takuya; Anderson, C S; Bell, M R; Bray, J D; Farnes, J S; Ideguchi, S; Kumazaki, K; O'Brien, T; O'Sullivan, S P; Scaife, A M M; Stepanov, R; Stil, J; Takahashi, K; van Weeren, R J; Wolleben, M

    2014-01-01

    (abridged) We run a Faraday structure determination data challenge to benchmark the currently available algorithms including Faraday synthesis (previously called RM synthesis in the literature), wavelet, compressive sampling and $QU$-fitting. The frequency set is similar to POSSUM/GALFACTS with a 300 MHz bandwidth from 1.1 to 1.4 GHz. We define three figures of merit motivated by the underlying science: a) an average RM weighted by polarized intensity, RMwtd, b) the separation $\\Delta\\phi$ of two Faraday components and c) the reduced chi-squared. Based on the current test data of signal to noise ratio of about 32, we find that: (1) When only one Faraday thin component is present, most methods perform as expected, with occasional failures where two components are incorrectly found; (2) For two Faraday thin components, QU-fitting routines perform the best, with errors close to the theoretical ones for RMwtd, but with significantly higher errors for $\\Delta\\phi$. All other methods including standard Faraday synt...

  19. Future Observations of Cosmic Magnetic Fields with LOFAR, SKA and Its Precursors

    Science.gov (United States)

    Beck, Rainer

    Polarization observations with the forthcoming large radio telescopes will open a new era in the observation of magnetic fields and should help to understand their origin. Low-frequency radio synchrotron emission from the Milky Way, galaxies and galaxy clusters, observed with the new Low Frequency Array (LOFAR) and the planned Square Kilometre Array (SKA), traces low-energy cosmic ray electrons and allows us to map the structure of weak magnetic fields in the outer regions and halos of galaxies, in halos and relics of clusters and in the Milky Way. Polarization at higher frequencies (1-10 GHz), to be observed with the SKA and its precursors Australia SKA Pathfinder (ASKAP) and the South African MeerKAT telescopes, will trace magnetic fields in the disks and central regions of galaxies and in cluster relics in unprecedented detail. All-sky surveys of Faraday rotation measures towards a dense grid of polarized background sources with ASKAP (project POSSUM) and the SKA are dedicated to measure magnetic fields in intervening galaxies, clusters and intergalactic filaments, and will be used to model the overall structure and strength of magnetic fields in the Milky Way. Cosmic magnetism is "key science" for LOFAR, ASKAP and the SKA.

  20. Future Observations of Cosmic Magnetic Fields with the SKA and its Precursors

    CERN Document Server

    Beck, Rainer

    2011-01-01

    The origin of magnetic fields in the Universe is an open problem in astrophysics and fundamental physics. Polarization observations with the forthcoming large radio telescopes, especially the Square Kilometre Array (SKA), will open a new era in the observation of magnetic fields and should help to understand their origin. Low-frequency radio synchrotron emission, to be observed with LOFAR, MWA and the SKA, traces low-energy cosmic ray electrons and allows us to map the structure of weak magnetic fields in the outer regions and halos of galaxies, in halos and relics of galaxy clusters and in the Milky Way. Polarization at higher frequencies (1-10 GHz), to be observed with the SKA and its precursors ASKAP and MeerKAT, will trace magnetic fields in the disks and central regions of galaxies and in cluster relics in unprecedented detail. All-sky surveys of Faraday rotation measures towards a dense grid of polarized background sources with ASKAP (project POSSUM) and the SKA are dedicated to measure magnetic fields ...

  1. Nowhere man: The Countryside of Fred Williams after Western Desert painting

    Directory of Open Access Journals (Sweden)

    Darren Jorgenson

    2012-11-01

    Full Text Available Two monographs on Australian artist Fred Williams, published by Patrick McCaughey and James Mollison during the 1980s, have recently been joined by a third, Deborah Hart’s Fred Williams: Infinite Horizons (2011. While the first two argue that the artist’s work bridged a schism between Australian landscape painting and an internationalist contemporary art of the 1960s, the rise of Western Desert painting invites a new reading of his landscapes. Ron Radford’s Preface to Hart’s new monograph wants to reconcile the artist’s relationship to Western Desert painting with an anecdote about Clifford Possum’s visit to the Art Gallery of South Australia in 1984. Possum was enthusiastic about a painting by Williams, and Radford sees in this enthusiasm a reconciliation of Aboriginal and non-Aboriginal ways of seeing. Such different readings of Williams and his work, authored in different historical periods, reflect different moments in the unfolding of national anxieties that constitute the history of Australian art.

  2. The use of damage control orthopaedics to minimize negative sequelae of surgery delay in elderly comorbid patients with hip fracture.

    Science.gov (United States)

    Dong, C-H; Wang, Z-M; Zhao, X-L; Wang, A-M

    2016-06-01

    Hip surgeries count to the most frequent orthopaedic operations in older patients. Nonelective surgeries for hip fractures cause substantial economic burden because of high costs of medical treatment and high associated mortality. Surgery for hip fracture in the elderly comorbid patient still presents a challenge to orthopaedic surgeons. It is recommended that this surgery is performed within 48 hours after sustaining the hip fracture to decrease mortality. Yet the recommended early surgery (i.e. 48 hours after the incident) is not always feasible due to the frequent overall frailty of the patients or conditions of concomitant disease. The care of patients unfit for early surgery has been not adequately addressed in the literature. We have previously introduced an algorithm based on ASA-PS and P-POSSUM scores to stratify elderly comorbid patients for early vs delayed hip surgery, and used principles of Damage Control Orthopaedics to minimized negative sequelae of surgery delay (Dong C et al., PLoS One 2016). In this paper, we elaborate on Damage Control Orthopaedics and the proposed approach in the context of frequent comorbidities in the elderly orthopaedic patients. Further studies on this subject are urgently needed to establish international consensus on hip fracture surgery delayed due to overall patient frailty or extensive comorbidities. PMID:27383299

  3. Effect of imbalanced nutrients and immigration on Prymnesium parvum community dominance and toxicity: Results from in-lake microcosm experiments

    Science.gov (United States)

    Errera, R.M.; Roelke, D.L.; Kiesling, R.L.; Brooks, B.W.; Grover, J.P.; Schwierzke, L.; Urena-Boeck, F.; Baker, J.W.; Pinckney, J.L.

    2008-01-01

    Prymnesium parvum, a haptophyte species, forms harmful blooms, including those that have caused severe fish kills in Texas, USA, over the past 6 yr. We studied P. parvum dynamics using in situ microcosm experiments at Lake Possum Kingdom, Texas, during 3 seasons (fall 2004, winter and spring 2005). Experimental treatments included full and partial nutrient enrichment (encompassing nitrogen [N] and phosphorus [P] deficient treatments), P. parvum immigration and combinations of these factors. In the control and N and P deficient treatments, P. parvum populations dominated the community, but only in the N deficient treatments did P. parvum experience a significant growth in the population. In contrast, when nutrients were not limiting, P. parvum tended to lose its competitive edge to other taxa such as chlorophytes, euglenophytes and diatoms, which then dominated the community. Population growth of P. parvum was also stimulated through immigration, but only during the winter experiment, a period of the year when bloom initiation is common. This finding suggests that movement into the water column may be an important process leading to P. parvum bloom initiation. Toxicity of P. parvum to fish was also affected by the nutrient changes: during conditions of no nutrient addition P. parvum was most toxic; intermediate toxicity was observed under N and P deficient conditions, and full nutrient enrichments resulted in nearly non-toxic conditions. ?? Inter-Research 2008.

  4. Parasite and predator risk assessment: nuanced use of olfactory cues.

    Science.gov (United States)

    Sharp, John G; Garnick, Sarah; Elgar, Mark A; Coulson, Graeme

    2015-10-22

    Foraging herbivores face twin threats of predation and parasite infection, but the risk of predation has received much more attention. We evaluated, experimentally, the role of olfactory cues in predator and parasite risk assessment on the foraging behaviour of a population of marked, free-ranging, red-necked wallabies (Macropus rufogriseus). The wallabies adjusted their behaviour according to these olfactory cues. They foraged less, were more vigilant and spent less time at feeders placed in the vicinity of faeces from dogs that had consumed wallaby or kangaroo meat compared with that of dogs feeding on sheep, rabbit or possum meat. Wallabies also showed a species-specific faecal aversion by consuming less food from feeders contaminated with wallaby faeces compared with sympatric kangaroo faeces, whose gastrointestinal parasite fauna differs from that of the wallabies. Combining both parasite and predation cues in a single field experiment revealed that these risks had an additive effect, rather than the wallabies compromising their response to one risk at the expense of the other. PMID:26468246

  5. Does bipedality predict the group-level manual laterality in mammals?

    Directory of Open Access Journals (Sweden)

    Andrey Giljov

    Full Text Available BACKGROUND: Factors determining patterns of laterality manifestation in mammals remain unclear. In primates, the upright posture favours the expression of manual laterality across species, but may have little influence within a species. Whether the bipedalism acts the same in non-primate mammals is unknown. Our recent findings in bipedal and quadrupedal marsupials suggested that differences in laterality pattern, as well as emergence of manual specialization in evolution might depend on species-specific body posture. Here, we evaluated the hypothesis that the postural characteristics are the key variable shaping the manual laterality expression across mammalian species. METHODOLOGY/PRINCIPAL FINDINGS: We studied forelimb preferences in a most bipedal marsupial, brush-tailed bettong, Bettongia penicillata in four different types of unimanual behavior. The significant left-forelimb preference at the group level was found in all behaviours studied. In unimanual feeding on non-living food, catching live prey and nest-material collecting, all or most subjects were lateralized, and among lateralized bettongs a significant majority displayed left-forelimb bias. Only in unimanual supporting of the body in the tripedal stance the distribution of lateralized and non-lateralized individuals did not differ from chance. Individual preferences were consistent across all types of behaviour. The direction or the strength of forelimb preferences were not affected by the animals' sex. CONCLUSIONS/SIGNIFICANCE: Our findings support the hypothesis that the expression of manual laterality depends on the species-typical postural habit. The interspecies comparison illustrates that in marsupials the increase of bipedality corresponds with the increase of the degree of group-level forelimb preference in a species. Thus, bipedalism can predict pronounced manual laterality at both intra- and interspecific levels in mammals. We also conclude that quadrupedal position in

  6. Role of Species-Specific Primary Structure Differences in Aβ42 Assembly and Neurotoxicity.

    Science.gov (United States)

    Roychaudhuri, Robin; Zheng, Xueyun; Lomakin, Aleksey; Maiti, Panchanan; Condron, Margaret M; Benedek, George B; Bitan, Gal; Bowers, Michael T; Teplow, David B

    2015-12-16

    A variety of species express the amyloid β-protein (Aβ (the term "Aβ" refers both to Aβ40 and Aβ42, whereas "Aβ40" and "Aβ42" refer to each isoform specifically). Those species expressing Aβ with primary structure identical to that expressed in humans have been found to develop amyloid deposits and Alzheimer's disease-like neuropathology. In contrast, the Aβ sequence in mice and rats contains three amino acid substitutions, Arg5Gly, His13Arg, and Tyr10Phe, which apparently prevent the development of AD-like neuropathology. Interestingly, the brush-tailed rat, Octodon degus, expresses Aβ containing only one of these substitutions, His13Arg, and does develop AD-like pathology. We investigate here the biophysical and biological properties of Aβ peptides from humans, mice (Mus musculus), and rats (Octodon degus). We find that each peptide displays statistical coil → β-sheet secondary structure transitions, transitory formation of hydrophobic surfaces, oligomerization, formation of annuli, protofibrils, and fibrils, and an inverse correlation between rate of aggregation and aggregate size (faster aggregation produced smaller aggregates). The rank order of assembly rate was mouse > rat > Aβ42. The rank order of neurotoxicity of assemblies formed by each peptide immediately after preparation was Aβ42 > mouse ≈ rat. These data do not support long-standing hypotheses that the primary factor controlling development of AD-like neuropathology in rodents is Aβ sequence. Instead, the data support a hypothesis that assembly quaternary structure and organismal responses to toxic peptide assemblies mediate neuropathogenetic effects. The implication of this hypothesis is that a valid understanding of disease causation within a given system (organism, tissue, etc.) requires the coevaluation of both biophysical and cell biological properties of that system. PMID:26421877

  7. Behavioral responses of native prey to disparate predators: naiveté and predator recognition.

    Science.gov (United States)

    Anson, Jennifer R; Dickman, Chris R

    2013-02-01

    It is widely accepted that predator recognition and avoidance are important behaviors in allowing prey to mitigate the impacts of their predators. However, while prey species generally develop anti-predator behaviors through coevolution with predators, they sometimes show accelerated adoption of these behaviors under strong selection pressure from novel species. We used a field manipulation experiment to gauge the ability of the common ringtail possum (Pseudocheirus peregrinus), a semi-arboreal Australian marsupial, to recognize and respond to olfactory cues of different predator archetypes. We predicted that ringtails would display stronger anti-predator behaviors to cues of the invasive European red fox (Vulpes vulpes) in areas where fox impacts had been greatest, and to cues of the native lace monitor (Varanus varius) in areas of sympatry compared with allopatry. We found that ringtails fled quickly and were more alert when exposed to the fecal odors of both predators compared to neutral and pungent control odors, confirming that predator odors are recognized and avoided. However, these aversive responses were similar irrespective of predator presence or level of impact. These results suggest that selection pressure from the fox has been sufficient for ringtails to develop anti-predator behaviors over the few generations since foxes have become established. In contrast, we speculate that aversive responses by ringtails to the lace monitor in areas where this predator is absent reflect recent coexistence of the two species. We conclude that rapid evolution of anti-predator behaviors may occur when selection is strong. The maintenance of these behaviors should allow re-establishment of predator-prey relationships if the interactants regain sympatry via range shifts or management actions to reintroduce them to their former ranges. PMID:22865005

  8. Final environmental statement related to the proposed construction of Douglas Point Nuclear Generating Station, Units 1 and 2: (Docket Nos. 50-448 and 50-449)

    International Nuclear Information System (INIS)

    The proposed action is the issuance of construction permits to the Potomac Electric Power Company for the construction of the Douglas Point Nuclear Generating Station, Units 1 and 2, located in Charles County, Maryland. The exhaust steam will be cooled via a closed-cycle mode incorporating natural-draft wet cooling towers. The water used in the cooling system will be obtained from the Potomac River. Construction-related activities on the site will convert about 290 acres of the 1390 acres of forested land at the Douglas Point site to industrial use. In addition to acreage at the site, approximately 4.5 miles of transmission corridor will require about 211 acres of land for rights-of-way. This corridor will connect with 27 miles of existing rights-of-way over which a line connecting Possum Point to Burches Hill has already been approved. The installation of new transmission line, uniquely identified with Douglas Point, along the existing right-of-way will involve approximately 464 additional acres. As described in the application, the maximum river water intake will be about 97,200 gpm. Of this, a maximum of about 28,000 gpm will be lost in drift or evaporation from the cooling towers. About 700 gpm maximum of fresh well water will be consumed. It is conservatively assumed that all aquatic organisms entrained in the service water system will be killed due to thermal and mechanical shock. It is further estimated that at 97,200 gpm maximum total river water intake, the maximum impact on the striped bass fishery will be a reduction of <5%. The risk associated with accidental radiation exposure is very low. 32 figs., 59 tabs

  9. Why biosecurity matters: students' knowledge of biosecurity and implications for future engagement with biosecurity initiatives

    Science.gov (United States)

    Ram, Rajesh; France, Bev; Birdsall, Sally

    2016-01-01

    Background: Research on biosecurity is important as New Zealand's agricultural export-driven economy is susceptible to biosecurity threats. Because New Zealand is reliant on the primary industries to drive its economy, bovine diseases such as foot and mouth could have a devastating effect on the economy. Purpose: Making sure that the general public are aware of the importance of maintaining biosecurity is crucial in order to protect New Zealand's economy, human health, the environment, and social and cultural values. New Zealand Year 9 students' knowledge of biosecurity was gauged as these students represented the next generation of individuals tasked to maintain biosecurity in New Zealand. Design: A qualitative approach using the interpretive mode of inquiry was used to investigate the knowledge about biosecurity with New Zealand Year 9 students. Questionnaires and interviews were the data collection tools. Sample: One hundred and seventy-one students completed a questionnaire that consisted of Likert-type questions and open-ended questions. Nine students were interviewed about their knowledge. Results: The findings showed that New Zealand Year 9 students lacked specific knowledge about unwanted plants, animals and microorganisms. These students saw illicit drug plants as unwanted plants and mainly saw possums as unwanted animals in New Zealand. Their knowledge about unwanted microorganisms in New Zealand was dominated by human-disease-causing microbes. A lack of knowledge of biosecurity issues in New Zealand was seen as the major factor in these students limited understanding of biosecurity. Conclusions: Based on these findings, it can be said that knowledge of an issue is critical in enabling individuals to develop an understanding about biosecurity. Explicit teaching of biosecurity-related curriculum topics could provide New Zealand Year 9 students with an opportunity to develop knowledge about biosecurity in New Zealand.

  10. The Commensal Streptococcus salivarius K12 Downregulates the Innate Immune Responses of Human Epithelial Cells and Promotes Host-Microbe Homeostasis▿ †

    Science.gov (United States)

    Cosseau, Celine; Devine, Deirdre A.; Dullaghan, Edie; Gardy, Jennifer L.; Chikatamarla, Avinash; Gellatly, Shaan; Yu, Lorraine L.; Pistolic, Jelena; Falsafi, Reza; Tagg, John; Hancock, Robert E. W.

    2008-01-01

    Streptococcus salivarius is an early colonizer of human oral and nasopharyngeal epithelia, and strain K12 has reported probiotic effects. An emerging paradigm indicates that commensal bacteria downregulate immune responses through the action on NF-κB signaling pathways, but additional mechanisms underlying probiotic actions are not well understood. Our objective here was to identify host genes specifically targeted by K12 by comparing their responses with responses elicited by pathogens and to determine if S. salivarius modulates epithelial cell immune responses. RNA was extracted from human bronchial epithelial cells (16HBE14O- cells) cocultured with K12 or bacterial pathogens. cDNA was hybridized to a human 21K oligonucleotide-based array. Data were analyzed using ArrayPipe, InnateDB, PANTHER, and oPOSSUM. Interleukin 8 (IL-8) and growth-regulated oncogene alpha (Groα) secretion were determined by enzyme-linked immunosorbent assay. It was demonstrated that S. salivarius K12 specifically altered the expression of 565 host genes, particularly those involved in multiple innate defense pathways, general epithelial cell function and homeostasis, cytoskeletal remodeling, cell development and migration, and signaling pathways. It inhibited baseline IL-8 secretion and IL-8 responses to LL-37, Pseudomonas aeruginosa, and flagellin in epithelial cells and attenuated Groα secretion in response to flagellin. Immunosuppression was coincident with the inhibition of activation of the NF-κB pathway. Thus, the commensal and probiotic behaviors of S. salivarius K12 are proposed to be due to the organism (i) eliciting no proinflammatory response, (ii) stimulating an anti-inflammatory response, and (iii) modulating genes associated with adhesion to the epithelial layer and homeostasis. S. salivarius K12 might thereby ensure that it is tolerated by the host and maintained on the epithelial surface while actively protecting the host from inflammation and apoptosis induced by

  11. The commensal Streptococcus salivarius K12 downregulates the innate immune responses of human epithelial cells and promotes host-microbe homeostasis.

    Science.gov (United States)

    Cosseau, Celine; Devine, Deirdre A; Dullaghan, Edie; Gardy, Jennifer L; Chikatamarla, Avinash; Gellatly, Shaan; Yu, Lorraine L; Pistolic, Jelena; Falsafi, Reza; Tagg, John; Hancock, Robert E W

    2008-09-01

    Streptococcus salivarius is an early colonizer of human oral and nasopharyngeal epithelia, and strain K12 has reported probiotic effects. An emerging paradigm indicates that commensal bacteria downregulate immune responses through the action on NF-kappaB signaling pathways, but additional mechanisms underlying probiotic actions are not well understood. Our objective here was to identify host genes specifically targeted by K12 by comparing their responses with responses elicited by pathogens and to determine if S. salivarius modulates epithelial cell immune responses. RNA was extracted from human bronchial epithelial cells (16HBE14O- cells) cocultured with K12 or bacterial pathogens. cDNA was hybridized to a human 21K oligonucleotide-based array. Data were analyzed using ArrayPipe, InnateDB, PANTHER, and oPOSSUM. Interleukin 8 (IL-8) and growth-regulated oncogene alpha (Groalpha) secretion were determined by enzyme-linked immunosorbent assay. It was demonstrated that S. salivarius K12 specifically altered the expression of 565 host genes, particularly those involved in multiple innate defense pathways, general epithelial cell function and homeostasis, cytoskeletal remodeling, cell development and migration, and signaling pathways. It inhibited baseline IL-8 secretion and IL-8 responses to LL-37, Pseudomonas aeruginosa, and flagellin in epithelial cells and attenuated Groalpha secretion in response to flagellin. Immunosuppression was coincident with the inhibition of activation of the NF-kappaB pathway. Thus, the commensal and probiotic behaviors of S. salivarius K12 are proposed to be due to the organism (i) eliciting no proinflammatory response, (ii) stimulating an anti-inflammatory response, and (iii) modulating genes associated with adhesion to the epithelial layer and homeostasis. S. salivarius K12 might thereby ensure that it is tolerated by the host and maintained on the epithelial surface while actively protecting the host from inflammation and apoptosis

  12. Assessing the risk: Scoring systems for outcome prediction in emergency laparotomies.

    Science.gov (United States)

    Nag, Deb Sanjay

    2015-12-01

    Emergency laparotomy is the commonest emergency surgical procedure in most hospitals and includes over 400 diverse surgical procedures. Despite the evolution of medicine and surgical practices, the mortality in patients needing emergency laparotomy remains abnormally high. Although surgical risk assessment first started with the ASA Physical Status score in 1941, efforts to find an ideal scoring system that accurately estimates the risk of mortality, continues till today. While many scoring systems have been developed, no single scoring system has been validated across multiple centers and geographical locations. While some scoring systems can predict the risk merely based upon preoperative findings and parameters, some rely on intra-operative assessment and histopathology reports to accurately stratify the risk of mortality. Although most scoring systems can potentially be used to compare risk-adjusted mortality across hospitals and amongst surgeons, only those which are based on preoperative findings can be used for risk prognostication and identify high-risk patients before surgery for an aggressive treatment. The recognition of the fact, that in the absence of outcome data in these patients, it would be impossible to evaluate the impact of quality improvement initiatives on risk-adjusted mortality, hospital groups and surgical societies have got together and started to pool data and analyze it. Appropriate scoring systems for emergency laparotomies would help in risk prognostication, risk-adjusted audit and assess the impact of quality improvement initiative in patient care across hospitals. Large multi-centric studies across varied geographic locations and surgical practices need to assess and validate the ideal and most apt scoring system for emergency laparotomies. While APACHE-II and P-POSSUM continue to be the most commonly used scoring system in emergency laparotomies,studies need to compare them in their ability to predict mortality and explore if either

  13. Assessment of Genetic Markers for Tracking the Sources of Human Wastewater Associated Escherichia coli in Environmental Waters.

    Science.gov (United States)

    Warish, Ahmed; Triplett, Cheryl; Gomi, Ryota; Gyawali, Pradip; Hodgers, Leonie; Toze, Simon

    2015-08-01

    In this study, we have evaluated the performance characteristics (host-specificity and -sensitivity) of four human wastewater-associated Escherichia coli (E. coli) genetic markers (H8, H12, H14, and H24) in 10 target (human) and nontarget (cat, cattle, deer, dog, emu, goat, horse, kangaroo, and possum) host groups in Southeast Queensland, Australia. The overall host-sensitivity values of the tested markers in human wastewater samples were 1.0 (all human wastewater samples contained the E. coli genetic markers). The overall host-specificity values of these markers to differentiate between human and animal host groups were 0.94, 0.85, 0.72, and 0.57 for H8, H12, H24, and H14, respectively. Based on the higher host-specificity values, H8 and H12 markers were chosen for a validation environmental study. The prevalence of the H8 and H12 markers was determined among human wastewater E. coli isolates collected from a wastewater treatment plant (WWTP). Among the 97 isolates tested, 44 (45%) and 14 (14%) were positive for the H8 and H12 markers, respectively. A total of 307 E. coli isolates were tested from environmental water samples collected in Brisbane, of which 7% and 20% were also positive for the H8 and H12 markers, respectively. Based on our results, we recommend that these markers could be useful when it is important to identify the source(s) of E. coli (whether they originated from human wastewater or not) in environmental waters. PMID:26151092

  14. The distribution of polarized radio sources >15 μJy IN GOODS-N

    International Nuclear Information System (INIS)

    We present deep Very Large Array observations of the polarization of radio sources in the GOODS-N field at 1.4 GHz at resolutions of 1.''6 and 10''. At 1.''6, we find that the peak flux cumulative number count distribution is N(> p) ∼ 45*(p/30 μJy)–0.6 per square degree above a detection threshold of 14.5 μJy. This represents a break from the steeper slopes at higher flux densities, resulting in fewer sources predicted for future surveys with the Square Kilometer Array and its precursors. It provides a significant challenge for using background rotation measures (RMs) to study clusters of galaxies or individual galaxies. Most of the polarized sources are well above our detection limit, and they are also radio galaxies that are well-resolved even at 10'', with redshifts from ∼0.2-1.9. We determined a total polarized flux for each source by integrating the 10'' polarized intensity maps, as will be done by upcoming surveys such as POSSUM. These total polarized fluxes are a factor of two higher, on average, than the peak polarized flux at 1.''6; this would increase the number counts by ∼50% at a fixed flux level. The detected sources have RMs with a characteristic rms scatter of ∼11 rad m–2 around the local Galactic value, after eliminating likely outliers. The median fractional polarization from all total intensity sources does not continue the trend of increasing at lower flux densities, as seen for stronger sources. The changes in the polarization characteristics seen at these low fluxes likely represent the increasing dominance of star-forming galaxies.

  15. The distribution of polarized radio sources >15 μJy IN GOODS-N

    Energy Technology Data Exchange (ETDEWEB)

    Rudnick, L. [Minnesota Institute for Astrophysics, School of Physics and Astronomy, University of Minnesota, 116 Church Street SE, Minneapolis, MN 55455 (United States); Owen, F. N., E-mail: larry@umn.edu [National Radio Astronomy Observatory, Socorro, NM 87801 (United States)

    2014-04-10

    We present deep Very Large Array observations of the polarization of radio sources in the GOODS-N field at 1.4 GHz at resolutions of 1.''6 and 10''. At 1.''6, we find that the peak flux cumulative number count distribution is N(> p) ∼ 45*(p/30 μJy){sup –0.6} per square degree above a detection threshold of 14.5 μJy. This represents a break from the steeper slopes at higher flux densities, resulting in fewer sources predicted for future surveys with the Square Kilometer Array and its precursors. It provides a significant challenge for using background rotation measures (RMs) to study clusters of galaxies or individual galaxies. Most of the polarized sources are well above our detection limit, and they are also radio galaxies that are well-resolved even at 10'', with redshifts from ∼0.2-1.9. We determined a total polarized flux for each source by integrating the 10'' polarized intensity maps, as will be done by upcoming surveys such as POSSUM. These total polarized fluxes are a factor of two higher, on average, than the peak polarized flux at 1.''6; this would increase the number counts by ∼50% at a fixed flux level. The detected sources have RMs with a characteristic rms scatter of ∼11 rad m{sup –2} around the local Galactic value, after eliminating likely outliers. The median fractional polarization from all total intensity sources does not continue the trend of increasing at lower flux densities, as seen for stronger sources. The changes in the polarization characteristics seen at these low fluxes likely represent the increasing dominance of star-forming galaxies.

  16. Is Radical Bowel Cancer Resection Under Local Anaesthesia and Sedation Feasible?

    Science.gov (United States)

    Sebastian, J; Sran, H; Marzouk, D

    2015-08-01

    Some patients with bowel cancer have significant comorbidities, making them unfit for major surgery under general anaesthesia. However, treatment without surgery offers no possibility of cure, and furthermore, symptom control may be poor. We investigated the possibility of performing these resections under local anaesthesia in patients with a slim body habitus in a cohort of patients rejected for general anaesthesia. Eight patients (4 M, 4 F) aged 77-89 were included in this study. All had significant comorbidities and were deemed unfit for general anaesthesia by the consultant anaesthetist in charge of pre assessing high-risk patients. All patients had undergone a thorough assessment, which included P-POSSUM scoring. The recruited patients underwent a careful and fully informed consenting process, leading to standard cancer resections. These resections occurred between 2005 and 2012, under combined local anaesthesia and sedation. The operations undertaken were four right hemicolectomies (for caecal cancer), two Hartmann's procedures (for sigmoid cancer), one Hartmann's procedure with en bloc small bowel resection (for sigmoid cancer invading small bowel) and one transverse colectomy (for mid transverse colon cancer). Seven patients survived radical surgery without complications, although one died from an unrelated cause 8 months after surgery. One of these surviving patients subsequently underwent CABG and further bowel surgery under GA 2 years later for a metachronous sigmoid cancer. There was one postoperative death due to cardiogenic shock on the third postoperative day. Radical cancer resections under local anaesthesia are feasible in suitably selected high-risk patients with acceptable mortality and comparable medium- to long-term results. PMID:26702231

  17. Goal-directed hemostatic therapy using the rotational thromboelastometry in patients requiring emergent cardiovascular surgery

    Directory of Open Access Journals (Sweden)

    Danièle Sartorius

    2014-01-01

    Full Text Available Aims and Objectives: We assessed the clinical impact of goal-directed coagulation management based on rotational thromboelastometry (ROTEM in patients undergoing emergent cardiovascular surgical procedures. Materials and Methods: Over a 2-year period, data from 71 patients were collected prospectively and blood samples were obtained for coagulation testing. Administration of packed red blood cells (PRBC and hemostatic products were guided by an algorithm using ROTEM-derived information and hemoglobin level. Based on the amount of PRBC transfused, two groups were considered: High bleeders (≥5 PRBC; HB and low bleeders (<5 PRBC; LB. Data were analyzed using Chi-square test, unpaired t-test and analysis of variance as appropriate. Results: Pre-operatively, the HB group (n = 31 was characterized by lower blood fibrinogen and decreased clot amplitude at ROTEM compared with the LB group (n = 40. Intraoperatively, larger amounts of fibrinogen, fresh frozen plasma and platelets were required to normalize the coagulation parameters in the HB group. Post-operatively, the incidence of major thromboembolic and ischemic events did not differ between the two groups (<10% and the observed in-hospital mortality was significantly less than expected by the Physiological and Operative Severity Score for the enumeration of Mortality and Morbidity (POSSUM score, 22% vs. 35% in HB and 5% vs. 13% in LB group. Conclusions: ROTEM-derived information is helpful to detect early coagulation abnormalities and to monitor the response to hemostatic therapy. Early goal-directed management of coagulopathy may improve outcome after cardiovascular surgery.

  18. The Distribution of Polarized Radio Sources >15 μJy in GOODS-N

    Science.gov (United States)

    Rudnick, L.; Owen, F. N.

    2014-04-01

    We present deep Very Large Array observations of the polarization of radio sources in the GOODS-N field at 1.4 GHz at resolutions of 1.''6 and 10''. At 1.''6, we find that the peak flux cumulative number count distribution is N(> p) ~ 45*(p/30 μJy)-0.6 per square degree above a detection threshold of 14.5 μJy. This represents a break from the steeper slopes at higher flux densities, resulting in fewer sources predicted for future surveys with the Square Kilometer Array and its precursors. It provides a significant challenge for using background rotation measures (RMs) to study clusters of galaxies or individual galaxies. Most of the polarized sources are well above our detection limit, and they are also radio galaxies that are well-resolved even at 10'', with redshifts from ~0.2-1.9. We determined a total polarized flux for each source by integrating the 10'' polarized intensity maps, as will be done by upcoming surveys such as POSSUM. These total polarized fluxes are a factor of two higher, on average, than the peak polarized flux at 1.''6; this would increase the number counts by ~50% at a fixed flux level. The detected sources have RMs with a characteristic rms scatter of ~11 rad m-2 around the local Galactic value, after eliminating likely outliers. The median fractional polarization from all total intensity sources does not continue the trend of increasing at lower flux densities, as seen for stronger sources. The changes in the polarization characteristics seen at these low fluxes likely represent the increasing dominance of star-forming galaxies.

  19. Gastric cancer surgery: Billroth I or Billroth II for distal gastrectomy?

    Directory of Open Access Journals (Sweden)

    Zhu Zheng-Gang

    2009-12-01

    Full Text Available Abstract Background The selection of an anastomosis method after a distal gastrectomy is a highly debatable topic; however, the available documentation lacks the necessary research based on a comparison of early postoperative complications. This study was conducted to investigate the difference of early postoperative complications between Billroth I and Billroth II types of anastomosis for distal gastrectomies. Methods A total of 809 patients who underwent distal gastrectomies for gastric cancer during four years were included in the study. The only study endpoint was analysis of in-patients' postoperative complications. The risk adjusted complication rate was compared by POSSUM (Physiological and operative severity score for enumeration of morbidity and mortality and the severity of complications was compared by Rui Jin Hospital classification of complication. Results Complication rate of Billroth II type of anastomosis was almost double of that in Billroth I (P = 0.000. Similarly, the risk adjusted complication rate was also higher in Billroth II group. More severe complications were observed and the postoperative duration was significantly longer in Billroth II type (P = 0.000. Overall expenditure was significantly higher in Billroth II type (P = 0.000. Conclusion Billroth II method of anastomosis was associated with higher rate of early postoperative complications. Therefore, we conclude that the Billroth I method should be the first choice after a distal gastrectomy as long as the anatomic and oncological environment of an individual patient allows us to perform it. However more prospective studies should be designed to compare the overall surgical outcomes of both anastomosis methods.

  20. Comparison of Risk Scoring Systems to Predict the Outcome in ASA-PS V Patients Undergoing Surgery: A Retrospective Cohort Study.

    Science.gov (United States)

    Yurtlu, Derya Arslan; Aksun, Murat; Ayvat, Pnar; Karahan, Nagihan; Koroglu, Lale; Aran, Gülcin Önder

    2016-03-01

    Operative decision in American Society of Anesthesiology Physical Status (ASA-PS) V patient is difficult as this group of patients expected to have high mortality rate. Another risk scoring system in this ASA-PS V subset of patients can aid to ease this decision.Data of ASA-PS V classified patients between 2011 and 2013 years in a single hospital were analyzed in this study. Predicted mortality of these patients was determined with acute physiology and chronic health evaluations (APACHE) II, simplified acute physiology score (SAPS II), Charlson comorbidity index (CCI), Porthsmouth physiological and operative severity score for enumeration of mortality and morbidity (P-POSSUM), Surgical apgar score (SAS), and Goldman cardiac risk index (GCRI) scores. Observed and predicted mortality rates according to the risk indexes in these patients were compared at survivor and nonsurvivor group of patients. Risk stratification was made with receiver operator characteristic (ROC) curve analysis.Data of 89 patients were included in the analyses. Predicted mortality rates generated by APACHE II and SAPS II scoring systems were significantly different between survivor and nonsurvivor group of patients. Risk stratification with ROC analysis revealed that area under curve was 0.784 and 0.681 for SAPS II and APACHE II scoring systems, respectively. Highest sensitivity (77.3) is reached with SAPS II score.APACHE II and SAPS II are better predictive tools of mortality in ASA-PS V classified subset of patients. Discrimination power of SAPS II score is the best among the compared risk stratification scores. SAPS II can be suggested as an additional risk scoring system for ASA-PS V patients. PMID:27043696

  1. Aquatic impact

    International Nuclear Information System (INIS)

    Because of the high reproduction rates of the plankton and good tidal mixing at existing plants, depletion of plankton populations has not occurred. Spawning occurs throughout the Bay for the species of fish present here, so local depletions are insufficient to decrease Bay populations. Impingement totals are small compared to mortality due to other sources. In addition, efforts to reduce these totals are now underway at all three existing plants, Calvert Cliffs, Morgantown, and Chalk Point. Habitat modification effects, usually more subtle in nature, have minor, localized impacts. Coupled together, the power plant monitoring studies show a low cumulative impact on the mesohaline environment. The major area of concern within this region is the impact of cooling water withdrawals upon the nursery and spawning areas of striped bass and other anadromous species. Possum Point and Vienna have the highest potential for impact. New facilities planned for this region (Douglas Point, Summit, and Vienna) would increase withdrawals. The overall impact upon striped bass due to entrainment drops from an estimated 6.6% entrainment (upper bound) of the eggs and larvae spawned in the Maryland portion of the Bay at present to an estimated 3.4% (upper bound) after 1987. The addition of Douglas Point and Summit is more than off-set by the retirements of the once-through cooling units at Vienna. No impingement data are available at any of the present plants; however, degraded water quality at the Baltimore and Washington plants appears to have severely restricted fish populations in these waters. The proposed plants are expected to have no major impacts in the areas of impingement or habitat modification due to the small amount of water withdrawn

  2. A large 28S rDNA-based phylogeny confirms the limitations of established morphological characters for classification of proteocephalidean tapeworms (Platyhelminthes, Cestoda

    Directory of Open Access Journals (Sweden)

    Alain de Chambrier

    2015-04-01

    Full Text Available Proteocephalidean tapeworms form a diverse group of parasites currently known from 315 valid species. Most of the diversity of adult proteocephalideans can be found in freshwater fishes (predominantly catfishes, a large proportion infects reptiles, but only a few infect amphibians, and a single species has been found to parasitize possums. Although they have a cosmopolitan distribution, a large proportion of taxa are exclusively found in South America. We analyzed the largest proteocephalidean cestode molecular dataset to date comprising more than 100 species (30 new, including representatives from 54 genera (80% and all subfamilies, thus significantly improving upon previous works to develop a molecular phylogeny for the group. The Old World origin of proteocephalideans is confirmed, with their more recent expansion in South America. The earliest diverging lineages are composed of Acanthotaeniinae and Gangesiinae but most of the presently recognized subfamilies (and genera appear not to be monophyletic; a deep systematic reorganization of the order is thus needed and the present subfamilial system should be abandoned. The main characters on which the classical systematics of the group has been built, such as scolex morphology or relative position of genital organs in relation to the longitudinal musculature, are of limited value, as demonstrated by the very weak support for morphologically-defined subfamilies. However, new characters, such as the pattern of uterus development, relative ovary size, and egg structure have been identified, which may be useful in defining phylogenetically well-supported subgroups. A strongly supported lineage infecting various snakes from a wide geographical distribution was found. Although several improvements over previous works regarding phylogenetic resolution and taxon coverage were achieved in this study, the major polytomy in our tree, composed largely of siluriform parasites from the Neotropics, remained

  3. AB170. Loss of heterozygosity in child with multiple congenital anomaly

    Science.gov (United States)

    Aswin, Yulia Ariani; Sjarif, Damayanti Rusli

    2015-01-01

    Background Multiple congenital anomaly (MCA) has become an increasing problem in worldwide, since it significantly contributes to infant mortality rate (IMR) and caused many morbidities during neonatal until childhood period. Prevention has to be done to decrease the incidence through prenatal diagnosis, hence a proper postnatal definitive diagnosis should be established as a reference. Microaray system is one of the leading technique in order to detect copy number variations (CNV’s) and loss of heterozygosities (LOH’s) which may responsible to phenotype. This report is aimed to demonstrate a case of MCA with normal G-banding result, no pathologic CNV’s, with wide area of LOH’s contain several genes which may responsible to the phenotype. Methods Using Online Mendelian Inheritance in Man (OMIM) and Pictures of Standard Syndromes and Undiagnosed Malformation (POSSUM) databases, certain syndrome were tried to identify. Chromosome analysis were performed to detect large aberration. Microarray examination was done using Infinium CytoSNP-850K DNA analysis bead chip kit from Illumina. Chip was scanned using Hi-scan scanner from Illumina. Data were extracted using genome studio software. Data were analyzed using Nexus software. Results A 8-year-old girl was brought by parents to hospital with a chief complains dyspnea and looks cyanosis since 1 month prior to admission. She was born spontaneously, full term, no cyanosis, with distinctive face. Birth weight was 2,800 g. Her growth was retarded, but her development was normal. There is no history of seizure. Patient was a student in 3rd grade of elementary school, with an average level of intelligence. Physical examination reveals tachypnea and cyanosis. There was pansystolic mur-mur without gallop. Clubbing fingers were noticed. There are several dysmorphic feature such as frontal bossing, wide frontal, depressed nasal bridge, hypertelorism, down slanting palpebrae, asymetric face (hemi hypoplasia), midfacial

  4. AB016. Developing diagnostic strategy of multiple congenital anomalies in Indonesia

    Science.gov (United States)

    Sjarif, Damayanti Rusli; Aswin, Yulia Ariani

    2015-01-01

    Background Pediatricians quite often must deal with multiple congenital anomalies (MCA). Without a correct diagnosis, many available forms of therapy will be under-or-overused and counseling about prognosis and recurrence risk maybe unrealistic. The basis for diagnosis of MCA involves a combination of defining the physical manifestations and diagnostic genetic testing. Chromosome analysis is a standard practice to unravel the etiology of MCA. Conventional cytogenetic method has limitation in detecting abe1rrations less than 5 Mb in size. Microarray technology could overcome this obstacle. The aim of this study is to develop diagnosis strategy of MCA cases. Methods Seventy two MCA cases were recruited from July 2013 until June 2014. Fifty one subjects were diagnosed phenotypically using OMIM and POSSUM databases. Subsequently, chromosome analysis were performed as a first step of diagnosis strategy. Nine cases among those subjects found to have chromosome aberrations, whereas twelve cases showed normal karyotypes. Eight subjects from the normal karyotype group have a good quality of DNA and proceed to microarray examination. Microarray examination were done at Department of Medical Genetics, UMC Utrecht, Netherlands, using Infinium CytoSNP-850K DNA analysis bead chip kit from Illumina. Chips were scanned using Hi-scan scanner from Illumina. Data were extracted using genome studio software. Data were analyzed using Nexus software. Results Nine out of twenty cases were found to have chromosome aberrations. Those aberrations are:46,XY,add(13)(q34); 46,XY,6 Mar, 17 dmin; 46,XX,r(4)(p16q35); 46,XY,22ps+; 46,XY,add(5)(p15); 47,XX+G; 46,XX/45XX Rob (13,15/q10.2,q10), 45XX Rob (13,14)(q10,q10); 46,XX, ring 13; 45,XY,der(2)del(2)(q37.3)t(2;15)(q37.2;q11.2). Five out of eight subjects which tested by microarray showed normal array. Two subjects showed well known deletion syndrome, which are Wolf-Hirschhorn syndrome and Williams-Beuren syndrome. One case has normal array with

  5. Comparative analysis of laparoscopic low rectal resections

    Directory of Open Access Journals (Sweden)

    I. L. Chernikovsky

    2015-07-01

    Full Text Available Objective: to study the immediate results of laparoscopic intersphincteric resection (ISR and ultralow anterior resection (ULAR of the rectum.Subjects and methods. The results of surgical treatment in 42 patients operated on in the Saint Petersburg Clinical Research-Practical Center for Specialized Medical (Oncology Cares in March 2014 to January 2015 are given. The inclusion criteria were the lower edge of cT1–3N0 adenocarcinoma 2-5 cm above the dentate line and no signs of invasion into the sphincter and levators. All the patients were divided into 2 groups: 1 24 patients who had undergone laparoscopic ISR; 2 18 patients who had laparoscopic ULAR. Both groups were matched for gender, age, body mass index, and CR-POSSUM predicted mortality scores. Thirty-two patients received neoadjuvant chemoradiotherapy. Results. The mean duration of operations did not differ significantly in the groups: 206 ± 46 and 216 ± 24 min (р = 0.72. The differences in the mean volume of blood loss were also insignificant: 85 and 113 ml (р = 0.93. Circular and distal resection margins were intact in all the cases. In 18 (75 % patients in Group 1 and in 14 (77.8 % patients in Group 2, the quality of total mesorectumectomy (TME was rated as grade 3 according to the Quirk criteria (p = 0.83. In Group 1, complications requiring no reoperation occurred in 5 (20.8 % cases: anastomotic incompetence in 3 (12.5 % cases, anastomotic stricture with further bougienage in 1 (4.2 %, and urinary retention in 1 (4.2 %. In Group 2, postoperative coтplications were also observed in 5 (27.8 % cases: necrosis of the brought-out bowel in 2 (11.1 % patients and coloanal incompetence in 1 (5.6 % required reoperation; 2 (11.1 % patients underwent bougienage due to established anastomotic stricture. One month postoperatively, the Wexner constipation scoring system was used to rate the degree of encopresis: anal incontinence turned out to be significantly higher in Group 2 and amounted

  6. Initial serum lactate level as predictor of morbidity after major abdominal surgery%腹部大手术后首次动脉血乳酸浓度对患者并发症的预测价值

    Institute of Scientific and Technical Information of China (English)

    李声华; 刘芬; 张应天; 赵文辉

    2008-01-01

    Objective To evaluate the value of immediate postoperative arterial lactate level to predict morbidity after major abdominal surgery. Methods 139 patients,73 males and 66 females, aged (64 ±14)(26-87), who underwent major abdominal surgery had their levels of arterial lactate, blood routine, blood gas and electrolytes measured after they were sent to the ICU. The physiological and operative severity score for the enumeration of mortality and morbidity (POSSUM) and the simplified acute physiology score Ⅱ (SAPS Ⅱ ) levels in the first 24-hour postoperative period were calculated Multivariate logistic regression analysis was utilized to examine the independent relationship of the initial lactate, blood gas values, and anion gap with the morbidity. Results Sixty-one cases of postoperative complications were recorded in the 47 patients (34%). The median initial lactate level of the patients with postoperative complications was 1.7 retool/L, significantly higher than that of the patients without complication (1.2mmol/L,P=0.001). Multivariate analysis showed that lactate level (odds ratio:1.81, 95% confidence interval:1.14-2.89;P=0.013)and Simplified Acute Physiology Score Ⅱ (SAPS Ⅱ (odds rstio:l.14;95% confidence interval:1.08-1.21, P < 0.001) were significantly predictive of postoperative morbidity. The optimal value of lactate to discriminate between the patients who did or did not develop postoperative complications was 2.7 mmol/L as associated with the highest sum of sensitivity and specificity (29.8% and 95.7% respectively). The lactate level more than 2.7 mmol/L was associated with 9.3-fold-higher odds for postoperative complications (95% confidence interval:2.9-30. 4, P< 0.001 ). After adjustment for SAP Ⅱ, the lactate level 2.7 mmol/L remained strongly associated with morbidity (odds ratio:5.9; 95% confidence interval:1.6-21.7; P=0.007). Conclusion Initial serum lactate level is significantly associated with postoperative complications and can