WorldWideScience

Sample records for brugia malayi larvae

  1. Infective Larvae of Brugia malayi Induce Polarization of Host Macrophages that Helps in Immune Evasion

    Directory of Open Access Journals (Sweden)

    Aditi Sharma

    2018-02-01

    Full Text Available Filarial parasites suppress, divert, or polarize the host immune response to aid their survival. However, mechanisms that govern the polarization of host MΦs during early filarial infection are not completely understood. In this study, we infected BALB/c mice with infective larvae stage-3 of Brugia malayi (Bm-L3 and studied their effect on the polarization of splenic MΦs. Results showed that MΦs displayed M2-phenotype by day 3 p.i. characterized by upregulated IL-4, but reduced IL-12 and Prostaglandin-D2 secretion. Increased arginase activity, higher arginase-1 but reduced NOS2 expression and poor phagocytic and antigen processing capacity was also observed. M2 MΦs supported T-cell proliferation and characteristically upregulated p-ERK but downregulated NF-κB-p65 and NF-κB-p50/105. Notably, Bm-L3 synergized with host regulatory T-cells (Tregs and polarized M2 MΦs to regulatory MΦs (Mregs by day 7 p.i., which secreted copious amounts of IL-10 and prostaglandin-E2. Mregs also showed upregulated expression levels of MHC-II, CD80, and CD86 and exhibited increased antigen-processing capacity but displayed impaired activation of NF-κB-p65 and NF-κB-p50/105. Neutralization of Tregs by anti-GITR + anti-CD25 antibodies checked the polarization of M2 MΦs to Mregs, decreased accumulation of regulatory B cells and inflammatory monocytes, and reduced secretion of IL-10, but enhanced IL-4 production and percentages of eosinophils, which led to Bm-L3 killing. In summary, we report hitherto undocumented effects of early Bm-L3 infection on the polarization of splenic MΦs and show how infective larvae deftly utilize the functional plasticity of host MΦs to establish themselves inside the host.

  2. Distribution of Brugia malayi larvae and DNA in vector and non-vector mosquitoes: implications for molecular diagnostics

    Directory of Open Access Journals (Sweden)

    Christensen Bruce M

    2009-11-01

    Full Text Available Abstract Background The purpose of this study was to extend prior studies of molecular detection of Brugia malayi DNA in vector (Aedes aegypti- Liverpool and non-vector (Culex pipiens mosquitoes at different times after ingestion of infected blood. Results Parasite DNA was detected over a two week time course in 96% of pooled thoraces of vector mosquitoes. In contrast, parasite DNA was detected in only 24% of thorax pools from non-vectors; parasite DNA was detected in 56% of midgut pools and 47% of abdomen pools from non-vectors. Parasite DNA was detected in vectors in the head immediately after the blood meal and after 14 days. Parasite DNA was also detected in feces and excreta of the vector and non-vector mosquitoes which could potentially confound results obtained with field samples. However, co-housing experiments failed to demonstrate transfer of parasite DNA from infected to non-infected mosquitoes. Parasites were also visualized in mosquito tissues by immunohistololgy using an antibody to the recombinant filarial antigen Bm14. Parasite larvae were detected consistently after mf ingestion in Ae. aegypti- Liverpool. Infectious L3s were seen in the head, thorax and abdomen of vector mosquitoes 14 days after Mf ingestion. In contrast, parasites were only detected by histology shortly after the blood meal in Cx. pipiens, and these were not labeled by the antibody. Conclusion This study provides new information on the distribution of filarial parasites and parasite DNA in vector and non-vector mosquitoes. This information should be useful for those involved in designing and interpreting molecular xenomonitoring studies.

  3. Maternal influence on susceptibility of offspring to Brugia malayi infection in a murine model of filariasis.

    Science.gov (United States)

    Rajan, T V; Bailis, J M; Yates, J A; Shultz, L D; Greiner, D L; Nelson, F K

    1994-12-01

    We have used the severe combined immunodeficient C.B-17-scid/scid mouse to investigate the influences of maternal immune status and parasite burden on the susceptibility (or resistance) of offspring to infection with the human filarial parasite, Brugia malayi. C.B-17-scid/scid mice are permissive for infection while immunocompetent C.B-17(-)+/+ mice are uniformly resistant. Reciprocal matings of C.B-17-scid/scid and C.B-17(-)+/+ mice were performed. The C.B-17-scid/scid females were either naive or infected with Brugia malayi. The resulting immunocompetent C.B-17-scid/+ and C.B-17(-)+/scid progeny were challenged at weaning with an intraperitoneal injection of Brugia malayi third stage larvae known to produce patent infection in > 95% of C.B-17-scid/scid mice. We observed that 40.0%l (34/85) of the immunocompetent offspring of C.B-17-scid/scid females x C.B-17(-)+/+ males were permissive for the growth and development of Brugia malayi larvae to adults. No difference was observed in susceptibility to infection between the progeny of infected or uninfected C.B-17-scid/scid mothers mated with C.B-17(-)+/+ fathers, arguing against acquired immunological tolerance to the parasite in the former. In marked contrast, only 4.8% (2/42) of the heterozygous progeny of wild type C.B-17(-)+/+ females mated with C.B-17-scid/scid males were permissive. These observations document conversion of a 'resistant' phenotype to a 'susceptible' phenotype by manipulation of maternal immune status and provide clear evidence of maternal influence on offspring susceptibility to infection with Brugia malayi.

  4. In vitro silencing of Brugia malayi trehalose-6-phosphate phosphatase impairs embryogenesis and in vivo development of infective larvae in jirds.

    Directory of Open Access Journals (Sweden)

    Susheela Kushwaha

    Full Text Available The trehalose metabolic enzymes have been considered as potential targets for drug or vaccine in several organisms such as Mycobacterium, plant nematodes, insects and fungi due to crucial role of sugar trehalose in embryogenesis, glucose uptake and protection from stress. Trehalose-6-phosphate phosphatase (TPP is one of the enzymes of trehalose biosynthesis that has not been reported in mammals. Silencing of tpp gene in Caenorhabditis elegans revealed an indispensable functional role of TPP in nematodes.In the present study, functional role of B. malayi tpp gene was investigated by siRNA mediated silencing which further validated this enzyme to be a putative antifilarial drug target. The silencing of tpp gene in adult female B. malayi brought about severe phenotypic deformities in the intrauterine stages such as distortion and embryonic development arrest. The motility of the parasites was significantly reduced and the microfilarial production as well as their in vitro release from the female worms was also drastically abridged. A majority of the microfilariae released in to the culture medium were found dead. B. malayi infective larvae which underwent tpp gene silencing showed 84.9% reduced adult worm establishment after inoculation into the peritoneal cavity of naïve jirds.The present findings suggest that B. malayi TPP plays an important role in the female worm embryogenesis, infectivity of the larvae and parasite viability. TPP enzyme of B. malayi therefore has the potential to be exploited as an antifilarial drug target.

  5. Deteksi Brugia malayi pada Armigeres subalbatus dan Culex quinquefasciatusyang diinfeksikan darah penderita filariasis dengan metode PCR

    Directory of Open Access Journals (Sweden)

    Yahya Yahya

    2015-01-01

    Full Text Available Abstract. Pemayungdistricts, Batanghari regency of Jambi province classified as filariasis endemic areas in Jambi province since the Mf rate reached 1.5% in 2011. A study was conducted to identify Brugia malayi on experimentally infected Ar. subalbatus and Cx. quinquefasciatus. An experimental study was performed with completely randomized design and six repetitions. Standard of treatment in this study was time (hours that selected for mosquitoes to bite the patients with filariasis (experimental infection. Selected time is at 9.00 a.m, 5.00 p.m, 9.00 p.m, and at 1.00 a.m. The results showed that filarial L3 larvae did not found on Ar. subalbatus and Cx. quinquefasciatus mosquitoes during surgery at day 11th to 13th after infection. Density of microfilariae in the blood of humans as a source of infection was 17 microfilariae per 20 micro liter blood. Otherwise, after detection by PCR, our study found positive B.malayi on Cx. quinquefasciatus thorax and proboscis. It indicates that Cx. quinquefasciatusas potential vector of B.malayi filariasis compared to Ar. subalbatus. Keywords: PCR, filariasis, Armigeres subalbatus, Culex quinquefasciatus, Brugia malayi   Abstrak. Kecamatan Pemayung Kabupaten Batanghari Provinsi Jambi merupakan wilayah endemis filariasis di Provinsi Jambi Karena angka Mf rate mencapai 1,5% pada tahun 2011. Penelitian ini untuk mengetahui tingkat kerentanan nyamuk Ar. subalbatus dan Cx. quinquefasciatus terhadap infeksi B. malayi subperiodik nokturna yang dilakukan pada tahun 2013, sehingga dapat dianalisis potensi nyamuk tersebut sebagai vektor filariasis di lokasi penelitian. Desain penelitian adalah eksperimental dengan rancangan acak lengkap dan enam kali pengulangan. Variabel perlakuan dalam penelitian ini adalah waktu (jam yang dipilih untuk menggigitkan nyamuk pada penderita filariasis (infeksi percobaan. Waktu yang dipilih adalah pukul 09.00 WIB, pukul 17.00 WIB, pukul 21.00 WIB dan pukul 01.00 WIB. Hasil penelitian

  6. Detection of a new focus of Brugia malayi infection in Orissa.

    Science.gov (United States)

    Rath, R N; Mohapatra, B N; Das, B

    1989-03-01

    526 people were surveyed in a village called Chudamani, in Balasore district of Orissa, for detection of asymptomatic microfilaria (mf) carriers. Of these 36 (6.8 per cent) were cases found to harbour mf; 19 cases had Brugia malayi, 4 Wuchereria bancrofti and 5 cases had mixed infection. In 8 cases, species could not be ascertained. For the first time after 1955, a focus of B. malayi has been detected in Orissa.

  7. The solution structure of the forkhead box-O DNA binding domain of Brugia malayi DAF-16a.

    Science.gov (United States)

    Casper, Sarah K; Schoeller, Scott J; Zgoba, Danielle M; Phillips, Andrew J; Morien, Thomas J; Chaffee, Gary R; Sackett, Peter C; Peterson, Francis C; Crossgrove, Kirsten; Veldkamp, Christopher T

    2014-12-01

    Brugia malayi is a parasitic nematode that causes lymphatic filariasis in humans. Here the solution structure of the forkhead DNA binding domain of Brugia malayi DAF-16a, a putative ortholog of Caenorhabditis elegans DAF-16, is reported. It is believed to be the first structure of a forkhead or winged helix domain from an invertebrate. C. elegans DAF-16 is involved in the insulin/IGF-I signaling pathway and helps control metabolism, longevity, and development. Conservation of sequence and structure with human FOXO proteins suggests that B. malayi DAF-16a is a member of the FOXO family of forkhead proteins. © 2014 Wiley Periodicals, Inc.

  8. Detection of human filarial parasite Brugia malayi in dogs by histochemical staining and molecular techniques.

    Science.gov (United States)

    Ambily, V R; Pillai, Usha Narayana; Arun, R; Pramod, S; Jayakumar, K M

    2011-09-27

    Human filariasis caused by Brugia malayi is still a public health problem in many countries of Asia including India, Indonesia, Malaysia and Thailand. The World Health Organization (WHO) has targeted to eliminate filariasis by the year 2020 by Mass annual single dose Diethylcarbamazine Administration (MDA). Results of the MDA programme after the first phase was less satisfactory than expected. Malayan filariasis caused by B. malayi is endemic in the south of Thailand where domestic cat serves as the major reservoir host. There is no report about the occurrence of B. malayi in dogs. The present work was carried out to find out the incidence of microfilariasis in dogs and also to detect the presence of human filarial infection in dogs, if any. One hundred dogs above 6 months of age presented to the veterinary college Hospital, Mannuthy, Kerala, with clinical signs suggestive of microfilariasis - fever, anorexia, conjunctivitis, limb and scrotal oedema - were screened for microfilariae by wet film examination. Positive cases were subjected to Giemsa staining, histochemical staining and molecular techniques. Results of the study showed that 80% of dogs had microfilariasis; out of which 20% had sheathed microfilaria. Giemsa and histochemical staining character, PCR and sequencing confirmed it as B. malayi. High prevalence of B. malayi in dogs in this study emphasized the possible role of dogs in transmission of human filariasis. Copyright © 2011 Elsevier B.V. All rights reserved.

  9. Mining predicted essential genes of Brugia malayi for nematode drug targets.

    Directory of Open Access Journals (Sweden)

    Sanjay Kumar

    Full Text Available We report results from the first genome-wide application of a rational drug target selection methodology to a metazoan pathogen genome, the completed draft sequence of Brugia malayi, a parasitic nematode responsible for human lymphatic filariasis. More than 1.5 billion people worldwide are at risk of contracting lymphatic filariasis and onchocerciasis, a related filarial disease. Drug treatments for filariasis have not changed significantly in over 20 years, and with the risk of resistance rising, there is an urgent need for the development of new anti-filarial drug therapies. The recent publication of the draft genomic sequence for B. malayi enables a genome-wide search for new drug targets. However, there is no functional genomics data in B. malayi to guide the selection of potential drug targets. To circumvent this problem, we have utilized the free-living model nematode Caenorhabditis elegans as a surrogate for B. malayi. Sequence comparisons between the two genomes allow us to map C. elegans orthologs to B. malayi genes. Using these orthology mappings and by incorporating the extensive genomic and functional genomic data, including genome-wide RNAi screens, that already exist for C. elegans, we identify potentially essential genes in B. malayi. Further incorporation of human host genome sequence data and a custom algorithm for prioritization enables us to collect and rank nearly 600 drug target candidates. Previously identified potential drug targets cluster near the top of our prioritized list, lending credibility to our methodology. Over-represented Gene Ontology terms, predicted InterPro domains, and RNAi phenotypes of C. elegans orthologs associated with the potential target pool are identified. By virtue of the selection procedure, the potential B. malayi drug targets highlight components of key processes in nematode biology such as central metabolism, molting and regulation of gene expression.

  10. Effects of Doxycycline on gene expression in Wolbachia and Brugia malayi adult female worms in vivo

    Directory of Open Access Journals (Sweden)

    Rao Ramakrishna U

    2012-02-01

    Full Text Available Abstract Background Most filarial nematodes contain Wolbachia symbionts. The purpose of this study was to examine the effects of doxycycline on gene expression in Wolbachia and adult female Brugia malayi. Methods Brugia malayi infected gerbils were treated with doxycycline for 6-weeks. This treatment largely cleared Wolbachia and arrested worm reproduction. RNA recovered from treated and control female worms was labeled by random priming and hybridized to the Version 2- filarial microarray to obtain expression profiles. Results and discussion Results showed significant changes in expression for 200 Wolbachia (29% of Wolbachia genes with expression signals in untreated worms and 546 B. malayi array elements after treatment. These elements correspond to known genes and also to novel genes with unknown biological functions. Most differentially expressed Wolbachia genes were down-regulated after treatment (98.5%. In contrast, doxycycline had a mixed effect on B. malayi gene expression with many more genes being significantly up-regulated after treatment (85% of differentially expressed genes. Genes and processes involved in reproduction (gender-regulated genes, collagen, amino acid metabolism, ribosomal processes, and cytoskeleton were down-regulated after doxycycline while up-regulated genes and pathways suggest adaptations for survival in response to stress (energy metabolism, electron transport, anti-oxidants, nutrient transport, bacterial signaling pathways, and immune evasion. Conclusions Doxycycline reduced Wolbachia and significantly decreased bacterial gene expression. Wolbachia ribosomes are believed to be the primary biological target for doxycycline in filarial worms. B. malayi genes essential for reproduction, growth and development were also down-regulated; these changes are consistent with doxycycline effects on embryo development and reproduction. On the other hand, many B. malayi genes involved in energy production, electron

  11. Defining Brugia malayi and Wolbachia symbiosis by stage-specific dual RNA-seq.

    Directory of Open Access Journals (Sweden)

    Alexandra Grote

    2017-03-01

    Full Text Available Filarial nematodes currently infect up to 54 million people worldwide, with millions more at risk for infection, representing the leading cause of disability in the developing world. Brugia malayi is one of the causative agents of lymphatic filariasis and remains the only human filarial parasite that can be maintained in small laboratory animals. Many filarial nematode species, including B. malayi, carry an obligate endosymbiont, the alpha-proteobacteria Wolbachia, which can be eliminated through antibiotic treatment. Elimination of the endosymbiont interferes with development, reproduction, and survival of the worms within the mamalian host, a clear indicator that the Wolbachia are crucial for survival of the parasite. Little is understood about the mechanism underlying this symbiosis.To better understand the molecular interplay between these two organisms we profiled the transcriptomes of B. malayi and Wolbachia by dual RNA-seq across the life cycle of the parasite. This helped identify functional pathways involved in this essential symbiotic relationship provided by the co-expression of nematode and bacterial genes. We have identified significant stage-specific and gender-specific differential expression in Wolbachia during the nematode's development. For example, during female worm development we find that Wolbachia upregulate genes involved in ATP production and purine biosynthesis, as well as genes involved in the oxidative stress response.This global transcriptional analysis has highlighted specific pathways to which both Wolbachia and B. malayi contribute concurrently over the life cycle of the parasite, paving the way for the development of novel intervention strategies.

  12. Suppression of Brugia malayi (sub-periodic larval development in Aedes aegypti (Liverpool strain fed on blood of animals immunized with microfilariae

    Directory of Open Access Journals (Sweden)

    K Athisaya Mary

    2005-07-01

    Full Text Available Preliminary studies were carried out to investigate the role of filarial specific antibodies, raised in an animal model against the filarial parasite, Brugia malayi (sub-periodic, in blocking their early development in an experimental mosquito host, Aedes aegypti (Liverpool strain. In order to generate filarial specific antibodies, Mongolian gerbils, Meriones unguiculatus, were immunized either with live microfilariae (mf of B. malayi or their homogenate. Mf were harvested from the peritoneal cavity of Mongolian gerbils with patent infection of B. malayi and fed to A. aegypti along with the blood from immunized animals. Development of the parasite in infected mosquitoes was monitored until they reached infective stage larvae (L3. Fewer number of parasites developed to first stage (L1 and subsequently to L2 and L3 in mosquitoes fed with blood of immunized animals, when compared to those fed with blood of control animals. The results thus indicated that filarial parasite specific antibodies present in the blood of the immunized animals resulted in the reduction of number of larvae of B. malayi developing in the mosquito host.

  13. Transcriptomes and pathways associated with infectivity, survival and immunogenicity in Brugia malayi L3

    Directory of Open Access Journals (Sweden)

    Spiro David

    2009-06-01

    Full Text Available Abstract Background Filarial nematode parasites cause serious diseases such as elephantiasis and river blindness in humans, and heartworm infections in dogs. Third stage filarial larvae (L3 are a critical stage in the life cycle of filarial parasites, because this is the stage that is transmitted by arthropod vectors to initiate infections in mammals. Improved understanding of molecular mechanisms associated with this transition may provide important leads for development of new therapies and vaccines to prevent filarial infections. This study explores changes in gene expression associated with the transition of Brugia malayi third stage larvae (BmL3 from mosquitoes into mammalian hosts and how these changes are affected by radiation. Radiation effects are especially interesting because irradiated L3 induce partial immunity to filarial infections. The underlying molecular mechanisms responsible for the efficacy of such vaccines are unkown. Results Expression profiles were obtained using a new filarial microarray with 18, 104 64-mer elements. 771 genes were identified as differentially expressed in two-way comparative analyses of the three L3 types. 353 genes were up-regulated in mosquito L3 (L3i relative to cultured L3 (L3c. These genes are important for establishment of filarial infections in mammalian hosts. Other genes were up-regulated in L3c relative to L3i (234 or irradiated L3 (L3ir (22. These culture-induced transcripts include key molecules required for growth and development. 165 genes were up-regulated in L3ir relative to L3c; these genes encode highly immunogenic proteins and proteins involved in radiation repair. L3ir and L3i have similar transcription profiles for genes that encode highly immunogenic proteins, antioxidants and cuticle components. Conclusion Changes in gene expression that normally occur during culture under conditions that support L3 development and molting are prevented or delayed by radiation. This may explain

  14. Inventory and analysis of ATP-binding cassette (ABC) systems in Brugia malayi.

    Science.gov (United States)

    Ardelli, B F; Stitt, L E; Tompkins, J B

    2010-07-01

    ABC systems are one of the largest described protein superfamilies. These systems have a domain organization that may contain 1 or more transmembrane domains (ABC_TM1F) and 1 or 2 ATP-binding domains (ABC_2). The functions (e.g., import, export and DNA repair) of these proteins distinguish the 3 classes of ABC systems. Mining and PCR-based cloning were used to identify 33 putative ABC systems from the Brugia malayi genome. There were 31 class 2 genes, commonly called ABC transporters, and 2 class 3 genes. The ABC transporters were divided into subfamilies. Three belonged to subfamily A, 16 to subfamily B, 5 to subfamily C, 1 to subfamily E and 3 to subfamilies F and G, respectively. None were placed in subfamilies D and H. Similar to other ABC systems, the ABC_2 domain of B. malayi genes was conserved and contained the Walker A and B motifs, the signature sequence/linker region and the switch region with the conserved histidine. The ABC_TM1F domain was less conserved. The relative abundance of ABC systems was quantified using real-time reverse transcription PCR and was significantly higher in female adults of B. malayi than in males and microfilaria, particularly those in subfamilies B and C, which are associated with drug resistance.

  15. Brugia malayi excreted/secreted proteins at the host/parasite interface: stage- and gender-specific proteomic profiling.

    Directory of Open Access Journals (Sweden)

    Sasisekhar Bennuru

    Full Text Available Relatively little is known about the filarial proteins that interact with the human host. Although the filarial genome has recently been completed, protein profiles have been limited to only a few recombinants or purified proteins of interest. Here, we describe a large-scale proteomic analysis using microcapillary reverse-phase liquid chromatography-tandem-mass spectrometry to identify the excretory-secretory (ES products of the L3, L3 to L4 molting ES, adult male, adult female, and microfilarial stages of the filarial parasite Brugia malayi. The analysis of the ES products from adult male, adult female, microfilariae (Mf, L3, and molting L3 larvae identified 852 proteins. Annotation suggests that the functional and component distribution was very similar across each of the stages studied; however, the Mf contributed a higher proportion to the total number of identified proteins than the other stages. Of the 852 proteins identified in the ES, only 229 had previous confirmatory expressed sequence tags (ESTs in the available databases. Moreover, this analysis was able to confirm the presence of 274 "hypothetical" proteins inferred from gene prediction algorithms applied to the B. malayi (Bm genome. Not surprisingly, the majority (160/274 of these "hypothetical" proteins were predicted to be secreted by Signal IP and/or SecretomeP 2.0 analysis. Of major interest is the abundance of previously characterized immunomodulatory proteins such as ES-62 (leucyl aminopeptidase, MIF-1, SERPIN, glutathione peroxidase, and galectin in the ES of microfilariae (and Mf-containing adult females compared to the adult males. In addition, searching the ES protein spectra against the Wolbachia database resulted in the identification of 90 Wolbachia-specific proteins, most of which were metabolic enzymes that have not been shown to be immunogenic. This proteomic analysis extends our knowledge of the ES and provides insight into the host-parasite interaction.

  16. Brugia malayi microfilariae adhere to human vascular endothelial cells in a C3-dependent manner.

    Directory of Open Access Journals (Sweden)

    Jan-Hendrik Schroeder

    2017-05-01

    Full Text Available Brugia malayi causes the human tropical disease, lymphatic filariasis. Microfilariae (Mf of this nematode live in the bloodstream and are ingested by a feeding mosquito vector. Interestingly, in a remarkable co-evolutionary adaptation, Mf appearance in the peripheral blood follows a circadian periodicity and reaches a peak when the mosquito is most likely to feed. For the remaining hours, the majority of Mf sequester in the lung capillaries. This circadian phenomenon has been widely reported and is likely to maximise parasite fitness and optimise transmission potential. However, the mechanism of Mf sequestration in the lungs remains largely unresolved. In this study, we demonstrate that B. malayi Mf can, directly adhere to vascular endothelial cells under static conditions and under flow conditions, they can bind at high (but not low flow rates. High flow rates are more likely to be experienced diurnally. Furthermore, a non-periodic nematode adheres less efficiently to endothelial cells. Strikingly C3, the central component of complement, plays a crucial role in the adherence interaction. These novel results show that microfilariae have the ability to bind to endothelial cells, which may explain their sequestration in the lungs, and this binding is increased in the presence of inflammatory mediators.

  17. Live Brugia malayi microfilariae inhibit transendothelial migration of neutrophils and monocytes.

    Directory of Open Access Journals (Sweden)

    Jan-Hendrik Schroeder

    Full Text Available Lymphatic filariasis is a major tropical disease caused by the parasite Brugia malayi. Microfilariae (Mf circulate in the peripheral blood for 2-3 hours in synchronisation with maximal feeding of the mosquito vector. When absent from the peripheral blood, Mf sequester in the capillaries of the lungs. Mf are therefore in close contact with vascular endothelial cells (EC and may induce EC immune function and/or wound repair mechanisms such as angiogenesis. In this study, Mf were co-cultured with human umbilical vein EC (HUVEC or human lung microvascular EC (HLMVEC and the transendothelial migration of leukocyte subsets was analysed. In addition, the protein and/or mRNA expression of chemokine, cytokine and angiogenic mediators in endothelial cells in the presence of live microfilariae were measured by a combination of cDNA arrays, protein arrays, ELISA and fluorescence antibody tests.Surprisingly, our findings indicate that Mf presence partially blocked transendothelial migration of monocytes and neutrophils, but not lymphocytes. However, Mf exposure did not result in altered vascular EC expression of key mediators of the tethering stage of extravasation, such as ICAM-1, VCAM-1 and various chemokines. To further analyse the immunological function of vascular EC in the presence of Mf, we measured the mRNA and/or protein expression of a number of pro-inflammatory mediators. We found that expression levels of the mediators tested were predominantly unaltered upon B. malayi Mf exposure. In addition, a comparison of angiogenic mediators induced by intact Mf and Wolbachia-depleted Mf revealed that even intact Mf induce the expression of remarkably few angiogenic mediators in vascular EC. Our study suggests that live microfilariae are remarkably inert in their induction and/or activation of vascular cells in their immediate local environment. Overall, this work presents important insights into the immunological function of the vascular endothelium during

  18. The heme biosynthetic pathway of the obligate Wolbachia endosymbiont of Brugia malayi as a potential anti-filarial drug target.

    Directory of Open Access Journals (Sweden)

    Bo Wu

    2009-07-01

    Full Text Available Filarial parasites (e.g., Brugia malayi, Onchocerca volvulus, and Wuchereria bancrofti are causative agents of lymphatic filariasis and onchocerciasis, which are among the most disabling of neglected tropical diseases. There is an urgent need to develop macro-filaricidal drugs, as current anti-filarial chemotherapy (e.g., diethylcarbamazine [DEC], ivermectin and albendazole can interrupt transmission predominantly by killing microfilariae (mf larvae, but is less effective on adult worms, which can live for decades in the human host. All medically relevant human filarial parasites appear to contain an obligate endosymbiotic bacterium, Wolbachia. This alpha-proteobacterial mutualist has been recognized as a potential target for filarial nematode life cycle intervention, as antibiotic treatments of filarial worms harboring Wolbachia result in the loss of worm fertility and viability upon antibiotic treatments both in vitro and in vivo. Human trials have confirmed this approach, although the length of treatments, high doses required and medical counter-indications for young children and pregnant women warrant the identification of additional anti-Wolbachia drugs.Genome sequence analysis indicated that enzymes involved in heme biosynthesis might constitute a potential anti-Wolbachia target set. We tested different heme biosynthetic pathway inhibitors in ex vivo B. malayi viability assays and report a specific effect of N-methyl mesoporphyrin (NMMP, which targets ferrochelatase (FC, the last step. Our phylogenetic analysis indicates evolutionarily significant divergence between Wolbachia heme genes and their human homologues. We therefore undertook the cloning, overexpression and analysis of several enzymes of this pathway alongside their human homologues, and prepared proteins for drug targeting. In vitro enzyme assays revealed a approximately 600-fold difference in drug sensitivities to succinyl acetone (SA between Wolbachia and human 5

  19. Identification and characterization of nematode specific protective epitopes of Brugia malayi TRX towards development of synthetic vaccine construct for lymphatic filariasis.

    Science.gov (United States)

    Madhumathi, Jayaprakasam; Prince, Prabhu Rajaiah; Anugraha, Gandhirajan; Kiran, Pote; Rao, Donthamsetty Nageswara; Reddy, Maryada Venkata Rami; Kaliraj, Perumal

    2010-07-12

    Although multi-epitope vaccines have been evaluated for various diseases, they have not yet been investigated for lymphatic filariasis. Here, we report for the first time identification of two immunodominant B epitopes (TRXP1 and TRXP2) from the antioxidant Brugia malayi thioredoxin by studying their immune responses in mice model and human subjects. TRXP1 was also found to harbor a T epitope recognized by human PBMCs and mice splenocytes. Further, the epitopic peptides were synthesized as a single peptide conjugate (PC1) and their prophylactic efficacy was tested in a murine model of filariasis with L3 larvae. PC1 conferred a significantly high protection (75.14%) (P TRX (63.03%) (P < 0.018) in experimental filariasis. Our results suggest that multi-epitope vaccines could be a promising strategy in the control of lymphatic filariasis.

  20. Brugia malayi gene expression in response to the targeting of the Wolbachia endosymbiont by tetracycline treatment.

    Directory of Open Access Journals (Sweden)

    Elodie Ghedin

    2009-10-01

    Full Text Available Brugia malayi, like most human filarial parasite species, harbors an endosymbiotic bacterium of the genus Wolbachia. Elimination of the endosymbiont leads to sterilization of the adult female. Previous biochemical and genetic studies have established that communication with its endobacterium is essential for survival of the worm.We used electron microscopy to examine the effects of antibiotic treatment on Wolbachia cell structure. We have also used microarray and quantitative RT-PCR analyses to examine the regulation of the B. malayi transcripts altered in response to the anti-Wolbachia treatment. Microscopy of worms taken from animals treated with tetracycline for 14 and 21 days (14 d and 21 d demonstrated substantial morphologic effects on the Wolbachia endobacterium by 14 d and complete degeneration of the endobacterial structures by 21 d. We observed upregulation of transcripts primarily encoding proteins involved in amino acid synthesis and protein translation, and downregulation of transcripts involved in cuticle biosynthesis after both 7 d and 14 d of treatment. In worms exposed to tetracycline in culture, substantial effects on endobacteria morphology were evident by day 3, and extensive death of the endobacteria was observed by day 5. In a detailed examination of the expression kinetics of selected signaling genes carried out on such cultured worms, a bimodal pattern of regulation was observed. The selected genes were upregulated during the early phase of antibiotic treatment and quickly downregulated in the following days. These same genes were upregulated once more at 6 days post-treatment.Upregulation of protein translation and amino acid synthesis may indicate a generalized stress response induced in B. malayi due to a shortage of essential nutrients/factors that are otherwise supplied by Wolbachia. Downregulation of transcripts involved in cuticle biosynthesis perhaps reflects a disruption in the normal embryogenic program. This is

  1. Galactolipids from Bauhinia racemosa as a new class of antifilarial agents against human lymphatic filarial parasite, Brugia malayi.

    Science.gov (United States)

    Sashidhara, Koneni V; Singh, Suriya P; Misra, Sweta; Gupta, Jyoti; Misra-Bhattacharya, Shailja

    2012-04-01

    Bioassay guided fractionation of ethanolic extract of the leaves of Bauhinia racemosa led to the isolation of galactolipid and catechin class of the compounds (1-7) from the most active n-butanol fraction (F4). Among the active galactolipids, 1 emerged as the lead molecule which was active on both forms of lymphatic filarial parasite, Brugia malayi. It was found to be better than the standard drug ivermectin and diethylcarbamazine (DEC) in terms of dose and efficacy. Copyright © 2012 Elsevier Masson SAS. All rights reserved.

  2. Expression of five acetylcholine receptor subunit genes in Brugia malayi adult worms

    Directory of Open Access Journals (Sweden)

    Ben-Wen Li

    2015-12-01

    Full Text Available Acetylcholine receptors (AChRs are required for body movement in parasitic nematodes and are targets of “classical” anthelmintic drugs such as levamisole and pyrantel and of newer drugs such as tribendimidine and derquantel. While neurotransmission explains the effects of these drugs on nematode movement, their effects on parasite reproduction are unexplained. The levamisole AChR type (L-AChRs in Caenorhabditis elegans is comprised of five subunits: Cel-UNC-29, Cel-UNC-38, Cel-UNC-63, Cel-LEV-1 and Cel-LEV-8. The genome of the filarial parasite Brugia malayi contains nine AChRs subunits including orthologues of Cel-unc-29, Cel-unc-38, and Cel-unc-63. We performed in situ hybridization with RNA probes to localize the expression of five AChR genes (Bm1_35890-Bma-unc-29, Bm1_20330-Bma-unc-38, Bm1_38195-Bma-unc-63, Bm1_48815-Bma-acr-26 and Bm1_40515-Bma-acr-12 in B. malayi adult worms. Four of these genes had similar expression patterns with signals in body muscle, developing embryos, spermatogonia, uterine wall adjacent to stretched microfilariae, wall of Vas deferens, and lateral cord. Three L-AChR subunit genes (Bma-unc-29, Bma-unc-38 and Bma-unc-63 were expressed in body muscle, which is a known target of levamisole. Bma-acr-12 was co-expressed with these levamisole subunit genes in muscle, and this suggests that its protein product may form receptors with other alpha subunits. Bma-acr-26 was expressed in male muscle but not in female muscle. Strong expression signals of these genes in early embryos and gametes in uterus and testis suggest that AChRs may have a role in nervous system development of embryogenesis and spermatogenesis. This would be consistent with embryotoxic effects of drugs that target these receptors in filarial worms. Our data show that the expression of these receptor genes is tightly regulated with regard to localization in adult worms and developmental stage in embryos and gametes. These results may help to explain the

  3. Cofactor Independent Phosphoglycerate Mutase of Brugia malayi Induces a Mixed Th1/Th2 Type Immune Response and Inhibits Larval Development in the Host

    Directory of Open Access Journals (Sweden)

    Prashant K. Singh

    2014-01-01

    Full Text Available Lymphatic filariasis is a major debilitating disease, endemic in 72 countries putting more than 1.39 billion people at risk and 120 million are already infected. Despite the significant progress in chemotherapeutic advancements, there is still need for other measures like development of an effective vaccine or discovery of novel drug targets. In this study, structural and immunological characterization of independent phosphoglycerate mutase of filarial parasite Brugia malayi was carried out. Protein was found to be expressed in all major parasite life stages and as an excretory secretory product of adult parasites. Bm-iPGM also reacted to all the categories of human bancroftian patient’s sera including endemic normals. In vivo immunological behaviour of protein was determined in immunized BALB/c mice followed by prophylactic analysis in BALB/c mice and Mastomys coucha. Immunization with Bm-iPGM led to generation of a mixed Th1/Th2 type immune response offering 58.2% protection against larval challenge in BALB/c and 65–68% protection in M. coucha. In vitro studies confirmed participation of anti-Bm-iPGM antibodies in killing of B. malayi infective larvae and microfilariae through ADCC mechanism. The present findings reveal potential immunoprotective nature of Bm-iPGM advocating its worth as an antifilarial vaccine candidate.

  4. Profiling the macrofilaricidal effects of flubendazole on adult female Brugia malayi using RNAseq

    Directory of Open Access Journals (Sweden)

    Maeghan O'Neill

    2016-12-01

    Full Text Available The use of microfilaricidal drugs for the control of onchocerciasis and lymphatic filariasis (LF necessitates prolonged yearly dosing. Prospects for elimination or eradication of these diseases would be enhanced by the availability of a macrofilaricidal drug. Flubendazole (FLBZ, a benzimidazole anthelmintic, is an appealing candidate. FLBZ has demonstrated potent macrofilaricidal effects in a number of experimental rodent models and in one human trial. Unfortunately, FLBZ was deemed unsatisfactory for use in mass drug administration campaigns due to its limited oral bioavailability. A new formulation that enables sufficient bioavailability following oral administration could render FLBZ an effective treatment for onchocerciasis and LF. Identification of drug-derived effects is important in ascertaining a dosage regimen which is predicted to be lethal to the parasite in situ. In previous histological studies, exposure to FLBZ induced damage to tissues required for reproduction and survival at pharmacologically relevant concentrations. However, more precise and quantitative indices of drug effects are needed. This study assessed drug effects using a transcriptomic approach to confirm effects observed histologically and to identify genes which were differentially expressed in treated adult female Brugia malayi. Comparative analysis across different concentrations (1 μM and 5 μM and durations (48 and 120 h provided an overview of the processes which are affected by FLBZ exposure. Genes with dysregulated expression were consistent with the reproductive effects observed via histology in our previous studies. This study revealed transcriptional changes in genes involved in embryo development. Additionally, significant downregulation was observed in genes encoding cuticle components, which may reflect changes in developing embryos, the adult worm cuticle or both. These data support the hypothesis that FLBZ acts predominantly on rapidly dividing

  5. Production of Brugia malayi BmSXP Recombinant Protein Expressed in Escherichia coli

    Directory of Open Access Journals (Sweden)

    Khoo, T. K.

    2010-01-01

    Full Text Available A rapid antibody detection test is very useful for detection of lymphatic filariasis, especially for certification and surveillance of post-mass drug administration. One such kit, panLF RapidTM (commercialized by Malaysian BioDiagnostic Research Sdn. Bhd. had been developed in our laboratory for the detection of all species of filarial infections. It is based on the detection of anti-filarial IgG4 antibodies that react with recombinant Brugia malayi antigens, BmR1 and BmSXP. In this study, the growth of recombinant bacteria that produce BmSXP was optimized under shake flask fermentation for high yield of the recombinant antigen. The optimizations involved selection of suitable growth medium, IPTG concentration and induction time. The medium that yielded the highest biomass as well as total protein was Terrific Broth (TB medium, which is an undefined medium. Initiation of induction of protein expression was found to be best at mid-log phase (OD600 = 1.5, with IPTG concentration of 1.0 mM, and harvest time at 9 h post-induction. This study showed that under the optimized conditions, the shake flask culture produced 4 g/L biomass (dry cell weight of recombinant Escherichia coli BmSXP/pPROEXHTa/TOP10F’, which yielded 2.42 mg/L of purified BmSXP recombinant antigen. The purified antigen was analyzed by SDS-PAGE and the antigenicity of protein was confirmed by Western blot.

  6. Stage- and gender-specific proteomic analysis of Brugia malayi excretory-secretory products.

    Directory of Open Access Journals (Sweden)

    Yovany Moreno

    Full Text Available INTRODUCTION: While we lack a complete understanding of the molecular mechanisms by which parasites establish and achieve protection from host immune responses, it is accepted that many of these processes are mediated by products, primarily proteins, released from the parasite. Parasitic nematodes occur in different life stages and anatomical compartments within the host. Little is known about the composition and variability of products released at different developmental stages and their contribution to parasite survival and progression of the infection. METHODOLOGY/PRINCIPAL FINDINGS: To gain a deeper understanding on these aspects, we collected and analyzed through 1D-SDS PAGE and LC-MS/MS the Excretory-Secretory Products (ESP of adult female, adult male and microfilariae of the filarial nematode Brugia malayi, one of the etiological agents of human lymphatic filariasis. This proteomic analysis led to the identification of 228 proteins. The list includes 76 proteins with unknown function as well as also proteins with potential immunoregulatory properties, such as protease inhibitors, cytokine homologues and carbohydrate-binding proteins. Larval and adult ESP differed in composition. Only 32 proteins were shared between all three stages/genders. Consistent with this observation, different gene ontology profiles were associated with the different ESP. CONCLUSIONS/SIGNIFICANCE: A comparative analysis of the proteins released in vitro by different forms of a parasitic nematode dwelling in the same host is presented. The catalog of secreted proteins reflects different stage- and gender-specific related processes and different strategies of immune evasion, providing valuable insights on the contribution of each form of the parasite for establishing the host-parasite interaction.

  7. Tissue and stage-specific distribution of Wolbachia in Brugia malayi.

    Directory of Open Access Journals (Sweden)

    Kerstin Fischer

    2011-05-01

    Full Text Available BACKGROUND: Most filarial parasite species contain Wolbachia, obligatory bacterial endosymbionts that are crucial for filarial development and reproduction. They are targets for alternative chemotherapy, but their role in the biology of filarial nematodes is not well understood. Light microscopy provides important information on morphology, localization and potential function of these bacteria. Surprisingly, immunohistology and in situ hybridization techniques have not been widely used to monitor Wolbachia distribution during the filarial life cycle. METHODS/PRINCIPAL FINDINGS: A monoclonal antibody directed against Wolbachia surface protein and in situ hybridization targeting Wolbachia 16S rRNA were used to monitor Wolbachia during the life cycle of B. malayi. In microfilariae and vector stage larvae only a few cells contain Wolbachia. In contrast, large numbers of Wolbachia were detected in the lateral chords of L4 larvae, but no endobacteria were detected in the genital primordium. In young adult worms (5 weeks p.i., a massive expansion of Wolbachia was observed in the lateral chords adjacent to ovaries or testis, but no endobacteria were detected in the growth zone of the ovaries, uterus, the growth zone of the testis or the vas deferens. Confocal laser scanning and transmission electron microscopy showed that numerous Wolbachia are aligned towards the developing ovaries and single endobacteria were detected in the germline. In inseminated females (8 weeks p.i. Wolbachia were observed in the ovaries, embryos and in decreasing numbers in the lateral chords. In young males Wolbachia were found in distinct zones of the testis and in large numbers in the lateral chords in the vicinity of testicular tissue but never in mature spermatids or spermatozoa. CONCLUSIONS: Immunohistology and in situ hybridization show distinct tissue and stage specific distribution patterns for Wolbachia in B. malayi. Extensive multiplication of Wolbachia occurs in the

  8. Comparison of an enzyme linked immunosorbent assay (ELISA) and a radioallergosorbent test (RAST) for detection of IgE antibodies to Brugia malayi

    NARCIS (Netherlands)

    Wahyuni, Sitti; van Ree, Ronald; Mangali, Andarias; Supali, Taniawati; Yazdanbakhsh, Maria; Sartono, Erliyani

    2003-01-01

    The enzyme linked immunosorbent assay (ELISA) for specific IgE antibodies to Brugia malayi was compared with the radioallergosorbent test (RAST) for use in immunoepidemiological studies of lymphatic filariasis. Sera used were from individuals (aged 5-82 years) living in an area endemic for lymphatic

  9. Poly(d,l)-lactide-co-glycolide (PLGA) microspheres as immunoadjuvant for Brugia malayi antigens.

    Science.gov (United States)

    Saini, Vinay; Verma, Shiv Kumar; Murthy, P Kalpana; Kohli, Dharmveer

    2013-08-28

    Recently we identified in Brugia malayi adult worm extract (BmA) a pro-inflammatory 54-68kDa SDS-PAGE resolved fraction F6 that protects the host from the parasite via Th1/Th2 type responses. We are currently investigating F6 as a potential source of vaccine candidate(s) and the present study is aimed at investigating the suitability of poly(d,l)-lactide-co-glycolide microspheres (PLGA-Ms) as immunoadjuvant for the antigen administration in a single dose. PLGA-Ms were prepared aseptically by a modified double emulsion (w/o/w) solvent evaporation technique and their size, shape, antigen adsorption efficiency, in-process stability, and antigen release were characterized. Swiss mice were immunized by a single subcutaneous administration of BmA and F6 adsorbed on PLGA-Ms (lactide:glycolide ratios 50:50 and 75:25) and the immune responses were compared with administration of 1 or 2 doses of plain BmA and F6. Specific IgG, IgG1, IgG2a, IgG2b, IgE levels in serum, cellular-proliferative response and release of IFN-γ, TNF-α and nitric oxide from the cells of immunized host in response to the antigens/LPS/Con A challenge and antibody-dependant cellular cytotoxicity (ADCC) to parasite life stages were determined. The average size of PLGA-Ms 50:50 was smaller than the size of PLGA-Ms 75:25 and the % antigen adsorption efficiency of PLGA-Ms 50:50 was greater than PLGA-Ms 75:25. Single shot injection of PLGA-Ms 50:50/75:25-BmA/F6 produced better and stronger IgG, IgG1/IgG2a and cell-mediated immune responses than even two injections of plain BmA or F6. Further, PLGA-Ms 50:50-F6 produced stronger responses than PLGA-Ms 50:50-BmA. Anti-PLGA-Ms 50:50-F6 antibodies elicited higher ADCC response to infective larval and microfilarial stages of the parasite than anti-PLGA-Ms 75:25-F6 antibodies. The findings demonstrate that PLGA-Ms 50:50 is an excellent adjuvant for use with F6 in a single administration. This is the first ever report on PLGA as immunoadjuvant for filarial antigens

  10. Immunization of Mastomys coucha with Brugia malayi recombinant trehalose-6-phosphate phosphatase results in significant protection against homologous challenge infection.

    Directory of Open Access Journals (Sweden)

    Susheela Kushwaha

    Full Text Available Development of a vaccine to prevent or reduce parasite development in lymphatic filariasis would be a complementary approach to existing chemotherapeutic tools. Trehalose-6-phosphate phosphatase of Brugia malayi (Bm-TPP represents an attractive vaccine target due to its absence in mammals, prevalence in the major life stages of the parasite and immunoreactivity with human bancroftian antibodies, especially from endemic normal subjects. We have recently reported on the cloning, expression, purification and biochemical characterization of this vital enzyme of B. malayi. In the present study, immunoprophylactic evaluation of Bm-TPP was carried out against B. malayi larval challenge in a susceptible host Mastomys coucha and the protective ability of the recombinant protein was evaluated by observing the adverse effects on microfilarial density and adult worm establishment. Immunization caused 78.4% decrease in microfilaremia and 71.04% reduction in the adult worm establishment along with sterilization of 70.06% of the recovered live females. The recombinant protein elicited a mixed Th1/Th2 type of protective immune response as evidenced by the generation of both pro- and anti-inflammatory cytokines IL-2, IFN-γ, TNF-α, IL-4 and an increased production of antibody isotypes IgG1, IgG2a, IgG2b and IgA. Thus immunization with Bm-TPP conferred considerable protection against B. malayi establishment by engendering a long-lasting effective immune response and therefore emerges as a potential vaccine candidate against lymphatic filariasis (LF.

  11. The role of polymorphisms in the spliced leader addition domain in determining promoter activity in Brugia malayi.

    Science.gov (United States)

    Bailey, Michelle; Chauhan, Chitra; Liu, Canhui; Unnasch, Thomas R

    2011-03-01

    Previous studies of Brugia malayi promoters have suggested that they are unusual in that they lack the CAAT or TATAA boxes that are often emblematic of eucaryotic core promoter domains. Instead, the region surrounding the spliced leader (SL) addition site appears to function as the core promoter domain in B. malayi. To test the hypothesis that polymorphisms in this SL addition domain are important determinants of promoter activity, a series of domain swap mutants were prepared replacing the SL addition domain of the B. malayi 13kDa large subunit ribosomal protein (BmRPL13) with those of other ribosomal protein (RP) promoters exhibiting a wide range of activities. These constructs were then tested for promoter activity in a homologous transient transfection system. On average, polymorphisms in the SL addition domain were found to be responsible for 80% of the variation in promoter activity exhibited by the RP promoters tested. Essentially all of this effect could be attributable to polymorphisms in the 10nt located directly upstream of the SL addition site. A comparison of the sequence of this domain to the promoter activity exhibited by the domain swap mutants suggested that promoter activity was related to the number of T residues present in the coding strand of the upstream domain. Confirming this, mutation of the upstream domain of the promoter of the BmRPS4 gene to a homogeneous stretch of 10 T residues resulted in a significant increase in promoter activity. Copyright © 2010 Elsevier B.V. All rights reserved.

  12. Immunogenicity and Protective Efficacy of Brugia malayi Heavy Chain Myosin as Homologous DNA, Protein and Heterologous DNA/Protein Prime Boost Vaccine in Rodent Model.

    Directory of Open Access Journals (Sweden)

    Jyoti Gupta

    Full Text Available We earlier demonstrated the immunoprophylactic efficacy of recombinant heavy chain myosin (Bm-Myo of Brugia malayi (B. malayi in rodent models. In the current study, further attempts have been made to improve this efficacy by employing alternate approaches such as homologous DNA (pcD-Myo and heterologous DNA/protein prime boost (pcD-Myo+Bm-Myo in BALB/c mouse model. The gene bm-myo was cloned in a mammalian expression vector pcDNA 3.1(+ and protein expression was confirmed in mammalian Vero cell line. A significant degree of protection (79.2%±2.32 against L3 challenge in pcD-Myo+Bm-Myo immunized group was observed which was much higher than that exerted by Bm-Myo (66.6%±2.23 and pcD-Myo (41.6%±2.45. In the heterologous immunized group, the percentage of peritoneal leukocytes such as macrophages, neutrophils, B cells and T cells marginally increased and their population augmented further significantly following L3 challenge. pcD-Myo+Bm-Myo immunization elicited robust cellular and humoral immune responses as compared to pcD-Myo and Bm-Myo groups as evidenced by an increased accumulation of CD4+, CD8+ T cells and CD19+ B cells in the mouse spleen and activation of peritoneal macrophages. Though immunized animals produced antigen-specific IgG antibodies and isotypes, sera of mice receiving pcD-Myo+Bm-Myo or Bm-Myo developed much higher antibody levels than other groups and there was profound antibody-dependent cellular adhesion and cytotoxicity (ADCC to B. malayi infective larvae (L3. pcD-Myo+Bm-Myo as well as Bm-Myo mice generated a mixed T helper cell phenotype as evidenced by the production of both pro-inflammatory (IL-2, IFN-γ and anti-inflammatory (IL-4, IL-10 cytokines. Mice receiving pcD-Myo on contrary displayed a polarized pro-inflammatory immune response. The findings suggest that the priming of animals with DNA followed by protein booster generates heightened and mixed pro- and anti-inflammatory immune responses that are capable of

  13. Identification of anti-filarial leads against aspartate semialdehyde dehydrogenase of Wolbachia endosymbiont of Brugia malayi: combined molecular docking and molecular dynamics approaches.

    Science.gov (United States)

    Amala, Mathimaran; Rajamanikandan, Sundaraj; Prabhu, Dhamodharan; Surekha, Kanagarajan; Jeyakanthan, Jeyaraman

    2018-02-06

    Lymphatic filariasis is a debilitating vector borne parasitic disease that infects human lymphatic system by nematode Brugia malayi. Currently available anti-filarial drugs are effective only on the larval stages of parasite. So far, no effective drugs are available for humans to treat filarial infections. In this regard, aspartate semialdehyde dehydrogenase (ASDase) in lysine biosynthetic pathway from Wolbachia endosymbiont Brugia malayi represents an attractive therapeutic target for the development of novel anti-filarial agents. In this present study, molecular modeling combined with molecular dynamics simulations and structure-based virtual screening were performed to identify potent lead molecules against ASDase. Based on Glide score, toxicity profile, binding affinity and mode of interactions with the ASDase, five potent lead molecules were selected. The molecular docking and dynamics results revealed that the amino acid residues Arg103, Asn133, Cys134, Gln161, Ser164, Lys218, Arg239, His246, and Asn321 plays a crucial role in effective binding of Top leads into the active site of ASDase. The stability of the ASDase-lead complexes was confirmed by running the 30 ns molecular dynamics simulations. The pharmacokinetic properties of the identified lead molecules are in the acceptable range. Furthermore, density functional theory and binding free energy calculations were performed to rank the lead molecules. Thus, the identified lead molecules can be used for the development of anti-filarial agents to combat the pathogenecity of Brugia malayi.

  14. Functional analysis of the cathepsin-like cysteine protease genes in adult Brugia malayi using RNA interference.

    Directory of Open Access Journals (Sweden)

    Louise Ford

    Full Text Available Cathepsin-like enzymes have been identified as potential targets for drug or vaccine development in many parasites, as their functions appear to be essential in a variety of important biological processes within the host, such as molting, cuticle remodeling, embryogenesis, feeding and immune evasion. Functional analysis of Caenorhabditis elegans cathepsin L (Ce-cpl-1 and cathepsin Z (Ce-cpz-1 has established that both genes are required for early embryogenesis, with Ce-cpl-1 having a role in regulating in part the processing of yolk proteins. Ce-cpz-1 also has an important role during molting.RNA interference assays have allowed us to verify whether the functions of the orthologous filarial genes in Brugia malayi adult female worms are similar. Treatment of B. malayi adult female worms with Bm-cpl-1, Bm-cpl-5, which belong to group Ia of the filarial cpl gene family, or Bm-cpz-1 dsRNA resulted in decreased numbers of secreted microfilariae in vitro. In addition, analysis of the intrauterine progeny of the Bm-cpl-5 or Bm-cpl Pro dsRNA- and siRNA-treated worms revealed a clear disruption in the process of embryogenesis resulting in structural abnormalities in embryos and a varied differential development of embryonic stages.Our studies suggest that these filarial cathepsin-like cysteine proteases are likely to be functional orthologs of the C. elegans genes. This functional conservation may thus allow for a more thorough investigation of their distinct functions and their development as potential drug targets.

  15. Immunization with Brugia malayi Myosin as Heterologous DNA Prime Protein Boost Induces Protective Immunity against B. malayi Infection in Mastomys coucha.

    Directory of Open Access Journals (Sweden)

    Jyoti Gupta

    Full Text Available The current control strategies employing chemotherapy with diethylcarbamazine, ivermectin and albendazole have reduced transmission in some filaria-endemic areas, there is growing interest for complementary approaches, such as vaccines especially in light of threat of parasite developing resistance to mainstay drugs. We earlier demonstrated recombinant heavy chain myosin of B. malayi (Bm-Myo as a potent vaccine candidate whose efficacy was enhanced by heterologous DNA prime/protein boost (Myo-pcD+Bm-Myo vaccination in BALB/c mice. BALB/c mouse though does not support the full developmental cycle of B. malayi, however, the degree of protection may be studied in terms of transformation of challenged infective larvae (L3 to next stage (L4 with an ease of delineating the generated immunological response of host. In the current investigation, DNA vaccination with Bm-Myo was therefore undertaken in susceptible rodent host, Mastomys coucha (M. coucha which sustains the challenged L3 and facilitates their further development to sexually mature adult parasites with patent microfilaraemia. Immunization schedule consisted of Myo-pcD and Myo-pcD+Bm-Myo followed by B. malayi L3 challenge and the degree of protection was evaluated by observing microfilaraemia as well as adult worm establishment. Myo-pcD+Bm-Myo immunized animals not only developed 78.5% reduced blood microfilarial density but also decreased adult worm establishment by 75.3%. In addition, 75.4% of the recovered live females revealed sterilization over those of respective control animals. Myo-pcD+Bm-Myo triggered higher production of specific IgG and its isotypes which induced marked cellular adhesion and cytotoxicity (ADCC to microfilariae (mf and L3 in vitro. Both Th1 and Th2 cytokines were significantly up-regulated displaying a mixed immune response conferring considerable protection against B. malayi establishment by engendering a long-lasting effective immune response and therefore emerges

  16. Profiling extracellular vesicle release by the filarial nematode Brugia malayi reveals sex-specific differences in cargo and a sensitivity to ivermectin.

    Directory of Open Access Journals (Sweden)

    Hiruni Harischandra

    2018-04-01

    Full Text Available The filarial nematode Brugia malayi is an etiological agent of Lymphatic Filariasis. The capability of B. malayi and other parasitic nematodes to modulate host biology is recognized but the mechanisms by which such manipulation occurs are obscure. An emerging paradigm is the release of parasite-derived extracellular vesicles (EV containing bioactive proteins and small RNA species that allow secretion of parasite effector molecules and their potential trafficking to host tissues. We have previously described EV release from the infectious L3 stage B. malayi and here we profile vesicle release across all intra-mammalian life cycle stages (microfilariae, L3, L4, adult male and female worms. Nanoparticle Tracking Analysis was used to quantify and size EVs revealing discrete vesicle populations and indicating a secretory process that is conserved across the life cycle. Brugia EVs are internalized by murine macrophages with no preference for life stage suggesting a uniform mechanism for effector molecule trafficking. Further, the use of chemical uptake inhibitors suggests all life stage EVs are internalized by phagocytosis. Proteomic profiling of adult male and female EVs using nano-scale LC-MS/MS described quantitative and qualitative differences in the adult EV proteome, helping define the biogenesis of Brugia EVs and revealing sexual dimorphic characteristics in immunomodulatory cargo. Finally, ivermectin was found to rapidly inhibit EV release by all Brugia life stages. Further this drug effect was also observed in the related filarial nematode, the canine heartworm Dirofilaria immitis but not in an ivermectin-unresponsive field isolate of that parasite, highlighting a potential mechanism of action for this drug and suggesting new screening platforms for anti-filarial drug development.

  17. Wolbachia lipoproteins: abundance, localisation and serology of Wolbachia peptidoglycan associated lipoprotein and the Type IV Secretion System component, VirB6 from Brugia malayi and Aedes albopictus.

    Science.gov (United States)

    Voronin, Denis; Guimarães, Ana F; Molyneux, Gemma R; Johnston, Kelly L; Ford, Louise; Taylor, Mark J

    2014-10-06

    Lipoproteins are the major agonists of Wolbachia-dependent inflammatory pathogenesis in filariasis and a validated target for drug discovery. Here we characterise the abundance, localisation and serology of the Wolbachia lipoproteins: Wolbachia peptidoglycan associated lipoprotein and the Type IV Secretion System component, VirB6. We used proteomics to confirm lipoprotein presence and relative abundance; fractionation, immunoblotting and confocal and electron immuno-microscopy for localisation and ELISA for serological analysis. Proteomic analysis of Brugia malayi adult female protein extracts confirmed the presence of two lipoproteins, previously predicted through bioinformatics: Wolbachia peptidoglycan associated lipoprotein (wBmPAL) and the Type IV Secretion System component, VirB6 (wBmVirB6). wBmPAL was among the most abundant Wolbachia proteins present in an extract of adult female worms with wBmVirB6 only detected at a much lower abundance. This differential abundance was reflected in the immunogold-labelling, which showed wBmPAL localised at numerous sites within the bacterial membranes, whereas wBmVirB6 was present as a single cluster on each bacterial cell and also located within the bacterial membranes. Immunoblotting of fractionated extracts confirmed the localisation of wBmPAL to membranes and its absence from cytosolic fractions of C6/36 mosquito cells infected with wAlbB. In whole worm mounts, antibody labelling of both lipoproteins were associated with Wolbachia. Serological analysis showed that both proteins were immunogenic and raised antibody responses in the majority of individuals infected with Wuchereria bancrofti. Two Wolbachia lipoproteins, wBmPAL and wBmVirB6, are present in extracts of Brugia malayi with wBmPAL among the most abundant of Wolbachia proteins. Both lipoproteins localised to bacterial membranes with wBmVirB6 present as a single cluster suggesting a single Type IV Secretory System on each Wolbachia cell.

  18. Exome and Transcriptome Sequencing of Aedes aegypti Identifies a Locus That Confers Resistance to Brugia malayi and Alters the Immune Response

    KAUST Repository

    Juneja, Punita

    2015-03-27

    Many mosquito species are naturally polymorphic for their abilities to transmit parasites, a feature which is of great interest for controlling vector-borne disease. Aedes aegypti, the primary vector of dengue and yellow fever and a laboratory model for studying lymphatic filariasis, is genetically variable for its capacity to harbor the filarial nematode Brugia malayi. The genome of Ae. aegypti is large and repetitive, making genome resequencing difficult and expensive. We designed exome captures to target protein-coding regions of the genome, and used association mapping in a wild Kenyan population to identify a single, dominant, sex-linked locus underlying resistance. This falls in a region of the genome where a resistance locus was previously mapped in a line established in 1936, suggesting that this polymorphism has been maintained in the wild for the at least 80 years. We then crossed resistant and susceptible mosquitoes to place both alleles of the gene into a common genetic background, and used RNA-seq to measure the effect of this locus on gene expression. We found evidence for Toll, IMD, and JAK-STAT pathway activity in response to early stages of B. malayi infection when the parasites are beginning to die in the resistant genotype. We also found that resistant mosquitoes express anti-microbial peptides at the time of parasite-killing, and that this expression is suppressed in susceptible mosquitoes. Together, we have found that a single resistance locus leads to a higher immune response in resistant mosquitoes, and we identify genes in this region that may be responsible for this trait.

  19. Recombinant Brugia malayi pepsin inhibitor (rBm33) exploits host signaling events to regulate inflammatory responses associated with lymphatic filarial infections.

    Science.gov (United States)

    Sreenivas, Kirthika; Kalyanaraman, Haripriya; Babu, Subash; Narayanan, Rangarajan Badri

    2017-11-01

    Prolonged existence of filarial parasites and their molecules within the host modulate the host immune system to instigate their survival and induce inflammatory responses that contribute to disease progression. Recombinant Brugia malayi pepsin inhibitor (rBm33) modulates the host immune responses by skewing towards Th1 responses characterized by secretion of inflammatory molecules such as TNF-α, IL-6, nitric oxide (NO). Here we also specified the molecular signaling events triggered by rBm33 in peripheral blood mononuclear cells (PBMCs) of filarial endemic normals (EN). rBm33 predominantly enhanced the levels of nitric oxide in cultured PBMCs but did not result in oxidative stress to the host cells. Further, rBm33 treatment of human PBMCs resulted in higher GSH/GSSG levels. MYD88 dependent activation was found to be associated with rBm33 specific inflammatory cytokine production. rBm33 triggered intracellular signaling events also involved JNK activation in host PBMCs. In addition, c-Fos and not NF-κB was identified as the transcription factor regulating the expression of inflammatory cytokines in rBm33 stimulated PBMCs. rBm33 marked its role in filarial pathology by altered levels of growth factors but did not have a significant impact on matrix metalloproteinases (MMPs), tissue inhibitors of matrix metalloproteinases (TIMPs) activity of host PBMCs. Thus, the study outlines the signaling network of rBm33 induced inflammatory responses within the host immune cells. Copyright © 2017 Elsevier Ltd. All rights reserved.

  20. Physicochemical properties of the modeled structure of astacin metalloprotease moulting enzyme NAS-36 and mapping the druggable allosteric space of Heamonchus contortus, Brugia malayi and Ceanorhabditis elegans via molecular dynamics simulation.

    Science.gov (United States)

    Sharma, Om Prakash; Agrawal, Sonali; Kumar, M Suresh

    2013-12-01

    Nematodes represent the second largest phylum in the animal kingdom. It is the most abundant species (500,000) in the planet. It causes chronic, debilitating infections worldwide such as ascariasis, trichuriasis, hookworm, enterobiasis, strongyloidiasis, filariasis and trichinosis, among others. Molecular modeling tools can play an important role in the identification and structural investigation of molecular targets that can act as a vital candidate against filariasis. In this study, sequence analysis of NAS-36 from H. contortus (Heamonchus contortus), B. malayi (Brugia malayi) and C. elegans (Ceanorhabditis elegans) has been performed, in order to identify the conserved residues. Tertiary structure was developed for an insight into the molecular structure of the enzyme. Molecular Dynamics Simulation (MDS) studies have been carried out to analyze the stability and the physical properties of the proposed enzyme models in the H. contortus, B. malayi and C. elegans. Moreover, the drug binding sites have been mapped for inhibiting the function of NAS-36 enzyme. The molecular identity of this protease could eventually demonstrate how ex-sheathment is regulated, as well as provide a potential target of anthelmintics for the prevention of nematode infections.

  1. The n-hexane and chloroform fractions of Piper betle L. trigger different arms of immune responses in BALB/c mice and exhibit antifilarial activity against human lymphatic filarid Brugia malayi.

    Science.gov (United States)

    Singh, Meghna; Shakya, Shilpy; Soni, Vishal Kumar; Dangi, Anil; Kumar, Nikhil; Bhattacharya, Shailja-Misra

    2009-06-01

    Modulation of immune functions by using herbal plants and their products has become fundamental regime of therapeutic approach. Piper betle Linn. (Piperaceae) is a widely distributed plant in the tropical and subtropical regions of the world and has been attributed as traditional herbal remedy for many diseases. We have recently reported the antifilarial and antileishmanial efficacy in the leaf extract of Bangla Mahoba landrace of P. betle which is a female plant. The present report describes the in vivo immunomodulatory efficacy of the crude methanolic extract and its n-hexane, chloroform, n-butanol fractions of the female plant at various dose levels ranging between 0.3 and 500 mg/kg in BALB/c. Attempts were also made to observe antifilarial activity of the active extracts and correlate it with the antigen specific immune responses in another rodent Mastomys coucha infected with human lymphatic filarial parasite Brugia malayi. The crude methanol extract and n-hexane fraction were found to potentiate significant (p<0.001) enhancement of both humoral (plaque forming cells, hemagglutination titre) as well as cell-mediated (lymphoproliferation, macrophage activation, delayed type hypersensitivity) immune responses in mice. The flow cytometric analysis of splenocytes of treated mice indicated enhanced population of T-cells (CD4(+), CD8(+)) and B-cells (CD19(+)). The n-hexane fraction (3 mg/kg) was found to induce biased type 2 cytokine response as revealed by increased IL-4(+) and decreased IFN-gamma(+) T-cell population while the chloroform fraction (10 mg/kg) produced a predominant type 1 cytokines. Crude methanolic extract (100 mg/kg) demonstrated a mixed type 1 and type 2 cytokine responses thus suggesting a remarkable immunomodulatory property in this plant. The induction of differential T-helper cell immune response appears ideal to overcome immunosuppression as observed in case of lymphatic, filarial Brugia malayi infection which may also be extended to other

  2. Cytokine production in BALB/c mice immunized with radiation attenuated third stage larvae of the filarial nematode, Brugia pahangi

    International Nuclear Information System (INIS)

    Bancroft, A.J.; Devaney, E.; Grencis, R.K.; Else, K.J.

    1993-01-01

    BALB/c mice immunized with radiation-attenuated third stage larvae of the filarial nematode Brugia pahangi are strongly immune to challenge infection. Investigation of the profile of cytokines secreted by spleen cells from immune mice stimulated in vitro with either parasite Ag or with Con A revealed high levels of IL-5 and IL-9 and moderate levels of IL-4. In contrast, secretion of IFN-γ by spleen cells from immune animals was negligible. Spleen cells from control mice secreted low levels of all cytokines assayed. Levels of parasite-specific IgE were significantly elevated in immune animals and a peripheral blood eosinophilia was observed, which exhibited a biphasic distribution. Our results are consistent with the preferential expansion of Th2 cells in immune animals and provide the basis for dissecting the means by which radiation-attenuated larvae of filarial nematodes stimulate immunity. 5l refs., 3 figs., 3 tabs

  3. Brugia malayi Antigen (BmA Inhibits HIV-1 Trans-Infection but Neither BmA nor ES-62 Alter HIV-1 Infectivity of DC Induced CD4+ Th-Cells.

    Directory of Open Access Journals (Sweden)

    Emily E I M Mouser

    Full Text Available One of the hallmarks of HIV-1 disease is the association of heightened CD4+ T-cell activation with HIV-1 replication. Parasitic helminths including filarial nematodes have evolved numerous and complex mechanisms to skew, dampen and evade human immune responses suggesting that HIV-1 infection may be modulated in co-infected individuals. Here we studied the effects of two filarial nematode products, adult worm antigen from Brugia malayi (BmA and excretory-secretory product 62 (ES-62 from Acanthocheilonema viteae on HIV-1 infection in vitro. Neither BmA nor ES-62 influenced HIV-1 replication in CD4+ enriched T-cells, with either a CCR5- or CXCR4-using virus. BmA, but not ES-62, had the capacity to bind the C-type lectin dendritic cell-specific intercellular adhesion molecule-3-grabbing non-integrin (DC-SIGN thereby inhibiting HIV-1 trans-infection of CD4+ enriched T-cells. As for their effect on DCs, neither BmA nor ES-62 could enhance or inhibit DC maturation as determined by CD83, CD86 and HLA-DR expression, or the production of IL-6, IL-10, IL-12 and TNF-α. As expected, due to the unaltered DC phenotype, no differences were found in CD4+ T helper (Th cell phenotypes induced by DCs treated with either BmA or ES-62. Moreover, the HIV-1 susceptibility of the Th-cell populations induced by BmA or ES-62 exposed DCs was unaffected for both CCR5- and CXCR4-using HIV-1 viruses. In conclusion, although BmA has the potential capacity to interfere with HIV-1 transmission or initial viral dissemination through preventing the virus from interacting with DCs, no differences in the Th-cell polarizing capacity of DCs exposed to BmA or ES-62 were observed. Neither antigenic source demonstrated beneficial or detrimental effects on the HIV-1 susceptibility of CD4+ Th-cells induced by exposed DCs.

  4. Attempts at immunization against Malayan filariasis using X-irradiated infective larvae

    International Nuclear Information System (INIS)

    Ramachandran, C.P.

    1975-01-01

    Recent studies on immunity to helminthic infections have shown that some degree of protective immunity may be stimulated by inoculations of attenuated living worms or their metabolites. Although much on these lines has been done with several helminths, little if any has been done with filarial infections in general. Experiments were designed to observe the effects of attempted immunization in the rhesus monkey as well as the domestic cat by the use of attenuated infective larvae of Brugia malayi. The sub-periodic strain of Brugia malayi, the major filarial parasite of man in Malaysia, maintained in the laboratory on experimentally infected cats and rhesus monkeys were used for the preparation of X-irradiated vaccines as well as for challenge inoculations. Third-stage infective larvae of Brugia malayi were obtained from experimentally fed Aedes togoi mosquitoes. Infective larvae were irradiated by X-rays, using a Dermopan X-ray unit at exposures between 10 - 40 kR. Rhesus monkeys and cats were inoculated twice with 100 - 400 attenuated larvae per inoculation at 2 week intervals and challenged about a month later by inoculation of 100 normal larvae. Control animals for each vaccination dose as well as for challenge doses were maintained. In rhesus monkeys persistent immunity to challenge infections (expressed as failure to cause microfilaraemia) were obtained in animals vaccinated with 200 infective larvae attenuated by X-irradiation at 20000 R. Encouraged with the results obtained on rhesus monkeys, similar experiments on an enlarged scale using varying strengths of the vaccines were carried out on the domestic cat, which is a more receptive animal host for Brugia malayi. However, all cats vaccinated when challenged came down with patent infection indicating lack of any definite immunity. In all these experiments, results of vaccine control animals showed that inoculation of irradiated larvae was not followed by the infection of microfilaria in the blood, indicating

  5. 周期型马来丝虫复合基因重组质粒和相应表达蛋白的免疫学研究%Immunology comparision of composite gene recombinant plasmid and expressed protein of periodical Brugia malayi

    Institute of Scientific and Technical Information of China (English)

    王慧; 方政; 徐倩; 陆施娟; 钱一言; 徐怿琳; 方浩; 徐邦生

    2014-01-01

    粒/复合重组蛋白/CpG组小鼠淋巴细胞刺激增殖指数(1.629±0.235)高于复合重组蛋白组(1.248±0.110,P<0.05);免疫4、6周后,复合重组质粒/复合重组蛋白/CpG组和复合重组质粒/CpG组小鼠血清IFN-γ水平[(101.660±5.101)、(178.265±7.139)mg/L,(102.067±3.722)、(115.148±6.031)mg/L]均高于复合重组蛋白组[(75.438±2.102)、(82.004±3.777) mg/L,P均<0.05];免疫后6周,复合重组质粒/复合重组蛋白/CpG组和复合重组蛋白/CpG组的小鼠血清IL-4水平[(75.385±3.318)、(46.363±3.672)mg/L]均明显高于复合重组质粒/CpG组[(36.691±3.443)mg/L,P均<0.05).结论 pcDNA3.1-BmCPI/BmGAPDH核酸疫苗和相应蛋白疫苗均可诱导BALB/c小鼠产生特异性体液和细胞免疫应答反应.核酸疫苗-蛋白疫苗联合免疫效果有明显的优势.%Objective To construct a plasmid DNA vector expressing cysteine protease inhibitor and glyceraldehydes-3-phosphate dehydrogenase of periodic Brugia malayi(BmCPI/BmGAPDH),and purify the recombinant protein after transfecting the vector into human cervical carcinoma cells(Hela) for expression.To make a comparison of immunity efficacy between the recombinant plasmid and the homologous protein and to a lay theoretic and experimental basis for developing novel anti-filarial genetic engineering vaccines.Methods The amplified genes BmCPI and BmGAPDH and a plasmid vector were double enzymes digested and ligated to construct a recombinant plasmid pcDNA3.1 (+)-BmCPI/BmGAPDH,and this plasmid was transfected to Hela cells after being identified.G418 was used for screening transfectants,and the monoclonal resistant cell strain was determined by RT-PCR and SDS-PAGE.The recombinant protein was purified by affnity chromatography and identified by Western blotting.Sixty BALB/c mice were divided into 5 groups,12 per group,and they were immunized at 2,4,and 6 weeks.Mice in control groups were injected with PBS 100 μ1 or pcDNA3.1 100 μg/CpG 30 μg,and mice in

  6. A reverse transcriptase-PCR assay for detecting filarial infective larvae in mosquitoes.

    Directory of Open Access Journals (Sweden)

    Sandra J Laney

    2008-06-01

    Full Text Available Existing molecular assays for filarial parasite DNA in mosquitoes cannot distinguish between infected mosquitoes that contain any stage of the parasite and infective mosquitoes that harbor third stage larvae (L3 capable of establishing new infections in humans. We now report development of a molecular L3-detection assay for Brugia malayi in vectors based on RT-PCR detection of an L3-activated gene transcript.Candidate genes identified by bioinformatics analysis of EST datasets across the B. malayi life cycle were initially screened by PCR using cDNA libraries as templates. Stage-specificity was confirmed using RNA isolated from infected mosquitoes. Mosquitoes were collected daily for 14 days after feeding on microfilaremic cat blood. RT-PCR was performed with primer sets that were specific for individual candidate genes. Many promising candidates with strong expression in the L3 stage were excluded because of low-level transcription in less mature larvae. One transcript (TC8100, which encodes a particular form of collagen was only detected in mosquitoes that contained L3 larvae. This assay detects a single L3 in a pool of 25 mosquitoes.This L3-activated gene transcript, combined with a control transcript (tph-1, accession # U80971 that is constitutively expressed by all vector-stage filarial larvae, can be used to detect filarial infectivity in pools of mosquito vectors. This general approach (detection of stage-specific gene transcripts from eukaryotic pathogens may also be useful for detecting infective stages of other vector-borne parasites.

  7. Exome and Transcriptome Sequencing of Aedes aegypti Identifies a Locus That Confers Resistance to Brugia malayi and Alters the Immune Response

    KAUST Repository

    Juneja, Punita; Ariani, Cristina V.; Ho, Yung Shwen; Akorli, Jewelna; Palmer, William J.; Pain, Arnab; Jiggins, Francis M.

    2015-01-01

    to target protein-coding regions of the genome, and used association mapping in a wild Kenyan population to identify a single, dominant, sex-linked locus underlying resistance. This falls in a region of the genome where a resistance locus was previously

  8. ORF Alignment: NC_006833 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available TRS of Brugia malayi] ... Length = 188 ... Query: 439 HPLGFARCQVYNTYIIAEARGK...LIIVDQHAAHERLVYECLKQKSSIKRQKLLLSEVVEIK 498 ... HPLGFARCQVYNTYIIAEARGKLIIVDQHAAHERLVYECLKQKSSIKRQKLLLSEVVEIK Sbjct: 1 ... HPLGFAR

  9. Brugia timori INFECTION IN LEKEBAI, FLORES: clinical aspects

    Directory of Open Access Journals (Sweden)

    Arbain Joesoef

    2012-09-01

    Full Text Available Pengamatan filariasis pada penduduk Nualolo-Lekebai, Pulau Flores telah dilakukan pada bulan Februari 1975. Kampung Nualolo-Lekebai berpenduduk 680 jiwa, pekerjaan bertani dan menganut agama Nasrani. Kebiasaan hidup di antara penduduk di daerah ini adalah menyerahkan pelaksanaan pekerjaan berat pada kaum wanita, baik di rumah ataupun di kebun. Dalam perjalanan jauh baik ke kebun atau ke pasar, kaum wanitanya selalu berjalan kaki sedangkan kaum prianya menunggang kuda. Sejumlah 80% dari penduduk kampung ini telah diperiksa terhadap infeksi parasit filaria dan terhadap gejala filariasis. Dari hasil yang ditemukan ternyata penduduk kampung ini menderita infeksi Brugia timori dengan angka derajat infeksi sebesar 7.0% dan angka derajat elephantiasis sebesar 10.3%. Hal yang menarik yang ditemukan dalam pengamatan ini adalah tingginya angka derajat elephantiasis pada kaum wanita dibandingkan dengan pada kaum pria. Fenomena ini mungkin disebabkan oleh kebiasaan hidup kaum wanita di daerah ini sehari-hari yang bekerja lebih berat dan berjalan kaki lebih sering dan lebih jauh dibandingkan kaum prianya.

  10. A PRELIMINARY STUDY OF MALAYAN FILARIASIS IN PUDING VILLAGE, JAMBI PROVINCE (SUMATERA, INDONESIA

    Directory of Open Access Journals (Sweden)

    Sudomo M.

    2012-09-01

    Full Text Available Beberapa daerah di Propinsi Jambi akan dikembangkan menjadi daerah transmigrasi, satu di antara­nya adalah daerah Kumpeh yang terletak berdekatan dengan daerah endemik filariasis malayi. Desa yang paling dekat dengan lokasi transmigrasi tersebut adalah desa Puding. Penelitian pendahuluan tentang penyakit filariasis telah dikerjakan di desa Puding untuk mengetahui tingkat endemisitas, periodisitas B. malayi, fauna nyamuk, jenis nyamuk yang potensial menjadi vektor filariasis, hospes reservoir dan keadaan sosial-ekonomi-budaya penduduk setempat. Mf rate pada penduduk desa Puding adalah 18,7% dan dari B. malayi jenis subperiodiknokturna. Nyamuk yang tertangkap terdiri dari enam genera yaitu genus Anopheles, Aedes, Culex, Coquilletidia, Mansonia dan Tripteroides. Dari enam genera tersebut yang potensial untuk menjadi vektor filariasis adalah genus Mansonia dan ini didukung dengan diketemukannyd larva stadium L3 (infektif Brugia sp di tubuh nyamuk tersebut. Keadaan sosial-ekonomi-budaya, khususnya menyangkut adat istiadat dan kebiasaan penduduk setempat, telah dipelajari.

  11. Reactive oxygen species production and Brugia pahangi survivorship in Aedes polynesiensis with artificial Wolbachia infection types.

    Directory of Open Access Journals (Sweden)

    Elizabeth S Andrews

    Full Text Available Heterologous transinfection with the endosymbiotic bacterium Wolbachia has been shown previously to induce pathogen interference phenotypes in mosquito hosts. Here we examine an artificially infected strain of Aedes polynesiensis, the primary vector of Wuchereria bancrofti, which is the causative agent of Lymphatic filariasis (LF throughout much of the South Pacific. Embryonic microinjection was used to transfer the wAlbB infection from Aedes albopictus into an aposymbiotic strain of Ae. polynesiensis. The resulting strain (designated "MTB" experiences a stable artificial infection with high maternal inheritance. Reciprocal crosses of MTB with naturally infected wild-type Ae. polynesiensis demonstrate strong bidirectional incompatibility. Levels of reactive oxygen species (ROS in the MTB strain differ significantly relative to that of the wild-type, indicating an impaired ability to regulate oxidative stress. Following a challenge with Brugia pahangi, the number of filarial worms achieving the infective stage is significantly reduced in MTB as compared to the naturally infected and aposymbiotic strains. Survivorship of MTB differed significantly from that of the wild-type, with an interactive effect between survivorship and blood feeding. The results demonstrate a direct correlation between decreased ROS levels and decreased survival of adult female Aedes polynesiensis. The results are discussed in relation to the interaction of Wolbachia with ROS production and antioxidant expression, iron homeostasis and the insect immune system. We discuss the potential applied use of the MTB strain for impacting Ae. polynesiensis populations and strategies for reducing LF incidence in the South Pacific.

  12. Larvae for layers

    DEFF Research Database (Denmark)

    Bjerrum, Lotte; Fischer, Christian Holst; Nordentoft, Steen

    2013-01-01

    Companies and researchers are in close collaboration developing a container- based system for cultivating fly larvae at organic poultry farms. In a one week process, manure will be converted to compost and the live larvae will be harvested and used for feeding laying hens. The larvae are expected...

  13. Macrofilaricidal and microfilaricidal effects of Neurolaena lobata, a Guatemalan medicinal plant, on Brugia pahangi.

    Science.gov (United States)

    Fujimaki, Y; Kamachi, T; Yanagi, T; Cáceres, A; Maki, J; Aoki, Y

    2005-03-01

    Twelve extracts of 11 Guatemalan medicinal plants were initially screened in vitro for potential macrofilaricidal activity against Brugia pahangi, a lymphatic dwelling filarial worm, using concentrations from 125 to 1000 microg ml(-1) of each extract that could be dissolved in the culture medium. Of 12 extracts used, the ethanol extract of leaves of Neurolaena lobata showed the strongest activity against the motility of adult worms. Subsequently, the extract of N. lobata was extensively examined in vitro for macro- and micro-filaricidal effects using a series of concentrations of 500, 250, 100, 50 and 10 microg ml(-1). The effects were assessed by worm motility, microfilarial release by female worms and a MTT assay. The effect on the motility of adult worms was observed in a concentration- and time-dependent manner. The time required to stop motility of both sexes of adult worms was 6 h at 500 microg ml(-1), 24 h at 250 microg ml(-1), and 3 days for females and 4 days for males at 100 microg ml(-1). The movement of females ceased at 4 days at a concentration of 50 microg ml(-1) whereas the motility of males was only reduced. The loss of worm's viability was confirmed by the MTT assay and was similar to the motility results. These concentrations, including 10 microg ml(-1), prevented microfilarial release by females in a concentration- and time-dependent manner. Concentrations higher than 100 microg ml(-1) even induced mortality of the microfilariae. The present study suggested that the ethanol extract of Neurolaena lobata has potential macro- and micro-filaricidal activities.

  14. Key to marine arthropod larvae

    Directory of Open Access Journals (Sweden)

    John A. Fornshell

    2012-03-01

    Full Text Available The scope of this key is restricted to the larvae of marine arthropods. The key is based solely on their morphology, patterns of body segmentation, numbers of appendages, and mode of locomotion. An effort has been made to treat all traditionally named larval forms, both planktonic and benthic. It is intended that this key be useful for a researcher working with archived museum specimens and therefore, does not include habitat information as a identifying trait, even though this information is usually available in the archived records. Within the phylum Arthropoda there are two sub-phyla and eleven classes having larval stages in the marineenvironment. Where feasible the original names of the various larval types have been used. Because this nomenclature is less commonly used today compared to the past, the more recent taxonomic affinities are included in parentheses after the original larval name. The key includes the following thirty-four larvae: Branchhiopoda nauplii; Cephalocarida nauplii; Mystacocarida nauplii; trilobite larva; protonymphon; hexapod larvae; Remipedia nauplii; nauplius - Y larvae; Cirripedia nauplii; Ascothoracida nauplii; Ostracoda nauplii; Euphausiacea nauplii; Penaeidea nauplii; Cyclopoida nauplii; Calanoida nauplii; Harpacticoida nauplii;Polyarthra nauplii; cypris larva; eryonecius larva; cypris-Y larva; elapthocaris larvae; mysis larvae; lucifer zoea; acetes zoea; acanthosoma larva; phyllosoma; antizoea larva; anomuran zoea; brachyuran zoea; calyptopis larvae; furcilia larva; crytopia larva; puerulus larva; alima larva.

  15. Immune responses of B. malayi thioredoxin (TRX) and venom allergen homologue (VAH) chimeric multiple antigen for lymphatic filariasis.

    Science.gov (United States)

    Anugraha, Gandhirajan; Jeyaprita, Parasurama Jawaharlal; Madhumathi, Jayaprakasam; Sheeba, Tamilvanan; Kaliraj, Perumal

    2013-12-01

    Although multiple vaccine strategy for lymphatic filariasis has provided tremendous hope, the choice of antigens used in combination has determined its success in the previous studies. Multiple antigens comprising key vaccine candidates from different life cycle stages would provide a promising strategy if the antigenic combination is chosen by careful screening. In order to analyze one such combination, we have used a chimeric construct carrying the well studied B. malayi antigens thioredoxin (BmTRX) and venom allergen homologue (BmVAH) as a fusion protein (TV) and evaluated its immune responses in mice model. The efficacy of fusion protein vaccine was explored in comparison with the single antigen vaccines and their cocktail. In mice, TV induced significantly high antibody titer of 1,28,000 compared to cocktail vaccine TRX+VAH (50,000) and single antigen vaccine TRX (16,000) or VAH (50,000). Furthermore, TV elicited higher level of cellular proliferative response together with elevated levels of IFN-γ, IL-4 and IL-5 indicating a Th1/Th2 balanced response. The isotype antibody profile showed significantly high level of IgG1 and IgG2b confirming the balanced response elicited by TV. Immunization with TV antigen induced high levels of both humoral and cellular immune responses compared to either cocktail or antigen given alone. The result suggests that TV is highly immunogenic in mice and hence the combination needs to be evaluated for its prophylactic potential.

  16. Baylisascaris Larva Migrans

    Science.gov (United States)

    Kazacos, Kevin R.; Abbott, Rachel C.; van Riper, Charles

    2016-05-26

    SummaryBaylisascaris procyonis, the common raccoon roundworm, is the most commonly recognized cause of clinical larva migrans (LM) in animals, a condition in which an immature parasitic worm or larva migrates in a host animal’s tissues, causing obvious disease. Infection with B. procyonis is best known as a cause of fatal or severe neurologic disease that results when the larvae invade the brain, the spinal cord, or both; this condition is known as neural larva migrans (NLM). Baylisascariasis is a zoonotic disease, that is, one that is transmissible from animals to humans. In humans, B. procyonis can cause damaging visceral (VLM), ocular (OLM), and neural larva migrans. Due to the ubiquity of infected raccoons around humans, there is considerable human exposure and risk of infection with this parasite. The remarkable disease-producing capability of B. procyonis in animals and humans is one of the most significant aspects of the biology of ascarids (large roundworms) to come to light in recent years. Infection with B. procyonis has important health implications for a wide variety of free-ranging and captive wildlife, zoo animals, domestic animals, as well as human beings, on both an individual and population level. This report, eighth in the series of U.S. Geological Survey Circulars on zoonotic diseases, will help us to better understand the routes of Baylisascaris procyonis infections and how best to adequately monitor this zoonotic disease.

  17. Visceral larva migrans: case report

    OpenAIRE

    Machado, Alexandre Bortoli; El Achkar, Marice Emanuela

    2003-01-01

    Larva migrans visceral é doença infecciosa, adquirida por ingestão de ovos provenientes dos vermes Toxocara canis e/ou Toxocara cati que infestam cães e gatos; as larvas penetram a parede intestinal e migram através dos tecidos levando a alterações diversas, conseqüentes a uma resposta inflamatória imune.¹ Os autores descrevem um caso clínico de larva migrans visceral com apresentação clínica atípica.Visceral larva migrans is an infectious human disease that occurs following ingestion of eggs...

  18. Cutaneous larva migrans

    Directory of Open Access Journals (Sweden)

    Aleksandra Wieczorek

    2016-09-01

    Full Text Available Introduction . Cutaneous larva migrans (CLM is a tropical zoonosis, caused by parasites, usually Ancylostoma braziliense. Humans are an accidental host. Polish patients with CLM are usually tourists visiting tropical and subtropical countries. The first symptoms do not always appear as creeping eruptions, which complicates the diagnosis. Objective. To present the case of a man with CLM after returning from Thailand to Poland and associated diagnostic difficulties. Case report. We present a case of a 28-year-old man who returned to Poland from Thailand. The first symptoms appeared as disseminated pruritic papules. No improvement after treatment with corticosteroids and antihistamines was observed. The diagnosis was established after the appearance of serpentine erythemas and improvement after albendazole therapy. Conclusions. In the case of returnees from exotic countries suffering from raised, pruritic rashes, and no improvement after treatment with corticosteroids and antihistamines, parasitic etiology should be considered.

  19. Repurposing auranofin as a lead candidate for treatment of lymphatic filariasis and onchocerciasis.

    Directory of Open Access Journals (Sweden)

    Christina A Bulman

    2015-02-01

    Full Text Available Two major human diseases caused by filariid nematodes are onchocerciasis, or river blindness, and lymphatic filariasis, which can lead to elephantiasis. The drugs ivermectin, diethylcarbamazine (DEC, and albendazole are used in control programs for these diseases, but are mainly effective against the microfilarial stage and have minimal or no effect on adult worms. Adult Onchocerca volvulus and Brugia malayi worms (macrofilariae can live for up to 15 years, reproducing and allowing the infection to persist in a population. Therefore, to support control or elimination of these two diseases, effective macrofilaricidal drugs are necessary, in addition to current drugs. In an effort to identify macrofilaricidal drugs, we screened an FDA-approved library with adult worms of Brugia spp. and Onchocerca ochengi, third-stage larvae (L3s of Onchocerca volvulus, and the microfilariae of both O. ochengi and Loa loa. We found that auranofin, a gold-containing drug used for rheumatoid arthritis, was effective in vitro in killing both Brugia spp. and O. ochengi adult worms and in inhibiting the molting of L3s of O. volvulus with IC50 values in the low micromolar to nanomolar range. Auranofin had an approximately 43-fold higher IC50 against the microfilariae of L. loa compared with the IC50 for adult female O. ochengi, which may be beneficial if used in areas where Onchocerca and Brugia are co-endemic with L. loa, to prevent severe adverse reactions to the drug-induced death of L. loa microfilariae. Further testing indicated that auranofin is also effective in reducing Brugia adult worm burden in infected gerbils and that auranofin may be targeting the thioredoxin reductase in this nematode.

  20. [Biotechnological aspects in "loco" larvae].

    Science.gov (United States)

    Inestrosa, N C; Labarca, R; Perelman, A; Campos, E O; Araneda, R; González, M; Brandan, E; Sánchez, J P; González-Plaza, R

    1990-10-01

    The biology of planktotrophic larvae of Concholepas concholepas is the main bottleneck towards developing biotechnologies to rear this muricid. Data concerning planktonic larvae development, diets and environmental signals triggering larval settlement and recruitment is scarce. We have begun the study of the molecular and cell biology of embryos, larvae and recruits having as a final goal, the development of appropriate biotechnologies to rear this gastropod. First, an inverse ratio between BuChE and AChE enzyme activities was established. This ratio may be a precise developmental marker for this species. Second, for the first time a phosphoinositide related regulatory pathway is reported in a muricid, opening a new approach to the biotechnological management of larvae. Third, the relation between sulfate in sea water and larval motility was studied. Concentrations below 125 microM sulfate decreases larval motility. The sulfate is incorporated in proteoglycans which participate in different developmental phenomena. Lastly, a genomic Concholepas concholepas DNA sequence, similar to that of a human growth hormone probe was detected. This is very interesting since growth factors are key molecules during development, growth and are involved in food conversion rates in fish and also, in a variety of marine invertebrates.

  1. Isolamento de esporos de Paenibacillus larvae subsp. larvae no Brasil Detectionof Paenibacillus larvae subsp. larvae spores in Brazil

    Directory of Open Access Journals (Sweden)

    Dulce Maria Tocchetto Schuch

    2003-03-01

    Full Text Available Este trabalho objetivou detectar presença de esporos de Paenibacillus larvae subsp. larvae em produtos de um entreposto do interior do Estado do Rio Grande do Sul, a identificação de possíveis fontes de contaminação e a avaliação da possibilidade da transferência de esporos para colméias de apiários adjacentes a partir de produtos importados contaminados. Foram analisados mel e pólen importados disponíveis no entreposto, favo do ninho (crias, pólen e mel colhido de uma colméia sadia, mel estocado em um dos apiários e abelhas adultas. Os resultados foram positivosem relação ao mel e pólen importados, a três grupos de abelhas adultas e ao mel do favo.The objective of this work was to detect the presence of Paenibacillus larvae subsp. larvae spores in products from a warehouse located in Rio Grande do Sul State, Brazil, the identification of possible contamination sources, and the assessment of spores transference possibility from contaminated imported products from the warehouse to apiaries located in the surrounding area. Samples of imported pollen and bulk honey stocked in the warehouse, and honeycomb (brood, honey and pollen from a healthy hive, honey from one apiary and adult bees were analyzed. Imported honey and pollen, and three groups of adult bees and the honey collected from the honeycomb resulted positive.

  2. Radiosensitivity of spores of Paenibacillus larvae ssp. larvae in honey

    Energy Technology Data Exchange (ETDEWEB)

    Almeida, Wanderley Mendes de [Ministerio da Agricultura, Pecuaria e Abastecimento, Rio de Janeiro, RJ (Brazil). Servico de Inspecao de Produtos de Origem Animal]. E-mail: sipa-rj@agricultura.gov.br; Vital, Helio de Carvalho [Centro Tecnologico do Exercito CTEx, Rio de Janeiro, RJ (Brazil). Div. de Defesa Quimica, Biologica e Nuclear]. E-mail: vital@ctex.eb.br; Schuch, Dulce Maria Tocchetto [Ministerio da Agricultura, Pecuaria e Abastecimento, Porto Alegre, RS (Brazil)]. E-mail: micro-lara-rs@agricultura.gov.br

    2007-07-01

    Irradiation, usually used in combination with other conventional methods of conservation, has been proven to be an efficient tool to ensure the safety of many types of foods by destroying pathogenic microorganisms and extending their shelf-lives. This work has investigated the efficacy of gamma irradiation to inactivate spores of the bacterium Paenibacillus larvae that causes the 'American foulbrood', a highly contagious disease still exotic in Brazil that kills bees and contaminates honey, preventing its commercialization and causing great economical losses. In this study, 60 g samples of two types of honey inoculated with 3.5x10{sup 3} spores/mL of that bacterium were irradiated with doses of 0, 5, 7.5, 10, 12.5 and 15 kGy and counted. The analyses indicated a mean reduction of 97.5{+-}0.7% in the number of viable spores exposed to 5 kGy. The application of doses of 7.5 kGy or higher yielded no viable spores above the detection threshold (10/mL). In addition the value of D{sub 10} (3.1{+-}0.3 kGy) was estimated and the logarithm of the population of viable spores of Paenibacillus larvae subsp. larvae was determined as linear and quadratic polynomial functions of the radiation dose. The results indicated that the dose of 10 kGy could be insufficient to assure complete sterilization of honey in some cases while suggesting that 25 kGy would perform such task adequately. (author)

  3. Self mixing of fly larvae during feeding

    Science.gov (United States)

    Shishkov, Olga; Johnson, Christopher; Hu, David

    How do we sustainably feed a growing world population? One solution of increasing interest is the use of black solider fly larvae, pea-sized grubs envisioned to transform hundreds of tons of food waste into a sustainable protein source. Although startups across the world are raising these larvae, a physical understanding of how they should be raised and fed remains missing. In this study, we present experiments measuring their feeding rate as a function of number of larvae. We show that larger groups of larvae have greater mixing which entrains hungry larvae around the food, increasing feeding rate. Feeding of larvae thus differs from feeding of cattle or other livestock which exhibit less self-mixing.

  4. Biology of Paenibacillus larvae, a deadly pathogen of honey bee larvae.

    Science.gov (United States)

    Ebeling, Julia; Knispel, Henriette; Hertlein, Gillian; Fünfhaus, Anne; Genersch, Elke

    2016-09-01

    The gram-positive bacterium Paenibacillus larvae is the etiological agent of American Foulbrood of honey bees, a notifiable disease in many countries. Hence, P. larvae can be considered as an entomopathogen of considerable relevance in veterinary medicine. P. larvae is a highly specialized pathogen with only one established host, the honey bee larva. No other natural environment supporting germination and proliferation of P. larvae is known. Over the last decade, tremendous progress in the understanding of P. larvae and its interactions with honey bee larvae at a molecular level has been made. In this review, we will present the recent highlights and developments in P. larvae research and discuss the impact of some of the findings in a broader context to demonstrate what we can learn from studying "exotic" pathogens.

  5. Workbook on Identification of Aedes Aegypti Larvae.

    Science.gov (United States)

    Pratt, Harry D.; And Others

    This self-instructional booklet is designed to enable yellow fever control workers to identify the larvae of "Aedes aegypti." The morphological features of mosquito larvae are illustrated in this partially programed text, and the distinguishing features of "A. aegypti" indicated. A glossary is included. (AL)

  6. Coral larvae move toward reef sounds

    NARCIS (Netherlands)

    Vermeij, M.J.A.; Marhaver, K.L.; Huijbers, C.M.; Nagelkerken, I.; Simpson, S.D.

    2010-01-01

    Free-swimming larvae of tropical corals go through a critical life-phase when they return from the open ocean to select a suitable settlement substrate. During the planktonic phase of their life cycle, the behaviours of small coral larvae (<1 mm) that influence settlement success are difficult to

  7. Feeding for larvae of catfish Pangasionodon sp. larvae in different ages

    Directory of Open Access Journals (Sweden)

    Muhammad Agus Suprayudi

    2015-05-01

    Full Text Available ABSTRACT Sludge worm (Tubifex sp. as natural feed on catfish (Pangasionodon sp. larvae rearing is available in limited amount especially during rainy season. It becomes a constraint factor for larvae rearing sector. This research was conducted to evaluate the appropriate initial age of catfish larvae to get artificial feed as sludge worm replacement. Evaluation was conducted on the growth and survival of catfish larvae in 14 days of culture. There were four treatments of feeding in triplicates i.e. larvae were given natural feed without artificial feed, given artificial feed started from d3, d6, and d9 with three replications. The results showed that larvae fed on artificial feed on d3 had the lowest growth compared to the other treatments, whereas the survival was not significantly different (P>0.05 among the treatments. As a conclusion, artificial feed could be used to replace natural feed for catfish larvae started at the age of nine days. Keywords: sludge worm, catfish larvae, artificial feed  ABSTRAK Cacing sutra (Tubifex sp. tersedia dalam jumlah terbatas terutama pada musim penghujan sebagai pakan alami dalam usaha pembenihan ikan patin (Pangasionodon sp.. Ini menjadi kendala dalam usaha pembenihan. Penelitian ini dilakukan untuk mengevaluasi umur larva ikan patin yang tepat untuk mulai diberi pakan buatan menggantikan cacing sutra. Evaluasi dilakukan pada pertumbuhan dan kelangsungan hidup larva ikan patin umur 14 hari. Selama pemeliharaan, larva diberi pakan dengan empat perlakuan; pemberian pakan alami tanpa pakan buatan, pemberian pakan buatan mulai d3, d6, dan d9 dengan tiga ulangan untuk masing-masing perlakuan. Hasil penelitian menunjukkan bahwa perlakuan pemberian pakan buatan mulai d3 memiliki pertumbuhan panjang yang terkecil dibandingkan perlakuan lain, sedangkan tingkat kelangsungan hidup larva tidak berbeda nyata (P>0,05 antarperlakuan. Berdasarkan hasil penelitian, dapat disimpulkan bahwa pakan buatan dapat digunakan

  8. Larva migrans visceral: relato de caso

    OpenAIRE

    Machado Alexandre Bortoli; El Achkar Marice Emanuela

    2003-01-01

    Larva migrans visceral é doença infecciosa, adquirida por ingestão de ovos provenientes dos vermes Toxocara canis e/ou Toxocara cati que infestam cães e gatos; as larvas penetram a parede intestinal e migram através dos tecidos levando a alterações diversas, conseqüentes a uma resposta inflamatória imune.¹ Os autores descrevem um caso clínico de larva migrans visceral com apresentação clínica atípica.

  9. TIME management by medicinal larvae.

    Science.gov (United States)

    Pritchard, David I; Čeřovský, Václav; Nigam, Yamni; Pickles, Samantha F; Cazander, Gwendolyn; Nibbering, Peter H; Bültemann, Anke; Jung, Wilhelm

    2016-08-01

    Wound bed preparation (WBP) is an integral part of the care programme for chronic wounds. The acronym TIME is used in the context of WBP and describes four barriers to healing in chronic wounds; namely, dead Tissue, Infection and inflammation, Moisture imbalance and a non-migrating Edge. Larval debridement therapy (LDT) stems from observations that larvae of the blowfly Lucilia sericata clean wounds of debris. Subsequent clinical studies have proven debriding efficacy, which is likely to occur as a result of enzymatically active alimentary products released by the insect. The antimicrobial, anti-inflammatory and wound healing activities of LDT have also been investigated, predominantly in a pre-clinical context. This review summarises the findings of investigations into the molecular mechanisms of LDT and places these in context with the clinical concept of WBP and TIME. It is clear from these findings that biotherapy with L. sericata conforms with TIME, through the enzymatic removal of dead tissue and its associated biofilm, coupled with the secretion of defined antimicrobial peptides. This biotherapeutic impact on the wound serves to reduce inflammation, with an associated capacity for an indirect effect on moisture imbalance. Furthermore, larval serine proteinases have the capacity to alter fibroblast behaviour in a manner conducive to the formation of granulation tissue. © 2015 Medicalhelplines.com Inc and John Wiley & Sons Ltd.

  10. Image-based automatic recognition of larvae

    Science.gov (United States)

    Sang, Ru; Yu, Guiying; Fan, Weijun; Guo, Tiantai

    2010-08-01

    As the main objects, imagoes have been researched in quarantine pest recognition in these days. However, pests in their larval stage are latent, and the larvae spread abroad much easily with the circulation of agricultural and forest products. It is presented in this paper that, as the new research objects, larvae are recognized by means of machine vision, image processing and pattern recognition. More visional information is reserved and the recognition rate is improved as color image segmentation is applied to images of larvae. Along with the characteristics of affine invariance, perspective invariance and brightness invariance, scale invariant feature transform (SIFT) is adopted for the feature extraction. The neural network algorithm is utilized for pattern recognition, and the automatic identification of larvae images is successfully achieved with satisfactory results.

  11. Extreme morphologies of mantis shrimp larvae

    DEFF Research Database (Denmark)

    Haug, Carolin; Ahyong, Shane T.; Wiethase, Joris H.

    2016-01-01

    Larvae of stomatopods (mantis shrimps) are generally categorized into four larval types: antizoea, pseudozoea (both representing early larval stages), alima and erichthus (the latt er two representing later larval stages). These categories, however, do not refl ect the existing morphological...

  12. CalCOFI Larvae Counts Positive Tows

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for eggs captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  13. Extreme morphologies of mantis shrimp larvae

    OpenAIRE

    Haug, Carolin; Ahyong, Shane T.; Wiethase, Joris H.; Olesen, Jørgen; Haug, Joachim T.

    2016-01-01

    ABSTRACT Larvae of stomatopods (mantis shrimps) are generally categorized into four larval types: antizoea, pseudozoea (both representing early larval stages), alima and erichthus (the latter two representing later larval stages). These categories, however, do not reflect the existing morphological diversity of stomatopod larvae, which is largely unstudied. We describe here four previously unknown larval types with extreme morphologies. All specimens were found in the collections of the Zoolo...

  14. Activity of R(+ limonene against Anisakis larvae

    Directory of Open Access Journals (Sweden)

    Filippo Giarratana

    2015-12-01

    Full Text Available The aim of this work is to evaluate the activity of R(+ limonene of against Anisakidae larvae. Its effectiveness was tested in vitro. The results obtained showing a significant activity of the compound against Anisakis larvae, suggesting further investigation on its potential use in the industrial marinating process. In this regard, the use of R(+ limonene in seafood products could be interesting, also due the sensory attributes resulting from its use and its relatively safe status.

  15. Extreme morphologies of mantis shrimp larvae

    Directory of Open Access Journals (Sweden)

    Carolin Haug

    Full Text Available ABSTRACT Larvae of stomatopods (mantis shrimps are generally categorized into four larval types: antizoea, pseudozoea (both representing early larval stages, alima and erichthus (the latter two representing later larval stages. These categories, however, do not reflect the existing morphological diversity of stomatopod larvae, which is largely unstudied. We describe here four previously unknown larval types with extreme morphologies. All specimens were found in the collections of the Zoological Museum, University of Copenhagen and were collected during the Danish Dana Expedition round the world 1928-30. These new larval types all represent erichthus-type larvae, especially differing in their shield morphologies. The shield morphology ranges from almost spherical to rather disc-like, with sometimes extremely elongated spines, but only a general systematic assignment of the larvae was possible. Further investigations of these larvae are crucial to understand their life habits and ecological impact, especially as stomatopod and other crustacean larvae might have a much more important position in the marine ecosystems than their corresponding adults.

  16. Chironomidae bloodworms larvae as aquatic amphibian food.

    Science.gov (United States)

    Fard, Mojdeh Sharifian; Pasmans, Frank; Adriaensen, Connie; Laing, Gijs Du; Janssens, Geert Paul Jules; Martel, An

    2014-01-01

    Different species of chironomids larvae (Diptera: Chironomidae) so-called bloodworms are widely distributed in the sediments of all types of freshwater habitats and considered as an important food source for amphibians. In our study, three species of Chironomidae (Baeotendipes noctivagus, Benthalia dissidens, and Chironomus riparius) were identified in 23 samples of larvae from Belgium, Poland, Russia, and Ukraine provided by a distributor in Belgium. We evaluated the suitability of these samples as amphibian food based on four different aspects: the likelihood of amphibian pathogens spreading, risk of heavy metal accumulation in amphibians, nutritive value, and risk of spreading of zoonotic bacteria (Salmonella, Campylobacter, and ESBL producing Enterobacteriaceae). We found neither zoonotic bacteria nor the amphibian pathogens Ranavirus and Batrachochytrium dendrobatidis in these samples. Our data showed that among the five heavy metals tested (Hg, Cu, Cd, Pb, and Zn), the excess level of Pb in two samples and low content of Zn in four samples implicated potential risk of Pb accumulation and Zn inadequacy. Proximate nutritional analysis revealed that, chironomidae larvae are consistently high in protein but more variable in lipid content. Accordingly, variations in the lipid: protein ratio can affect the amount and pathway of energy supply to the amphibians. Our study indicated although environmentally-collected chironomids larvae may not be vectors of specific pathogens, they can be associated with nutritional imbalances and may also result in Pb bioaccumulation and Zn inadequacy in amphibians. Chironomidae larvae may thus not be recommended as single diet item for amphibians. © 2014 Wiley Periodicals, Inc.

  17. Self-heating by large insect larvae?

    Science.gov (United States)

    Cooley, Nikita L; Emlen, Douglas J; Woods, H Arthur

    2016-12-01

    Do insect larvae ever self-heat significantly from their own metabolic activity and, if so, under what sets of environmental temperatures and across what ranges of body size? We examine these questions using larvae of the Japanese rhinoceros beetle (Trypoxylus dichotomus), chosen for their large size (>20g), simple body plan, and underground lifestyle. Using CO 2 respirometry, we measured larval metabolic rates then converted measured rates of gas exchange into rates of heat production and developed a mathematical model to predict how much steady state body temperatures of underground insects would increase above ambient depending on body size. Collectively, our results suggest that large, extant larvae (20-30g body mass) can self-heat by at most 2°C, and under many common conditions (shallow depths, moister soils) would self-heat by less than 1°C. By extending the model to even larger (hypothetical) body sizes, we show that underground insects with masses >1kg could heat, in warm, dry soils, by 1.5-6°C or more. Additional experiments showed that larval critical thermal maxima (CT max ) were in excess of 43.5°C and that larvae could behaviorally thermoregulate on a thermal gradient bar. Together, these results suggest that large larvae living underground likely regulate their temperatures primarily using behavior; self-heating by metabolism likely contributes little to their heat budgets, at least in most common soil conditions. Copyright © 2016 Elsevier Ltd. All rights reserved.

  18. PERKEMBANGAN AWAL LARVA KERAPU KERTANG (Epinephelus lanceolatus

    Directory of Open Access Journals (Sweden)

    Philip Teguh Imanto

    2016-11-01

    Full Text Available Observasi pada larva kerapu kertang (E. lanceolatus dilaksanakan di Balai Besar Riset Perikanan Budidaya Laut (BBRPBL, Gondol-Bali, untuk mengumpulkan informasi dasar tentang perkembangan awal morfologi larva yang penting untuk menunjang keberhasilan pembenihannya. Larva berasal dari telur hasil pemijahan yang dirangsang dengan hormon (di Taiwan dan ditransportasikan segera setelah menetas (D-0 melalui transportasi udara ke laboratotium pembenihan BBRPBL, Gondol. Pengamatan dilakukan dengan memanfaatkan fasilitas tangki 500 L dengan sistem air resirkulasi. Dari data yang dihimpun diketahui bahwa rata-rata panjang total larva (D-1 2,48 mm; D-8 3,17 mm; dan tumbuh dengan cepat mencapai 10,79 mm pada D-19. Kuning telur larva yang berumur sehari (D-1 rata-rata bervolume 150,3 x 10-4 mm3 dan pada hari ketiga terserap 42,61% dan habis pada hari keempat (D-4. Butir minyak larva D-1 sebesar 41,9 x 10-4 mm3 dan masih tersisa sebesar 0,34 x 10-4 mm3 sampai dengan D-6. Mulut larva diperhitungkan sudah mencapai lebar sebesar 200 μm pada D-2. dan mampu untuk memangsa rotifer sejalan dengan pigmentasi mata yang mulai terjadi pada D-2 dan sempurna pada D-3. Dari analisis pertumbuhan terjadi titik belok (flexion point pada D-8 dan setelah itu terjadi kurva pertumbuhan yang cepat y= 0,6747x-2,5508. Berdasarkan hasil observasi tersebut maka pemberian pakan awal untuk larva kerapu kertang sudah bisa diberikan pada D-2 akhir (sore, pada D-8 komposisi pakan alami sudah harus diubah dengan memberikan pakan yang lebih besar dan bernutrisi tinggi. Observation on early development of E. lanceolatus larvae have been conducted in laboratory condition at Gondol Research Institute for Mariculture (GRIM Bali; the purpose was to gain basic data mainly on the larval development stage to support both larval rearing and aquaculture technique of this species. The larvae from egg were produced by induced spawning technique and transported on D-0 to GRIM. Observation have been

  19. Effect of gamma rays on the larvae of Rhipicephalus bursa

    International Nuclear Information System (INIS)

    Gecheva, G.

    1979-01-01

    Rhipicephalus bursa larvae were exposed to a single acute gamma-irradiation from cobalt 60 source in doses from 0.5 to 40 kiloroentgen (kr). Doses higher than 20 kr rilled the larvae, lower than 10 kr produced disturbances in tick development, dependent on radiation; larvae irradiated with 2 to 3 kr started sucking blood as larvae ordinarily do, but could not undergo metamorphosis; larvae irradiated with lower doses (0.5 and 1 kr) had a prolonged metamorphosis, the onset of oviposition was delayed and the percentage of hatched second generation larvae was reduced. (A.B.)

  20. CalCOFI Larvae Counts, Scientific Names CI to CO

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  1. CalCOFI Larvae Counts, Scientific Names DH to EC

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  2. CalCOFI Larvae Counts, Scientific Names TF to U

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  3. CalCOFI Larvae Counts, Scientific Names HJ to ID

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  4. CalCOFI Larvae Counts, Scientific Names AN to AR

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  5. CalCOFI Larvae Counts, Scientific Names SJ to ST

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  6. CalCOFI Larvae Counts, Scientific Names CP to DE

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  7. CalCOFI Larvae Counts, Scientific Names C to CE

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  8. CalCOFI Larvae Counts, Scientific Names EV to GN

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  9. CalCOFI Larvae Counts, Scientific Names V to Z

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  10. CalCOFI Larvae Counts, Scientific Names ED to EU

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  11. CalCOFI Larvae Counts, Scientific Names SD to SI

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  12. CalCOFI Larvae Counts, Scientific Names MB to MO

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  13. CalCOFI Larvae Counts, Scientific Names LJ to MA

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  14. CalCOFI Larvae Counts, Scientific Names AS to BA

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  15. CalCOFI Larvae Counts, Scientific Names SB to SC

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  16. CalCOFI Larvae Counts, Scientific Names MP to NA

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  17. CalCOFI Larvae Counts, Scientific Names SU to TE

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  18. CalCOFI Larvae Counts, Scientific Names PL to PO

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  19. CalCOFI Larvae Counts, Scientific Names IE to LA

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  20. CalCOFI Larvae Counts, Scientific Names A to AM

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  1. CalCOFI Larvae Counts, Scientific Names HB to HI

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  2. CalCOFI Larvae Counts, Scientific Names OM to OX

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  3. CalCOFI Larvae Counts, Scientific Names Q to SA

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  4. CalCOFI Larvae Counts, Scientific Names PP to PZ

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  5. CalCOFI Larvae Counts, Scientific Names GO to HA

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  6. CalCOFI Larvae Counts, Scientific Names NB to OL

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  7. CalCOFI Larvae Counts, Scientific Names LB to LI

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  8. CalCOFI Larvae Counts, Scientific Names BCE to BZ

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  9. CalCOFI Larvae Counts, Scientific Names CD to CH

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  10. CalCOFI Larvae Counts, Scientific Names OY to PI

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  11. Bothid larvae (Pleuronectiformes-Pisces) of the Indian Ocean

    Digital Repository Service at National Institute of Oceanography (India)

    Devi, C.B.L.

    the Indian Ocean, their regional, seasonal as well as diurnal variations. Engyprosopon grandisquamis dominated contributing to 23.2% of the total larvae. Numerically the incidence of bothid larvae suggested a uniform pattern of distribution during the two...

  12. Decapod larvae from the nearshore waters of Karwar

    Digital Repository Service at National Institute of Oceanography (India)

    Nair, V.R.; Paulinose, V.T.

    Abundance of decapod larvae at three stations in Binge Bay, Karwar has been reported based on surface collections taken during the period October 1975 to September 1976. The larvae were very common in the Bay and the postmonsoon months sustained...

  13. Differential expression of IgE and IgG4 specific antibody responses in asymptomatic and chronic human filariasis

    NARCIS (Netherlands)

    Kurniawan, A.; Yazdanbakhsh, M.; van Ree, R.; Aalberse, R.; Selkirk, M. E.; Partono, F.; Maizels, R. M.

    1993-01-01

    A population of 164 adult individuals resident in an area endemic for Brugia malayi lymphatic filariasis has been studied for humoral immune responses to filarial parasites. Antibody levels to Ag extracted from adult worms were determined for each of the IgG subclasses, for IgM and for IgE. The

  14. Primary structure of and immunoglobulin E response to the repeat subunit of gp15/400 from human lymphatic filarial parasites

    NARCIS (Netherlands)

    Paxton, W. A.; Yazdanbakhsh, M.; Kurniawan, A.; Partono, F.; Maizels, R. M.; Selkirk, M. E.

    1993-01-01

    We have isolated and sequenced clones encoding the repeated subunit of the surface-associated glycoprotein gp15/400 from the two nematode species predominantly responsible for lymphatic filariasis in humans: Brugia malayi and Wuchereria bancrofti. The amino acid sequence of the 15-kDa subunit,

  15. Crustacean Larvae-Vision in the Plankton.

    Science.gov (United States)

    Cronin, Thomas W; Bok, Michael J; Lin, Chan

    2017-11-01

    We review the visual systems of crustacean larvae, concentrating on the compound eyes of decapod and stomatopod larvae as well as the functional and behavioral aspects of their vision. Larval compound eyes of these macrurans are all built on fundamentally the same optical plan, the transparent apposition eye, which is eminently suitable for modification into the abundantly diverse optical systems of the adults. Many of these eyes contain a layer of reflective structures overlying the retina that produces a counterilluminating eyeshine, so they are unique in being camouflaged both by their transparency and by their reflection of light spectrally similar to background light to conceal the opaque retina. Besides the pair of compound eyes, at least some crustacean larvae have a non-imaging photoreceptor system based on a naupliar eye and possibly other frontal eyes. Larval compound-eye photoreceptors send axons to a large and well-developed optic lobe consisting of a series of neuropils that are similar to those of adult crustaceans and insects, implying sophisticated analysis of visual stimuli. The visual system fosters a number of advanced and flexible behaviors that permit crustacean larvae to survive extended periods in the plankton and allows them to reach acceptable adult habitats, within which to metamorphose. © The Author 2017. Published by Oxford University Press on behalf of the Society for Integrative and Comparative Biology. All rights reserved. For permissions please email: journals.permissions@oup.com.

  16. Suppressing bullfrog larvae with carbon dioxide

    Science.gov (United States)

    Gross, Jackson A.; Ray, Andrew; Sepulveda, Adam J.; Watten, Barnaby J.; Densmore, Christine L.; Layhee, Megan J.; Mark Abbey-Lambert,; ,

    2014-01-01

    Current management strategies for the control and suppression of the American Bullfrog (Lithobates catesbeianus = Rana catesbeiana Shaw) and other invasive amphibians have had minimal effect on their abundance and distribution. This study evaluates the effects of carbon dioxide (CO2) on pre- and prometamorphic Bullfrog larvae. Bullfrogs are a model organism for evaluating potential suppression agents because they are a successful invader worldwide. From experimental trials we estimated that the 24-h 50% and 99% lethal concentration (LC50 and LC99) values for Bullfrog larvae were 371 and 549 mg CO2/L, respectively. Overall, larvae that succumbed to experimental conditions had a lower body condition index than those that survived. We also documented sublethal changes in blood chemistry during prolonged exposure to elevated CO2. Specifically, blood pH decreased by more than 0.5 pH units after 9 h of exposure and both blood partial pressure of CO2 (pCO2) and blood glucose increased. These findings suggest that CO2 treatments can be lethal to Bullfrog larvae under controlled laboratory conditions. We believe this work represents the necessary foundation for further consideration of CO2 as a potential suppression agent for one of the most harmful invaders to freshwater ecosystems.

  17. (Herklotsichthys quadrimaculatus) Larvae on Sofala Bank

    African Journals Online (AJOL)

    Abstract—Vertical larval fish movement influences their survival and dispersal, hence recruitment variability. This study presents the vertical behaviour of gold- spot herring (Herklotsichthys quadrimaculatus) larvae observed on the Sofala Bank. (Mozambique) throughout a 48-hour period when depth-stratified samples were.

  18. Monograph On Bothid Larvae (Pleuronectiformes - Pisces)

    Digital Repository Service at National Institute of Oceanography (India)

    Devi, C.B.L.

    in the preparation of a descriptive document on the larvae of flat fishes from the Indian Ocean. However, study of the larval forms from the Indian Ocean has been made possible due to the availability of material from the Naga Expedition (1959-61) from the Gulf...

  19. ISOLASI BACILLUS THURINGIENSIS DARI LARVA DAN PENGUJIAN PATOGENISITASNYA TERHADAP LARVA NYAMUK VEKTOR

    Directory of Open Access Journals (Sweden)

    Blondine Ch. P.

    2012-09-01

    Full Text Available A study to evaluate pathogenic organisms as cause of mosquito larvae death was conducted at Wonokerto and Pabelan villages, Salatiga Luar Kota subdistrict, Semarang regency in Central Java from May 1991 through December 1991. Bacterial isolation from dead larvae showed that 31 B. thuringicnsis isolates were obtained from 31 larvae samples collected from 2 location e.g Wonokerto village (3 samples, Pabelan village (28 samples. Nineteen isolates (61,3% showed a pathogenicity of more than 50% to third toward instar larvae of Aedes aegypti and Culex quinquefasciatus respectively 24 hours after exposure. This study shows the possible use of B. thuringiensis for biologic control of mosquitoes which can act as vectors for human diseases.

  20. Lagrangian Observations and Modeling of Marine Larvae

    Science.gov (United States)

    Paris, Claire B.; Irisson, Jean-Olivier

    2017-04-01

    Just within the past two decades, studies on the early-life history stages of marine organisms have led to new paradigms in population dynamics. Unlike passive plant seeds that are transported by the wind or by animals, marine larvae have motor and sensory capabilities. As a result, marine larvae have a tremendous capacity to actively influence their dispersal. This is continuously revealed as we develop new techniques to observe larvae in their natural environment and begin to understand their ability to detect cues throughout ontogeny, process the information, and use it to ride ocean currents and navigate their way back home, or to a place like home. We present innovative in situ and numerical modeling approaches developed to understand the underlying mechanisms of larval transport in the ocean. We describe a novel concept of a Lagrangian platform, the Drifting In Situ Chamber (DISC), designed to observe and quantify complex larval behaviors and their interactions with the pelagic environment. We give a brief history of larval ecology research with the DISC, showing that swimming is directional in most species, guided by cues as diverse as the position of the sun or the underwater soundscape, and even that (unlike humans!) larvae orient better and swim faster when moving as a group. The observed Lagrangian behavior of individual larvae are directly implemented in the Connectivity Modeling System (CMS), an open source Lagrangian tracking application. Simulations help demonstrate the impact that larval behavior has compared to passive Lagrangian trajectories. These methodologies are already the base of exciting findings and are promising tools for documenting and simulating the behavior of other small pelagic organisms, forecasting their migration in a changing ocean.

  1. Feeding frequency and caste differentiation in Bombus terrestris larvae

    NARCIS (Netherlands)

    Ribeiro, M.F.; Velthuis, H.H.W.; Duchateau, Marie José; Tweel, I. van der

    1998-01-01

    The frequency with which bumble bee larvae are fed during their development was studied using video-recordings. The behaviour of the workers while feeding worker, male and queen larvae of Bombus terrestris was recorded. At the beginning of development, female larvae of both castes were fed at a

  2. Larva migrans visceral: relato de caso Visceral larva migrans: case report

    Directory of Open Access Journals (Sweden)

    Alexandre Bortoli Machado

    2003-04-01

    Full Text Available Larva migrans visceral é doença infecciosa, adquirida por ingestão de ovos provenientes dos vermes Toxocara canis e/ou Toxocara cati que infestam cães e gatos; as larvas penetram a parede intestinal e migram através dos tecidos levando a alterações diversas, conseqüentes a uma resposta inflamatória imune.¹ Os autores descrevem um caso clínico de larva migrans visceral com apresentação clínica atípica.Visceral larva migrans is an infectious human disease that occurs following ingestion of eggs from the environment originating from roundworms which commonly infect dogs and cats, Toxocara canis and Toxocara cati. The larvae penetrate the gut wall and migrate through the tissues causing disorders consequent to an inflammatory immune response¹. The authors describe a clinical case of visceral larva migrans with an unusual clinical presentation and also its clinical aspects, diagnosis and treatment are reviewed.

  3. Lethal infection thresholds of Paenibacillus larvae for honeybee drone and worker larvae (Apis mellifera).

    Science.gov (United States)

    Behrens, Dieter; Forsgren, Eva; Fries, Ingemar; Moritz, Robin F A

    2010-10-01

    We compared the mortality of honeybee (Apis mellifera) drone and worker larvae from a single queen under controlled in vitro conditions following infection with Paenibacillus larvae, a bacterium causing the brood disease American Foulbrood (AFB). We also determined absolute P. larvae cell numbers and lethal titres in deceased individuals of both sexes up to 8 days post infection using quantitative real-time PCR (qPCR). Our results show that in drones the onset of infection induced mortality is delayed by 1 day, the cumulative mortality is reduced by 10% and P. larvae cell numbers are higher than in worker larvae. Since differences in bacterial cell titres between sexes can be explained by differences in body size, larval size appears to be a key parameter for a lethal threshold in AFB tolerance. Both means and variances for lethal thresholds are similar for drone and worker larvae suggesting that drone resistance phenotypes resemble those of related workers. © 2010 Society for Applied Microbiology and Blackwell Publishing Ltd.

  4. Development of lymphatic filarial parasite Wuchereria bancrofti (Spirurida: Onchocercidae) in mosquito species (Diptera: Culicidae) fed artificially on microfilaremic blood.

    Science.gov (United States)

    Paily, K P; Hoti, S L; Balaraman, K

    2006-11-01

    The efficiency of laboratory colonies of mosquitoes such as Anopheles stephensi Liston, Aedes aegypti (L.) Liverpool strain, Ae. aegypti wild type, Aedes albopictus (Skuse), Culex tritaeniorhynchus Giles, Culex sitiens Wiedemann, and Armigeres subalbatus Coquillett in supporting the development of Wuchereria bancrofti (Cobbold) (Spirurida: Onchocercidae) microfilariae to infective larvae was investigated. The mosquitoes were fed on heparinized microfilaremic human blood by using a membrane-feeding unit with Parafilm as membrane. The rate of infection, parasite development, and parasite burden were compared with that in the known vector mosquito Culex quinquefasciatus Say. Cx. quinquefasciatus showed the highest percentage of infection, followed by Ae. aegypti Liverpool strain and An. stephensi. The rate of development of the parasite was more or less similar in all the three species, and infective larvae were found on day 13. When the larvae were harvested on day 17, Cx. quinquefasciatus yielded the highest numbers, followed by Ae. aegypti Liverpool strain and An. stephensi. The percentage of infection was low, and the development was slow in Cx. tritaeniorhynchus compared with the other susceptible species. The parasite developed to second-stage larvae only by day 22 and to infective larvae by day 28. When 2-wk-old Cx. tritaeniorhynchus were fed on microfilaremic blood, they could develop the parasite to infective larvae by day 13 postfeeding. All other species of mosquitoes tested were found to be refractory to parasite development. It is shown that Cx. quinquefasciatus is the most suitable mosquito host for the production of infective larvae. However, Ae. aegypti Liverpool strain, which is commonly used for Brugia malayi filarial parasite, also can be used for generation of W. bancrofti infective larvae to circumvent the problem of maintaining two mosquito species.

  5. Analysis of feeding behavior of Drosophila larvae on liquid food.

    Science.gov (United States)

    Shen, Ping

    2012-05-01

    The food responses of Drosophila larvae offer an excellent opportunity to study the genetic and neural regulation of feeding behavior. Compared with fed larvae, hungry larvae are more likely to display aggressive foraging, rapid food intake, compensatory feeding, and stress-resistant food procurement. Behavioral assays have been developed to quantitatively assess particular aspects of the hunger-driven food response. In combination, these assays help define the specific role of signaling molecules or neurons in the regulation of feeding behavior in foraging larvae. This protocol describes the analysis of larvae feeding on liquid food. The test is designed for quantitative assessment of the food ingestion rate of individual larvae under different energy states. It provides a simple and reliable way to measure the graded modification of the baseline feeding rate of larvae as food deprivation is prolonged. The test is applicable to routine functional testing and larger-scale screening of genetic mutations and biologics that might affect food consumption.

  6. Caffeine taste signaling in Drosophila larvae

    Directory of Open Access Journals (Sweden)

    Anthi A Apostolopoulou

    2016-08-01

    Full Text Available The Drosophila larva has a simple peripheral nervous system with a comparably small number of sensory neurons located externally at the head or internally along the pharynx to assess its chemical environment. It is assumed that larval taste coding occurs mainly via external organs (the dorsal, terminal and ventral organ. However, the contribution of the internal pharyngeal sensory organs has not been explored. Here we find that larvae require a single pharyngeal gustatory receptor neuron pair called D1, which is located in the dorsal pharyngeal sensilla, in order to avoid caffeine and to associate an odor with caffeine punishment. In contrast, caffeine-driven reduction in feeding in non-choice situations does not require D1. Hence, this work provides data on taste coding via different receptor neurons, depending on the behavioral context. Furthermore, we show that the larval pharyngeal system is involved in bitter tasting. Using ectopic expressions, we show that the caffeine receptor in neuron D1 requires the function of at least four receptor genes: the putative coreceptors Gr33a, Gr66a, the putative caffeine-specific receptor Gr93a, and yet unknown additional molecular component(s. This suggests that larval taste perception is more complex than previously assumed already at the sensory level. Taste information from different sensory organs located outside at the head or inside along the pharynx of the larva is assembled to trigger taste guided behaviours.

  7. Feeding behavior of giant gourami, Osphronemus gouramy (Lacepede larvae

    Directory of Open Access Journals (Sweden)

    Thumronk Amornsakun

    2014-06-01

    Full Text Available Feeding experiments were carried out in 15-liter glass aquaria with 10 liters of water containing 1000 larvae aged 1.5 days post-hatching (before mouth opening in three replicates. It was found that the feeding scheme of larval giant gourami aged 5-17 days (TL 8.36-13.40 mm consumed Moina. The larvae aged 14-17 days (TL 12.40-13.40 mm consumed both Moina and artificial pellet. Larvae aged more than 18-days (TL 13.60 mm consumed only artificial pellet. Daily food uptake by the larvae and juvenile were determined in a 15-liter aquaria (water volume 10 liters containing 500 larvae. The larvae were fed with Moina at density of 10 ind/ml. Aquaria without larvae were also set for a control of natural fluctuation in food density. The amount of food intake was calculated based on changes of food density in the aquarium with and without fish larvae. It was found the average uptake of Moina in digestive tract per day of larvae aged 5, 8, 11, 14 and 17 days old were 38, 52, 182, 205 and 266 individual/larva, respectively at density of 1.27, 1.73, 6.07, 6.83, and 8.87 individual/ml, respectively.

  8. The Identification of Congeners and Aliens by Drosophila Larvae.

    Directory of Open Access Journals (Sweden)

    Francisco Del Pino

    Full Text Available We investigated the role of Drosophila larva olfactory system in identification of congeners and aliens. We discuss the importance of these activities in larva navigation across substrates, and the implications for allocation of space and food among species of similar ecologies. Wild type larvae of cosmopolitan D. melanogaster and endemic D. pavani, which cohabit the same breeding sites, used species-specific volatiles to identify conspecifics and aliens moving toward larvae of their species. D. gaucha larvae, a sibling species of D. pavani that is ecologically isolated from D. melanogaster, did not respond to melanogaster odor cues. Similar to D. pavani larvae, the navigation of pavani female x gaucha male hybrids was influenced by conspecific and alien odors, whereas gaucha female x pavani male hybrid larvae exhibited behavior similar to the D. gaucha parent. The two sibling species exhibited substantial evolutionary divergence in processing the odor inputs necessary to identify conspecifics. Orco (Or83b mutant larvae of D. melanogaster, which exhibit a loss of sense of smell, did not distinguish conspecific from alien larvae, instead moving across the substrate. Syn97CS and rut larvae of D. melanogaster, which are unable to learn but can smell, moved across the substrate as well. The Orco (Or83b, Syn97CS and rut loci are necessary to orient navigation by D. melanogaster larvae. Individuals of the Trana strain of D. melanogaster did not respond to conspecific and alien larval volatiles and therefore navigated randomly across the substrate. By contrast, larvae of the Til-Til strain used larval volatiles to orient their movement. Natural populations of D. melanogaster may exhibit differences in identification of conspecific and alien larvae. Larval locomotion was not affected by the volatiles.

  9. Transcriptional response of honey bee larvae infected with the bacterial pathogen Paenibacillus larvae.

    Science.gov (United States)

    Cornman, Robert Scott; Lopez, Dawn; Evans, Jay D

    2013-01-01

    American foulbrood disease of honey bees is caused by the bacterium Paenibacillus larvae. Infection occurs per os in larvae and systemic infection requires a breaching of the host peritrophic matrix and midgut epithelium. Genetic variation exists for both bacterial virulence and host resistance, and a general immunity is achieved by larvae as they age, the basis of which has not been identified. To quickly identify a pool of candidate genes responsive to P. larvae infection, we sequenced transcripts from larvae inoculated with P. larvae at 12 hours post-emergence and incubated for 72 hours, and compared expression levels to a control cohort. We identified 75 genes with significantly higher expression and six genes with significantly lower expression. In addition to several antimicrobial peptides, two genes encoding peritrophic-matrix domains were also up-regulated. Extracellular matrix proteins, proteases/protease inhibitors, and members of the Osiris gene family were prevalent among differentially regulated genes. However, analysis of Drosophila homologs of differentially expressed genes revealed spatial and temporal patterns consistent with developmental asynchrony as a likely confounder of our results. We therefore used qPCR to measure the consistency of gene expression changes for a subset of differentially expressed genes. A replicate experiment sampled at both 48 and 72 hours post infection allowed further discrimination of genes likely to be involved in host response. The consistently responsive genes in our test set included a hymenopteran-specific protein tyrosine kinase, a hymenopteran specific serine endopeptidase, a cytochrome P450 (CYP9Q1), and a homolog of trynity, a zona pellucida domain protein. Of the known honey bee antimicrobial peptides, apidaecin was responsive at both time-points studied whereas hymenoptaecin was more consistent in its level of change between biological replicates and had the greatest increase in expression by RNA-seq analysis.

  10. SEBARAN LARVA IKAN DAN KAITANNYA DENGAN KONDISI OSEANOGRAFI LAUT SULAWESI

    Directory of Open Access Journals (Sweden)

    Khairul Amri

    2015-06-01

    Full Text Available Laut Sulawesi diketahui sebagai daerah penangkapan ikan yang potensial sekaligus diduga sebagai lokasi pemijahan. Berbagai jenis larva ikan pelagis maupun demersal ditemukan di perairan ini. Kelimpahan dan sebaran larva ikan di suatu perairan sangat dipengaruhi oleh kondisi oseanografi seperti temperatur, salinitas dan sejumlah parameter lainnya termasuk ketersediaan pakan. Untuk mengetahui pengaruh parameter oseanografi terhadap kelimpahan dan sebaran spasial larva ikan di Laut Sulawesi, telah dilakukan penelitian menggunakan kapal riset KR Baruna Jaya VII pada Oktober 2012. Parameter oseanografi yaitu temperatur dan salinitas diukur menggunakan iCTD dan sampling larva menggunakan bonggo net pada 18 stasiun pengukuran. Analisa hubungan kondisi oseanografi dengan sebaran larva dilakukan secara deskriptif dan pemetaan sebarannya dilakukan secara spasial. Hasil menunjukan keterkaitan sejumlah parameter oseanografi dengan kelimpahan dan sebaran spasial larva ikan. Sebaran larva famili Scombroidae dominan berada pada perairan bersalinitas tinggi karena merupakan jenis ikan oseanik. Larva ikan demersal banyak ditemukan di perairan sekitar Kep.Sangihe Talaud. Kelimpahan larva tertinggi ditemukan di perairan bagian utara dan barat lokasi penelitian dimana kelimpahan plankton tinggi ditemukan.   Celebes Sea is known as a potential fishing and spawning grounds for several pelagic fish species. Abundance and distribution of fish larvae are allegedly linked to oceanographic conditions such as temperature, salinity and others oceanographic parameters including food availablity. To see the effect of oceanographic on the abundance and spatial distribution of fish larvae in the Celebes Sea, has conducted a research in October 2012using the research vessel KR Baruna Jaya VII. The measurement of oceanographic parameters including temperature and salinity and larval sampling were done respectively by using iCTD and Bonggo net at 18 measuring stations. The

  11. Analysis of feeding behavior of Drosophila larvae on solid food.

    Science.gov (United States)

    Shen, Ping

    2012-05-01

    The food responses of Drosophila larvae offer an excellent opportunity to study the genetic and neural regulation of feeding behavior. Compared with fed larvae, hungry larvae are more likely to display aggressive foraging, rapid food intake, compensatory feeding, and stress-resistant food procurement. Behavioral assays have been developed to quantitatively assess particular aspects of the hunger-driven food response. In combination, these assays help define the specific role of signaling molecules or neurons in the regulation of feeding behavior in foraging larvae. This protocol is designed for quantitative assessment of the willingness of individual larvae to procure solid food under different energy states. It provides a simple and reliable way to measure the graded modification of the baseline feeding rate of larvae as the period of food deprivation is increased. The test is applicable to routine functional testing and larger-scale screening of genetic mutations and biologics that might affect food consumption.

  12. Modeling peripheral olfactory coding in Drosophila larvae.

    Directory of Open Access Journals (Sweden)

    Derek J Hoare

    Full Text Available The Drosophila larva possesses just 21 unique and identifiable pairs of olfactory sensory neurons (OSNs, enabling investigation of the contribution of individual OSN classes to the peripheral olfactory code. We combined electrophysiological and computational modeling to explore the nature of the peripheral olfactory code in situ. We recorded firing responses of 19/21 OSNs to a panel of 19 odors. This was achieved by creating larvae expressing just one functioning class of odorant receptor, and hence OSN. Odor response profiles of each OSN class were highly specific and unique. However many OSN-odor pairs yielded variable responses, some of which were statistically indistinguishable from background activity. We used these electrophysiological data, incorporating both responses and spontaneous firing activity, to develop a bayesian decoding model of olfactory processing. The model was able to accurately predict odor identity from raw OSN responses; prediction accuracy ranged from 12%-77% (mean for all odors 45.2% but was always significantly above chance (5.6%. However, there was no correlation between prediction accuracy for a given odor and the strength of responses of wild-type larvae to the same odor in a behavioral assay. We also used the model to predict the ability of the code to discriminate between pairs of odors. Some of these predictions were supported in a behavioral discrimination (masking assay but others were not. We conclude that our model of the peripheral code represents basic features of odor detection and discrimination, yielding insights into the information available to higher processing structures in the brain.

  13. Learning and memory in zebrafish larvae

    Science.gov (United States)

    Roberts, Adam C.; Bill, Brent R.; Glanzman, David L.

    2013-01-01

    Larval zebrafish possess several experimental advantages for investigating the molecular and neural bases of learning and memory. Despite this, neuroscientists have only recently begun to use these animals to study memory. However, in a relatively short period of time a number of forms of learning have been described in zebrafish larvae, and significant progress has been made toward their understanding. Here we provide a comprehensive review of this progress; we also describe several promising new experimental technologies currently being used in larval zebrafish that are likely to contribute major insights into the processes that underlie learning and memory. PMID:23935566

  14. A Madurella mycetomatis Grain Model in Galleria mellonella Larvae.

    Directory of Open Access Journals (Sweden)

    Wendy Kloezen

    Full Text Available Eumycetoma is a chronic granulomatous subcutaneous infectious disease, endemic in tropical and subtropical regions and most commonly caused by the fungus Madurella mycetomatis. Interestingly, although grain formation is key in mycetoma, its formation process and its susceptibility towards antifungal agents are not well understood. This is because grain formation cannot be induced in vitro; a mammalian host is necessary to induce its formation. Until now, invertebrate hosts were never used to study grain formation in M. mycetomatis. In this study we determined if larvae of the greater wax moth Galleria mellonella could be used to induce grain formation when infected with M. mycetomatis. Three different M. mycetomatis strains were selected and three different inocula for each strain were used to infect G. mellonella larvae, ranging from 0.04 mg/larvae to 4 mg/larvae. Larvae were monitored for 10 days. It appeared that most larvae survived the lowest inoculum, but at the highest inoculum all larvae died within the 10 day observation period. At all inocula tested, grains were formed within 4 hours after infection. The grains produced in the larvae resembled those formed in human and in mammalian hosts. In conclusion, the M. mycetomatis grain model in G. mellonella larvae described here could serve as a useful model to study the grain formation and therapeutic responses towards antifungal agents in the future.

  15. Fate of pharmaceuticals and pesticides in fly larvae composting

    Energy Technology Data Exchange (ETDEWEB)

    Lalander, C., E-mail: cecilia.lalander@slu.se [Department of Energy and Technology, Swedish University of Agricultural Sciences (Sweden); Senecal, J.; Gros Calvo, M. [Department of Energy and Technology, Swedish University of Agricultural Sciences (Sweden); Ahrens, L.; Josefsson, S.; Wiberg, K. [Department of Aquatic Sciences and Assessment, Swedish University of Agricultural Sciences (Sweden); Vinnerås, B. [Department of Energy and Technology, Swedish University of Agricultural Sciences (Sweden)

    2016-09-15

    A novel and efficient organic waste management strategy currently gaining great attention is fly larvae composting. High resource recovery efficiency can be achieved in this closed-looped system, but pharmaceuticals and pesticides in waste could potentially accumulate in every loop of the treatment system and spread to the environment. This study evaluated the fate of three pharmaceuticals (carbamazepine, roxithromycin, trimethoprim) and two pesticides (azoxystrobin, propiconazole) in a fly larvae composting system and in a control treatment with no larvae. It was found that the half-life of all five substances was shorter in the fly larvae compost (< 10% of control) and no bioaccumulation was detected in the larvae. Fly larvae composting could thus impede the spread of pharmaceuticals and pesticides into the environment. - Highlights: • Degradation of pharmaceuticals and pesticides in fly larvae composting (FLC). • Half-life considerably shorter in FLC than in control with no larvae. • Half-life of carbamazepine was less than two days in FLC. • No bioaccumulation in larvae detected. • FLC could impede the spreading of pharmaceuticals and pesticide in the environment.

  16. Fate of pharmaceuticals and pesticides in fly larvae composting

    International Nuclear Information System (INIS)

    Lalander, C.; Senecal, J.; Gros Calvo, M.; Ahrens, L.; Josefsson, S.; Wiberg, K.; Vinnerås, B.

    2016-01-01

    A novel and efficient organic waste management strategy currently gaining great attention is fly larvae composting. High resource recovery efficiency can be achieved in this closed-looped system, but pharmaceuticals and pesticides in waste could potentially accumulate in every loop of the treatment system and spread to the environment. This study evaluated the fate of three pharmaceuticals (carbamazepine, roxithromycin, trimethoprim) and two pesticides (azoxystrobin, propiconazole) in a fly larvae composting system and in a control treatment with no larvae. It was found that the half-life of all five substances was shorter in the fly larvae compost (< 10% of control) and no bioaccumulation was detected in the larvae. Fly larvae composting could thus impede the spread of pharmaceuticals and pesticides into the environment. - Highlights: • Degradation of pharmaceuticals and pesticides in fly larvae composting (FLC). • Half-life considerably shorter in FLC than in control with no larvae. • Half-life of carbamazepine was less than two days in FLC. • No bioaccumulation in larvae detected. • FLC could impede the spreading of pharmaceuticals and pesticide in the environment.

  17. Nutritional condition and vertical distribution of Baltic cod larvae

    DEFF Research Database (Denmark)

    Grønkjær, P.; Clemmesen, C.; St. John, Michael

    1997-01-01

    Newly hatched Baltic cod Gadus morhua larvae are typically found at depths >60 m. This is a region of low light and prey availability, hence generating the hypothesis that larvae have to migrate from hatching depth to the surface layer to avoid starvation and improve their nutritional condition...... aged 2-25 days (median 10 days) ranged from 0.4 to 6.2, corresponding to levels exhibited by starving and fast growing larvae in laboratory calibration studies (starvation, protein growth rate, G(pi)=-12.2% day(-1); fast-growing larvae, G(pi)=14.1% day(-1)) respectively. Seventy per cent of the field...

  18. Effect of gut bacterial isolates from Apis mellifera jemenitica on Paenibacillus larvae infected bee larvae.

    Science.gov (United States)

    Al-Ghamdi, Ahmad; Ali Khan, Khalid; Javed Ansari, Mohammad; Almasaudi, Saad B; Al-Kahtani, Saad

    2018-02-01

    The probiotic effects of seven newly isolated gut bacteria, from the indegenous honey bees of Saudi Arabia were investigated. In vivo bioassays were used to investigate the effects of each gut bacterium namely, Fructobacillus fructosus (T1), Proteus mirabilis (T2), Bacillus licheniformis (T3), Lactobacillus kunkeei (T4), Bacillus subtilis (T5), Enterobacter kobei (T6), and Morganella morganii (T7) on mortality percentage of honey bee larvae infected with P. larvae spores along with negative control (normal diet) and positive control (normal diet spiked with P. larvae spores). Addition of gut bacteria to the normal diet significantly reduced the mortality percentage of the treated groups. Mortality percentage in all treated groups ranged from 56.67% up to 86.67%. T6 treated group exhibited the highest mortality (86.67%), whereas T4 group showed the lowest mortality (56.67%). Among the seven gut bacterial treatments, T4 and T3 decreased the mortality 56.67% and 66.67%, respectively, whereas, for T2, T6, and T7 the mortality percentage was equal to that of the positive control (86.67%). Mortality percentages in infected larval groups treated with T1, and T5 were 78.33% and 73.33% respectively. Most of the mortality occurred in the treated larvae during days 2 and 3. Treatments T3 and T4 treatments showed positive effects and reduced mortality.

  19. Effect of gut bacterial isolates from Apis mellifera jemenitica on Paenibacillus larvae infected bee larvae

    Directory of Open Access Journals (Sweden)

    Ahmad Al-Ghamdi

    2018-02-01

    Full Text Available The probiotic effects of seven newly isolated gut bacteria, from the indegenous honey bees of Saudi Arabia were investigated. In vivo bioassays were used to investigate the effects of each gut bacterium namely, Fructobacillus fructosus (T1, Proteus mirabilis (T2, Bacillus licheniformis (T3, Lactobacillus kunkeei (T4, Bacillus subtilis (T5, Enterobacter kobei (T6, and Morganella morganii (T7 on mortality percentage of honey bee larvae infected with P. larvae spores along with negative control (normal diet and positive control (normal diet spiked with P. larvae spores. Addition of gut bacteria to the normal diet significantly reduced the mortality percentage of the treated groups. Mortality percentage in all treated groups ranged from 56.67% up to 86.67%. T6 treated group exhibited the highest mortality (86.67%, whereas T4 group showed the lowest mortality (56.67%. Among the seven gut bacterial treatments, T4 and T3 decreased the mortality 56.67% and 66.67%, respectively, whereas, for T2, T6, and T7 the mortality percentage was equal to that of the positive control (86.67%. Mortality percentages in infected larval groups treated with T1, and T5 were 78.33% and 73.33% respectively. Most of the mortality occurred in the treated larvae during days 2 and 3. Treatments T3 and T4 treatments showed positive effects and reduced mortality.

  20. Biofilms and Marine Invertebrate Larvae: What Bacteria Produce That Larvae Use to Choose Settlement Sites

    Science.gov (United States)

    Hadfield, Michael G.

    2011-01-01

    Communities of microorganisms form thin coats across solid surfaces in the sea. Larvae of many marine invertebrates use biofilm components as cues to appropriate settlement sites. Research on the tube-dwelling polychaete worm Hydroides elegans, a globally common member of biofouling communities, is described to exemplify approaches to understanding biofilm bacteria as a source of settlement cues and larvae as bearers of receptors for bacterial cues. The association of species of the bacterial genus Pseudoalteromonas with larval settlement in many phyla is described, and the question of whether cues are soluble or surface-bound is reviewed, concluding that most evidence points to surface-bound cues. Seemingly contradictory data for stimulation of barnacle settlement are discussed; possibly both explanations are true. Paleontological evidence reveals a relationship between metazoans and biofilms very early in metazoan evolution, and thus the receptors for bacterial cues of invertebrate larvae are very old and possibly unique. Finally, despite more than 60 years of intense investigation, we still know very little about either the bacterial ligands that stimulate larval settlement or the cellular basis of their detection by larvae.

  1. PERKEMBANGAN ENZIM PENCERNAAN LARVA IKAN PATIN, Pangasius hypophthalmus sp.

    Directory of Open Access Journals (Sweden)

    Irzal Effendi

    2003-05-01

    Full Text Available Development of digestive enzymes; protease, lipase and amylase were observed in patin catfish, Pangasius hypophthalmus, larvae.  The 1 day old larvae (day after hatching, with 3,37-3,97 mm length and 0,62-0,79 mg weight, were reared in aquarium 60x50x40 cm with stocking  density of 20 fish/l.  Larvae were fed  Artemia dan tubificid worms 2-8 dan 7-15 days after hatching (dAH,  respectively (schedule I;  2-6 and  5-15 dAH (schedule II; and 2-4 and 5-15 dAH (schedule III.  Chlorella was ready to eat by larvae at the entirely rearing.  For enzyme assay, larvae were sampled from each aquarium at stages of 1, 2, 3, 5, 7, 10 and 15 dAH.    Protease and lipase activity were detected in digestive tract of  1 dAH larvae.   Digestive enzymes development have a similar pattern in larvae for all feeding schedules.  Protease activity  decreased with the increasing of age until 3 dAH, then increased  until the larvae reached 7 dAH, and sharply decreased until 10 dAH and then slowly decreased thereafter. Lipase activity tended to increase slowly with age up to 3 dAH, and increased sharply until 5 dAH, and then decreased sharply until 7 dAH  before decreased again up to the end of rearing.  Amylase activity in larvae increased slowly with the increasing of age up to 5 dAH, then increased sharply until 7 dAH, and decreased thereafter.  In dimly lighted larvae, amylase activity decreased before increased up to 12 d AH, then decreased thereafter.  The amount of food organisms in larval gut, body weight and length, and survival rate of larvae were also measured and discussed.Key Words:  Digestive enzymes, development, larvae, patin catfish, Pangasius hypophthalmus ABSTRAKPenelitian ini bertujuan untuk mengetahui perkembangan enzim protease, lipase dan amilase saluran pencernaan larva ikan patin akibat perubahan skedul pemberian pakan.  Larva ikan patin (panjang 3,77–3,97 mm dan bobot 0,62-0,79 mg berumur 1 hari dipelihara di akuarium 60x

  2. Complete Genome Sequence of Paenibacillus larvae MEX14, Isolated from Honey Bee Larvae from the Xochimilco Quarter in Mexico City.

    Science.gov (United States)

    Peréz de la Rosa, D; Pérez de la Rosa, J J; Cossio-Bayugar, R; Miranda-Miranda, E; Lozano, L; Bravo-Díaz, M A; Rocha-Martínez, M K; Sachman-Ruiz, B

    2015-08-27

    Paenibacillus larvae strain MEX14 is a facultative anaerobic endospore-forming bacterium that infects Apis mellifera larvae. Strain MEX14 was isolated from domestic bee larvae collected in a backyard in Mexico City. The estimated genome size was determined to be 4.18 Mb, and it harbors 4,806 protein coding genes (CDSs). Copyright © 2015 Peréz de la Rosa et al.

  3. Fish larvae from the Gulf of California

    Directory of Open Access Journals (Sweden)

    Gerardo Aceves-Medina

    2003-03-01

    Full Text Available Taxonomic composition of fish larvae was analysed from 464 plankton samples obtained during 10 oceanographic surveys in the Gulf of California between 1984 and 1988. We identified 283 taxa: 173 species, 57 genera, and 53 families. Tropical and subtropical species predominated except during the winter, when temperate-subarctic species were dominant. The most abundant species were the mesopelagic Benthosema panamense, Triphoturus mexicanus and Vinciguerria lucetia, but the coastal pelagic species Engraulis mordax, Opisthonema spp., Sardinops caeruleus and Scomber japonicus were also prominent. The taxonomic composition of the ichthyoplankton shows the seasonality of the Gulf as well as environmental changes that occurred between the 1984-1987 warm period and the 1956-1957 cool period previously reported. The presence of E. mordax larvae as one of the most abundant species in the Gulf provides evidence of the reproduction of this species two years before the development of the northern anchovy fishery and the decline of the sardine fishery in the Gulf of California.

  4. Screening of the ‘Open Scaffolds’ collection from Compounds Australia identifies a new chemical entity with anthelmintic activities against different developmental stages of the barber's pole worm and other parasitic nematodes

    Directory of Open Access Journals (Sweden)

    Sarah Preston

    2017-12-01

    Full Text Available The discovery and development of novel anthelmintic classes is essential to sustain the control of socioeconomically important parasitic worms of humans and animals. With the aim of offering novel, lead-like scaffolds for drug discovery, Compounds Australia released the ‘Open Scaffolds’ collection containing 33,999 compounds, with extensive information available on the physicochemical properties of these chemicals. In the present study, we screened 14,464 prioritised compounds from the ‘Open Scaffolds’ collection against the exsheathed third-stage larvae (xL3s of Haemonchus contortus using recently developed whole-organism screening assays. We identified a hit compound, called SN00797439, which was shown to reproducibly reduce xL3 motility by ≥ 70%; this compound induced a characteristic, “coiled” xL3 phenotype (IC50 = 3.46–5.93 μM, inhibited motility of fourth-stage larvae (L4s; IC50 = 0.31–12.5 μM and caused considerable cuticular damage to L4s in vitro. When tested on other parasitic nematodes in vitro, SN00797439 was shown to inhibit (IC50 = 3–50 μM adults of Ancylostoma ceylanicum (hookworm and first-stage larvae of Trichuris muris (whipworm and eventually kill (>90% these stages. Furthermore, this compound completely inhibited the motility of female and male adults of Brugia malayi (50–100 μM as well as microfilariae of both B. malayi and Dirofilaria immitis (heartworm. Overall, these results show that SN00797439 acts against genetically (evolutionarily distant parasitic nematodes i.e. H. contortus and A. ceylanicum [strongyloids] vs. B. malayi and D. immitis [filarioids] vs. T. muris [enoplid], and, thus, might offer a novel, lead-like scaffold for the development of a relatively broad-spectrum anthelmintic. Our future work will focus on assessing the activity of SN00797439 against other pathogens that cause neglected tropical diseases, optimising analogs with improved biological activities and

  5. Efektivitas Bacillus thuringiensis dalam Pengendalian Larva Nyamuk Anopheles sp.

    Directory of Open Access Journals (Sweden)

    Citra Inneke Wibowo

    2017-08-01

    Full Text Available Nyamuk Anopheles sp adalah vektor penyakit malaria. Pengendalian vektor penyakit malaria dapat dilakukan secara biologis yaitu dengan menggunakan Bacillus thuringiensis. Tujuan penelitian adalah untuk mengetahui efektivitas konsentrasi Bacillus thuringiensis dalam pengendalian larva nyamuk Anopheles sp.Penelitian ini dilakukan secara eksperimental menggunakan Rancangan Acak Lengkap Faktorial (RAL Faktorial yang terdiri atas dua faktor yaitu konsentrasi Bacillus thuringiensis dan stadia larva Anopheles dengan pengulangan tiga kali.Perlakuan yang dicobakan adalahkonsentrasi Bacillus thuringiensis (A yang terdiri atas 5 taraf:A0: konsentrasi B.thuringiensis 0 CFU.mL-1, A1: konsentrasi B.thuringiensis 102 CFU.mL-1, A2: konsentrasi B.thuringiensis 104 CFU.mL-1, A3: konsentrasi B.thuringiensis 106CFU.mL-1, A4: konsentrasi B.thuringiensis 108CFU.mL-1. Perlakuan tahapan instar larva Anopheles sp. (B adalah sebagai berikut:B1: stadia larva instar I, B2: stadia larva instar II, B3: stadia larva instar III, B4: stadia larva instar IVsehingga terdapat 60 satuan percobaan. Hasil penelitian  menunjukkan konsentrasi B. thuringiensis isolat CK dan IPB CC yang paling berpengaruh dalam pengendalian larva Anopheles sp adalah 108 CFU.mL-1 . Instar larva yang paling peka terhadap B. thuringiensis isolat IPB CC adalah instar I dan II sedangkan instar yang peka terhadap isolat CK adalah instar II, Perlakuan konsentrasi isolat B. thuringiensis dan tingkat instar larva yang paling baik dalam pengendalian larva Anopheles sp. adalah 108 CFU.mL-1, dan instar I dan II.

  6. Rapid bioassay to screen potential biopesticides in Tenebrio molitor larvae

    Science.gov (United States)

    A simplified assay was devised to evaluate the response of Tenebrio molitor larvae to potential insect control products. The assay incorporates punched disks of flattened whole-grain bread placed in 96-well plates, with treatments applied topically, and neonate larvae added to each well. To evalua...

  7. The larva of Paracapnia disala (Jewett) (Plecoptera: Capniidae)

    Science.gov (United States)

    Kenneth W. Stewart

    2010-01-01

    The larva of Paracapnia disala (Jewett) was associated from two first order headwater streams in the H.J. Andrews Experimental Forest, Oregon, U.S.A. Larvae of this first western Paracapnia species to be associated, were studied and compared morphologically with those of the eastern Paracapnia angulata...

  8. Occurrence of digenean larvae in freshwater snails in the Ruvu ...

    African Journals Online (AJOL)

    Occurrence of digenean larvae in freshwater snails in the Ruvu basin, Tanzania. G Nkwengulila, ESP Kigadye. Abstract. A survey was carried out on digenean larvae infecting freshwater snails in five habitats in Dar es Salaam, Ruvu and Morogoro. 9424 snails belonging to 12 species from five families were examined for ...

  9. The occurrence of digenean larvae in freshwater snails at Mbezi ...

    African Journals Online (AJOL)

    The occurrence of digenean larvae in freshwater snails at Mbezi-Temboni pond, Dar es Salaam. ESP Kigadye, G Nkwengulila. Abstract. The abundance of digenean larvae in snails at a pond in Mbezi-Temboni, Dar es Salaam, was investigated from July 1996 to June 1997. A total of 2,112 snails belonging to three species, ...

  10. Preliminary screening of plant essential oils against larvae of Culex ...

    African Journals Online (AJOL)

    Preliminary screenings of 22 plant essential oils were tested for mortality of the mosquito larvae Culex quinquefasciatus under laboratory conditions. Percent (%) mortality of the mosquito larvae were obtained for each essential oil. At different exposure periods, viz. 1, 3, 6, 12 and 24 h among the 22 plant oils tested, eight ...

  11. Cutaneous larva migrans: a bad souvenir from the vacation.

    Science.gov (United States)

    Criado, Paulo Ricardo; Belda, Walter; Vasconcellos, Cidia; Silva, Cristiana Silveira

    2012-06-15

    Cutaneous larva migrans (CLM) is a common endemic disease in tropical and subtropical countries. This condition is caused by skin-penetrating larvae of nematodes, mainly of the hookworm Ancylostoma braziliense and other nematodes of the family Ancylostomidae. We report three cases of CLM acquired during vacations in different regions of Brazil.

  12. Cultivation of sponge larvae: settlement, survival, and growth of juveniles

    NARCIS (Netherlands)

    Caralt, de S.; Otjens, H.; Uriz, M.J.; Wijffels, R.H.

    2007-01-01

    The aim of this study was to culture sponge juveniles from larvae. Starting from larvae we expected to enhance the survival and growth, and to decrease the variation in these parameters during the sponge cultures. First, settlement success, morphological changes during metamorphosis, and survival of

  13. Structure and occurrence of cyphonautes larvae (Bryozoa, Ectoprocta)

    DEFF Research Database (Denmark)

    Nielsen, Claus; Worsaae, Katrine

    2010-01-01

    We have studied larvae of the freshwater ctenostome Hislopia malayensis with scanning electron microscopy (SEM), confocal laser scanning microscopy (CLSM), and LM of serial sections. Some additional observations on larvae of M. membranacea using SEM and CLSM are also reported. The overall configu...

  14. Composition, Abundance and Distribution of Brachyuran Larvae in ...

    African Journals Online (AJOL)

    ... Ocypodidae, Grapsidae and Xanthidae. Abundance of brachyuran larvae was significantly positively correlated with total zooplankton abundance (r2 = 0.8) and salinity (r2 = 0.71). Keywords: Brachyuran larvae, abundance, composition, Mida creek, Kenya West Indian Ocean Journal of Marine Science Vol. 3 (2) 2004: pp.

  15. Production of live prey for marine fish larvae

    OpenAIRE

    Kraul, S

    1989-01-01

    Tropical marine fish larvae vary in their requirements for live planktonic food. Selection of live prey species for culture depends on larval size and larval tolerance of water quality. This report describes some of the cultured prey species, and their uses and limits as effective food for fish larvae. Methods are presented for the culture of phytoplankton, rotifers, copepods, and other live feeds.

  16. External Ophthalmomyiasis Caused by a Rare Infesting Larva, Sarcophaga argyrostoma

    Directory of Open Access Journals (Sweden)

    Shmuel Graffi

    2013-01-01

    Full Text Available Purpose. External ophthalmomyiasis (EO is caused by infesting larvae belonging to various species of flies. Most documented cases result from sheep (Oestrus ovis and Russian (Rhinoestrus purpureus botfly larvae, but we recently discovered a rare case of EO caused by flesh fly (Sarcophaga argyrostoma larvae. Here, we report the case of a patient with EO who had been hospitalized and sedated for 1 week because of unrelated pneumonia. Methods. Case report. Results. A total of 32 larvae were removed from the adnexae of both eyes. Larvae identification was confirmed through DNA analysis. Treatment with topical tobramycin resulted in complete resolution of EO. Conclusion. EO can be caused by S. argyrostoma, and the elderly and debilitated may require extra ocular protection against flies during sedation.

  17. Survival of mayfly larvae under mine acid conditions

    Energy Technology Data Exchange (ETDEWEB)

    Napier, S. Jr.; Hummon, W.D.

    1976-01-01

    Mayfly larvae were abundant and diverse in riffle zones of three control streams in southeastern Ohio. But none were found in such zones of three streams having current or past histories of mine acid pollution, despite vegetative recovery of reclaimed land bordering two of the streams. Laboratory studies showed stepwise increases in non-predatory mortality of mayfly larvae with increased mine acidity. Dragonfly larvae predation on mayfly larvae was constant at pH 8.1 to 4.1, but decreased at pH 3.1 despite tolerance of dragonfly larvae to low pH conditions. Extensive acid mine pollution thus may threaten aquatic biota through removal of food sources or reduced feeding rates as well as through direct mortality.

  18. Freshly squeezed: anaphylaxis caused by drone larvae juice.

    Science.gov (United States)

    Stoevesandt, J; Trautmann, A

    2017-11-30

    Drone larvae are mostly considered a by-product of beekeeping, but have recently been advo-cated as a high-protein source of food. There are as yet no data concerning their allergenic po-tential. We report on a 29-year old bee keeper who experienced an anaphylactic reaction following the consumption of a freshly prepared beverage from raw drone larvae. Larvae-specific sensitization was confirmed by prick-to-prick and basophil activation testing. Bee stings and classical bee products including honey and royal jelly were tolerated. This is the hitherto first report on IgE-mediated allergy to drone larvae. We suggest that a certain awareness towards the allergenicity of bee larvae is required.

  19. Antibacterial properties of grapefruit seed extract against Paenibacillus larvae subsp. larvae.

    Science.gov (United States)

    Semprini, P; Langella, V; Pasini, B; Falda, M T; Calvarese, S

    2004-01-01

    Twenty-one samples of grapefruit seed extract (GSE) either from marketed products or provided by an apiculturist were analysed to verify their inhibition activity, in particular against Paenibacillus larvae subsp. larvae, responsible for American foulbrood. The bactericide capacity of GSE has been measured in Bacillus subtilis BGA, Bacillus cereus 11778, Bacillus cereus K250 and Micrococcus luteus 9341a; these bacteria are normally used in the laboratory to study inhibitors. The results showed that not all GSE have the same inhibitory activity and two of those analysed do not inhibit the five bacteria used. Considering that 19 samples inhibited American foulbrood bacillus, the authors conclude that the use of a natural product (such as GSE) to control this important disease of bees, can be used as a substitute for chemotherapeutic products, after appropriate expedients.

  20. How to kill the honey bee larva: genomic potential and virulence mechanisms of Paenibacillus larvae.

    Directory of Open Access Journals (Sweden)

    Marvin Djukic

    Full Text Available Paenibacillus larvae, a Gram positive bacterial pathogen, causes American Foulbrood (AFB, which is the most serious infectious disease of honey bees. In order to investigate the genomic potential of P. larvae, two strains belonging to two different genotypes were sequenced and used for comparative genome analysis. The complete genome sequence of P. larvae strain DSM 25430 (genotype ERIC II consisted of 4,056,006 bp and harbored 3,928 predicted protein-encoding genes. The draft genome sequence of P. larvae strain DSM 25719 (genotype ERIC I comprised 4,579,589 bp and contained 4,868 protein-encoding genes. Both strains harbored a 9.7 kb plasmid and encoded a large number of virulence-associated proteins such as toxins and collagenases. In addition, genes encoding large multimodular enzymes producing nonribosomally peptides or polyketides were identified. In the genome of strain DSM 25719 seven toxin associated loci were identified and analyzed. Five of them encoded putatively functional toxins. The genome of strain DSM 25430 harbored several toxin loci that showed similarity to corresponding loci in the genome of strain DSM 25719, but were non-functional due to point mutations or disruption by transposases. Although both strains cause AFB, significant differences between the genomes were observed including genome size, number and composition of transposases, insertion elements, predicted phage regions, and strain-specific island-like regions. Transposases, integrases and recombinases are important drivers for genome plasticity. A total of 390 and 273 mobile elements were found in strain DSM 25430 and strain DSM 25719, respectively. Comparative genomics of both strains revealed acquisition of virulence factors by horizontal gene transfer and provided insights into evolution and pathogenicity.

  1. How to kill the honey bee larva: genomic potential and virulence mechanisms of Paenibacillus larvae.

    Science.gov (United States)

    Djukic, Marvin; Brzuszkiewicz, Elzbieta; Fünfhaus, Anne; Voss, Jörn; Gollnow, Kathleen; Poppinga, Lena; Liesegang, Heiko; Garcia-Gonzalez, Eva; Genersch, Elke; Daniel, Rolf

    2014-01-01

    Paenibacillus larvae, a Gram positive bacterial pathogen, causes American Foulbrood (AFB), which is the most serious infectious disease of honey bees. In order to investigate the genomic potential of P. larvae, two strains belonging to two different genotypes were sequenced and used for comparative genome analysis. The complete genome sequence of P. larvae strain DSM 25430 (genotype ERIC II) consisted of 4,056,006 bp and harbored 3,928 predicted protein-encoding genes. The draft genome sequence of P. larvae strain DSM 25719 (genotype ERIC I) comprised 4,579,589 bp and contained 4,868 protein-encoding genes. Both strains harbored a 9.7 kb plasmid and encoded a large number of virulence-associated proteins such as toxins and collagenases. In addition, genes encoding large multimodular enzymes producing nonribosomally peptides or polyketides were identified. In the genome of strain DSM 25719 seven toxin associated loci were identified and analyzed. Five of them encoded putatively functional toxins. The genome of strain DSM 25430 harbored several toxin loci that showed similarity to corresponding loci in the genome of strain DSM 25719, but were non-functional due to point mutations or disruption by transposases. Although both strains cause AFB, significant differences between the genomes were observed including genome size, number and composition of transposases, insertion elements, predicted phage regions, and strain-specific island-like regions. Transposases, integrases and recombinases are important drivers for genome plasticity. A total of 390 and 273 mobile elements were found in strain DSM 25430 and strain DSM 25719, respectively. Comparative genomics of both strains revealed acquisition of virulence factors by horizontal gene transfer and provided insights into evolution and pathogenicity.

  2. Effects of various diets on the calcium and phosphorus composition of mealworms (Tenebrio molitor larvae) and superworms (Zophobas morio larvae).

    Science.gov (United States)

    Latney, La'Toya V; Toddes, Barbara D; Wyre, Nicole R; Brown, Dorothy C; Michel, Kathryn E; Briscoe, Johanna A

    2017-02-01

    OBJECTIVE To evaluate whether the nutritive quality of Tenebrio molitor larvae and Zophobas morio larvae, which are commonly cultured as live food sources, is influenced by 4 commercially available diets used as nutritional substrates; identify which diet best improved calcium content of larvae; and identify the feeding time interval that assured the highest calcium intake by larvae. ANIMALS 2,000 Zophobas morio larvae (ie, superworms) and 7,500 Tenebrio molitor larvae (ie, mealworms). PROCEDURES Larvae were placed in control and diet treatment groups for 2-, 7-, and 10-day intervals. Treatment diets were as follows: wheat millings, avian hand feeding formula, organic avian mash diet, and a high-calcium cricket feed. Control groups received water only. After treatment, larvae were flash-frozen live with liquid nitrogen in preparation for complete proximate and mineral analyses. Analyses for the 2-day treatment group were performed in triplicate. RESULTS The nutrient composition of the high-calcium cricket feed groups had significant changes in calcium content, phosphorus content, and metabolizable energy at the 2-day interval, compared with other treatment groups, for both mealworms and superworms. Calcium content and calcium-to-phosphorus ratios for larvae in the high-calcium cricket feed group were the highest among the diet treatments for all treatment intervals and for both larval species. CONCLUSIONS AND CLINICAL RELEVANCE A 2-day interval with the high-calcium cricket feed achieved a larval nutrient composition sufficient to meet National Research Council dietary calcium recommendations for nonlactating rats. Mealworm calcium composition reached 2,420 g/1,000 kcal at 48 hours, and superworm calcium composition reached 2,070g/1,000 kcal at 48 hours. These findings may enable pet owners, veterinarians, insect breeders, and zoo curators to optimize nutritive content of larvae fed to insectivorous animals.

  3. [Toxicity and influencing factors of liquid chlorine on chironomid larvae].

    Science.gov (United States)

    Sun, Xing-Bin; Cui, Fu-Yi; Zhang, Jin-Song; Guo, Zhao-Hai; Xu, Feng; Liu, Li-Jun

    2005-09-01

    The excessive propagation of Chironomid larvae (red worm) in the sedimentation tanks is a difficult problem for the normal function of waterworks. The toxic effect of liquid chlorine on the different instar larvae of Chironomid was studied using distilled water as test sample. Furthermore, the effect of pH value, organic matter content, ammonia nitrogen, and algae content on toxicity of liquid chlorine was observed. The results show that the tolerance of Chironomid larvae to liquid chlorine is strengthened with the increase in instar. The 24h semi-lethal concentration (LC50) of liquid chlorine to the 4th instar larvae of Chironomid is 3.39 mg/L. Low pH value and high algae content are helpful to improve the toxic effect of liquid chlorine to Chironomid larvae. In neutral water body, the increase in organic matter content results in the decrease in the death rate of Chironomid larvae. The toxicity of liquid chlorine differs greatly in different concentrations of ammonia nitrogen. The death rate of the 4th instar larvae of Chironomid in raw water is higher by contrast with that in sedimentation tanks water for 24h disposal with various amount of liquid chlorine.

  4. Larvas migrans ganglionar: Presentación de un caso

    Directory of Open Access Journals (Sweden)

    María del Carmen Luis Álvarez

    2003-04-01

    Full Text Available Las larvas migrans visceral cuya causa radica en la infestación con larvas de toxocara canis o cati, ocurre más frecuentemente en niños menores de 10 años. Se presenta el caso de un niño de 8 años de edad en el cual se diagnosticó larvas migrans ganglionar. Se comentan aspectos etioepidemiológicos de la enfermedad, su cuadro clínico y evolución. Se hace énfasis en las medidas higiénicas sanitarias de control y manipulación de excretas de animales domésticos, en este caso de perros y gatos.Visceral larvae migrans caused by the infestation with larvae of toxocara canis or cati are more frequent among children under 10. The case of an 8-year-old boy who was diagnosed ganglionar larva migrans is presented. Comments are made on some etioepidemiological aspects of the disease, as well as on his clinical picture and evolution. Emphasis is made on the hygienic and sanitary measures of control and manipulation of stools from pegs as dogs and cats. Las larvas migrans visceral cuya causa radica en la infestación con larvas de toxocara canis o cati, ocurre más frecuentemente en niños menores de 10 años. Se presenta el caso de un niño de 8 años de edad en el cual se diagnosticó larvas migrans ganglionar. Se comentan aspectos etioepidemiológicos de la enfermedad, su cuadro clínico y evolución. se hace énfasis en las medidas higiénicas sanitarias de control y manipulación de excretas de animales domésticos, en este caso de perros y gatos.

  5. Tools for automating the imaging of zebrafish larvae.

    Science.gov (United States)

    Pulak, Rock

    2016-03-01

    The VAST BioImager system is a set of tools developed for zebrafish researchers who require the collection of images from a large number of 2-7 dpf zebrafish larvae. The VAST BioImager automates larval handling, positioning and orientation tasks. Color images at about 10 μm resolution are collected from the on-board camera of the system. If images of greater resolution and detail are required, this system is mounted on an upright microscope, such as a confocal or fluorescence microscope, to utilize their capabilities. The system loads a larvae, positions it in view of the camera, determines orientation using pattern recognition analysis, and then more precisely positions to user-defined orientation for optimal imaging of any desired tissue or organ system. Multiple images of the same larva can be collected. The specific part of each larva and the desired orientation and position is identified by the researcher and an experiment defining the settings and a series of steps can be saved and repeated for imaging of subsequent larvae. The system captures images, then ejects and loads another larva from either a bulk reservoir, a well of a 96 well plate using the LP Sampler, or individually targeted larvae from a Petri dish or other container using the VAST Pipettor. Alternative manual protocols for handling larvae for image collection are tedious and time consuming. The VAST BioImager automates these steps to allow for greater throughput of assays and screens requiring high-content image collection of zebrafish larvae such as might be used in drug discovery and toxicology studies. Copyright © 2015 The Author. Published by Elsevier Inc. All rights reserved.

  6. Vaccination of lambs with irradiated larvae of Bunostomum trigonocephalum

    International Nuclear Information System (INIS)

    Srivastava, V.K.; Singh, K.S.; Subramanian, G.

    1987-01-01

    Vaccination with a single dose of 2,000 infective larvae of Bunostomum trigonocephalum, irradiated at 40 kR, caused 80 per cent reduction in worm establishment and such lambs withstood a challenge infection which was otherwise fatal to non-vaccinated lambs. The female worms, which developed from irradiated larvae, were irregular in shape, had cuticular thickening at the genital opening and in many male worms the copulatory bursa was rudimentary. The sex ratio was adversely affected in worms developing from irradiated larvae. The population had preponderant sterile females and a very few male worms. (author)

  7. Utilization of computer processed high definition video imaging for measuring motility of microscopic nematode stages on a quantitative scale: "The Worminator".

    Science.gov (United States)

    Storey, Bob; Marcellino, Chris; Miller, Melissa; Maclean, Mary; Mostafa, Eman; Howell, Sue; Sakanari, Judy; Wolstenholme, Adrian; Kaplan, Ray

    2014-12-01

    A major hindrance to evaluating nematode populations for anthelmintic resistance, as well as for screening existing drugs, new compounds, or bioactive plant extracts for anthelmintic properties, is the lack of an efficient, objective, and reproducible in vitro assay that is adaptable to multiple life stages and parasite genera. To address this need we have developed the "Worminator" system, which objectively and quantitatively measures the motility of microscopic stages of parasitic nematodes. The system is built around the computer application "WormAssay", developed at the Center for Discovery and Innovation in Parasitic Diseases at the University of California, San Francisco. WormAssay was designed to assess motility of macroscopic parasites for the purpose of high throughput screening of potential anthelmintic compounds, utilizing high definition video as an input to assess motion of adult stage (macroscopic) parasites (e.g. Brugia malayi). We adapted this assay for use with microscopic parasites by modifying the software to support a full frame analysis mode that applies the motion algorithm to the entire video frame. Thus, the motility of all parasites in a given well are recorded and measured simultaneously. Assays performed on third-stage larvae (L3) of the bovine intestinal nematode Cooperia spp., as well as microfilariae (mf) of the filarioid nematodes B. malayi and Dirofilaria immitis, yielded reproducible dose responses using the macrocyclic lactones ivermectin, doramectin, and moxidectin, as well as the nicotinic agonists, pyrantel, oxantel, morantel, and tribendimidine. This new computer based-assay is simple to use, requires minimal new investment in equipment, is robust across nematode genera and developmental stage, and does not require subjective scoring of motility by an observer. Thus, the "Worminator" provides a relatively low-cost platform for developing genera- and stage-specific assays with high efficiency and reproducibility, low labor input

  8. Utilization of computer processed high definition video imaging for measuring motility of microscopic nematode stages on a quantitative scale: “The Worminator”

    Directory of Open Access Journals (Sweden)

    Bob Storey

    2014-12-01

    Full Text Available A major hindrance to evaluating nematode populations for anthelmintic resistance, as well as for screening existing drugs, new compounds, or bioactive plant extracts for anthelmintic properties, is the lack of an efficient, objective, and reproducible in vitro assay that is adaptable to multiple life stages and parasite genera. To address this need we have developed the “Worminator” system, which objectively and quantitatively measures the motility of microscopic stages of parasitic nematodes. The system is built around the computer application “WormAssay”, developed at the Center for Discovery and Innovation in Parasitic Diseases at the University of California, San Francisco. WormAssay was designed to assess motility of macroscopic parasites for the purpose of high throughput screening of potential anthelmintic compounds, utilizing high definition video as an input to assess motion of adult stage (macroscopic parasites (e.g. Brugia malayi. We adapted this assay for use with microscopic parasites by modifying the software to support a full frame analysis mode that applies the motion algorithm to the entire video frame. Thus, the motility of all parasites in a given well are recorded and measured simultaneously. Assays performed on third-stage larvae (L3 of the bovine intestinal nematode Cooperia spp., as well as microfilariae (mf of the filarioid nematodes B. malayi and Dirofilaria immitis, yielded reproducible dose responses using the macrocyclic lactones ivermectin, doramectin, and moxidectin, as well as the nicotinic agonists, pyrantel, oxantel, morantel, and tribendimidine. This new computer based-assay is simple to use, requires minimal new investment in equipment, is robust across nematode genera and developmental stage, and does not require subjective scoring of motility by an observer. Thus, the “Worminator” provides a relatively low-cost platform for developing genera- and stage-specific assays with high efficiency and

  9. Fish larvae at fronts: Horizontal and vertical distributions of gadoid fish larvae across a frontal zone at the Norwegian Trench

    DEFF Research Database (Denmark)

    Munk, Peter

    2014-01-01

    The reproduction and early life history of many fish species are linked to the physical and biological characteristics of fronts. In order to ascertain linkages between frontal physics and fish larvae, we investigated distributional differences among gadoid fish larvae comparing these to both...... the vertical and horizontal distributions of each species. However, the three-dimensional pattern of distribution differed significantly among species of larvae and species of copepods. The study underlines the complexity of bio-physical interrelationships in the frontal zone, and indicates that the zone...

  10. Effects of benzylisoquinoline alkaloids on the larvae of polyphagous Lepidoptera.

    Science.gov (United States)

    Miller, James S; Feeny, Paul

    1983-06-01

    Six benzylisoquinoline alkaloids were fed to the larvae of three polyphagous Lepidoptera species: Hyphantria cunea, Spodoptera eridania, and Lymantria dispar. Exposure of last instar larvae to alkaloid-containing diets over a 24-h period resulted in reduced feeding rates and reduced growth efficiencies. Lymantria dispar larvae reared from eggs on alkaloid diets took longer to reach the fifth instar, attained lower larval weights, and showed reduced survivorship. The benzylisoquinolines tested were not equally effective as toxins or feeding inhibitors. Some produced dramatic effects while others produced no effects. The relative responses of the three caterpillar species to the six alkaloids were similar. Those benzylisoquinolines with a methylene-dioxyphenyl (1,3-benzodioxole) group were consistently the most toxic or repellent while laudanosine, a relatively simple benzylisoquinoline, was generally innocuous. Available host records indicate that benzylisoquinoline-containing plants are avoided by the larvae of these moth species.

  11. Starvation threshold of Balanus amphitrite larvae in relation to temperature

    Digital Repository Service at National Institute of Oceanography (India)

    Anil, A.C.; Desai, D.V.

    Energy content in the non-feeding (lecithotrophic) cyprid larvae of B. amphitrite plays an important role in determining its metamorphic characteristics. In this context it is important to understand the energy transformed to this stage from...

  12. Fish larvae from the Canary region in autumn

    Directory of Open Access Journals (Sweden)

    J. M. Rodríguez

    2000-03-01

    Full Text Available In this paper, the taxonomic composition of the fish larvae community in the Canary region in autumn 1991 is presented. In total, 8699 larvae belonging to 58 fish families were studied. 176 taxonomic groups were identified, 149 at species level and the rest were identified at a higher level. The most numerous family and the one that presented the greatest number of species was Myctophidae. The most frequently caught species was Cyclothone braueri. The taxonomic composition (at family level of the fish larvae community, dominated by four mesopelagic families, was typical of oceanic regions of warm waters. The most remarkable feature of the fish larvae community was its high specific diversity.

  13. Odour avoidance learning in the larva of Drosophila melanogaster

    Indian Academy of Sciences (India)

    Prakash

    Recent experiments with larvae have employed appetitive ... Tata Institute of Fundamental Research, National Centre for Biological Sciences, Bangalore 560 065, India ..... psychology: event timing turns punishment to reward; Nature.

  14. Preliminary notes on the decapod larvae of the Arabian Sea

    Digital Repository Service at National Institute of Oceanography (India)

    Menon, M.K.; Menon, P.G.; Paulinose, V.T.

    The note presents some general facts regarding the distribution of some of the larger groups of decapod larvae in the Arabian Sea Their relative numbers and the families and subfamilies, so far as can be recognized, represented within each group...

  15. Commercially important penaeid shrimp larvae in the estuaries of Goa

    Digital Repository Service at National Institute of Oceanography (India)

    Achuthankutty, C.T.

    Larval stages of the penaeid shrimps, Metapenaeus dobsoni (Miers), M. affinis (Milne - Edwards) and Penaeus merguiensis De Man were mostly distributed at the lower reaches of Mandovi and Zuari estuaries. While larvae of M. dobsoni and M. affinis...

  16. Identification of antigenic proteins of setaria cervi by immunoblotting technique

    International Nuclear Information System (INIS)

    Kaushal, N.A.; Kaushal, D.C.; Ghatak, S.

    1987-01-01

    Identification and characterization of antigenic proteins of Setaria cervi (bovine filarial parasite) adults and microfilariae was done by immunoblotting technique using hyperimmune rabbit sera against S. cervi and Brugia malayi. The antigens recognized by these sera were detected by using 125 I protein-A followed by autoradiography. Fifteen different antigens were observed to be common between adult and microfilarial stages of the parasite. Some stage specific antigens were also identified. Many antigens of S. cervi adults and microfilariae were also recognized by rabbit anti-B.malayi serum showing the existence of common antigenic determinants between the bovine and human filarial parasites

  17. Development of digestive enzymes in larvae of Mayancichlid Cichlasoma urophthalmus

    OpenAIRE

    López Ramírez, G.; Cuenca Soria, C.A.; Álvarez González, C.A.; Tovar Ramírez, D.; Ortiz Galindo, José Luis; Perales García, N.; Márquez Couturier, G.; Arias Rodríguez, L.; Indy, J.R.; Contreras Sánchez, W.M.; Gisbert, E.; Moyano, F.J.

    2011-01-01

    The development of digestive enzymes during the early ontogeny of the Mayan cichlid (Cichlasoma urophthalmus) was studied using biochemical and electrophoretic techniques. From yolk absorption (6 days after hatching: dah), larvae were fed Artemia nauplii until 15 dah, afterward they were fed with commercial microparticulated trout food (45% protein and 16% lipids) from 16 to 60 dah. Several samples were collected including yolk-sac larvae (considered as day 1 after hatching) and specimens up ...

  18. Sun-Compass Orientation in Mediterranean Fish Larvae

    OpenAIRE

    Faillettaz , Robin; Blandin , Agathe; Paris , Claire B.; Koubbi , Philippe; Irisson , Jean-Olivier

    2015-01-01

    International audience; Mortality is very high during the pelagic larval phase of fishes but the factors that determine recruitment success remain unclear and hard to predict. Because of their bipartite life history , larvae of coastal species have to head back to the shore at the end of their pelagic episode , to settle. These settlement-stage larvae are known to display strong sensory and motile abilities, but most work has been focused on tropical, insular environments and on the influence...

  19. Prevalence of American Foulbrood and Paenibacillus Larvae Genotypes in Bulgaria

    OpenAIRE

    RUSENOVA, Nikolina; PARVANOV, Parvan

    2016-01-01

    This study aimed to analyse the prevalence of American foulbrood and Paenibacillus larvae genotypes in Bulgaria. For this purpose, data concerning American foulbrood outbreaks were used. Also, available data on the number of destroyed bee families covering a twenty-five-year period (1989 - 2013) was collected from the register of Bulgarian Food Safety Agency. In addition, Paenibacillus larvae genotypes in 15 apiaries were established by rep - PCR with BOXA1R and MBOREP1 primers. Results showe...

  20. Larvicidal activity of Cybistax antisyphilitica against Aedes aegypti larvae.

    Science.gov (United States)

    Rodrigues, A M S; de Paula, J E; Roblot, F; Fournet, A; Espíndola, L S

    2005-12-01

    The larvicidal activity against Aedes aegypti larvae of a stem wood hexane extract of Cybistax antisyphilitica was evaluated. Bioassay-guided fractionation of the crude extract, monitored by larvicidal assay, led to the isolation of a natural quinone identified as 2-hydroxy-3-(3-methyl-2-butenyl)-1.4-naphthoquinone (lapachol). This compound was quite potent against A. aegypti larvae (LC50 26.3 microg/ml).

  1. The use of fly larvae for organic waste treatment.

    Science.gov (United States)

    Čičková, Helena; Newton, G Larry; Lacy, R Curt; Kozánek, Milan

    2015-01-01

    The idea of using fly larvae for processing of organic waste was proposed almost 100 years ago. Since then, numerous laboratory studies have shown that several fly species are well suited for biodegradation of organic waste, with the house fly (Musca domestica L.) and the black soldier fly (Hermetia illucens L.) being the most extensively studied insects for this purpose. House fly larvae develop well in manure of animals fed a mixed diet, while black soldier fly larvae accept a greater variety of decaying organic matter. Blow fly and flesh fly maggots are better suited for biodegradation of meat processing waste. The larvae of these insects have been successfully used to reduce mass of animal manure, fecal sludge, municipal waste, food scrapes, restaurant and market waste, as well as plant residues left after oil extraction. Higher yields of larvae are produced on nutrient-rich wastes (meat processing waste, food waste) than on manure or plant residues. Larvae may be used as animal feed or for production of secondary products (biodiesel, biologically active substances). Waste residue becomes valuable fertilizer. During biodegradation the temperature of the substrate rises, pH changes from neutral to alkaline, ammonia release increases, and moisture decreases. Microbial load of some pathogens can be substantially reduced. Both larvae and digested residue may require further treatment to eliminate pathogens. Facilities utilizing natural fly populations, as well as pilot and full-scale plants with laboratory-reared fly populations have been shown to be effective and economically feasible. The major obstacles associated with the production of fly larvae from organic waste on an industrial scale seem to be technological aspects of scaling-up the production capacity, insufficient knowledge of fly biology necessary to produce large amounts of eggs, and current legislation. Technological innovations could greatly improve performance of the biodegradation facilities and

  2. Parasites of fish larvae: do they follow metabolic energetic laws?

    Science.gov (United States)

    Muñoz, Gabriela; Landaeta, Mauricio F; Palacios-Fuentes, Pamela; George-Nascimento, Mario

    2015-11-01

    Eumetazoan parasites in fish larvae normally exhibit large body sizes relative to their hosts. This observation raises a question about the potential effects that parasites might have on small fish. We indirectly evaluated this question using energetic metabolic laws based on body volume and the parasite densities. We compared the biovolume as well as the numeric and volumetric densities of parasites over the host body volume of larval and juvenile-adult fish and the average of these parasitological descriptors for castrator parasites and the parasites found in the fish studied here. We collected 5266 fish larvae using nearshore zooplankton sampling and 1556 juveniles and adult fish from intertidal rocky pools in central Chile. We considered only the parasitized hosts: 482 fish larvae and 629 juvenile-adult fish. We obtained 31 fish species; 14 species were in both plankton and intertidal zones. Fish larvae exhibited a significantly smaller biovolume but larger numeric and volumetric densities of parasites than juvenile-adult fish. Therefore, fish larvae showed a large proportion of parasite biovolume per unit of body host (cm(3)). However, the general scaling of parasitological descriptors and host body volume were similar between larvae and juvenile-adult fish. The ratio between the biovolume of parasites and the host body volume in fish larvae was similar to the proportion observed in castrator parasites. Furthermore, the ratios were different from those of juvenile-adult fish, which suggests that the presence of parasites implies a high energetic cost for fish larvae that would diminish the fitness of these small hosts.

  3. The hatching larva of the priapulid worm Halicryptus spinulosus

    OpenAIRE

    Janssen, Ralf; Wennberg, Sofia A; Budd, Graham E

    2009-01-01

    Abstract Despite their increasing evolutionary importance, basic knowledge about the priapulid worms remains limited. In particular, priapulid development has only been partially documented. Following previous description of hatching and the earliest larval stages of Priapulus caudatus, we here describe the hatching larva of Halicryptus spinulosus. Comparison of the P. caudatus and the H. spinulosus hatching larvae allows us to attempt to reconstruct the ground pattern of priapulid developmen...

  4. Abscisic acid enhances cold tolerance in honeybee larvae

    Science.gov (United States)

    Sturla, Laura; Guida, Lucrezia; Vigliarolo, Tiziana; Maggi, Matías; Eguaras, Martín; Zocchi, Elena; Lamattina, Lorenzo

    2017-01-01

    The natural composition of nutrients present in food is a key factor determining the immune function and stress responses in the honeybee (Apis mellifera). We previously demonstrated that a supplement of abscisic acid (ABA), a natural component of nectar, pollen, and honey, increases honeybee colony survival overwinter. Here we further explored the role of ABA in in vitro-reared larvae exposed to low temperatures. Four-day-old larvae (L4) exposed to 25°C for 3 days showed lower survival rates and delayed development compared to individuals growing at a standard temperature (34°C). Cold-stressed larvae maintained higher levels of ABA for longer than do larvae reared at 34°C, suggesting a biological significance for ABA. Larvae fed with an ABA-supplemented diet completely prevent the low survival rate due to cold stress and accelerate adult emergence. ABA modulates the expression of genes involved in metabolic adjustments and stress responses: Hexamerin 70b, Insulin Receptor Substrate, Vitellogenin, and Heat Shock Proteins 70. AmLANCL2, the honeybee ABA receptor, is also regulated by cold stress and ABA. These results support a role for ABA increasing the tolerance of honeybee larvae to low temperatures through priming effects. PMID:28381619

  5. Quantification of vestibular-induced eye movements in zebrafish larvae

    Directory of Open Access Journals (Sweden)

    Mo Weike

    2010-09-01

    Full Text Available Abstract Background Vestibular reflexes coordinate movements or sensory input with changes in body or head position. Vestibular-evoked responses that involve the extraocular muscles include the vestibulo-ocular reflex (VOR, a compensatory eye movement to stabilize retinal images. Although an angular VOR attributable to semicircular canal stimulation was reported to be absent in free-swimming zebrafish larvae, recent studies reveal that vestibular-induced eye movements can be evoked in zebrafish larvae by both static tilts and dynamic rotations that tilt the head with respect to gravity. Results We have determined herein the basis of sensitivity of the larval eye movements with respect to vestibular stimulus, developmental stage, and sensory receptors of the inner ear. For our experiments, video recordings of larvae rotated sinusoidally at 0.25 Hz were analyzed to quantitate eye movements under infrared illumination. We observed a robust response that appeared as early as 72 hours post fertilization (hpf, which increased in amplitude over time. Unlike rotation about an earth horizontal axis, rotation about an earth vertical axis at 0.25 Hz did not evoke eye movements. Moreover, vestibular-induced responses were absent in mutant cdh23 larvae and larvae lacking anterior otoliths. Conclusions Our results provide evidence for a functional vestibulo-oculomotor circuit in 72 hpf zebrafish larvae that relies upon sensory input from anterior/utricular otolith organs.

  6. Sun-Compass Orientation in Mediterranean Fish Larvae.

    Science.gov (United States)

    Faillettaz, Robin; Blandin, Agathe; Paris, Claire B; Koubbi, Philippe; Irisson, Jean-Olivier

    2015-01-01

    Mortality is very high during the pelagic larval phase of fishes but the factors that determine recruitment success remain unclear and hard to predict. Because of their bipartite life history, larvae of coastal species have to head back to the shore at the end of their pelagic episode, to settle. These settlement-stage larvae are known to display strong sensory and motile abilities, but most work has been focused on tropical, insular environments and on the influence of coast-related cues on orientation. In this study we quantified the in situ orientation behavior of settlement-stage larvae in a temperate region, with a continuous coast and a dominant along-shore current, and inspected both coast-dependent and independent cues. We tested six species: one Pomacentridae, Chromis chromis, and five Sparidae, Boops boops, Diplodus annularis, Oblada melanura, Spicara smaris and Spondyliosoma cantharus. Over 85% of larvae were highly capable of keeping a bearing, which is comparable to the orientation abilities of tropical species. Sun-related cues influenced the precision of bearing-keeping at individual level. Three species, out of the four tested in sufficient numbers, oriented significantly relative to the sun position. These are the first in situ observations demonstrating the use of a sun compass for orientation by wild-caught settlement-stage larvae. This mechanism has potential for large-scale orientation of fish larvae globally.

  7. Sun-Compass Orientation in Mediterranean Fish Larvae.

    Directory of Open Access Journals (Sweden)

    Robin Faillettaz

    Full Text Available Mortality is very high during the pelagic larval phase of fishes but the factors that determine recruitment success remain unclear and hard to predict. Because of their bipartite life history, larvae of coastal species have to head back to the shore at the end of their pelagic episode, to settle. These settlement-stage larvae are known to display strong sensory and motile abilities, but most work has been focused on tropical, insular environments and on the influence of coast-related cues on orientation. In this study we quantified the in situ orientation behavior of settlement-stage larvae in a temperate region, with a continuous coast and a dominant along-shore current, and inspected both coast-dependent and independent cues. We tested six species: one Pomacentridae, Chromis chromis, and five Sparidae, Boops boops, Diplodus annularis, Oblada melanura, Spicara smaris and Spondyliosoma cantharus. Over 85% of larvae were highly capable of keeping a bearing, which is comparable to the orientation abilities of tropical species. Sun-related cues influenced the precision of bearing-keeping at individual level. Three species, out of the four tested in sufficient numbers, oriented significantly relative to the sun position. These are the first in situ observations demonstrating the use of a sun compass for orientation by wild-caught settlement-stage larvae. This mechanism has potential for large-scale orientation of fish larvae globally.

  8. Abscisic acid enhances cold tolerance in honeybee larvae.

    Science.gov (United States)

    Ramirez, Leonor; Negri, Pedro; Sturla, Laura; Guida, Lucrezia; Vigliarolo, Tiziana; Maggi, Matías; Eguaras, Martín; Zocchi, Elena; Lamattina, Lorenzo

    2017-04-12

    The natural composition of nutrients present in food is a key factor determining the immune function and stress responses in the honeybee ( Apis mellifera ). We previously demonstrated that a supplement of abscisic acid (ABA), a natural component of nectar, pollen, and honey, increases honeybee colony survival overwinter. Here we further explored the role of ABA in in vitro -reared larvae exposed to low temperatures. Four-day-old larvae (L4) exposed to 25°C for 3 days showed lower survival rates and delayed development compared to individuals growing at a standard temperature (34°C). Cold-stressed larvae maintained higher levels of ABA for longer than do larvae reared at 34°C, suggesting a biological significance for ABA. Larvae fed with an ABA-supplemented diet completely prevent the low survival rate due to cold stress and accelerate adult emergence. ABA modulates the expression of genes involved in metabolic adjustments and stress responses: Hexamerin 70b, Insulin Receptor Substrate, Vitellogenin , and Heat Shock Proteins 70. AmLANCL2, the honeybee ABA receptor, is also regulated by cold stress and ABA. These results support a role for ABA increasing the tolerance of honeybee larvae to low temperatures through priming effects. © 2017 The Author(s).

  9. Long-wavelength photosensitivity in coral planula larvae.

    Science.gov (United States)

    Mason, Benjamin M; Cohen, Jonathan H

    2012-04-01

    Light influences the swimming behavior and settlement of the planktonic planula larvae of coral, but little is known regarding the photosensory biology of coral at this or any life-history stage. Here we used changes in the electrical activity of coral planula tissue upon light flashes to investigate the photosensitivity of the larvae. Recordings were made from five species: two whose larvae are brooded and contain algal symbionts (Porites astreoides and Agaricia agaricites), and three whose larvae are spawned and lack algal symbionts (Acropora cervicornis, Acropora palmata,and Montastrea faveolata). Photosensitivity originated from the coral larva rather than from, or in addition to, its algal symbionts as species with and without symbionts displayed similar tissue-level electrical responses to light. All species exhibited as much (or more) sensitivity to red stimuli as to blue/green stimuli, which is consistent with a role for long-wavelength visible light in the preference for substrata observed during settlement and in facilitating vertical positioning of larvae in the water column.

  10. Using Real-time PCR for Identification of Paenibacillus larvae

    Directory of Open Access Journals (Sweden)

    Vladimíra Kňazovická

    2011-05-01

    Full Text Available The aim of the study was identification of Paenibacillus larvae that causes American foulbrood disease (AFB in colony of bees (Apis mellifera. Bacterial isolates originated from honey samples, because presence of P. larvae in honey is treated as early diagnostic of AFB. Intense proteolytic activity and no catalase activity are typical for Gram positive rod-shaped bacteria P. larvae. We diluted honey (1:2, heated at 80 °C for 10 min and inoculated on semiselective medium MYPGP agar with nalidixic acid. Plates were cultivated at 37 °C for 48 – 72 h under the aerobic conditions. Selected colonies were transferred on MYT agar and cultivated 24 h. We analysed 30 honey samples and found 27 bacterial isolates. All isolates were Gram positive and mainly rod-shaped. No catalase activity was documented for 6 from 27 isolates. Identification was finished by real-time PCR to detect the 16S rRNA gene of Paenibacillus larvae with real-time cycler Rotor-Gene 6000. As DNA template we used genomic DNA isolated with commercial kit and DNA lysate obtaining by boiled cells. We used 2 strains of P. larvae from CCM (Czech Collection of Microorganisms as positive control. The reliable method of detection P. larvae has important rule for beekeeping.

  11. Observations of the sound producing organs in achelate lobster larvae

    Directory of Open Access Journals (Sweden)

    John A. Fornshell

    2017-06-01

    Full Text Available The Achelata, lobsters lacking claws and having a phyllosoma larva, are divided into two families, the Palinuridae or spiny lobsters and the Scyllaridae or slipper lobsters. Within the Palinuridae adults of two groups were identified by Parker (1884, the Stridentesthat are capable of producing sounds, and the Silentesthat are not known to produce sounds. The Stridentes employ a file-like structure on the dorsal surface of the cephalon and a plectrum consisting of a series of ridges on the proximal segment of the second antenna to produce their sounds. All species of Achelata hatch as an unpigmented thin phyllosoma larva. The phyllosoma larva of the Stridentes have a presumptive file-like structure on the dorsal cephalon. A similar file-like structure is found on the cephalon of one species of Silentes, Palinurellus wienckki, and some but not all of the phyllosoma larvae of the Scyllaridae. No presumptive plectrum is found on the second antenna of any of the phyllosoma larvae. Presence of a presumptive file-like structure on phyllosoma larvae of Silentes and Scyllaridae suggests that the ability to produce sounds may have been lost secondarily in the Silentes and Scyllaridae.

  12. Acute toxicity of sodium metabisulphite in larvae and post-larvae of the land crab, Cardisoma guanhumi.

    Science.gov (United States)

    Galli, Orlando B S; Fujimoto, Rodrigo Y; Abrunhosa, Fernando A

    2012-08-01

    Sodium metabisulphite (SMB) is used in marine shrimp aquaculture to prevent the occurrence of black spot. The release SMB into the estuarine environment from shrimp farm pond effluents has been reported. This study evaluated the susceptibility of larvae and post-larvae of land crab, Cardisoma guanhumi to this salt. A decrease in dissolved oxygen and pH occurred with increasing concentration of SMB and exposure time. LC(50) values after 48 h of exposure were 34 ± 1.1 mg/L, 31.1 ± 1.9 mg/L, and 30.6 ± 0.5 mg/L for I zoea larvae, megalopa larvae and stage I juveniles, respectively.

  13. First record of larvae of Chironomidae (Insecta, Diptera as prey of Temnocephala sp. (Platyhelminthes, Temnocephalidae, an ectosymbiont on larvae of Corydalidae (Megaloptera

    Directory of Open Access Journals (Sweden)

    Susana Trivinho-Strixino

    2012-09-01

    Full Text Available First record of larvae of Chironomidae (Insecta, Diptera as prey of Temnocephala sp. (Platyhelminthes, Temnocephalidae, an ectosymbiont on larvae of Corydalidae (Megaloptera. This study constitutes the first record of Temnocephala Blanchard, an ectosymbiont on Corydalidae, as a possible predator of chironomid larvae. Twenty-eight Corydalidae larvae (Corydalus and Protochauliodes were examined under stereomicroscopic in search for Temnocephala and Chironomidae larvae, of which five megalopteran larvae had 24 Temnocephala sp. associated. Furthermore, eight of these Temnocephala worms had chironomid larvae in their gut contents, an interaction previously unknown. Gut content analyses revealed Corynoneura as the commonest chironomid, but larvae of Larsia, Rheotanytarsus and Tanytarsus were recorded as well. This study included Corydalus and Protochauliodes as hosts for Temnocephala, which might be important for this worm dispersion and population dynamics.

  14. Development of Digestive Enzyme of Patin Pangasius hypohthalmus Larvae

    Directory of Open Access Journals (Sweden)

    I. Effendi

    2007-01-01

    Full Text Available Culture of patin Pangasius hypophthalmus especially larval rearing  very depends on the supply of natural food as energy source.  Artemia is the main natural food for fish larvae as a starter food, but its price is high.  To reduce production cost, farmers tend to reduce the feeding frequency and shorten  the Artemia feeding period.  Altering feeding regime however may reduce fry quality. This relate to the availability of digestive enzymes.  The objective of this study was  to examine digestive enzymes activity in patin larvae fed with  different feeding regime.  By shorten feeding period with Artemia to 2-4 days and Tubifex,substitution, the enzymes activity of protease, lipase and amylase were revealed similar pattern   The enzymes activity tends to increase and reach the peak at day 7 , and decrease later on until day 15 after hatching.  Survival rate of fish were varied for each treatment, and the highest survival rate was obtained when larvae were fed by Artemia for 8 days.  Blood worm were not fully digested by patin larvae at early stage. Keywords: enzyme, digestion, patin, Pangasius hypophthalmus   ABSTRAK Proses budidaya ikan patin, Pangasius hypophthalmus terutama pembenihan sangat tergantung oleh ketersediaan pakan alami sebagai sumber energinya. Artemia merupakan pakan alami yang banyak diberikan pada saat larva ikan mulai makan, namun harganya relatif tinggi. Untuk menekan biaya produksi, petani ikan patin cenderung mengurangi frekuensi pemberian Artemia dan mempersingkat waktu pemberiannya. Penggeseran jadwal ini diduga mengakibatkan penurunan kualitas benih ikan patin yang dihasilkan yang berhubungan dengan kesiapan enzim pencernaannya. Penelitian ini dilakukan untuk mengetahui aktivitas enzim pada larva ikan patin dengan jadwal pemberian pakan yang berbeda. Dengan memotong waktu pemberian Artemia 2 - 4 hari dan disubstitusi dengan Tubifex, aktifitas enzim protease, lipase dan amilase pada larva ikan patin, memiliki

  15. Amostragem por larva-única na vigilância de Aedes aegypti Single-larva sampling for Aedes aegypti surveillance

    Directory of Open Access Journals (Sweden)

    José Eduardo Bracco

    1995-04-01

    Full Text Available Com a finalidade de testar a metodologia de amostragem por larva-única na vigilância entomológica do Aedes aegypti, foram pesquisados domicílios do Município de Araraquara, SP (Brasil. Nos criadouros que continham larvas de Aedes uma delas foi coletada. Como controle, após a coleta da larva-única, todas as larvas foram coletadas para identificação posterior. Esse processo foi repetido no laboratório. Dos 447 domicílios visitados, apenas 12 foram considerados positivos e 20 criadouros foram identificados; destes, 13 continham larvas de Aedes; 5, larvas de Aedes e Culex e 2, larvas de Culex. Os resultados mostram o reconhecimento correto, no campo, de todos os criadouros, evidenciando que o método poderia ser utilizado na vigilância entomológica de municípios sem infestação domiciliar ou infestados apenas com uma única espécie de Aedes.Buildings in Araraquara city, Southeastern Brazil, were searched during a year for the presence of Aedes larvae using single larva sampling in order to check the single-larva methodology. In those breeding places in wich Aedes larvae were found, one of them was collected. As a control, after the single larva had been collected, all the larvae from the breeding place were collected for later identification. This process was repeated in the laboratory. Of the 447 domiciles searched, 12 were considered positive and 20 breeding places were found. Of the breeding places, 13 contained Aedes larvae, 5 both Aedes and Culex larvae and 2 Culex larvae only. The results show that all the breeding places in the field were properly recognited showing the method may be used for Aedes surveillance in cities infested with one species only or without any domiciliary infestation.

  16. High magnetic field induced otolith fusion in the zebrafish larvae.

    Science.gov (United States)

    Pais-Roldán, Patricia; Singh, Ajeet Pratap; Schulz, Hildegard; Yu, Xin

    2016-04-11

    Magnetoreception in animals illustrates the interaction of biological systems with the geomagnetic field (geoMF). However, there are few studies that identified the impact of high magnetic field (MF) exposure from Magnetic Resonance Imaging (MRI) scanners (>100,000 times of geoMF) on specific biological targets. Here, we investigated the effects of a 14 Tesla MRI scanner on zebrafish larvae. All zebrafish larvae aligned parallel to the B0 field, i.e. the static MF, in the MRI scanner. The two otoliths (ear stones) in the otic vesicles of zebrafish larvae older than 24 hours post fertilization (hpf) fused together after the high MF exposure as short as 2 hours, yielding a single-otolith phenotype with aberrant swimming behavior. The otolith fusion was blocked in zebrafish larvae under anesthesia or embedded in agarose. Hair cells may play an important role on the MF-induced otolith fusion. This work provided direct evidence to show that high MF interacts with the otic vesicle of zebrafish larvae and causes otolith fusion in an "all-or-none" manner. The MF-induced otolith fusion may facilitate the searching for MF sensors using genetically amenable vertebrate animal models, such as zebrafish.

  17. Microplastic ingestion in fish larvae in the western English Channel.

    Science.gov (United States)

    Steer, Madeleine; Cole, Matthew; Thompson, Richard C; Lindeque, Penelope K

    2017-07-01

    Microplastics have been documented in marine environments worldwide, where they pose a potential risk to biota. Environmental interactions between microplastics and lower trophic organisms are poorly understood. Coastal shelf seas are rich in productivity but also experience high levels of microplastic pollution. In these habitats, fish have an important ecological and economic role. In their early life stages, planktonic fish larvae are vulnerable to pollution, environmental stress and predation. Here we assess the occurrence of microplastic ingestion in wild fish larvae. Fish larvae and water samples were taken across three sites (10, 19 and 35 km from shore) in the western English Channel from April to June 2016. We identified 2.9% of fish larvae (n = 347) had ingested microplastics, of which 66% were blue fibres; ingested microfibers closely resembled those identified within water samples. With distance from the coast, larval fish density increased significantly (P < 0.05), while waterborne microplastic concentrations (P < 0.01) and incidence of ingestion decreased. This study provides baseline ecological data illustrating the correlation between waterborne microplastics and the incidence of ingestion in fish larvae. Copyright © 2017 Elsevier Ltd. All rights reserved.

  18. Dynamics of Social Behavior in Fruit Fly Larvae

    Science.gov (United States)

    Durisko, Zachary; Kemp, Rebecca; Mubasher, Rameeshay; Dukas, Reuven

    2014-01-01

    We quantified the extent and dynamics of social interactions among fruit fly larvae over time. Both a wild-type laboratory population and a recently-caught strain of larvae spontaneously formed social foraging groups. Levels of aggregation initially increased during larval development and then declined with the wandering stage before pupation. We show that larvae aggregated more on hard than soft food, and more at sites where we had previously broken the surface of the food. Groups of larvae initiated burrowing sooner than solitary individuals, indicating that one potential benefit of larval aggregations is an improved ability to dig and burrow into the food substrate. We also show that two closely related species, D. melanogaster and D. simulans, differ in their tendency to aggregate, which may reflect different evolutionary histories. Our protocol for quantifying social behavior in larvae uncovered robust social aggregations in this simple model, which is highly amenable to neurogenetic analyses, and can serve for future research into the mechanisms and evolution of social behavior. PMID:24740198

  19. Bacteria Present in Comadia redtenbacheri Larvae (Lepidoptera: Cossidae).

    Science.gov (United States)

    Hernández-Flores, L; Llanderal-Cázares, C; Guzmán-Franco, A W; Aranda-Ocampo, S

    2015-09-01

    The external and internal culturable bacterial community present in the larvae of Comadia redtenbacheri Hammerschmidt, an edible insect, was studied. Characterization of the isolates determined the existence of 18 morphotypes and phylogenetic analysis of the 16S rRNA gene revealed the existence of Paenibacillus sp., Bacillus safensis, Pseudomonas sp., Bacillus pseudomycoides, Corynebacterium variabile, Enterococcus sp., Gordonia sp., Acinetobacter calcoaceticus, Arthrobacter sp., Micrococcus sp., and Bacillus cereus. Greater diversity of bacteria was found in those larvae obtained from vendors than in those directly taken from Agave plants in nature. Many of the larvae obtained from vendors presented signs of potential disease, and after the analysis, results showed a greater bacterial community compared with the larvae with a healthy appearance. This indicates that bacterial flora can vary in accordance with how the larvae are handled during extraction, collection, and transport. © The Authors 2015. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  20. Phylogenetics links monster larva to deep-sea shrimp.

    Science.gov (United States)

    Bracken-Grissom, Heather D; Felder, Darryl L; Vollmer, Nicole L; Martin, Joel W; Crandall, Keith A

    2012-10-01

    Mid-water plankton collections commonly include bizarre and mysterious developmental stages that differ conspicuously from their adult counterparts in morphology and habitat. Unaware of the existence of planktonic larval stages, early zoologists often misidentified these unique morphologies as independent adult lineages. Many such mistakes have since been corrected by collecting larvae, raising them in the lab, and identifying the adult forms. However, challenges arise when the larva is remarkably rare in nature and relatively inaccessible due to its changing habitats over the course of ontogeny. The mid-water marine species Cerataspis monstrosa (Gray 1828) is an armored crustacean larva whose adult identity has remained a mystery for over 180 years. Our phylogenetic analyses, based in part on recent collections from the Gulf of Mexico, provide definitive evidence that the rare, yet broadly distributed larva, C. monstrosa, is an early developmental stage of the globally distributed deepwater aristeid shrimp, Plesiopenaeus armatus. Divergence estimates and phylogenetic relationships across five genes confirm the larva and adult are the same species. Our work demonstrates the diagnostic power of molecular systematics in instances where larval rearing seldom succeeds and morphology and habitat are not indicative of identity. Larval-adult linkages not only aid in our understanding of biodiversity, they provide insights into the life history, distribution, and ecology of an organism.

  1. Feeding ecology of lake whitefish larvae in eastern Lake Ontario

    Science.gov (United States)

    Johnson, James H.; McKenna, James E.; Chalupnicki, Marc A.; Wallbridge, Tim; Chiavelli, Rich

    2009-01-01

    We examined the feeding ecology of larval lake whitefish (Coregonus clupeaformis) in Chaumont Bay, Lake Ontario, during April and May 2004-2006. Larvae were collected with towed ichthyoplankton nets offshore and with larval seines along the shoreline. Larval feeding periodicity was examined from collections made at 4-h intervals over one 24-h period in 2005. Inter-annual variation in diet composition (% dry weight) was low, as was spatial variation among collection sites within the bay. Copepods (81.4%), primarily cyclopoids (59.1%), were the primary prey of larvae over the 3-year period. Cladocerans (8.1%; mainly daphnids, 6.7%) and chironomids (7.3%) were the other major prey consumed. Larvae did not exhibit a preference for any specific prey taxa. Food consumption of lake whitefish larvae was significantly lower at night (i.e., 2400 and 0400 h). Substantial variation in diet composition occurred over the 24-h diel study. For the 24-h period, copepods were the major prey consumed (50.4%) and their contribution in the diet ranged from 29.3% (0400 h) to 85.9% (1200 h). Chironomids made up 33.4% of the diel diet, ranging from 8.0% (0800 h) to 69.9% (0400 h). Diel variation in the diet composition of lake whitefish larvae may require samples taken at several intervals over a 24-h period to gain adequate representation of their feeding ecology.

  2. Food web changes under ocean acidification promote herring larvae survival.

    Science.gov (United States)

    Sswat, Michael; Stiasny, Martina H; Taucher, Jan; Algueró-Muñiz, Maria; Bach, Lennart T; Jutfelt, Fredrik; Riebesell, Ulf; Clemmesen, Catriona

    2018-05-01

    Ocean acidification-the decrease in seawater pH due to rising CO 2 concentrations-has been shown to lower survival in early life stages of fish and, as a consequence, the recruitment of populations including commercially important species. To date, ocean-acidification studies with fish larvae have focused on the direct physiological impacts of elevated CO 2 , but largely ignored the potential effects of ocean acidification on food web interactions. In an in situ mesocosm study on Atlantic herring (Clupea harengus) larvae as top predators in a pelagic food web, we account for indirect CO 2 effects on larval survival mediated by changes in food availability. The community was exposed to projected end-of-the-century CO 2 conditions (~760 µatm pCO 2 ) over a period of 113 days. In contrast with laboratory studies that reported a decrease in fish survival, the survival of the herring larvae in situ was significantly enhanced by 19 ± 2%. Analysis of the plankton community dynamics suggested that the herring larvae benefitted from a CO 2 -stimulated increase in primary production. Such indirect effects may counteract the possible direct negative effects of ocean acidification on the survival of fish early life stages. These findings emphasize the need to assess the food web effects of ocean acidification on fish larvae before we can predict even the sign of change in fish recruitment in a high-CO 2 ocean.

  3. ASPEK ZOONOTIK PARASIT NEMATODA PADA KERA DAN BINATANG MENGERAT DI BENGKULU, SUMATERA. INDONESIA

    Directory of Open Access Journals (Sweden)

    Untung S.

    2012-09-01

    Full Text Available Twentyfive monkeys and 481 rats were examined for parasitic nematodes in Bengkulu, nine species of nematode were found infecting these animals. Five of filarían nematodes, i.e. Brugia malayi, Brugia pahangi, Dirofilaria magnilarvatum and Edesonfilaria malayensis were infecting monkeys and one speciesTBreinlia booliati, was found infecting rats. Three species of gastrointestinal helminths, i.e. Trichuris trichiura, Enterobius vermicularis and Oestophagomomum spp were found in monkeys; a lung worm, Angiostrongylus cantonensis, was found in rats. The most important nematode species is B. malayi, which was found in Presbytis cristatus (36.8 % and in Macaca fascicularis (20.0 %. T. trichiura was found in R. cristatus (47.9 % and A. cantonensis in Rattus argentiventer (4.0 % and Rattus tiomanicus (2.9%.

  4. An improved brine shrimp larvae lethality microwell test method.

    Science.gov (United States)

    Zhang, Yi; Mu, Jun; Han, Jinyuan; Gu, Xiaojie

    2012-01-01

    This article described an improved brine shrimp larvae lethality microwell test method. A simply designed connecting vessel with alternative photoperiod was used to culture and collect high yield of active Artemia parthenogenetica nauplii for brine shrimp larvae lethality microwell test. Using this method, pure A. parthenogenetica nauplii suspension was easily cultured and harvested with high density about 100-150 larvae per milliliter and the natural mortality was reduced to near zero by elimination of unnecessary artificial disturbance. And its sensitivity was validated by determination of LC(50)-24 h of different reference toxicants including five antitumor agents, two pesticides, three organic pollutants, and four heavy metals salts, most of which exhibited LC(50)-24 h between 0.07 and 58.43 mg/L except for bleomycin and mitomycin C with LC(50)-24 h over 300 mg/L.

  5. Chrysomya megacephala (Fabricius) larvae: A new biodiesel resource

    International Nuclear Information System (INIS)

    Li, Zhuoxue; Yang, Depo; Huang, Miaoling; Hu, Xinjun; Shen, Jiangang; Zhao, Zhimin; Chen, Jianping

    2012-01-01

    Highlights: ►Chrysomya megacephala larvae oil as a new resource transforming to biodiesel. ► Larvae were grown up on restaurant garbage for five days then oil was extracted. ► Oil content in larvae was 24.40 wt% to 26.29 wt% comparing to soybean of 20 wt%. ► Utilization of garbage reduces pollution and makes economic recycle possible. ► The properties of ultimately FAME reach the ASTM D6751 and EN 14124 standards. -- Abstract: The current energy crisis greatly affects worldwide economic development. Therefore, identifying for new energy resources is critically important. In this study, we introduce a potential biodiesel source: Chrysomya megacephala (Fabricius) larvae (CML), which are proliferative and can be fed with a variety of low cost materials, such as manure, wheat bran, rotted meat and decayed vegetation. The potential of C. megacephala (Fabricius) larvae oil (CMLO) for biodiesel applications was explored. Oil was extracted from the CML raised by feeding on restaurant garbage for five days. The oil content obtained from the dehydrated CML ranged from 24.40% to 26.29% since restaurant garbage varies in composition day to day. The acid value of the CMLO was tested to be 1.10 mg KOH/g. Four factors were subsequently considered to optimize the transesterification of CMLO to biodiesel. The optimized conditions included a 6:1 methanol to oil molar ratio, 1.6% KOH catalyst, a reaction temperature of 55 °C and a reaction time of 30 min. Under these conditions, the maximum yield of fatty acid methyl esters (FAME) from CMLO was 87.71%. Finally, properties of the FAME were within the specifications of ASTM D6751 and EN 14214 biodiesel standards. Therefore, we concluded that C. megacephala (Fabricius) larvae represent a potential alternative feedstock for biodiesel production.

  6. Nematode cysts and larvae found in Achatina fulica Bowdich, 1822.

    Science.gov (United States)

    Franco-Acuña, D O; Pinheiro, J; Torres, E J L; Lanfredi, R M; Brandolini, S V P B

    2009-02-01

    This study describes the morphology of the nematode cysts and larvae found in Achatina fulica (giant African snail) in Brazil. Sixty snails were collected in Mesquita, Rio de Janeiro State. Fourteen of the snails were naturally infected. The cysts were spherical, pink colored and measured 0.97 to 1.57 mm in diameter. In the majority of cases they had a single larvae involved in amorphous material. A total of 222 encysted larvae were recovered. Of these, 30 were utilized in the morphological study. The length of the larvae varied from 2.57 to 5.8 mm and they were classified as small--up to 3.5 mm; medium--from 3.53 to 4.5 mm; and large--greater than 4.52 mm. The average length of the larvae in the three groups was 2.85, 3.87 and 5.23 mm, respectively. The larval cuticle was white, shiny and transversally striated until the posterior end of the body. At the anterior end there is a mouth with three lips, with amphids and papillae, followed by a muscular esophagus with average length of 0.61 mm, terminating in an esophageal bulb and having a nerve ring in the middle third of the esophagus, and an intestine with an opening near the posterior end. The tail begins from this opening and has two types of ends: short and abrupt or long and gradually tapering. The difference in the tail end can suggest sexual dimorphism, although no primordial reproductive structures were observed. These characteristics were not sufficient to identify the larvae, so there is a need for further study.

  7. Simulating the impact of the entrainment of winter flounder larvae

    International Nuclear Information System (INIS)

    Hess, K.W.; Sissenwine, M.P.; Saila, S.B.

    1975-01-01

    The transport of winter flounder larvae around the Millstone Point, Conn. Area by the action of tidal currents and diffusion was simulated by computer to predict the numbers which could be entrained during the operation of a local nuclear power station. A tidal hydrodynamic model with variable depth was employed to simulate currents and water levels. These techniques provided input to a transport model which simulated the concentration of larvae. A larval source in a tributary river was simulated for twenty tidal cycles, with and without entrainment. The results indicated that the reduction in winter flounder larvae near Millstone Point at the end of the pelagic stage (period during which larvae are likely to be entrained) was less than 1 percent when it was assumed that larvae have little chance of returning once lost from Millstone bight. In order to assess the effect of a 1 percent reduction in recruitment of winter flounder larvae to the benthic phase of their life cycle, the local population was simulated by a model in which year-classes and the total egg production were represented by compartments. Each year-class grew, produced eggs, suffered natural and fishing mortality according to information derived from the literature. The effect of power plant entrainment was incorporated by reducing the number of recruits to year-class I that would normally result from a specific level of egg production. For a 1 percent reduction in recruitment due to power plant entrainment, a potential 6 percent decrease in total population size following 35 years of operation was indicated. (U.S.)

  8. Distribution and elimination of Norfloxacin in Fenneropenaeus chinensis larvae

    Science.gov (United States)

    Sun, Ming; Li, Jian; Zhao, Fazhen; Li, Jitao; Chang, Zhiqiang

    2013-09-01

    This study examined the distribution and elimination of Norfloxacin (NFLX) in Fenneropenaeus chinensis ovary and egg and newly hatched larvae. Mature parental shrimp were exposed to 4 or 10 mg L-1 NFLX for 2 or 5 d. Ovary and eggs of the shrimp were sampled after spawning in order to detect NFLX residue using high-performance liquid chromatography (HPLC). Results showed that NFLX residue accumulated in F. chinensis eggs after the parental exposure, with the highest residue detected in ovary. To examine the fate of NFLX residue in larvae, we further determined the concentration of NFLX residue in F. chinensis eggs and larvae at 4 different developmental stages after 24-h exposure. From the newly metamorphosed larvae (0 h post-metamorphosis, h.p.m), samples were taken at different time intervals to 72 h.p.m. HPLC assay showed that the concentrations of NFLX residue in zoea exposed to 4 and 10 mg L-1 NFLX were the highest at 1.5 h, i.e., 0.332 and 0.454 μg g-1, respectively. At the two NFLX exposure levels, the elimination time of half NFLX (half life) in nauplius was 45.36 and 49.85 h, respectively, followed by that in zoea (31.68 and 33.13 h), mysis larvae (42.24 and 47.28 h) and postlarvae (24.48 and 30.96 h). Both NFLX exposure levels had a germicidal effect. The distribution and elimination of NFLX residue in F. chinensis tissue, eggs and larvae correlated well with the drug exposure level. The disappearance of NFLX residue coincided with the larval growth, and the half-life of NFLX decreased with the larval development.

  9. Acanthocephala Larvae parasitizing Ameiva ameiva ameiva (Linnaeus, 1758 (Squamata: Teiidae

    Directory of Open Access Journals (Sweden)

    Lilian Cristina Macedo

    2016-03-01

    Full Text Available Abstract Knowledge concerning the taxonomy and biology of species of Acanthocephala, helminth parasites of the helminth species of the phylum Acanthocephala, parasites of lizards in Brazilian Amazonia, is still insufficient, but reports of Acanthocephala in reptiles are becoming increasingly common in the literature. Cystacanth-stage Acanthocephalan larvae have been found in the visceral peritoneum during necropsy of Ameiva ameiva ameivalizards from the “Osvaldo Rodrigues da Cunha” Herpetology Collection of the Emílio Goeldi Museum, Belém, Pará, Brazil. The aim of this study was to present the morphological study of the Acanthocephala larvae found in A. ameiva ameiva lizard.

  10. Acanthocephala Larvae parasitizing Ameiva ameiva ameiva (Linnaeus, 1758) (Squamata: Teiidae).

    Science.gov (United States)

    Macedo, Lilian Cristina; Melo, Francisco Tiago de Vasconcelos; Ávila-Pires, Teresa Cristina Sauer; Giese, Elane Guerreiro; dos Santos, Jeannie Nascimento

    2016-01-01

    Knowledge concerning the taxonomy and biology of species of Acanthocephala, helminth parasites of the helminth species of the phylum Acanthocephala, parasites of lizards in Brazilian Amazonia, is still insufficient, but reports of Acanthocephala in reptiles are becoming increasingly common in the literature. Cystacanth-stage Acanthocephalan larvae have been found in the visceral peritoneum during necropsy of Ameiva ameiva ameivalizards from the "Osvaldo Rodrigues da Cunha" Herpetology Collection of the Emílio Goeldi Museum, Belém, Pará, Brazil. The aim of this study was to present the morphological study of the Acanthocephala larvae found in A. ameiva ameiva lizard.

  11. Cutaneous larva migrans after a trip to the Caribean

    OpenAIRE

    García-Fernández, Lisset; Calderón, María

    2014-01-01

    La larva migrans cutánea es una parasitosis ocasionada por las larvas de Ancylostoma braziliense y Ancylostoma caninum, cuyo vehículo es la arena de playas infestadas. Los perros y gatos son los hospederos definitivos. Esta parasitosis es endémica en las costas del Caribe, África, Australia y Asia. Presentamos el caso clínico de una mujer de 27 años de edad, quien tras haber realizado un viaje al Caribe mexicano y haber estado en contacto con arena de playa, presentó unas lesiones en el pie d...

  12. The hatching larva of the priapulid worm Halicryptus spinulosus

    Directory of Open Access Journals (Sweden)

    Budd Graham E

    2009-05-01

    Full Text Available Abstract Despite their increasing evolutionary importance, basic knowledge about the priapulid worms remains limited. In particular, priapulid development has only been partially documented. Following previous description of hatching and the earliest larval stages of Priapulus caudatus, we here describe the hatching larva of Halicryptus spinulosus. Comparison of the P. caudatus and the H. spinulosus hatching larvae allows us to attempt to reconstruct the ground pattern of priapulid development. These findings may further help unravelling the phylogenetic position of the Priapulida within the Scalidophora and hence contribute to the elucidation of the nature of the ecdysozoan ancestor.

  13. Ultrastructural observations of the larva of Tubiluchus corallicola (Priapulida)

    Science.gov (United States)

    Higgins, R. P.; Storch, V.

    1989-03-01

    Larvae of Tubiluchus corallicola van der Land 1968 were investigated by scanning and transmission electron microscopy. The scalids are sensory organs, each has a bipolar receptor cell with a single apical cilium similar to the scalid in the adult. Muscle cells of the larva are more differentiated than previously reported for other Priapulida; the larval arrangement of circular and longitudinal musculature differs from that of the adult, and a diaphragm is reported for the first time in Priapulida. The diaphragm may function in hydrostatic control of eversion and inversion of the introvert and mouth cone. The functional morphology of these two structures is discussed and contrasted with the Kinorhyncha.

  14. The hatching larva of the priapulid worm Halicryptus spinulosus.

    Science.gov (United States)

    Janssen, Ralf; Wennberg, Sofia A; Budd, Graham E

    2009-05-26

    Despite their increasing evolutionary importance, basic knowledge about the priapulid worms remains limited. In particular, priapulid development has only been partially documented. Following previous description of hatching and the earliest larval stages of Priapulus caudatus, we here describe the hatching larva of Halicryptus spinulosus. Comparison of the P. caudatus and the H. spinulosus hatching larvae allows us to attempt to reconstruct the ground pattern of priapulid development. These findings may further help unravelling the phylogenetic position of the Priapulida within the Scalidophora and hence contribute to the elucidation of the nature of the ecdysozoan ancestor.

  15. Infection of silkworm larvae by the entomopathogenic fungus Metarhizium anisopliae

    Directory of Open Access Journals (Sweden)

    Lucineia de Fátima Chasko Ribeiro

    Full Text Available ABSTRACT: The isolate E9 of Metarhizium anisopliae was used in commercial hybrids of Bombyx mori larvae to evaluate its biological effect. Symptomatological analyses showed typical signs of fungal infection. Histopathology revealed the presence of large numbers of hemocytes in the hemocoel, and on the sixth dpi the bodies of the insects appeared to be colonised by the fungus. The isolate E9 is pathogenic to larvae B. mori and; therefore, death of the insects was caused by the colonization of fungus in the epidermal and mesodermal tissues.

  16. Intraguild predation and cannibalism among larvae of detritivorous caddisflies in subalpine wetlands

    Science.gov (United States)

    Wissinger, S.A.; Sparks, G.B.; Rouse, G.L.; Brown, W.S.; Steltzer, Heidi

    1996-01-01

    Comparative data from subalpine wetlands in Colorado indicate that larvae of the limnephilid caddisflies, Asynarchus nigriculus and Limnephilus externus, are reciprocally abundant among habitats - Limnephilus larvae dominate in permanent waters, whereas Asynarchus larvae dominate in temporary basins. The purpose of this paper is to report on field and laboratory experiments that link this pattern of abundance to biotic interactions among larvae. In the first field experiment, growth and survival were compared in single and mixed species treatments in littoral enclosures. Larvae, which eat mainly vascular plant detritus, grew at similar rates among treatments in both temporary and permanent habitats suggesting that exploitative competition is not important under natural food levels and caddisfly densities. However, the survival of Limnephilus larvae was reduced in the presence of Asynarchus larvae. Subsequent behavioral studies in laboratory arenas revealed that Asynarchus larvae are extremely aggressive predators on Limnephilus larvae. In a second field experiment we manipulated the relative sizes of larvae and found that Limnephilus larvae were preyed on only when Asynarchus larvae had the same size advantage observed in natural populations. Our data suggest that the dominance of Asynarchus larvae in temporary habitats is due to asymmetric intraguild predation (IGP) facilitated by a phenological head start in development. These data do not explain the dominance of Limnephilus larvae in permanent basins, which we show elsewhere to be an indirect effect of salamander predation. Behavioral observations also revealed that Asynarchus larvae are cannibalistic. In contrast to the IGP on Limnephilus larvae, Asynarchus cannibalism occurs among same-sized larvae and often involves the mobbing of one victim by several conspecifics. In a third field experiment, we found that Asynarchus cannibalism was not density-dependent and occurred even at low larval densities. We

  17. The method by which Cephenemyia trompe (Modeer larvae invade reindeer (Rangifer tarandus

    Directory of Open Access Journals (Sweden)

    John R. Anderson

    1990-09-01

    Full Text Available Laboratory electrostimulated C. trompe (Modeer females forcefully expelled (sprayed larvae for 5-20 cm. The watery spray consisted of about 20 tiny droplets containing two to several larvae. Crawling first-instar larvae exhibited negative geotactic and phototropic responses; they were subject to rapid desiccation and became immobile as the tiny droplets dried within a few seconds. When 5-50 larvae from dissectedfemales were dropped in physiological saline onto different areas of the muzzle of restrained reindeer, only larvae placed deep within the nostrils and on the lips crawled out-of-sight down the nostril passage or into the mouth. Drops of larvae placed elsewhere quickly desiccated and the larvae became immobile. Larvae deposited by wild females onto a COz-baited reindeer model with the muzzle, lips and nostrils coated with insect trapping adhesive all were stuck only along the dorsal lip below the philtrum. All experimental evidence supports a natural per os mode of invasion.

  18. Development of Metarhizium anisopliae and Beauveria bassiana formulations for control of malaria mosquito larvae

    NARCIS (Netherlands)

    Bukhari, S.T.; Takken, W.; Koenraadt, C.J.M.

    2011-01-01

    Background The entomopathogenic fungi Metarhizium anisopliae and Beauveria bassiana have demonstrated effectiveness against anopheline larvae in the laboratory. However, utilising these fungi for the control of anopheline larvae under field conditions, relies on development of effective means of

  19. Variability in the distribution of planktonic fish eggs and larvae in the nearshore waters off Bombay

    Digital Repository Service at National Institute of Oceanography (India)

    Gajbhiye, S.N.; Nair, V.R.; Desai, B.N.

    represented different environmental conditions. Fish eggs and larvae were common in the area of study with maximum abundance in December 1979 and April/ August 1980. Mean density of fish eggs was maximum along the Mahim transect while population of larvae...

  20. Two alternating motor programs drive navigation in Drosophila larva.

    Directory of Open Access Journals (Sweden)

    Subhaneil Lahiri

    Full Text Available When placed on a temperature gradient, a Drosophila larva navigates away from excessive cold or heat by regulating the size, frequency, and direction of reorientation maneuvers between successive periods of forward movement. Forward movement is driven by peristalsis waves that travel from tail to head. During each reorientation maneuver, the larva pauses and sweeps its head from side to side until it picks a new direction for forward movement. Here, we characterized the motor programs that underlie the initiation, execution, and completion of reorientation maneuvers by measuring body segment dynamics of freely moving larvae with fluorescent muscle fibers as they were exposed to temporal changes in temperature. We find that reorientation maneuvers are characterized by highly stereotyped spatiotemporal patterns of segment dynamics. Reorientation maneuvers are initiated with head sweeping movement driven by asymmetric contraction of a portion of anterior body segments. The larva attains a new direction for forward movement after head sweeping movement by using peristalsis waves that gradually push posterior body segments out of alignment with the tail (i.e., the previous direction of forward movement into alignment with the head. Thus, reorientation maneuvers during thermotaxis are carried out by two alternating motor programs: (1 peristalsis for driving forward movement and (2 asymmetric contraction of anterior body segments for driving head sweeping movement.

  1. Does vertical migratory behaviour retain fish larvae onshore in ...

    African Journals Online (AJOL)

    ... and/or (2) DVM enhances the transport of larvae and pre-recruits from the offshore to the onshore domain of the nursery area, and then counteracts offshore advection by favouring retention. We tracked the trajectories of virtual particles in the model and calculated a pre-recruitment index as a proxy for transport success to ...

  2. Nutritional condition of fish larvae in South African estuaries: an ...

    African Journals Online (AJOL)

    Nutritional condition of fish larvae in South African estuaries: an appraisal of three biochemical methods. D Costalago, N Strydom, C Frost. Abstract. Estuaries are exposed to a number of threats and many South African estuarine systems are functionally and structurally altered. The extent to which fish are affected by these ...

  3. Enantiomerization and enantioselective bioaccumulation of metalaxyl in Tenebrio molitor larvae.

    Science.gov (United States)

    Gao, Yongxin; Wang, Huili; Qin, Fang; Xu, Peng; Lv, Xiaotian; Li, Jianzhong; Guo, Baoyuan

    2014-02-01

    The enantiomerization and enantioselective bioaccumulation of metalaxyl by a single dose of exposure to Tenebrio molitor larvae under laboratory condition were studied by high-performance liquid chromatography tandem mass spectroscopy (HPLC-MS/MS) based on a ChiralcelOD-3R [cellulosetris-tris-(3, 5-dichlorophenyl-carbamate)] column. Exposure of enantiopure R-metalaxyl and S-metalaxyl in Tenebrio molitor larvae exhibited significant enantiomerization, with formation of the R enantiomers from the S enantiomers, and vice versa, which might be attributed to the chiral pesticide catalyzed by a certain enzyme in Tenebrio molitor larvae. Enantiomerization was not observed in wheat bran during the period of 21 d. In addition, bioaccumulation of rac-metalaxyl in Tenebrio molitor larvae was enantioselective with a preferential accumulation of S-metalaxyl. These results showed that enantioselectivity was caused not only by actual degradation and metabolism but also by enantiomerization, which was an important process in the environmental fate and behavior of metalaxyl enantiomers. Copyright © 2013 Wiley Periodicals, Inc.

  4. Hydrodynamics of burst swimming fish larvae; a conceptual model approach

    NARCIS (Netherlands)

    Verhagen, J.H.G.

    2004-01-01

    Burst swimming of fish larvae is analysed from a hydrodynamic point of view. A picture of the expected flow pattern is presented based on information in literature on unsteady-flow patterns around obstacles in the intermediate Reynolds number region. It is shown that the acceleration stage of burst

  5. Migration Of Ancylostoma caninum Larvae Into Lungs Of Mice Fed ...

    African Journals Online (AJOL)

    Two randomly selected groups of Swiss Albino Wistar mice were therefore infected with 1000 infective larvae of Ancylostoma caninum/mouse. Test mice received 250mg Allium sativum/kg body weight daily ... KEY WORDS: Allium sativum, lungs, Ancylostoma caninum. Global Journal of Pure and Applied Sciences Vol.11(2) ...

  6. The larvae of decapods and fishes of Amba estuary, Maharashtra

    Digital Repository Service at National Institute of Oceanography (India)

    Paulinose, V.T.; Devi, C.B.L.; Govindan, K.; Gajbhiye, S.N; Nair, V.R.

    larvae to the total zooplankton population were 3.63 and 0.03 respectively. In the assessment of larval stocks environmental parameters and the presence of adult fish caught in the area were considered. The estuarine area supported fairly high fishery...

  7. Anaphe venata larva extract-induced purposeless chewing in rats ...

    African Journals Online (AJOL)

    In this study we investigated the effect of the crude aqueous and Phosphate Buffer Saline (PBS) extracts of this larva on altered spontaneous rat behavior in a novel environment particularly chewing behaviour, with a view to determine the mechanism(s) involved in these behavioural alteration. Animals were randomly ...

  8. Estuarine retention of larvae of the crab Rhithropanopeus harrisii

    Science.gov (United States)

    Cronin, Thomas W.

    1982-08-01

    Larvae of estuarine organisms continually face possible export from the parent estuary. Retention of larvae of the estuarine crab Rhithropanopeus harrisii was investigated in the upper Newport River estuary, North Carolina. All of the developmental stages occurred in the same area of the estuary with similar horizontal distributions, and the concentrations of intermediate and late stages were not greatly reduced from those of the first larval stage. This was strong evidence for the continuous retention of larvae in the upper estuary. To determine mechanisms by which retention might be effected, field studies of the vertical distributions and migrations of these larvae were made. The four zoeal stages had similar but complex vertical migration patterns, which varied from study to study. These migrations centered on the depth of no net flow, reducing longitudinal transport during development. Cross-spectral analysis of the larval migrations and the environmental cycles of light, salinity and current speed revealed that each of these external cycles affected larval depth. Megalopae of R. harrisii also migrated vertically, but they were present in much lower concentrations than the zoeal stages, an indication of a change to benthic existence in this final larval form.

  9. Aquaculture and feeding ecology: Feeding behaviour in turbot larvae

    DEFF Research Database (Denmark)

    Bruno, Eleonora

    capture success. This thesis is part of a large international project aimed at improving the rearing techniques of high value fish species larvae fed with calanoid copepods, their natural prey, to achieve high levels of survival and quality. In fact, fish aquaculture is becoming increasingly important...

  10. Tidal exchange of larvae of Sesarma catenata (Decapoda, Brachyura)

    African Journals Online (AJOL)

    The tidal exchange of larvae of the salt-marsh grapsid crab Sesarma catenata was studied in the Swartkops estuary, a tidally driven, shallow estuary in Algoa Bay, South Africa. Plankton samples were collected bimonlhly during spring and neap tides from October to March at the tidal inlet. Samples were collected hourly for ...

  11. Insect Larvae: A New Platform to Produce Commercial Recombinant Proteins.

    Science.gov (United States)

    Targovnik, Alexandra M; Arregui, Mariana B; Bracco, Lautaro F; Urtasun, Nicolas; Baieli, Maria F; Segura, Maria M; Simonella, Maria A; Fogar, Mariela; Wolman, Federico J; Cascone, Osvaldo; Miranda, Maria V

    2016-01-01

    In Biotechnology, the expression of recombinant proteins is a constantly growing field and different hosts are used for this purpose. Some valuable proteins cannot be produced using traditional systems. Insects from the order Lepidoptera infected with recombinant baculovirus have appeared as a good choice to express high levels of proteins, especially those with post-translational modifications. Lepidopteran insects, which are extensively distributed in the world, can be used as small protein factories, the new biofactories. Species like Bombyx mori (silkworm) have been analyzed in Asian countries to produce a great number of recombinant proteins for use in basic and applied science and industry. Many proteins expressed in this larva have been commercialized. Several recombinant proteins produced in silkworms have already been commercialized. On the other hand, species like Spodoptera frugiperda, Heliothis virescens, Rachiplusia nu, Helicoverpa zea and Trichoplusia ni are widely distributed in both the occidental world and Europe. The expression of recombinant proteins in larvae has the advantage of its low cost in comparison with insect cell cultures. A wide variety of recombinant proteins, including enzymes, hormones and vaccines, have been efficiently expressed with intact biological activity. The expression of pharmaceutically proteins, using insect larvae or cocoons, has become very attractive. This review describes the use of insect larvae as an alternative to produce commercial recombinant proteins.

  12. Biological control agent for mosquito larvae: Review on the killifish ...

    African Journals Online (AJOL)

    This review attempts to give an account on the recent advances on the killifish Aphanius dispar dispar as a biological control agent for mosquito larvae. Thirty six (36) articles of literature (scientific papers, technical and workshop reports) on this subject covering the period between 1980 and 2009 were reviewed.

  13. Symbiotic Bacteria Enable Olive Fly Larvae to Overcome Host Defenses

    International Nuclear Information System (INIS)

    Ben-Yosef, Michael; Yuval, Boaz; Pasternak, Zohar; Jurkevitch, Edouard

    2016-01-01

    Ripe fruit offer readily available nutrients for many animals, including fruit fly larvae (Diptera: Tephritidae) and their associated rot-inducing bacteria. Yet, during most of their ontogeny, fruit remain chemically defended and effectively suppress herbivores and pathogens by high levels of secondary metabolites. Olive flies (Bactrocera oleae) are uniquely able to develop in unripe olives. Unlike other frugivorous tephritids, the larvae maintain bacteria confined within their midgut caeca. We examined the interaction between larvae, their associated bacteria, and fruit chemical defence, hypothesizing that bacterial contribution to larval development is contingent on the phenology of fruit defensive chemistry. We demonstrate that larvae require their natural complement of bacteria (Candidatus Erwinia dacicola: Enterobacteriaceae) in order to develop in unripe olives. Conversely, when feeding on ripe fruit, larval development proceeds independently of these bacteria. Our experiments suggest that bacteria counteract the inhibitory effect of oleuropein—the principal phenolic glycoside in unripe olives. In light of these results, we suggest that the unique symbiosis in olive flies, compared with other frugivorous tephritids, is understood by considering the relationship between the fly, bacteria and fruit chemistry. When applied in an evolutionary context, this approach may also point out the forces which shaped symbioses across the Tephritidae. (author)

  14. Defensive enrolment in mantis shrimp larvae (Malacostraca: Stomatopoda)

    NARCIS (Netherlands)

    Haug, C.; Haug, J.T.

    2014-01-01

    We describe a possible new defensive behaviour of larval stages of mantis shrimps (Stomatopoda). Mantis shrimp larvae are rarely observed in nature, thus the study is based on postures of museum material and functional morphological aspects. Specimens described here are tightly enrolled, their pleon

  15. Response of larvae of Cirina forda Westwood (Lepidoptera ...

    African Journals Online (AJOL)

    Cirina forda, an economically important edible folivore of Vitellaria paradoxa in the moist and dry woodland savanna ecosystems of Nigeria, has become ecologically restricted to the upper dry woodland savanna ecozone. The larvae of this insect are good source of protein for human and livestock consumption and income.

  16. Metabolic alterations and molecular mechanism in silkworm larvae ...

    African Journals Online (AJOL)

    Silkworm larvae, Bombyx mori (L), is an important economic insect and also a tool to convert leaf protein into silk. The industrial and commercial use of silk, the historical and economic importance of production and its application in all over the world finely contributed to the silkworm promotion as a powerful laboratory model ...

  17. Nursing protects honeybee larvae from secondary metabolites of pollen.

    Science.gov (United States)

    Lucchetti, Matteo A; Kilchenmann, Verena; Glauser, Gaetan; Praz, Christophe; Kast, Christina

    2018-03-28

    The pollen of many plants contains toxic secondary compounds, sometimes in concentrations higher than those found in the flowers or leaves. The ecological significance of these compounds remains unclear, and their impact on bees is largely unexplored. Here, we studied the impact of pyrrolizidine alkaloids (PAs) found in the pollen of Echium vulgare on honeybee adults and larvae. Echimidine, a PA present in E. vulgare pollen, was isolated and added to the honeybee diets in order to perform toxicity bioassays. While adult bees showed relatively high tolerance to PAs, larvae were much more sensitive. In contrast to other bees, the honeybee larval diet typically contains only traces of pollen and consists predominantly of hypopharyngeal and mandibular secretions produced by nurse bees, which feed on large quantities of pollen-containing bee bread. We quantified the transfer of PAs to nursing secretions produced by bees that had previously consumed bee bread supplemented with PAs. The PA concentration in these secretions was reduced by three orders of magnitude as compared to the PA content in the nurse diet and was well below the toxicity threshold for larvae. Our results suggest that larval nursing protects honeybee larvae from the toxic effect of secondary metabolites of pollen. © 2018 The Authors.

  18. Diphyllobothrium nihonkaiense Tapeworm Larvae in Salmon from North America

    Czech Academy of Sciences Publication Activity Database

    Kuchta, Roman; Oros, M.; Ferguson, J.; Scholz, Tomáš

    2017-01-01

    Roč. 23, č. 2 (2017), s. 351-353 ISSN 1080-6040 R&D Projects: GA ČR GAP506/12/1632 Institutional support: RVO:60077344 Keywords : Alaska * Diphyllobothrium * human * larva * nonhuman * Oncorhynchus * seashore Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine OBOR OECD: Parasitology Impact factor: 8.222, year: 2016

  19. Nursing protects honeybee larvae from secondary metabolites of pollen

    Science.gov (United States)

    Lucchetti, Matteo A.; Kilchenmann, Verena; Glauser, Gaetan; Praz, Christophe

    2018-01-01

    The pollen of many plants contains toxic secondary compounds, sometimes in concentrations higher than those found in the flowers or leaves. The ecological significance of these compounds remains unclear, and their impact on bees is largely unexplored. Here, we studied the impact of pyrrolizidine alkaloids (PAs) found in the pollen of Echium vulgare on honeybee adults and larvae. Echimidine, a PA present in E. vulgare pollen, was isolated and added to the honeybee diets in order to perform toxicity bioassays. While adult bees showed relatively high tolerance to PAs, larvae were much more sensitive. In contrast to other bees, the honeybee larval diet typically contains only traces of pollen and consists predominantly of hypopharyngeal and mandibular secretions produced by nurse bees, which feed on large quantities of pollen-containing bee bread. We quantified the transfer of PAs to nursing secretions produced by bees that had previously consumed bee bread supplemented with PAs. The PA concentration in these secretions was reduced by three orders of magnitude as compared to the PA content in the nurse diet and was well below the toxicity threshold for larvae. Our results suggest that larval nursing protects honeybee larvae from the toxic effect of secondary metabolites of pollen. PMID:29563265

  20. Survival dynamics of scleractinian coral larvae and implications for dispersal

    Science.gov (United States)

    Graham, E. M.; Baird, A. H.; Connolly, S. R.

    2008-09-01

    Survival of pelagic marine larvae is an important determinant of dispersal potential. Despite this, few estimates of larval survival are available. For scleractinian corals, few studies of larval survival are long enough to provide accurate estimates of longevity. Moreover, changes in mortality rates during larval life, expected on theoretical grounds, have implications for the degree of connectivity among reefs and have not been quantified for any coral species. This study quantified the survival of larvae from five broadcast-spawning scleractinian corals ( Acropora latistella, Favia pallida, Pectinia paeonia, Goniastrea aspera, and Montastraea magnistellata) to estimate larval longevity, and to test for changes in mortality rates as larvae age. Maximum lifespans ranged from 195 to 244 d. These longevities substantially exceed those documented previously for coral larvae that lack zooxanthellae, and they exceed predictions based on metabolic rates prevailing early in larval life. In addition, larval mortality rates exhibited strong patterns of variation throughout the larval stage. Three periods were identified in four species: high initial rates of mortality; followed by a low, approximately constant rate of mortality; and finally, progressively increasing mortality after approximately 100 d. The lifetimes observed in this study suggest that the potential for long-distance dispersal may be substantially greater than previously thought. Indeed, detection of increasing mortality rates late in life suggests that energy reserves do not reach critically low levels until approximately 100 d after spawning. Conversely, increased mortality rates early in life decrease the likelihood that larvae transported away from their natal reef will survive to reach nearby reefs, and thus decrease connectivity at regional scales. These results show how variation in larval survivorship with age may help to explain the seeming paradox of high genetic structure at metapopulation scales

  1. Ocean Acidification Has Multiple Modes of Action on Bivalve Larvae.

    Science.gov (United States)

    Waldbusser, George G; Hales, Burke; Langdon, Chris J; Haley, Brian A; Schrader, Paul; Brunner, Elizabeth L; Gray, Matthew W; Miller, Cale A; Gimenez, Iria; Hutchinson, Greg

    2015-01-01

    Ocean acidification (OA) is altering the chemistry of the world's oceans at rates unparalleled in the past roughly 1 million years. Understanding the impacts of this rapid change in baseline carbonate chemistry on marine organisms needs a precise, mechanistic understanding of physiological responses to carbonate chemistry. Recent experimental work has shown shell development and growth in some bivalve larvae, have direct sensitivities to calcium carbonate saturation state that is not modulated through organismal acid-base chemistry. To understand different modes of action of OA on bivalve larvae, we experimentally tested how pH, PCO2, and saturation state independently affect shell growth and development, respiration rate, and initiation of feeding in Mytilus californianus embryos and larvae. We found, as documented in other bivalve larvae, that shell development and growth were affected by aragonite saturation state, and not by pH or PCO2. Respiration rate was elevated under very low pH (~7.4) with no change between pH of ~ 8.3 to ~7.8. Initiation of feeding appeared to be most sensitive to PCO2, and possibly minor response to pH under elevated PCO2. Although different components of physiology responded to different carbonate system variables, the inability to normally develop a shell due to lower saturation state precludes pH or PCO2 effects later in the life history. However, saturation state effects during early shell development will carry-over to later stages, where pH or PCO2 effects can compound OA effects on bivalve larvae. Our findings suggest OA may be a multi-stressor unto itself. Shell development and growth of the native mussel, M. californianus, was indistinguishable from the Mediterranean mussel, Mytilus galloprovincialis, collected from the southern U.S. Pacific coast, an area not subjected to seasonal upwelling. The concordance in responses suggests a fundamental OA bottleneck during development of the first shell material affected only by

  2. Ocean Acidification Has Multiple Modes of Action on Bivalve Larvae.

    Directory of Open Access Journals (Sweden)

    George G Waldbusser

    Full Text Available Ocean acidification (OA is altering the chemistry of the world's oceans at rates unparalleled in the past roughly 1 million years. Understanding the impacts of this rapid change in baseline carbonate chemistry on marine organisms needs a precise, mechanistic understanding of physiological responses to carbonate chemistry. Recent experimental work has shown shell development and growth in some bivalve larvae, have direct sensitivities to calcium carbonate saturation state that is not modulated through organismal acid-base chemistry. To understand different modes of action of OA on bivalve larvae, we experimentally tested how pH, PCO2, and saturation state independently affect shell growth and development, respiration rate, and initiation of feeding in Mytilus californianus embryos and larvae. We found, as documented in other bivalve larvae, that shell development and growth were affected by aragonite saturation state, and not by pH or PCO2. Respiration rate was elevated under very low pH (~7.4 with no change between pH of ~ 8.3 to ~7.8. Initiation of feeding appeared to be most sensitive to PCO2, and possibly minor response to pH under elevated PCO2. Although different components of physiology responded to different carbonate system variables, the inability to normally develop a shell due to lower saturation state precludes pH or PCO2 effects later in the life history. However, saturation state effects during early shell development will carry-over to later stages, where pH or PCO2 effects can compound OA effects on bivalve larvae. Our findings suggest OA may be a multi-stressor unto itself. Shell development and growth of the native mussel, M. californianus, was indistinguishable from the Mediterranean mussel, Mytilus galloprovincialis, collected from the southern U.S. Pacific coast, an area not subjected to seasonal upwelling. The concordance in responses suggests a fundamental OA bottleneck during development of the first shell material

  3. Developmental Toxicity of Dextromethorphan in Zebrafish Embryos/Larvae

    Science.gov (United States)

    Xu, Zheng; Williams, Frederick E.; Liu, Ming-Cheh

    2012-01-01

    Dextromethorphan is widely used in over-the-counter cough and cold medications. Its efficacy and safety for infants and young children remains to be clarified. The present study was designed to use the zebrafish as a model to investigate the potential toxicity of dextromethorphan during the embryonic and larval development. Three sets of zebrafish embryos/larvae were exposed to dextromethorphan at 24 hours post fertilization (hpf), 48 hpf, and 72 hpf, respectively, during the embryonic/larval development. Compared with the 48 and 72 hpf exposure sets, the embryos/larvae in the 24 hpf exposure set showed much higher mortality rates which increased in a dose-dependent manner. Bradycardia and reduced blood flow were observed for the embryos/larvae treated with increasing concentrations of dextromethorphan. Morphological effects of dextromethorphan exposure, including yolk sac and cardiac edema, craniofacial malformation, lordosis, non-inflated swim bladder, and missing gill, were also more frequent and severe among zebrafish embryos/larvae exposed to dextromethorphan at 24 hpf. Whether the more frequent and severe developmental toxicity of dextromethorphan observed among the embryos/larvae in the 24 hpf exposure set, as compared with the 48 and 72 hpf exposure sets, is due to the developmental expression of the Phase I and Phase II enzymes involved in the metabolism of dextromethorphan remains to be clarified. A reverse transcription-polymerase chain reaction (RT-PCR) analysis, nevertheless, revealed developmental stage-dependent expression of mRNAs encoding SULT3 ST1 and SULT3 ST3, two enzymes previously shown to be capable of sulfating dextrorphan, an active metabolite of dextromethorphan. PMID:20737414

  4. Preliminary study of killing the larva of plodia interpunella by irradiation

    International Nuclear Information System (INIS)

    Wang Jide; Ma Xiaoping

    1994-01-01

    The results of killing the larva of plodia interpunella in the fruit by 60 Co γ-irradiation are described. The lowest effective dose for killing larva by irradiation is ca. 2000 Gy; the effective dose for immediately killing larva is 3000 Gy. The method is simple and easy and also suitable for the study of commercial irradiation of dry-fruit

  5. Composting poultry manure by fly larvae (Musca domestica) eliminates Campylobacter jejuni from the manure

    DEFF Research Database (Denmark)

    Nordentoft, Steen; Hald, Birthe

    2013-01-01

    study To monitor fly larvae composting of poultry manure artificially contaminated with C. jejuni, and to investigate a possible transmission route of C. jejuni from the manure through the fly larvae to the adult fly. Conclusions The addition of fly larvae both accelerated the degradation of manure...

  6. Three different agglomerations of blood cells in a Caliroa limacina larva

    NARCIS (Netherlands)

    Barendrecht, G.

    1949-01-01

    Some time ago in our laboratory a number of larvae of Caliroa limacina Retz., the well known slug like sawfly larva of the pear, were fixed in toto and sectioned into complete series, which were coloured with EHRLICH’S or HEIDENHAIN’S haematoxylin and counterstained with eosin. Most of these larvae

  7. Weight changes and organ pathology in rats given edible larvae of ...

    African Journals Online (AJOL)

    Processing the larvae by boiling and sun-drying reduced the toxicity on the liver and heart but not in the kidney. More research is needed on the toxicological aspects of the consumption of Cirina forda larva. Keywords: insect larvae, processing, entomophagy, histopathology, rats. African Journal of Biomedical Research Vol.

  8. Distribution and seasonal abundance of carangid larvae in the Arabian sea and Bay of Bengal

    Digital Repository Service at National Institute of Oceanography (India)

    Peter, K.J.; Balachandran, T.

    Carangid larvae were recorded from 8.8% of the International Indian Ocean Expedition (IIOE) stations in the Arabian Sea and 13.2% in the Bay of Bengal. Their total contribution was 1.1% of the total larvae collected. The highest number of larvae...

  9. Effects of the Liquids Used to Kill Larvae on the Length of Forensically Important Blow Fly Lucilia sericata Meigen (Diptera: Calliphoridae) Larvae

    OpenAIRE

    Halide Nihal Açıkgöz; Ali Açıkgöz

    2017-01-01

    Forensic entomological practices rely upon accurate larval identification and measurement of larval length, for the estimation of post-mortem intervals. The methods used for killing larvae may affect the length of larvae. In the autopsy hall, corpses which are contain entomological remains have been washed with grape vinegar. Besides, while collecting and killing the larvae on corpses, crime scene teams use alcohol 70% because it is practical. The aim of this study was to determine which...

  10. Diagnosis of brugian filariasis by loop-mediated isothermal amplification.

    Directory of Open Access Journals (Sweden)

    Catherine B Poole

    Full Text Available In this study we developed and evaluated a Brugia Hha I repeat loop-mediated isothermal amplification (LAMP assay for the rapid detection of Brugia genomic DNA. Amplification was detected using turbidity or fluorescence as readouts. Reactions generated a turbidity threshold value or a clear visual positive within 30 minutes using purified genomic DNA equivalent to one microfilaria. Similar results were obtained using DNA isolated from blood samples containing B. malayi microfilariae. Amplification was specific to B. malayi and B. timori, as no turbidity was observed using DNA from the related filarial parasites Wuchereria bancrofti, Onchocerca volvulus or Dirofilaria immitis, or from human or mosquito. Furthermore, the assay was most robust using a new strand-displacing DNA polymerase termed Bst 2.0 compared to wild-type Bst DNA polymerase, large fragment. The results indicate that the Brugia Hha I repeat LAMP assay is rapid, sensitive and Brugia-specific with the potential to be developed further as a field tool for diagnosis and mapping of brugian filariasis.

  11. Elemental concentrations of aquatic insect larvae and attached algae on tone surfaces in an uncontaminated stream

    International Nuclear Information System (INIS)

    Momoshima, N.; Sugihara, S.; Hibino, K.; Nakamura, Y.

    2009-01-01

    Elemental concentrations of aquatic insect larvae and attached algae in an uncontaminated river were analyzed by instrumental neutron activation analysis (INAA) via the k 0 -standardization method. The aquatic insect larvae found were all intolerant species. No significant difference was observed int he elemental concentrations of aquatic insect larvae and attached algae long the river. Similar elemental concentrations were observed in the aquatic insect larvae collected at a fixed sampling point for two years. An analysis by the ratio-matching technique indicated a higher generic relationship between aquatic insect larvae and attached algae than river water. (author)

  12. Infestation of a bird and two cats by larvae of Plodia interpunctella (Lepidoptera: Pyralidae).

    Science.gov (United States)

    Pinckney, R D; Kanton, K; Foster, C N; Steinberg, H; Pellitteri, P

    2001-09-01

    The larvae of Plodia interpunctella (Hübner), commonly known as the Indian meal moth, often cause enormous losses in stored food supplies. We present three clinical case reports of accidental infestation by P. interpunctella larvae in two domestic cats and one parakeet. A larva gained entry into the avian host and subsequently migrated to the brain. It was alive, covered with "silk-like" fibers and confirmed to be a fourth instar. Plodia interpunctella larvae were excised with forceps from the subcutaneous tissues of the ear and neck of two cats in a different household. Previous reports of infestation by P. interpunctella larvae in vertebrates are unknown.

  13. Oesophagostomum columbianum : immunization of young lambs using gamma ray attenuated inefective larvae

    International Nuclear Information System (INIS)

    Sharma, R.L.; Dhar, D.N.

    1987-01-01

    Infective Oesophagostomum columbianum larvae were successfully attenuated by exposing them to a gamma radiation dose levels of either 40 or 50 Krad. Lambs receiving a single vaccination dose of 2000 infective larvae attenuated at 40 Krad developed partial protection, whereas those vaccinated with similar dose of infection with 50 Krad irradiated larvae failed to develop any protection. A double vaccination schedule comprising of 500 and 2000 gamma attenuated (40 Krad) infective larvae induced a significantly higher level of protection against the challenge dose. The possible use of radiation attenuated larvae as vaccine for immunoprophylaxis against ovine Oesophagostomiasis has been discussed. (author). 11 refs., 2 tables

  14. Tadpoles of three common anuran species from Thailand do not prey on mosquito larvae.

    Science.gov (United States)

    Weterings, Robbie

    2015-12-01

    Tadpoles are often considered to be predators of mosquito larvae and are therefore beneficial for the control of certain disease vectors. Nevertheless, only a few species have actually been recorded to prey on mosquito larvae. The mosquito larvae predation rates of tadpoles of three common Thai anuran species (Bufo melanostictus, Kaloula pulchra and Hylarana raniceps) were experimentally tested. Tadpoles in varying developmental stages were used to assess a size/age effect on the predation rate. In addition, different instars of Culex quinquefasciatus were used in order to assess a prey size effect on the predation rates. All three species failed to show any evidence of mosquito larvae predation. Neither small nor large tadpoles fed on mosquito larvae. Prey size also did not affect predation. Although tadpoles do not feed on mosquito larvae, there may be other direct or indirect inter-specific interactions that adversely impact the development of larvae in shared habitats with tadpoles. © 2015 The Society for Vector Ecology.

  15. Digestion in sea urchin larvae impaired under ocean acidification

    Science.gov (United States)

    Stumpp, Meike; Hu, Marian; Casties, Isabel; Saborowski, Reinhard; Bleich, Markus; Melzner, Frank; Dupont, Sam

    2013-12-01

    Larval stages are considered as the weakest link when a species is exposed to challenging environmental changes. Reduced rates of growth and development in larval stages of calcifying invertebrates in response to ocean acidification might be caused by energetic limitations. So far no information exists on how ocean acidification affects digestive processes in marine larval stages. Here we reveal alkaline (~pH 9.5) conditions in the stomach of sea urchin larvae. Larvae exposed to decreased seawater pH suffer from a drop in gastric pH, which directly translates into decreased digestive efficiencies and triggers compensatory feeding. These results suggest that larval digestion represents a critical process in the context of ocean acidification, which has been overlooked so far.

  16. Development of a two photon microscope for tracking Drosophila larvae

    Science.gov (United States)

    Karagyozov, Doycho; Mihovilovic Skanata, Mirna; Gershow, Marc

    Current in vivo methods for measuring neural activity in Drosophila larva require immobilization of the animal. Although we can record neural signals while stimulating the sensory organs, we cannot read the behavioral output because we have prevented the animal from moving. Many research questions cannot be answered without observation of neural activity in behaving (freely-moving) animals. We incorporated a Tunable Acoustic Gradient (TAG) lens into a two-photon microscope to achieve a 70kHz axial scan rate, enabling volumetric imaging at tens of hertz. We then implemented a tracking algorithm based on a Kalman filter to maintain the neurons of interest in the field of view and in focus during the rapid three dimensional motion of a free larva. Preliminary results show successful tracking of a neuron moving at speeds reaching 500 μm/s. NIH Grant 1DP2EB022359 and NSF Grant PHY-1455015.

  17. Tracking radioactive larvae of Strongyloides ratti in the host

    International Nuclear Information System (INIS)

    Wilson, P.A.G.

    1979-01-01

    Infective larvae of homogonic Strongyloides ratti grown in faecal culture with 32 P or 75 Se acquired a significant amount of radioactivity which was firmly attached to them. Heating removed most of the 32 P but left 75 Se in place. Subcutaneous injection of virgin and nursing mother rats with living and heat-killed ratioactive larvae resulted in a pattern of labelling in the small intestine of injected animals and, in the case of 75 Se, those of suckling pups, which can only be explained if labelled worms follow the natural migratory routes. The use of this tool in migratory studies is discussed, with precautions to allow for flaws in the technique. (author)

  18. Effects of plant phenols of performance of southern armyworm larvae.

    Science.gov (United States)

    Lindroth, R L; Peterson, S S

    1988-03-01

    We evaluated the effects of two classes of phenols on performance of penultimate instar southern armyworms, Spodoptera eridania. One class consisted of phenols containing a catechol (ortho-dihydroxybenzene) moiety and included chlorogenic acid, quercetin, rutin, and rhamnetin. A second group consisted of the phenolic glycoside salicin and its derivatives salicortin and tremulacin. The compounds were painted onto lima bean (Phaseolus lunatus) leaves and fed to larvae for the duration of the fifth instar. Chlorogenic acid and rhamnetin had no deleterious effects; rutin and quercetin caused some mortality and rutin reduced growth rates by decreasing consumption and digestion efficiency. Results showed that ortho-dihydroxybenzene groups may be necessary, but are not sufficient for biological activity. Salicin did not affect larvae; salicortin and tremulacin reduced growth rates primarily by decreasing consumption. These two compounds also caused degenerative lesions in midgut tissues. The presence of a benzoyl ester group in tremulacin accentuates its toxicity, relative to that of salicortin.

  19. Symmetry of priapulids (Priapulida). 2. Symmetry of larvae.

    Science.gov (United States)

    Adrianov, A V; Malakhov, V V

    2001-02-01

    Larvae of priapulids are characterized by radial symmetry evident from both external and internal characters of the introvert and lorica. The bilaterality appears as a result of a combination of several radial symmetries: pentaradial symmetry of the teeth, octaradial symmetry of the primary scalids, 25-radial symmetry of scalids, biradial symmetry of the neck, and biradial and decaradial symmetry of the trunk. Internal radiality is exhibited by musculature and the circumpharyngeal nerve ring. Internal bilaterality is evident from the position of the ventral nerve cord and excretory elements. Externally, the bilaterality is determined by the position of the anal tubulus and two shortened midventral rows of scalids bordering the ventral nerve cord. The lorical elements define the biradial symmetry that is missing in adult priapulids. The radial symmetry of larvae is a secondary appearance considered an evolutionary adaptation to a lifestyle within the three-dimensional environment of the benthic sediment. Copyright 2001 Wiley-Liss, Inc.

  20. The immunogenic effect of irradiated Hemonchus contortus larvae in goats

    International Nuclear Information System (INIS)

    de la Cruz, B.; Perfuse, W.

    1980-01-01

    The development of radiation-attenuated vaccines against parasitic disease has been reported in literature. The use of irradiated larvae as vaccines enables one to take advantage of the special immunological properties of living parasites; the radiation treatment can largely suppress the pathogenic effects of the vaccines and the reproductive capacity of the parasites involved. This report deals with our attempts to produce a radiation-attenuated vaccine against Hemonchus contortus infection in adult goats. Hemonchus contortus infection in ruminants is prevalent in the Philippines, especially among cattle and goats. The results presented indicate that a certain degree of resistance against Hemonchus contortus infection can be induced in adult goats immunized with irradiated larvae. The shelf-life of the vaccine was also determined. (author)

  1. Microvascular system forming in skeletal muscle near trichinella larvae

    International Nuclear Information System (INIS)

    Berzentsev, Y.A.; Oksov, I.V.

    1986-01-01

    The fine structure and dynamics of formation of the microcirculatory system about the larvae of the two Trichinella species, providing for the rapid entry of nutrient substances to the larvae, were investigated in the muscles of white mice. Hitological, hitochemical, autoradiographic, and electron-microscopic methods were used in the investigation. At a certain period of the experiment, the greatest quantity of RNA was found in the endotheliocyte cytoplasm, tritium-thymidine label was incorporated into the nuclei, and mitoses were visible. The transition to tissue parasitism was accompanied by a complication of the relationships with the host and the formation of a more complex independent microcirculatory system, which ensures a more intensive influx of blood

  2. Activity of Selected Formulated Biorational and Synthetic Insecticides Against Larvae of Helicoverpa armigera (Lepidoptera: Noctuidae).

    Science.gov (United States)

    Vivan, L M; Torres, J B; Fernandes, P L S

    2017-02-01

    This work studied 17 insecticides belonging to nucleopolyhedrovirus (NPV), Bacillus thuringiensis (Bt kurstaki and Bt aizawai), benzoylureas (insect growth regulators [IGRs]), carbamates, organophosphates, spinosyns, and diamides against larvae of Helicoverpa armigera (Hübner), invasive species in the South American continent. Larvae of different instars were fed for 7 d with untreated or insecticide-treated diets. Mortality was recorded daily for 7 d, and surviving larvae were individually weighed on the seventh day. The NPV and Bt insecticides caused 100% mortality of first-instar larvae and first-instar and second-instar larvae, respectively. However, both NPV and Bt-based products caused low mortality of third-instar larvae and did not kill older larvae. The IGR lufenuron was highly effective against all three ages of larvae tested, whereas teflubenzuron and triflumuron produced maximum 60% mortality of second-instar larvae and lower than 50% to older larvae. Thiodicarb, chlorantraniliprole, indoxacarb, chlorpyrifos, and chlorfenapyr, irrespective of tested age, caused 100% mortality of larvae, with the last two insecticides reaching 100% mortality within 2 d of feeding on the treated diet. Flubendiamide caused lower mortality but significantly affected the weight of surviving larvae, whereas neither spinosad nor methomyl produced significant mortality or affected the weight of larvae. Based on the results, the age of H. armigera larvae plays an important role in the recommendation of NPV and Bt insecticides. Furthermore, there are potential options between biological and synthetic insecticides tested against H. armigera, and recording larval size during monitoring, in addition to the infestation level, should be considered when recommending biological-based insecticides to control this pest. © The Authors 2016. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  3. Cockchafer larvae smell host root scents in soil.

    Directory of Open Access Journals (Sweden)

    Sonja Weissteiner

    Full Text Available In many insect species olfaction is a key sensory modality. However, examination of the chemical ecology of insects has focussed up to now on insects living above ground. Evidence for behavioral responses to chemical cues in the soil other than CO(2 is scarce and the role played by olfaction in the process of finding host roots below ground is not yet understood. The question of whether soil-dwelling beetle larvae can smell their host plant roots has been under debate, but proof is as yet lacking that olfactory perception of volatile compounds released by damaged host plants, as is known for insects living above ground, occurs. Here we show that soil-dwelling larvae of Melolontha hippocastani are well equipped for olfactory perception and respond electrophysiologically and behaviorally to volatiles released by damaged host-plant roots. An olfactory apparatus consisting of pore plates at the antennae and about 70 glomeruli as primary olfactory processing units indicates a highly developed olfactory system. Damage induced host plant volatiles released by oak roots such as eucalyptol and anisol are detected by larval antennae down to 5 ppbv in soil air and elicit directed movement of the larvae in natural soil towards the odor source. Our results demonstrate that plant-root volatiles are likely to be perceived by the larval olfactory system and to guide soil-dwelling white grubs through the dark below ground to their host plants. Thus, to find below-ground host plants cockchafer larvae employ mechanisms that are similar to those employed by the adult beetles flying above ground, despite strikingly different physicochemical conditions in the soil.

  4. Acanthocephala Larvae parasitizing Ameiva ameiva ameiva (Linnaeus, 1758) (Squamata: Teiidae)

    OpenAIRE

    Lilian Cristina Macedo; Francisco Tiago de Vasconcelos Melo; Teresa Cristina Sauer Ávila-Pires; Elane Guerreiro Giese; Jeannie Nascimento dos Santos

    2016-01-01

    Abstract Knowledge concerning the taxonomy and biology of species of Acanthocephala, helminth parasites of the helminth species of the phylum Acanthocephala, parasites of lizards in Brazilian Amazonia, is still insufficient, but reports of Acanthocephala in reptiles are becoming increasingly common in the literature. Cystacanth-stage Acanthocephalan larvae have been found in the visceral peritoneum during necropsy of Ameiva ameiva ameivalizards from the “Osvaldo Rodrigues da Cunha” Herpetolog...

  5. Antibacterial marine bacterium deter luminous vibriosis in shrimp larvae

    OpenAIRE

    Abraham, T.J.

    2004-01-01

    Inhibitory activity of a marine pigmented bacterium - Alteromonas sp. - isolated from Penaeus monodon Fabricius larva against pathogenic and environmental isolates of Vibrio harveyi was studied. All the isolates were inhibited to varying degrees by Alteromonas sp. in vitro. The antibacterial substance produced by the Alteromonas sp. was soluble in organic solvent and closely bound to the external surface of bacterial cells. The antibacterial Alteromonas sp., when allowed to colonize on shrimp...

  6. Microbial interference with hatch and survival of European eel larvae

    DEFF Research Database (Denmark)

    Sørensen, Sune Riis; Lauesen; Tomkiewicz, Jonna

    Recent research has significantly improved our knowledge and capabilities in the field of in vitro production of yolk sac larvae from European eel (Anguilla anguilla). Female broodstock European eels are matured by weekly administration of pituitary extract and male eels with hCG (human chorionic...... larviculture should not only focus on optimizing physical incubation conditions, but certainly also on the control over microbial interference....

  7. Chemical defence in chrysomelid eggs and neonate larvae

    OpenAIRE

    Pasteels, Jacques M.; Daloze, D.; Rowell-Rahier, Martine

    2009-01-01

    Eggs and neonate larvae of chrysomelid beetles (sub-tribes Chrysomelina and Phyllodectina) were investigated for the presence of defensive substances. The two isoxazolinone glucosides (compounds 1 and 2), characteristic of the adult defence secretion, were detected in the eggs of all studied species. Compound 2, containing a nitropropionate, is always present in concentrations (above 10-2 M), which are highly deterrent to the ant Myrmica rubra. This compound is not at all or only slightly to...

  8. Salinity tolerance of larvae of African catfish Clarias gariepinus ( ) X ...

    African Journals Online (AJOL)

    Fourteen and twenty one day larvae were exposed to abrupt stepwise change in salinity (2, 4, 6, 8, 10 and 12 ppt) for 96 hours to determine mortality, median lethal mortality, MLS and median lethal time, MLT. The fourteen day-old fry that were exposed to 0 – 6 ppt recorded 90%, 87.5% 77.5% and 10% survival at the end of ...

  9. The larva of Drusus vinconi Sipahiler, 1992 (Trichoptera, Limnephilidae, Drusinae

    Directory of Open Access Journals (Sweden)

    Johann Waringer

    2013-07-01

    Full Text Available This paper describes the previously unknown larva of Drusus vinconi Sipahiler, 1992. Information on the morphology of the 5th larval instar is given, and the most important diagnostic features are illustrated. In the context of existing identification keys the larva of D. vinconi keys together with D. annulatus (Stephens, 1837, D. biguttatus (Pictet, 1834, D. ingridae Sipahiler, 1993, Hadimina torosensis Sipahiler, 2002 and Leptodrusus budtzi (Ulmer, 1913. These species differ in the contours of the pronotum in lateral view, the presence/absence of the pronotal transverse groove, the shape of the median notch of the pronotum (in anterior view, pronotal sculpturing, presence/absence of the lateral carina of the head capsule, the number of proximo-dorsal setae on the mid-and hind femora, where the lateral fringe starts on the abdomen, and in geographic distribution. With respect to zoogeography, Drusus vinconi is a (micro-endemic of the Western Pyrenees. The species prefers stony substratum in springs and springbrooks of the montane and subalpine region (Graf et al. 2008; Sipahiler 1992, 1993. As a grazer, the larvae of D. vinconi feed on biofilm and epilithic algae.

  10. Observations of cocooned Hydrobaenus (Diptera: Chironomidae) larvae in Lake Michigan

    Science.gov (United States)

    Tucker, Taaja R.; Hudson, Patrick L.; Riley, Stephen

    2016-01-01

    Larvae of the family Chironomidae have developed a variety of ways to tolerate environmental stress, including the formation of cocoons, which allows larvae to avoid unfavorable temperature conditions, drought, or competition with other chironomids. Summer cocoon formation by younger instars of the genus Hydrobaenus Fries allows persistence through increased temperatures and/or intermittent dry periods in arid regions or temporary habitats, but this behavior was not observed in the Great Lakes until the current study. Cocoon-aestivating Hydrobaenus sp. larvae were found in benthic grab samples collected in 2010–2013 near Sleeping Bear Dunes National Lakeshore in northern Lake Michigan with densities up to 7329/m2. The aestivating species was identified as Hydrobaenus johannseni (Sublette, 1967), and the associated chironomid community was typical for an oligotrophic nearshore system. Hydrobaenus cocoon formation in the Great Lakes was likely previously unnoticed due to the discrepancies between the genus' life history and typical benthos sampling procedures which has consequences for describing chironomid communities where Hydrobaenus is present.

  11. Riceland mosquito management practices for Anopheles quadrimaculatus larvae.

    Science.gov (United States)

    Allen, R A; Wilkes, W W; Lewis, C N; Meisch, M V

    2008-12-01

    Two separate but related studies were conducted regarding management of Anopheles quadrimaculatus larval populations in commercial rice fields near Cleveland, MS, in 2004. Study 1 was to evaluate the effectiveness of 2 treatments of aerially applied ultra-low volume applications of Bacillus thuringiensis var. israelensis (Bti) against An. quadrimaculatus larvae in dense, high-canopy mid- to late-season rice crop. Study 2 was to investigate the effect of preflood treatments of lambda-cyhalothrin (Karate), which is commonly used against rice water weevil (Lissorhoptrus oryzophilus), on An. quadrimaculatus larvae. Excellent initial, but short residual control (>99% control 1 day after treatment) was observed in the Bti-treated fields in both mid- and late-season rice. Little or no effect on mosquito larvae was observed in the lambda-cyhalothrin-treated fields. Results indicate that Bti can be effectively used by mosquito management personnel to control larval populations of An. quadrimaculatus in late-season rice fields; however, lambda-cyhalothrin did not effectively control larval An. quadrimaculatus when applied preflood to rice fields.

  12. Hemolymph amino acid analysis of individual Drosophila larvae.

    Science.gov (United States)

    Piyankarage, Sujeewa C; Augustin, Hrvoje; Grosjean, Yael; Featherstone, David E; Shippy, Scott A

    2008-02-15

    One of the most widely used transgenic animal models in biology is Drosophila melanogaster, the fruit fly. Chemical information from this exceedingly small organism is usually accomplished by studying populations to attain sample volumes suitable for standard analysis methods. This paper describes a direct sampling technique capable of obtaining 50-300 nL of hemolymph from individual Drosophila larvae. Hemolymph sampling performed under mineral oil and in air at 30 s intervals up to 120 s after piercing larvae revealed that the effect of evaporation on amino acid concentrations is insignificant when the sample was collected within 60 s. Qualitative and quantitative amino acid analyses of obtained hemolymph were carried out in two optimized buffer conditions by capillary electrophoresis with laser-induced fluorescence detection after derivatizing with fluorescamine. Thirteen amino acids were identified from individual hemolymph samples of both wild-type (WT) control and the genderblind (gb) mutant larvae. The levels of glutamine, glutamate, and taurine in the gb hemolymph were significantly lower at 35%, 38%, and 57% of WT levels, respectively. The developed technique that samples only the hemolymph fluid is efficient and enables accurate organism-level chemical information while minimizing errors associated with possible sample contaminations, estimations, and effects of evaporation compared to the traditional hemolymph-sampling techniques.

  13. Nutritional Transition Period in Early Larvae Clarias Gariepinus

    International Nuclear Information System (INIS)

    Ing, N.S.; Chew, H.H.

    2015-01-01

    The nutritional transition period of Clarias gariepinus were described based on the early development from hatching to 120 hours after hatching (hAH) reared at 27.5 - 28.6 degree Celsius. Newly hatched larvae had a large greenish yolk sac volume (0.99 ± 0.31 mm"3) located below a straight undeveloped digestive tract, mouth not opened, eyes unpigmented and the larvae lie on the bottom of rearing tank. During endogenous feeding period, the larval feeding system has developed rapidly with development oesophagus. Yolk sac were not completely depleted at the onset of exogenous feeding (36 hAH, 0.19 ± 0.11 mm"3), and a period of mixed nutrition was observed up to 68 hAH when yolk was completely exhausted. Yolk sac volume was significantly different by time at hatching, 6, 12 and 18 to 36 hAH (ANOVA, P<0.05). At 36 hAH, the larvae commenced feeding once morphologically developed with opened anus, functional jaw and intestine, and demonstrated horizontally swimming. The rudimentary chemoreceptors like olfactory organs and taste buds that were found on the barbels and oral cavity assisted in food detection and commenced feeding without vision. Due to the cannibalistic behaviour at early stage, feed are suggested to be provided during 36 hAH and avoided delay feeding in the larval rearing. (author)

  14. Carbohydrate digestion in Lutzomyia longipalpis' larvae (Diptera - Psychodidae).

    Science.gov (United States)

    Vale, Vladimir F; Moreira, Bruno H; Moraes, Caroline S; Pereira, Marcos H; Genta, Fernando A; Gontijo, Nelder F

    2012-10-01

    Lutzomyia longipalpis is the principal species of phlebotomine incriminated as vector of Leishmania infantum, the etiological agent of visceral leishmaniasis in the Americas. Despite its importance as vector, almost nothing related to the larval biology, especially about its digestive system has been published. The objective of the present study was to obtain an overview of carbohydrate digestion by the larvae. Taking in account that phlebotomine larvae live in the soil rich in decaying materials and microorganisms we searched principally for enzymes capable to hydrolyze carbohydrates present in this kind of substrate. The principal carbohydrases encountered in the midgut were partially characterized. One of them is a α-amylase present in the anterior midgut. It is probably involved with the digestion of glycogen, the reserve carbohydrate of fungi. Two other especially active enzymes were present in the posterior midgut, a membrane bound α-glucosidase and a membrane bound trehalase. The first, complete the digestion of glycogen and the other probably acts in the digestion of trehalose, a carbohydrate usually encountered in microorganisms undergoing hydric stress. In a screening done with the use of p-nitrophenyl-derived substrates other less active enzymes were also observed in the midgut. A general view of carbohydrate digestion in L. longipalpis was presented. Our results indicate that soil microorganisms appear to be the main source of nutrients for the larvae. Copyright © 2012 Elsevier Ltd. All rights reserved.

  15. Effects of kinship or familiarity? Small thrips larvae experience lower predation risk only in groups of mixed-size siblings

    NARCIS (Netherlands)

    de Bruijn, P.J.A.; Sabelis, M.W.; Egas, M.

    2014-01-01

    In many species of insects, larvae are distributed in an aggregated fashion. As they may differ in size and size matters to predation risk, small larvae may be less likely to fall prey to predators when near large and therefore better-defended larvae. We hypothesize that the small larvae may profit

  16. Mananoligossacarídeo em dietas para larvas de tilápia Mannanoligosaccharides in diets for tilapia larvae

    Directory of Open Access Journals (Sweden)

    Kátia Kalko Schwarz

    2011-12-01

    Full Text Available Este experimento foi realizado para avaliar níveis crescentes de mananoligossacarídeo (MOS na dieta de larvas de tilápias-do-nilo (linhagem Supreme® na fase de reversão sexual durante 30 dias. Larvas de tilápia-do-nilo (n=1500, P=0,01 g ± 0,001 g foram distribuídas aleatoriamente em 30 tanques de 100 litros. Os peixes foram distribuídos em delineamento inteiramente casualizado, composto por seis tratamentos e cinco repetições. A dieta controle (isenta de MOS foi elaborada para conter aproximadamente 35% de proteína bruta e 3.100 kcal de ED/kg. As demais foram suplementadas com 0; 0,15; 0,30; 0,45; 0,60 e 0,75% de MOS em substituição ao milho da dieta controle. Com o aumento nos níveis de MOS nas dietas, foi observado aumento linear sobre o comprimento do intestino, a altura das vilosidades intestinais e a densidade dos vilos. Não houve diferença na composição corporal, no ganho em peso, no peso final, no comprimento final, no fator de condição, na taxa de sobrevivência e no número de células caliciformes do intestino das larvas. Os níveis de MOS tiveram efeito quadrático sobre a conversão alimentar, cujos melhores resultados foram obtidos com 0,34% de MOS. A utilização de MOS no nível de 0,34% em dietas para larvas de tilápia-do-nilo melhora a conversão alimentar e promove aumento do comprimento do intestino, da altura das vilosidades e da densidade de vilos intestinal.This experiment was conducted to evaluate increasing levels of mannanoligosaccharides (MOS in the diet of Nile tilapia larvae (Supreme® at the sex reversal stage for 30 days. Nile tilapia larvae (n = 1500, p = 0.01 ± 0.001 g, were randomly distributed in 30 tanks of 100 liters each, for 30 days. The fish were distributed in a randomized design with six treatments and five replicates. The control diet (no MOS was elaborated to contain approximately 35% of crude protein and 3,100 kcal DE/kg. Mannanoligosaccharides were included in the other diets

  17. Morphological and behavioral development of the piracanjuba larvae Desenvolvimento morfológico e comportamental de larvas de piracanjuba

    Directory of Open Access Journals (Sweden)

    Cláudia Maria Reis Raposo Maciel

    2010-05-01

    Full Text Available The objective of this work was to study the morphologic development and the swimming and feeding behaviors of piracanjuba larvae, Brycon orbignyanus Valenciennes (1849 (Characiformes, Characidae, Bryconinae, during the period from zero to 172 hours after hatching (standard length = 3.62 - 11.94 mm. The morphological analyses were accomplished by using a trinocular stereo microscope, while the behavioral analyses were performed through periodic observations. In 28 hours after hatching, the larvae (standard length = 6.25 ± 0.13 mm showed the following structural and behavioral characteristics that made them become active predators able to overcome a larval critical phase, the beginning of exogenous feeding: presence of pigmented eyes, terminal and wide mouth, developed oral dentition, developing digestive tube, yolk sac reduction, fins and swim bladder formation, horizontal swimming, cannibalism, and predation. Intense cannibalism among larvae was verified from 26 to 72 hours. At the end of the metamorphosis - 172 hours after hatching - the larvae measuring 11.94 + 0.80 mm in standard length presented a flexed notochord, caudal fin bifurcation, dorsal and anal fin formation, synchronized movements, and formation of shoals, characteristics that together allow enhanced perception and locomotio in exploration of the environment, determining the best moment for transfering to the fishponds. New studies can contribute to commercial fish farming by improving feeding management, performance, survival, and productivity of this species.Objetivou-se estudar o desenvolvimento morfológico e os comportamentos natatório e alimentar de larvas de piracanjuba, Brycon orbignyanus Valenciennes (1849 (Characiformes, Characidae, Bryconinae no período de 0 a 172 horas após a eclosão (comprimento-padrão = 3,62 - 11,94 mm. As análises morfológicas foram realizadas com auxílio de um microscópio estereoscópico trinocular e as comportamentais, por meio de

  18. Radiolabeling of infective third-stage larvae of Strongyloides stercoralis by feeding [75Se]selenomethionine-labeled Escherichia coli to first- and second-stage larvae

    International Nuclear Information System (INIS)

    Aikens, L.M.; Schad, G.A.

    1989-01-01

    A technique is described for radiolabeling Strongyloides stercoralis larvae with [ 75 Se]selenomethionine. Cultures of an auxotrophic methionine-dependent stain of Escherichia coli were grown in a medium containing Dulbecco's modified Eagle's medium supplemented with 5% nutrient broth, amino acids, and [ 75 Se]selenomethionine. When the 75 Se-labeled bacterial populations were in the stationary phase of growth, cultures were harvested and the bacteria dispersed on agar plates to serve as food for S. stercoralis larvae. Use of nondividing bacteria is important for successful labeling because the isotope is not diluted by cell division and death of larvae attributable to overgrowth by bacteria is prevented. First-stage S. stercoralis larvae were recovered from feces of infected dogs and reared in humid air at 30 C on agar plates seeded with bacteria. After 7 days, infective third-stage larvae were harvested. The mean specific activity of 6 different batches of larvae ranged from 75 to 330 counts per min/larva with 91.8 +/- 9.5% of the population labeled sufficiently to produce an autoradiographic focus during a practicable, 6-wk period of exposure. Labeled infective larvae penetrated the skin of 10-day-old puppies and migrated to the small intestine, where the developed to adulthood

  19. Regional distribution of Paenibacillus larvae subspecies larvae, the causative organism of American foulbrood, in honey bee colonies of the Western United States.

    Science.gov (United States)

    Eischen, Frank A; Graham, R Henry; Cox, Robert

    2005-08-01

    We examined honey bee, Apis mellifera L., colonies pollinating almonds in California during February 2003 for Paenibacillus larvae subsp. Larvae, the causative organism of the virulent brood disease American foulbrood. Colonies originating from the Rocky Mountain area and California had significantly higher numbers (P bees, respectively) than colonies from the upper Midwest (1.28). Colonies from the northwestern, central, and southwestern United States had intermediate CFU or bacterial colony levels. Operations positive for P. larvae larvae were relatively uniform at approximately 70-80%, and no regional significant differences were found. Percentages of colonies with high CFUs (> or = 400 per 30 bees) differed significantly, with those from the Rocky Mountain region having 8.73% compared with those of the upper Midwest with 0%. The significance of CFU levels was evaluated by inoculating healthy colonies with diseased immatures and sampling adult bees. The number of CFUs detected per diseased immature was conservatively estimated to be approximately 399 CFUs per 30 adult bees. We defined this spore level as 1 disease equivalent. Based on this, 3.86% colonies in our survey had 1 or more disease equivalent number of P. larvae larvae CFUs. Operations with high P. larvae larvae spore levels in their colonies will likely observe American foulbrood if prophylaxis is not practiced diligently.

  20. Annual and spatial variability in endo- and ectoparasite infections of North Sea cod (Gadus morhua Linnaeus, 1758) larvae, post-larvae and juveniles

    DEFF Research Database (Denmark)

    Mehrdana, Foojan; Bahlool, Qusay Z. M.; Skovgaard, Alf

    2014-01-01

    A parasitological investigation was performed on a total of 5380 Atlantic cod larvae, post-larvae and small juveniles sampled from the North Sea during a period of five years. The copepod Caligus elongatus (Von Nordmann, 1832) and the nematode Hysterothylacium aduncum (Rudolphi, 1802) were found ...

  1. Transcriptional responses in honey bee larvae infected with chalkbrood fungus.

    Science.gov (United States)

    Aronstein, Katherine A; Murray, Keith D; Saldivar, Eduardo

    2010-06-21

    Diseases and other stress factors working synergistically weaken honey bee health and may play a major role in the losses of bee populations in recent years. Among a large number of bee diseases, chalkbrood has been on the rise. We present here the experimental identification of honey bee genes that are differentially expressed in response to infection of honey bee larvae with the chalkbrood fungus, Ascosphaera apis. We used cDNA-AFLP Technology to profile transcripts in infected and uninfected bee larvae. From 64 primer combinations, over 7,400 transcriptionally-derived fragments were obtained A total of 98 reproducible polymorphic cDNA-AFLP fragments were excised and sequenced, followed by quantitative real-time RT-PCR (qRT-PCR) analysis of these and additional samples.We have identified a number of differentially-regulated transcripts that are implicated in general mechanisms of stress adaptation, including energy metabolism and protein transport. One of the most interesting differentially-regulated transcripts is for a chitinase-like enzyme that may be linked to anti-fungal activities in the honey bee larvae, similarly to gut and fat-body specific chitinases found in mosquitoes and the red flour beetle. Surprisingly, we did not find many components of the well-characterized NF-kappaB intracellular signaling pathways to be differentially-regulated using the cDNA-AFLP approach. Therefore, utilizing qRT-PCR, we probed some of the immune related genes to determine whether the lack of up-regulation of their transcripts in our analysis can be attributed to lack of immune activation or to limitations of the cDNA-AFLP approach. Using a combination of cDNA-AFLP and qRT-PCR analyses, we were able to determine several key transcriptional events that constitute the overall effort in the honey bee larvae to fight natural fungal infection. Honey bee transcripts identified in this study are involved in critical functions related to transcriptional regulation, apoptotic

  2. Whole-body gene expression pattern registration in Platynereis larvae.

    Science.gov (United States)

    Asadulina, Albina; Panzera, Aurora; Verasztó, Csaba; Liebig, Christian; Jékely, Gáspár

    2012-12-03

    Digital anatomical atlases are increasingly used in order to depict different gene expression patterns and neuronal morphologies within a standardized reference template. In evo-devo, a discipline in which the comparison of gene expression patterns is a widely used approach, such standardized anatomical atlases would allow a more rigorous assessment of the conservation of and changes in gene expression patterns during micro- and macroevolutionary time scales. Due to its small size and invariant early development, the annelid Platynereis dumerilii is particularly well suited for such studies. Recently a reference template with registered gene expression patterns has been generated for the anterior part (episphere) of the Platynereis trochophore larva and used for the detailed study of neuronal development. Here we introduce and evaluate a method for whole-body gene expression pattern registration for Platynereis trochophore and nectochaete larvae based on whole-mount in situ hybridization, confocal microscopy, and image registration. We achieved high-resolution whole-body scanning using the mounting medium 2,2'-thiodiethanol (TDE), which allows the matching of the refractive index of the sample to that of glass and immersion oil thereby reducing spherical aberration and improving depth penetration. This approach allowed us to scan entire whole-mount larvae stained with nitroblue tetrazolium/5-bromo-4-chloro-3-indolyl phosphate (NBT/BCIP) in situ hybridization and counterstained fluorescently with an acetylated-tubulin antibody and the nuclear stain 4'6-diamidino-2-phenylindole (DAPI). Due to the submicron isotropic voxel size whole-mount larvae could be scanned in any orientation. Based on the whole-body scans, we generated four different reference templates by the iterative registration and averaging of 40 individual image stacks using either the acetylated-tubulin or the nuclear-stain signal for each developmental stage. We then registered to these templates the

  3. Whole-body gene expression pattern registration in Platynereis larvae

    Directory of Open Access Journals (Sweden)

    Asadulina Albina

    2012-12-01

    Full Text Available Abstract Background Digital anatomical atlases are increasingly used in order to depict different gene expression patterns and neuronal morphologies within a standardized reference template. In evo-devo, a discipline in which the comparison of gene expression patterns is a widely used approach, such standardized anatomical atlases would allow a more rigorous assessment of the conservation of and changes in gene expression patterns during micro- and macroevolutionary time scales. Due to its small size and invariant early development, the annelid Platynereis dumerilii is particularly well suited for such studies. Recently a reference template with registered gene expression patterns has been generated for the anterior part (episphere of the Platynereis trochophore larva and used for the detailed study of neuronal development. Results Here we introduce and evaluate a method for whole-body gene expression pattern registration for Platynereis trochophore and nectochaete larvae based on whole-mount in situ hybridization, confocal microscopy, and image registration. We achieved high-resolution whole-body scanning using the mounting medium 2,2’-thiodiethanol (TDE, which allows the matching of the refractive index of the sample to that of glass and immersion oil thereby reducing spherical aberration and improving depth penetration. This approach allowed us to scan entire whole-mount larvae stained with nitroblue tetrazolium/5-bromo-4-chloro-3-indolyl phosphate (NBT/BCIP in situ hybridization and counterstained fluorescently with an acetylated-tubulin antibody and the nuclear stain 4’6-diamidino-2-phenylindole (DAPI. Due to the submicron isotropic voxel size whole-mount larvae could be scanned in any orientation. Based on the whole-body scans, we generated four different reference templates by the iterative registration and averaging of 40 individual image stacks using either the acetylated-tubulin or the nuclear-stain signal for each developmental

  4. Alimentação e comportamento de larvas de pacu, Piaractus mesopotamicus (Holmberg, 1887 Feeding and behavior of pacu, Piaractus mesopotamicus (Holmberg, 1887 larvae

    Directory of Open Access Journals (Sweden)

    Eduardo Lopes Beerli

    2004-02-01

    Full Text Available Conduziu-se este trabalho com o objetivo de avaliar o efeito da utilização de dietas naturais e artificiais sobre o desempenho e comportamento de larvas de pacu (Piaractus mesopotamicus, entre o 2º e o 10º dia de vida. Foram utilizadas 30 caixas plásticas, cada uma com 30 litros de água e renovação contínua, onde as larvas foram mantidas durante o período experimental. Cada caixa recebeu 10 larvas por litro, totalizando 300 larvas/caixa. Foram testados 6 tratamentos, cada qual com 5 repetições. Os tratamentos foram: T1-ração, T2-plâncton, T3-artêmia, T4-plâncton + ração, T5-artêmia + ração e T6-artêmia + plâncton. As larvas foram alimentadas 6 vezes ao dia, nos horários de 4, 8, 12, 16, 20 e 24 horas. A temperatura da água foi mantida constante a 27ºC, o oxigênio dissolvido permaneceu na faixa de 6,16 ± 0,34 e o pH, entre 7,16 ± 0,22. Aos 2, 4, 6, 8 e 10 dias de vida, foram coletadas amostras de 30 larvas para determinação do comprimento total e peso. No final do experimento (10º dia, as larvas que receberam artêmia + plâncton (T6 alcançaram os maiores valores de comprimento total (8,35 mm e peso corporal (3518 µg, em relação a todas as outras dietas testadas. As larvas devem permanecer em laboratório por um período de 6 dias após a eclosão, recebendo alimento do terceiro ao sexto dia. A partir do sexto dia, as larvas estão com a vesícula gasosa completamente inflada e apresentam nado contínuo.The objective of this research was to evaluate the effect of natural and artificial diets on the development and behavior of pacu (Piaractus mesopotamicus larvae, between the 2nd and 10th day post hatch. The larvaes were kept in 30L - plastic boxes (n = 30 boxes, in constant flow-through. The larvae density was 10 post-larvae/L (300 larvae/box. Six diets with 4 sampling days (4, 6, 8 and 10 days post-hatch, n = 30 larvae using 5 repetitions were tested. The diets were: T1- commercial feed, T2- plancton, T3

  5. Production of the catechol type siderophore bacillibactin by the honey bee pathogen Paenibacillus larvae.

    Science.gov (United States)

    Hertlein, Gillian; Müller, Sebastian; Garcia-Gonzalez, Eva; Poppinga, Lena; Süssmuth, Roderich D; Genersch, Elke

    2014-01-01

    The Gram-positive bacterium Paenibacillus larvae is the etiological agent of American Foulbrood. This bacterial infection of honey bee brood is a notifiable epizootic posing a serious threat to global honey bee health because not only individual larvae but also entire colonies succumb to the disease. In the recent past considerable progress has been made in elucidating molecular aspects of host pathogen interactions during pathogenesis of P. larvae infections. Especially the sequencing and annotation of the complete genome of P. larvae was a major step forward and revealed the existence of several giant gene clusters coding for non-ribosomal peptide synthetases which might act as putative virulence factors. We here present the detailed analysis of one of these clusters which we demonstrated to be responsible for the biosynthesis of bacillibactin, a P. larvae siderophore. We first established culture conditions allowing the growth of P. larvae under iron-limited conditions and triggering siderophore production by P. larvae. Using a gene disruption strategy we linked siderophore production to the expression of an uninterrupted bacillibactin gene cluster. In silico analysis predicted the structure of a trimeric trithreonyl lactone (DHB-Gly-Thr)3 similar to the structure of bacillibactin produced by several Bacillus species. Mass spectrometric analysis unambiguously confirmed that the siderophore produced by P. larvae is identical to bacillibactin. Exposure bioassays demonstrated that P. larvae bacillibactin is not required for full virulence of P. larvae in laboratory exposure bioassays. This observation is consistent with results obtained for bacillibactin in other pathogenic bacteria.

  6. PREVALENCE OF ANISAKID NEMATODE LARVAE INFECTING SOME MARINE FISHES FROM THE LIBYAN COAST.

    Science.gov (United States)

    Kassem, Hamed H; Bowashi, Salem Mohamed

    2015-12-01

    This study examined eight hundred ninety six marine fishes belonging to nine different fish species; Synodus saurus; Merluccius merluccius; Trachurus mediterraneus; Serranus cabrilla; Mullus surmuletus; Diplodus annularis; Spicara maena; Siganus rirulatus and Liza ramada. The fishes were bought from fish markets at five different sites on Libyan coast, from January to December 2013, for study the anisakids larvae among them. The results showed that 344/896 fishes (38.4%) were infected with Anisakids larvae. S. saurus was the highly infected (80.9%), followed by T mediterraneus (77.5%) but, S. cabrilla, S. maena, M merluccius, M surmuletus, and D. annularis were least anisakid infected showed rates of 58.2%, 53.8%, 43.7%, 36.7% & 3.6%, respectively. No parasites were in S. rirulatus and L, ramada. Ten species of Anisakids larvae was detected during the present study. Two Pseudoterranova sp. Larvae, two types of Anisakis larvae, Anisakis simplex larva and Anisakis sp. Larva, two types of Contracaecum sp. Larvae and four Hysterothylacium larvae. Females showed higher prevalence than males. The number of anisakid larvae varied according to body length and weight of infected fish, without significant difference between prevalence and seasons, but, a significant difference was between prevalence and regions.

  7. Biophysical processes leading to the ingress of temperate fish larvae into estuarine nursery areas: A review

    Science.gov (United States)

    Teodósio, Maria Alexandra; Paris, Claire B.; Wolanski, Eric; Morais, Pedro

    2016-12-01

    A series of complementary hypotheses have been proposed to explain the recruitment of marine and temperate pelagic fish larvae originated from pelagic eggs in coastal environments. In this review, we propose a new and complementary hypothesis describing the biophysical processes intervening in the recruitment of temperate fish larvae into estuaries. This new hypothesis, the Sense Acuity And Behavioral (SAAB) hypothesis, recognizes that recruitment is unlikely if the larvae drift passively with the water currents, and that successful recruitment requires the sense acuity of temperate fish larvae and their behavioral response to the estuarine cues present in coastal areas. We propose that temperate fish larvae use a hierarchy of sensory cues (odor, sound, visual and geomagnetic cues) to detect estuarine nursery areas and to aid during navigation towards these areas. The sensorial acuity increases along ontogeny, which coincides with increased swimming capabilities. The swimming strategies of post-flexion larvae differ from offshore areas to the tidal zone. In offshore areas, innate behavior might lead larvae towards the coast guided by a sun compass or by the earth's geomagnetic field. In areas under limited influence of estuarine plumes (either in energetic nearshore areas or offshore), post-flexion larvae display a searching swimming behavior for estuarine disconnected patches (infotaxis strategy). After finding an estuarine plume, larvae may swim along the increasing cue concentration to ingress into the estuary. Here, larvae exhibit a rheotaxis behavior and avoid displacement by longshore currents by keeping bearing during navigation. When larvae reach the vicinity of an estuary, merging diel rhythms with feeding and predator avoidance strategies with tidally induced movements is essential to increase their chances of estuarine ingress. A fish larva recruitment model developed for the Ria Formosa lagoon supports the general framework of the SAAB hypothesis. In

  8. A description of the Larva of Metapteron xanthomelas (Lucas, 1857) from the Restinga Forest of Southeastern Brazil (Coleoptera: Lycidae, Calopterini).

    Science.gov (United States)

    Ferreira, Vinicius De Souza; Costa, Cleide

    2015-02-03

    The last instar larva of Metapteron xanthomelas (Lucas, 1857) is described. This is the first description of a larva for the genus. Two live larvae collected in the Brazilian Atlantic coast Restinga Forest of Itanhaém, São Paulo, were reared, one to adult and one was fixed in the last instar. This larva differs from the known Calopterini larvae by the absence of urogomphi, the dorsal abdominal segments undivided and strongly alveolate ornamentation on the head. 

  9. First record of larvae of the water mite Hydrachna processifera Piersig, 1895 from Turkey (Acari, Hydrachnidia, Hydrachnidae

    Directory of Open Access Journals (Sweden)

    Medeni Aykut

    2018-02-01

    Full Text Available Larvae of water mite Hydrachna processifera Piersig, 1895 (Acari, Hydrachnidiae were reported on diving beetles Dytiscus marginalis Linnaeus, 1758 (Coleoptera, Dytiscidae from Turkey. The redescription of the larva was made. Earlier, the larva H. processifera was described as H. inermis, but it was subsequently synonymized with H. processifera. The larva of H. processifera is a new record for the Turkish fauna. All larvae of H. processifera were found on the mesosternum of the one specimens (prevalence = 16.7%.

  10. Effects of irradiation of Bombyx mori larvae on the evolution of ecdysteroid titer in haemolymph and ecdysone metabolism

    International Nuclear Information System (INIS)

    Coulon, Madeleine; Feyereisen, Rene

    1977-01-01

    Second and third instar larvae of B. mori show a peak of ecdysteroids in the haemolymph towards the end of each instar. Second instar larvae which are X-ray treated at 0 h die at the third ecdysis. In these larvae, titer and metabolism of ecdysone is disturbed. Larvae X-ray treated at 24h in the second instar mostly become permanent larvae of the third instar, having a very low level of circulating ecdysteroids, which hardly metabolize injected ecdysone [fr

  11. Description of the third instar larva of Megadytes latus (Fabricius (Coleoptera, Dytiscidae, with an identification key for described larvae of the genus Descrição da larva de terceiro ínstar de Megadytes latus (Fabricius (Coleoptera, Dytiscidae

    Directory of Open Access Journals (Sweden)

    Nelson Ferreira-Jr

    2006-09-01

    Full Text Available The last instar larva of M. latus (Fabricius, 1801 is described and figured, based on reared specimens from Serra dos Órgãos, Teresópolis, state of Rio de Janeiro, Brazil. Some notes on the biotope are provided.A larva de terceiro ínstar de M. latus (Fabricius, 1801 é descrita e ilustrada, baseado em espécimes criados da Serra dos Órgãos, Teresópolis, Rio de Janeiro, Brasil. Algumas notas acerca do biótopo onde as larvas foram coletadas são incluídas.

  12. Effect of electronic beam irradiation on last instar larvae of lasioderma serricorne fabricius

    International Nuclear Information System (INIS)

    Chen Yuntang; Guo Dongquan; Lu Xiaohua; Zhang Jianwei; Yang Baoan; Du Yueguang; Liu Jiangyu; Tian Zhanjun; Zhang Xiaoyan

    2010-01-01

    The electronic beam irradiation effects on the last instar larvae of cigarette beetle (Lasioderma serricorne Fabricius) in tobacco were studied, and the mortality in 42 days, lethal time, pupation rate, emergence rate and reproductive capacity after irradiation were measured. The results showed that the mortality increased with the increase of irradiation dosage, but the larvae did not dead immediately. The last instar larvae irradiated by the dosages higher than 480 Gy could prevent the development of larvae to adults. No new generation was found after 300 Gy treatment of the last instar larvae. So 300 Gy irradiation could be considered as a suitable dose to prevent the reproduction of cigarette beetle of the last instar larvae in the tobacco. (authors)

  13. [Infestation of the human digestive system with beetle larvae (Coleoptera: Cantharidae): a case report].

    Science.gov (United States)

    Yılmaz, Hasan; Taş Cengiz, Zeynep; Dülger, Ahmet Cumhur; Ekici, Pınar

    2014-12-01

    This study was conducted to report the digestive system infestation caused by the larvae of Coleoptera in a female pediatric patient. She was admitted to our hospital with the complaints of emergence of insect larvae from her vomit and feces, abdominal pain, inguinal pain, lack of appetite, hair loss, excessive cleaning behavior, extreme irritability, and distractibility. The larvae observed typically had the morphology of the larvae of insects related to the Cantharidae family in the Coleoptera order. For treatment, a single dose of albendazole (400 mg) was used. Consequently, in the present case, it was seen that the larvae of Coleoptera incidentally taken orally could continue to live for a period in the digestive tract of people, without losing vitality, and the larvae caused a variety of symptoms due to both their toxic agents and the possible irritation they caused.

  14. Coral larvae settle at a higher frequency on red surfaces

    Science.gov (United States)

    Mason, B.; Beard, M.; Miller, M. W.

    2011-09-01

    Although chemical cues serve as the primary determinants of larval settlement and metamorphosis, light is also known to influence the behavior and the settlement of coral planulae. For example, Porites astreoides planulae settle preferentially on unconditioned red substrata. In order to test whether this behavior was a response to color and whether other species also demonstrate color preference, settlement choice experiments were conducted with P. astreoides and Acropora palmata. In these experiments, larvae were offered various types of plastic substrata representing three to seven different color choices. Both species consistently settled on red (or red and orange) substrata at a higher frequency than other colors. In one experiment, P. astreoides settled on 100% of red, plastic cable ties but failed to settle on green or white substrata. In a second experiment, 24% of larvae settled on red buttons, more than settled on six other colors combined. A. palmata settled on 80% of red and of orange cables ties but failed to settle on blue in one experiment and settled on a greater proportion of red acrylic squares than on four other colors or limestone controls in a second experiment. The consistency of the response across a variety of plastic materials suggests the response is related to long-wavelength photosensitivity. Fluorescence and reflectance spectra of experimental substrata demonstrated that the preferred substrata had spectra dominated by wavelengths greater than 550 nm with little or no reflection or emission of shorter wavelengths. These results suggest that some species of coral larvae may use spectral cues for fine-scale habitat selection during settlement. This behavior may be an adaptation to promote settlement in crustose coralline algae (CCA)-dominated habitats facilitating juvenile survival.

  15. Descrição da larva de Erythemis mithroides (Brauer e notas sobre outras larvas conhecidas do gênero (Odonata, Libellulidae Description of the larva of Erythemis mithroides (Brauer and notes on other known larvae of the genus (Odonata, Libellulidae

    Directory of Open Access Journals (Sweden)

    J.M. Costa

    1993-01-01

    Full Text Available The last instar larva of Erythemis mithroides (Brauer, 1900 is described and figured based on exuviae of reared specimens. A comparative analysis of this immature stage and the known larvae of the genus are furnished according to the data available in the literature and of specimens of E credula (Hagen, 1861 and E. vesiculosa (Fab., 1775 permiting a diagnose for the larvae of the genus Erylhemis Hagen, 1861.

  16. Programa de computador para reconhecimento da larva de Aedes aegypti e Aedes albopictus

    OpenAIRE

    São Thiago, André Iwersen de; Kupek, Emil; Ferreira Neto, Joaquim Alves; São Thiago, Paulo de Tarso

    2002-01-01

    Software for pattern recognition of the larvae of mosquitoes Aedes aegypti and Aedes albopictus, biological vectors of dengue and yellow fever, has been developed. Rapid field identification of larva using a digital camera linked to a laptop computer equipped with this software may greatly help prevention campaigns.Foi desenvolvido um programa de computador para reconhecimento da larva de Aedes aegypti e Aedes albopictus, vetores biológicos de dengue e febre amarela. O programa possibilita rá...

  17. Development Of Enzyme Digestive Activity Of Blue Crab Portunus Pelagicus Larvae

    OpenAIRE

    Nikhlani, Andi; Sukarti, Komsanah

    2017-01-01

    Seed production continuity of Portunus pelagicus larvae had been conducted but the results were still un-consistent Digestive activity was known to be associated with the type of feed consumed by larvae. Amylase, lipase, and trypsin enzymes were used as a biological indicators to measure the digestion of feed. The aim of this study was to describe the activity of digestive enzymes in blue swimming crab larvae. Digestive enzyme activity data obtained was presented in graphical form and anal...

  18. Gastrointestinal symptoms resembling ulcerative proctitis caused by larvae of the drone fly Eristalis tenax.

    Science.gov (United States)

    Desoubeaux, Guillaume; Gaillard, Julien; Borée-Moreau, Diane; Bailly, Éric; Andres, Christian R; Chandenier, Jacques

    2014-04-01

    We report a case of facultative intestinal myiasis due to larvae of the drone fly Eristalis tenax, also named the rat-tailed maggots. The development of larvae in the lower bowel was responsible for non-specific gastrointestinal symptoms that resembled ulcerative proctitis. The diagnosis was established upon the observation of four spontaneously excreted mobile larvae. The definite identification of the E. tenax species was made possible by scanning electron microscopy. The clinical outcome was satisfactory.

  19. Effects of Foodstuffs on Intestinal Length in Larvae of Rhacophorus arboreus (Anura: Rhacophoridae) : Developmental Biology

    OpenAIRE

    SHINRI, HORIUCHI; YUTAKA, KOSHIDA; Department of Biology, College of General Education, Osaka University; Department of Biology, College of General Education, Osaka University

    1989-01-01

    Correlation between foodstuffs and intestinal length was examined in larvae of Rhacophorus arboreus (Anura: Rhacophoridae). The larva, being heterophagous, has a tube-like intestine provided with neither epithelial outfoldings nor villi, and intestinal length is found to be a good morphological index of digestive and absorptive functions of the intestine. The results obtained were summarized as follows: The grown larva fed on boiled spinach had an intestine more than 1.5 times as long as that...

  20. Immunization with irradiated larvae against Dictyocaulus filaria in young lambs

    Energy Technology Data Exchange (ETDEWEB)

    Dhar, D.N.; Sharma, R.L.

    1981-12-01

    In the lungworm-endemic areas of Kashmir, 6-10 week old lambs of Karnah and Kashmir Merino breeds were vaccinated with two doses of 50 kR gamma-irradiated larvae of Dictyocaulus filaria, given a month apart. Assessed on the basis of reduced prevalence and significantly lower faecal larval output over an eight-month observation period, vaccinated lambs showed a high degree of resistance to naturally acquired D. filaria infection. The results also show that vaccination against D. filaria provided some degree of protection against infection with other lungworm species.

  1. Immunization with irradiated larvae against Dictyocaulus filaria in young lambs

    International Nuclear Information System (INIS)

    Dhar, D.N.; Sharma, R.L.

    1981-01-01

    In the lungworm-endemic areas of Kashmir, 6-10 week old lambs of Karnah and Kashmir Merino breeds were vaccinated with two doses of 50 kR gamma-irradiated larvae of Dictyocaulus filaria, given a month apart. Assessed on the basis of reduced prevalence and significantly lower faecal larval output over an eight-month observation period, vaccinated lambs showed a high degree of resistance to naturally acquired D. filaria infection. The results also show that vaccination against D. filaria provided some degree of protection against infection with other lungworm species. (Auth.)

  2. The use of morphological and histological features as nutritional condition indices of Pagrus pagrus larvae

    Directory of Open Access Journals (Sweden)

    Marina Vera Diaz

    Full Text Available Morphometrical and histological techniques were employed to characterize Pagrus pagrus larvae nutritional condition. Larvae were reared in laboratory under controlled conditions with the main objective of testing whether these methodologies allowed finding differences between larvae from different feeding treatments. Once yolk was consumed (three days after hatching larvae were assigned to a feeding treatment: starved during the whole experiment; delayed feeding, starved during three days; fed during the entire experiment. Algae (Nannochloropsis oculata and rotifers (Brachionus plicatilis were provided to larvae for feed treatments. Larvae were fixed daily; for morphometrical purposes in 5% formaldehyde solution, and in Bouin for histological sections. Results herein obtained showed that both methodologies are sensitive enough to distinguish larvae characterized by different nutritional condition states obtained from the feeding treatments. Consequently, these methodologies could be employed in wild red porgy larvae in order to asses their nutritional condition. These techniques could also be employed to check larval quality obtained with aquaculture purposes to estimate the effects of changes in rearing protocols or kind of food supply and thus, to guaranty a higher survival of early developmental stages of reared larvae.

  3. Paenilarvins: Iturin family lipopeptides from the honey bee pathogen Paenibacillus larvae.

    Science.gov (United States)

    Sood, Sakshi; Steinmetz, Heinrich; Beims, Hannes; Mohr, Kathrin I; Stadler, Marc; Djukic, Marvin; von der Ohe, Werner; Steinert, Michael; Daniel, Rolf; Müller, Rolf

    2014-09-05

    The bacterium Paenibacillus larvae has been extensively studied as it is an appalling honey bee pathogen. In the present work, we screened crude extracts derived from fermentations of P. larvae genotypes ERIC I and II for antimicrobial activity, following the detection of four putative secondary metabolite gene clusters that show high sequence homology to known biosynthetic gene clusters for the biosynthesis of antibiotics. Low molecular weight metabolites produced by P. larvae have recently been shown to have toxic effects on honey bee larvae. Moreover, a novel tripeptide, sevadicin, was recently characterized from laboratory cultures of P. larvae. In this study, paenilarvins, which are iturinic lipopeptides exhibiting strong antifungal activities, were obtained by bioassay-guided fractionation from cultures of P. larvae, genotype ERIC II. Their molecular structures were determined by extensive 2D NMR spectroscopy, high resolution mass spectrometry, and other methods. Paenilarvins are the first antifungal secondary metabolites to be identified from P. larvae. In preliminary experiments, these lipopeptides also affected honey bee larvae and might thus play a role in P. larvae survival and pathogenesis. However, further studies are needed to investigate their function. © 2014 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  4. Inhibitory effect of indole analogs against Paenibacillus larvae, the causal agent of American foulbrood disease.

    Science.gov (United States)

    Alvarado, Israel; Margotta, Joseph W; Aoki, Mai M; Flores, Fernando; Agudelo, Fresia; Michel, Guillermo; Elekonich, Michelle M; Abel-Santos, Ernesto

    2017-09-01

    Paenibacillus larvae, a Gram-positive bacterium, causes American foulbrood (AFB) in honey bee larvae (Apis mellifera Linnaeus [Hymenoptera: Apidae]). P. larvae spores exit dormancy in the gut of bee larvae, the germinated cells proliferate, and ultimately bacteremia kills the host. Hence, spore germination is a required step for establishing AFB disease. We previously found that P. larvae spores germinate in response to l-tyrosine plus uric acid in vitro. Additionally, we determined that indole and phenol blocked spore germination. In this work, we evaluated the antagonistic effect of 35 indole and phenol analogs and identified strong inhibitors of P. larvae spore germination in vitro. We further tested the most promising candidate, 5-chloroindole, and found that it significantly reduced bacterial proliferation. Finally, feeding artificial worker jelly containing anti-germination compounds to AFB-exposed larvae significantly decreased AFB infection in laboratory-reared honey bee larvae. Together, these results suggest that inhibitors of P. larvae spore germination could provide another method to control AFB. © The Authors 2017. Published by Oxford University Press on behalf of Entomological Society of America.

  5. Cutaneous larva migrans in northern climates. A souvenir of your dream vacation.

    Science.gov (United States)

    Edelglass, J W; Douglass, M C; Stiefler, R; Tessler, M

    1982-09-01

    Three young women recently returned to the metropolitan Detroit area with cutaneous larva migrans. All three had vacationed at a popular club resort on the Caribbean island of Martinique. Cutaneous larva migrans is frequently seen in the southern United States, Central and South America, and other subtropical areas but rarely in northern climates. Several organisms can cause cutaneous larva migrans, or creeping eruption. The larvae of the nematode Ancylostoma braziliense are most often the causative organisms. Travel habits of Americans make it necessary for practitioners in northern climates to be familiar with diseases contracted primarily in warmer locations. The life cycle of causative organisms and current therapy are reviewed.

  6. Distribution and abundance of skipjack (Katsuwonus pelamis larvae in eastern Brazilian waters

    Directory of Open Access Journals (Sweden)

    Yasunobu Matsuura

    1982-01-01

    Full Text Available Based on data from two ichthyoplankton surveys carried out off the eastern Brazilian coast in June and November-December 1978, the larval distribution of skipjack is discussed. Skipjack larvae were more abundant in the November-December cruise (southern hemisphere spring. They occurred mainly at stations near the margin of the continental shelf or over seamounts. Out of 240 specimens of scombrid larvae collected in this area, skipjack larvae comprised only 10.4% (25 specimens, whereas the most abundant larvae were Thunnus spp. with 68.8% (165 specimens.

  7. Effect of gamma radiation on the Mediterranean flour moth, Ephestia Kuehniella, mature larvae and acceptability of irradiated larvae by Bracon hebetor females

    International Nuclear Information System (INIS)

    Mansour, M.

    2011-06-01

    Mediterranean flour moth, Ephestia kuehniella, mature 5 t h instar larvae were exposed to gamma radiation dosages ranging from 50-350 Gy at 50 Gy increment and the effects of gamma radiation on pupation, adult emergence and sex ratio were investigated. In addition, effects of irradiation on the rate of development to pupae and adults and the acceptance of irradiated larvae by B. hebetor females were examined. Results showed that the radio-sensitivity of E. kuehniella larvae increased with increasing dose. Pupation was significantly affected at 100 Gy dose, and completely prevented at 350 Gy dose. Adult emergence was only slightly different from pupation; emergence was significantly affected at 100 Gy dose and completely prevented at 300 Gy dose. Irradiation also negatively affected the rate of development of larvae to pupae and adults. While more than 98% of control larvae pupated within 10 days of treatment, this ratio decreased to about 79% in larvae exposed to 50 Gy and less than 4% in larvae exposed to 100 Gy dose. The rate of development to the adult stage was also similarly affected. While 97% of control insects emerged as adults in the 1st 20 days of treatment, this ratio decreased to about 53, 2 and zero percent in larvae exposed to 50, 100 and 150 Gy dose respectively. In addition, irradiation significantly affected male: female ratio; sex ratio was skewed in favor of males, and at 250 Gy dose all emerged moths were males. Furthermore, irradiation had no adverse effect on the degree of acceptance of mature larvae to parasitization; irradiated insects were as acceptable to B. hebetor females as unirradiated ones. (author)

  8. Effect of gamma radiation on the Mediterranean flour moth, Ephestia Kuehniella, mature larvae and acceptability of irradiated larvae by Bracon hebetor female

    International Nuclear Information System (INIS)

    Mansour, M.

    2012-01-01

    Mediterranean flour moth, Ephestia kuehniella, mature 5 t h instar larvae were exposed to gamma radiation dosages ranging from 50-350 Gy at 50 Gy increment and the effects of gamma radiation on pupation, adult emergence and sex ratio were investigated. In addition, effects of irradiation on the rate of development to pupae and adults and the acceptance of irradiated larvae by B. hebetor females were examined. Results showed that the radio-sensitivity of E. kuehniella larvae increased with increasing dose. Pupation was significantly affected at 100 Gy dose, and completely prevented at 350 Gy dose. Adult emergence was only slightly different from pupation; emergence was significantly affected at 100 Gy dose and completely prevented at 300 Gy dose. Irradiation also negatively affected the rate of development of larvae to pupae and adults. While more than 98% of control larvae pupated within 10 days of treatment, this ratio decreased to about 79% in larvae exposed to 50 Gy and less than 4% in larvae exposed to 100 Gy dose. The rate of development to the adult stage was also similarly affected. While 97% of control insects emerged as adults in the 1st 20 days of treatment, this ratio decreased to about 53, 2 and zero percent in larvae exposed to 50, 100 and 150 Gy dose respectively. In addition, irradiation significantly affected male: female ratio; sex ratio was skewed in favor of males, and at 250 Gy dose all emerged moths were males. Furthermore, irradiation had no adverse effect on the degree of acceptance of mature larvae to parasitization; irradiated insects were as acceptable to B. hebetor females as unirradiated ones. (author)

  9. Citrus Seed Oils Efficacy against Larvae of Aedes aegypti

    Directory of Open Access Journals (Sweden)

    Hazrat Bilal

    2017-10-01

    Full Text Available Background: Dengue fever is a serious public health issue in Pakistan for many years. Globally plants have been reported to contain compounds with insecticidal properties. These properties have been demonstrated more recently on the larval stages of mosquitoes. Therefore, Citrus cultivar seeds were evaluated for larvicidal potential against the primary dengue vector Aedes aegypti.Methods: Extraction of oil was done by a steam distillation method and oils were evaluated according to WHO guidelines for larvicides 2005 for evaluation of insecticidal properties of citrus seed extracts against mosquito larvae.Result: Among the Citrus cultivar seed oil, rough lemon (Citrus jambhiri had the lowest LC50 value (200.79ppm, while musambi (C. sinensis var musambi had the highest LC50 value (457.30ppm after 24 h of exposure.Conclusion: Citrus cultivars have some larvicidal potential but C. jambhiri had the greatest potential against A. ae­gypti larvae. Further small-scale field trials using the extracts of C. jambhiri will be conducted to determine opera­tional feasibility.

  10. Otolith geochemistry does not reflect dispersal history of clownfish larvae

    KAUST Repository

    Berumen, Michael L.

    2010-07-01

    Natural geochemical signatures in calcified structures are commonly employed to retrospectively estimate dispersal pathways of larval fish and invertebrates. However, the accuracy of the approach is generally untested due to the absence of individuals with known dispersal histories. We used genetic parentage analysis (genotyping) to divide 110 new recruits of the orange clownfish, Amphiprion percula, from Kimbe Island, Papua New Guinea, into two groups: "self-recruiters" spawned by parents on Kimbe Island and "immigrants" that had dispersed from distant reefs (>10 km away). Analysis of daily increments in sagittal otoliths found no significant difference in PLDs or otolith growth rates between self-recruiting and immigrant larvae. We also quantified otolith Sr/Ca and Ba/Ca ratios during the larval phase using laser ablation inductively coupled plasma mass spectrometry. Again, we found no significant differences in larval profiles of either element between self-recruits and immigrants. Our results highlight the need for caution when interpreting otolith dispersal histories based on natural geochemical tags in the absence of water chemistry data or known-origin larvae with which to test the discriminatory ability of natural tags. © 2010 Springer-Verlag.

  11. Defensive repertoire of Drosophila larvae in response to toxic fungi.

    Science.gov (United States)

    Trienens, Monika; Kraaijeveld, Ken; Wertheim, Bregje

    2017-10-01

    Chemical warfare including insecticidal secondary metabolites is a well-known strategy for environmental microbes to monopolize a food source. Insects in turn have evolved behavioural and physiological defences to eradicate or neutralize the harmful microorganisms. We studied the defensive repertoire of insects in this interference competition by combining behavioural and developmental assays with whole-transcriptome time-series analysis. Confrontation with the toxic filamentous fungus Aspergillus nidulans severely reduced the survival of Drosophila melanogaster larvae. Nonetheless, the larvae did not behaviourally avoid the fungus, but aggregated at it. Confrontation with fungi strongly affected larval gene expression, including many genes involved in detoxification (e.g., CYP, GST and UGT genes) and the formation of the insect cuticle (e.g., Tweedle genes). The most strongly upregulated genes were several members of the insect-specific gene family Osiris, and CHK-kinase-like domains were over-represented. Immune responses were not activated, reflecting the competitive rather than pathogenic nature of the antagonistic interaction. While internal microbes are widely acknowledged as important, our study emphasizes the underappreciated role of environmental microbes as fierce competitors. © 2017 John Wiley & Sons Ltd.

  12. TEKNOLOGI PEMELIHARAAN LARVA KERAPU SUNU (Plectropomus leopardus SECARA MASSAL

    Directory of Open Access Journals (Sweden)

    Titiek Aslianti

    2016-12-01

    Seed production technology of leopard coral trout, Plectropomus leopardus by improving hatchery management had been conducted in order to increase survival rate and to produce seed continuity. The initial feeding can successfully support in larval rearing. Feed organism as rotifer, trochophore gonad, egg yolk emulsion, and artificial feed emulsion, had been used as an initial feed. The twelve of concrete tanks with 6 m3 capacity were stocked with coral trout eggs at density 100,000—150,000 eggs/tank. Artemia nauplii, artificial feed, and mysid as feed, start on larvae D20 up to juvenile stage (D45. Growth rate and survival rate were observed and calculated when the experiment was terminated. The data was analyzed by descriptive. Nutrition value of food was analyzed by proximate and fatty acid composition. The others parameters such as deformity and water quality were observed. The result showed that artificial feed emulsion and egg yolk emulsion as an initial feeding can be improve the growth rate and increase survival rate of larvae. The range of total length, body weight and survival rate of the seed i.e. 1.95—2.85 cm; 0.64—0.73 g, and 0.25%— 3.97% with the daily growth rate 3,9%—4,22%, respectively. No back bone deformity in the seed, that is 21—23 segments with interspaces of segments 0.030—0.036 mm.

  13. Phototoxicity of petroleum products to marine invertebrate larvae and niles

    International Nuclear Information System (INIS)

    Pelletier, M.C.; Burgess, R.; Ho, K.; Kuhn, A.; McKinney, R.; Ryba, S.

    1995-01-01

    Ultraviolet light can activate certain polycyclic aromatic hydrocarbons (PAHs), inducing the production of free radicals. In biological organisms these free radicals destroy tissues, causing up to a 4,000 fold increase in toxicity. This dramatic response is a potential marker for PAH contamination in environmental samples. Ultraviolet enhancement of toxicity has ecological relevance as well. An oil spill can release large amounts of PAHs into the marine environment. Oil spill assessments to date have not included observations of any phototoxic effect on pelagic larvae or juveniles of benthic or epibenthic invertebrates. In this study, larvae and juveniles of the bivalve, Mulinia lateralis and juveniles of the mysid shrimp, Mysidopsis bahia were exposed to individual PAHs, as well as the water accommodated fractions of several petroleum products to verify the ability of this method to detect PAHs in environmental samples, and to determine if phototoxicity is a concern during and after an oil spill. Significant phototoxicity was seen in both single chemical and petroleum product exposures. Swartz's EPAH model was not applicable to the authors' results. They hoped to show causality but were not fully successful due to the need to further develop the model with their species and expand the number of PAH analyzed

  14. The hemolymph proteome of fed and starved Drosophila larvae.

    Science.gov (United States)

    Handke, Björn; Poernbacher, Ingrid; Goetze, Sandra; Ahrens, Christian H; Omasits, Ulrich; Marty, Florian; Simigdala, Nikiana; Meyer, Imke; Wollscheid, Bernd; Brunner, Erich; Hafen, Ernst; Lehner, Christian F

    2013-01-01

    The co-operation of specialized organ systems in complex multicellular organisms depends on effective chemical communication. Thus, body fluids (like blood, lymph or intraspinal fluid) contain myriads of signaling mediators apart from metabolites. Moreover, these fluids are also of crucial importance for immune and wound responses. Compositional analyses of human body fluids are therefore of paramount diagnostic importance. Further improving their comprehensiveness should increase our understanding of inter-organ communication. In arthropods, which have trachea for gas exchange and an open circulatory system, the single dominating interstitial fluid is the hemolymph. Accordingly, a detailed analysis of hemolymph composition should provide an especially comprehensive picture of chemical communication and defense in animals. Therefore we used an extensive protein fractionation workflow in combination with a discovery-driven proteomic approach to map out the detectable protein composition of hemolymph isolated from Drosophila larvae. Combined mass spectrometric analysis revealed more than 700 proteins extending far beyond the previously known Drosophila hemolymph proteome. Moreover, by comparing hemolymph isolated from either fed or starved larvae, we provide initial provisional insights concerning compositional changes in response to nutritional state. Storage proteins in particular were observed to be strongly reduced by starvation. Our hemolymph proteome catalog provides a rich basis for data mining, as exemplified by our identification of potential novel cytokines, as well as for future quantitative analyses by targeted proteomics.

  15. Vibrio harveyi effect under survival of Litopenaeus vannamei larvae

    Directory of Open Access Journals (Sweden)

    Gabriel Aguirre-Guzmán

    2013-06-01

    Full Text Available The culture of aquatic organisms show a high relevance in the human feeding and the culture activities can create artificial conditions that increase the growth and selection of specific bacteria. Vibrio species are normal bacteria’s from microflora of penaeid shrimp, those are opportunistic pathogens that can take advantage of the ecological changes generated for the culture of aquatic organisms and which may cause diseases, low survival and economic losses in the shrimp production. The aim of this research was to determine the variation in the survival of different larval substages (nauplius, zoea I-III, mysis I-III and postlarvae 1, of Pacific white shrimp Litopenaeus vannamei exposed at three doses [103 , 105 , and 107 colony-forming unit (CFU ml-1 [ of V. harveyi, by immersion (30 min as infection method. This species generated a significant low survival in larvae (p < 0.05 only in high doses (105 and 107 CFU ml-1 , where higher doses show the lowest values of survival. Larval substages and postlarvae 1 of shrimp showed sensitivity associate to the increase of Vibrio doses and this sensitivity decreased with the growth of larval substages and postlarvae 1. This information has high significance for the fisheries and aquaculture industry, which help to generate strategies to reduce the effects of V. harveyi with positive effect in growth and survival of the shrimp larvae and postlarvae 1.

  16. Decapod larvae dynamics on Berlengas Biosphere Reserve (UNESCO - Portugal

    Directory of Open Access Journals (Sweden)

    Lénia Da Fonseca Alexandre Rato

    2014-05-01

    Total decapoda abundance ranged from 0,06 ind.m-3 in May 2011 to 64,28ind.m-3 in August 2012, and significantly different between summer/winter and winter/spring months (P(perm≤0,05. The data obtained on this study revealed that Infraorders Brachyura, Anomura and Caridea are the most common. All three are significantly different between months (P(perm≤0,05 but not between sampling stations (P(perm>0,05. Brachyuran abundance was significantly affected by the Oceanograhic Conditions (P(perm≤0,05. Abundances were higher in spring and summer months, when Chlorophyl a values (mg.m-3, Temperature (ºC and Salinity (ppt were also higher. Decapoda community is directly affected by the surrounding environmental conditions in Berlengas Biosphere Reserve and abundance might also be related with specific larvae release throughout the year. Each sampling station was considered a replica from the study area. The ecological importance of Berlengas was also verified by the presence of non-frequent larvae of Achelata and Stomatopoda.

  17. Metabolism of 14C-diazinon by gypsy moth larvae

    International Nuclear Information System (INIS)

    Ahmad, S.; Forgashi, A.J.

    1975-01-01

    The metabolic fate of diazinon in larvae of Porthetria dispar (L.) was determined using 14 C-ring-labeled material. Following a 4-h ingestion period, 28.7 percent of the total recovered activity was present as diazinon in the larvae and 0.2 percent in the feces at 1 hr; by 12 h these amounts had changed to 1.4 and 15.4 percent, respectively. The major transformation products were 2,isopropyl-4-methyl-6-pyrimidinol greater than diazoxon greater than hydroxydiazinon greater than 2-(2'-hydroxy-2'-propyl)-4-methyl-6-pyrimidinol. Small amounts of 5 additional products were detected but were not identified. Metabolism of topically applied diazinon was the same qualitatively as that of ingested diazinon, based on a comparison of chloroform-extractable metabolites, although quantitative differences were evident. The synergists 2,6-dichlorobenzyl-2-propynyl ether (GA4-282) and piperonyl butoxide (PB) altered the metabolism of diazinon (both ingested and topical doses) by apparently similar actions, resulting in a reduction in the formation of 2-isopropyl-4-methyl-6-pyrimidinol, hydroxydiazinon, and 2-(2'-hydroxy-2'-propyl)-4-methyl-6-pyrimidinol

  18. The hemolymph proteome of fed and starved Drosophila larvae.

    Directory of Open Access Journals (Sweden)

    Björn Handke

    Full Text Available The co-operation of specialized organ systems in complex multicellular organisms depends on effective chemical communication. Thus, body fluids (like blood, lymph or intraspinal fluid contain myriads of signaling mediators apart from metabolites. Moreover, these fluids are also of crucial importance for immune and wound responses. Compositional analyses of human body fluids are therefore of paramount diagnostic importance. Further improving their comprehensiveness should increase our understanding of inter-organ communication. In arthropods, which have trachea for gas exchange and an open circulatory system, the single dominating interstitial fluid is the hemolymph. Accordingly, a detailed analysis of hemolymph composition should provide an especially comprehensive picture of chemical communication and defense in animals. Therefore we used an extensive protein fractionation workflow in combination with a discovery-driven proteomic approach to map out the detectable protein composition of hemolymph isolated from Drosophila larvae. Combined mass spectrometric analysis revealed more than 700 proteins extending far beyond the previously known Drosophila hemolymph proteome. Moreover, by comparing hemolymph isolated from either fed or starved larvae, we provide initial provisional insights concerning compositional changes in response to nutritional state. Storage proteins in particular were observed to be strongly reduced by starvation. Our hemolymph proteome catalog provides a rich basis for data mining, as exemplified by our identification of potential novel cytokines, as well as for future quantitative analyses by targeted proteomics.

  19. Effects of gamma radiation on the melanization process in larvae of stored product moths

    International Nuclear Information System (INIS)

    Lupa, D.

    1998-01-01

    Non-irradiated larvae of the Indian meal moth (Plodia interpunctella Hbn.), the Mediterranean flour moth (Ephestia (Anagasta) kuehniella Zell.), and the almond moth (Cadra cautella Wlk.) showed strong melanization after killing by freezing. However, there were some insects which showed lack of melanization or melanized only partly, sometimes like those that have been irradiated. A part of the larval body was dark black while the rest body was of natural color or only slightly gray. Also, black and gray patches were observed in the larvae. After the irradiation treatment, the number of non-melanized larvae and larvae exhibiting a slight melanization usually increased. The degree of melanization in the treated larvae was significantly different from the untreated insects. Generally, it decreased with increasing dose and time elapsed after the treatment. The melanization test for detecting irradiated moth larvae may produce inconsistent results because (a) irradiation does not completely prevent melanization in mature moth larvae, and (b) the untreated larvae, killed by freezing and examined at room temperature, often show incomplete melanization. An ideal method for detection of irradiated insects should be: (1 ) specific for irradiation and not influenced by other processes, (2) accurate and reproducible, (3) have a detection limit below the minimum dose likely to be applied to agricultural commodity as a quarantine treatment, (4) applicable to a range of pests, (5) quick and easy to perform, and (6) capable of providing an estimate of irradiation dose. The melanization test to detect irradiated larvae of the stored product moths fulfills only some of these requirements. Therefore, additional studies were performed to improve this test before it is recommended for quarantine inspection. Because visual assessment of the effects of irradiation on melanization of the moth larvae is very subjective and difficult to perform, a trial to determine the activity of

  20. Temporal and Spatial Distribution Patterns of Echinoderm Larvae in La Parguera, Puerto Rico

    Directory of Open Access Journals (Sweden)

    Stacey M Williams

    2010-10-01

    Full Text Available This study describes temporal and spatial abundance patterns of echinoderm larvae in La Parguera, Puerto Rico. For the temporal study, larvae were sampled by a series of monthly tows taken with a 64μm mesh net between the new and full moon from April 2005 to July 2006, September 2006 and August 2007. In order to measure spatial variation of echinoderm larval bundances, oblique tows were taken with 64 and 202μm mesh nets at seven different sites within the shelf, at the shelf-edge, and at a nearby oceanic stations during August 2007. Overall, Echinoidea (sea urchin exhibited the highest abundance with a total of 11 921 larvae, representing 52.5% of the total collection. Ophiuroidea (brittle star ranked second in abundance with 45.6% of the total larvae. Holothuroidea (sea cucumber and Asteroidea larvae (sea star accounted for less than 2% of the total echinoderm larval collection. Early larval stages (2-8 day old of Diadema antillarum represented 20% of the total Echinoidea larvae. There was no marked seasonal trend of echinoderm larval abundance; Echinoidea and Ophiuroidea larvae were present in all monthly samples indicating that reproduction occurs year-round. Peak abundances of later-stage Echinoidea larvae were observed during January, July and October and of later-stage Ophiuroidea larvae during June, August and October. The observed peaks of later-stage larval abundances may be indicative of higher recruitment activity during these months. There was a significant difference of echinoderm larval abundance between spatial stations, with higher abundances collected at the shelf-edge. Later-stage (~24 day old D. antillarum larvae were mostly collected at shelf-edge and oceanic locations. In addition, the 64mm mesh net was more efficient for collection of echinoderm larvae than the 202mm mesh net. Rev. Biol. Trop. 58 (Suppl. 3: 81-88. Epub 2010 October 01.

  1. Schinus terebinthifolius Leaf Extract Causes Midgut Damage, Interfering with Survival and Development of Aedes aegypti Larvae.

    Science.gov (United States)

    Procópio, Thamara Figueiredo; Fernandes, Kenner Morais; Pontual, Emmanuel Viana; Ximenes, Rafael Matos; de Oliveira, Aline Rafaella Cardoso; Souza, Carolina de Santana; Melo, Ana Maria Mendonça de Albuquerque; Navarro, Daniela Maria do Amaral Ferraz; Paiva, Patrícia Maria Guedes; Martins, Gustavo Ferreira; Napoleão, Thiago Henrique

    2015-01-01

    In this study, a leaf extract from Schinus terebinthifolius was evaluated for effects on survival, development, and midgut of A. aegypti fourth instar larvae (L4), as well as for toxic effect on Artemia salina. Leaf extract was obtained using 0.15 M NaCl and evaluated for phytochemical composition and lectin activity. Early L4 larvae were incubated with the extract (0.3-1.35%, w/v) for 8 days, in presence or absence of food. Polymeric proanthocyanidins, hydrolysable tannins, heterosid and aglycone flavonoids, cinnamic acid derivatives, traces of steroids, and lectin activity were detected in the extract, which killed the larvae at an LC50 of 0.62% (unfed larvae) and 1.03% (fed larvae). Further, the larvae incubated with the extract reacted by eliminating the gut content. No larvae reached the pupal stage in treatments at concentrations between 0.5% and 1.35%, while in the control (fed larvae), 61.7% of individuals emerged as adults. The extract (1.0%) promoted intense disorganization of larval midgut epithelium, including deformation and hypertrophy of cells, disruption of microvilli, and vacuolization of cytoplasms, affecting digestive, enteroendocrine, regenerative, and proliferating cells. In addition, cells with fragmented DNA were observed. Separation of extract components by solid phase extraction revealed that cinnamic acid derivatives and flavonoids are involved in larvicidal effect of the extract, being the first most efficient in a short time after larvae treatment. The lectin present in the extract was isolated, but did not show deleterious effects on larvae. The extract and cinnamic acid derivatives were toxic to A. salina nauplii, while the flavonoids showed low toxicity. S. terebinthifolius leaf extract caused damage to the midgut of A. aegypti larvae, interfering with survival and development. The larvicidal effect of the extract can be attributed to cinnamic acid derivatives and flavonoids. The data obtained using A. salina indicates that caution

  2. Schinus terebinthifolius Leaf Extract Causes Midgut Damage, Interfering with Survival and Development of Aedes aegypti Larvae.

    Directory of Open Access Journals (Sweden)

    Thamara Figueiredo Procópio

    Full Text Available In this study, a leaf extract from Schinus terebinthifolius was evaluated for effects on survival, development, and midgut of A. aegypti fourth instar larvae (L4, as well as for toxic effect on Artemia salina. Leaf extract was obtained using 0.15 M NaCl and evaluated for phytochemical composition and lectin activity. Early L4 larvae were incubated with the extract (0.3-1.35%, w/v for 8 days, in presence or absence of food. Polymeric proanthocyanidins, hydrolysable tannins, heterosid and aglycone flavonoids, cinnamic acid derivatives, traces of steroids, and lectin activity were detected in the extract, which killed the larvae at an LC50 of 0.62% (unfed larvae and 1.03% (fed larvae. Further, the larvae incubated with the extract reacted by eliminating the gut content. No larvae reached the pupal stage in treatments at concentrations between 0.5% and 1.35%, while in the control (fed larvae, 61.7% of individuals emerged as adults. The extract (1.0% promoted intense disorganization of larval midgut epithelium, including deformation and hypertrophy of cells, disruption of microvilli, and vacuolization of cytoplasms, affecting digestive, enteroendocrine, regenerative, and proliferating cells. In addition, cells with fragmented DNA were observed. Separation of extract components by solid phase extraction revealed that cinnamic acid derivatives and flavonoids are involved in larvicidal effect of the extract, being the first most efficient in a short time after larvae treatment. The lectin present in the extract was isolated, but did not show deleterious effects on larvae. The extract and cinnamic acid derivatives were toxic to A. salina nauplii, while the flavonoids showed low toxicity. S. terebinthifolius leaf extract caused damage to the midgut of A. aegypti larvae, interfering with survival and development. The larvicidal effect of the extract can be attributed to cinnamic acid derivatives and flavonoids. The data obtained using A. salina indicates

  3. An unprecedented role reversal: ground beetle larvae (Coleoptera: Carabidae lure amphibians and prey upon them.

    Directory of Open Access Journals (Sweden)

    Gil Wizen

    Full Text Available Amphibians often feed on beetle larvae, including those of ground beetles (Carabidae. Preliminary reports have detailed an unusual trophic interaction in which, in contrast, larvae of the ground beetle Epomis prey upon juvenile and adult amphibians. While it is known that these larvae feed exclusively on amphibians, how the predator-prey encounter occurs to the advantage of the beetle larvae had been unknown to date. Using laboratory observations and controlled experiments, we recorded the feeding behavior of Epomis larvae, as well as the behavior of their amphibian prey. Here we reveal that larvae of two species of Epomis (E. circumscriptus and E. dejeani lure their potential predator, taking advantage of the amphibian's predation behavior. The Epomis larva combines a sit-and-wait strategy with unique movements of its antennae and mandibles to draw the attention of the amphibian to the presence of a potential prey. The intensity of this enticement increases with decreasing distance between the larva and the amphibian. When the amphibian attacks, the larva almost always manages to avoid the predator's protracted tongue, exploiting the opportunity to attach itself to the amphibian's body and initiate feeding. Our findings suggest that the trophic interaction between Epomis larvae and amphibians is one of the only natural cases of obligatory predator-prey role reversal. Moreover, this interaction involves a small insect larva that successfully lures and preys on a larger vertebrate. Such role reversal is exceptional in the animal world, extending our perspective of co-evolution in the arms race between predator and prey, and suggesting that counterattack defense behavior has evolved into predator-prey role reversal.

  4. Helminths Parasite Larvae collected from Arabian Gulf Fish. 4. Description of four Larvae including two Metacercarae, one Didymozoid and one Acanthocephalan from Emirati Coasts

    International Nuclear Information System (INIS)

    Kardousha, M.M.

    2005-01-01

    Four helminth larvae from different fish hosts caught from Emirate coasts are described. Two are metacercariae related to genus Southampton's, type (I) and (II). Type (I) was found encysted in body cavities of the Indian halibut Psettodes erumei and the areolate grouper Epinephelus areolatusu and type (II) in the golden stripped goatfish Mulloides flavolineatus. The third larva is related to Acanthocephala and identified as Serrasentis sagittifer. It was collected from the body cavity of the spotted lizard fish Saurida undosquamius. The fourth larva belongs to the didymozoid trematodes, and was found infecting the kidneys of different hosts, such as Saurida undosquamis, the Jack pomfret Parastromateus niger and mackerel tuna Euthynnus affins. The larva related to Stephanostomum type (I) and type (II) and the dydimozoid type are described for the first time in the Arabian Gulf. (author)

  5. Effect of bodily fluids from honey bee (Apis mellifera) larvae on growth and genome-wide transcriptional response of the causal agent of American Foulbrood disease (Paenibacillus larvae).

    Science.gov (United States)

    De Smet, Lina; De Koker, Dieter; Hawley, Alyse K; Foster, Leonard J; De Vos, Paul; de Graaf, Dirk C

    2014-01-01

    Paenibacillus larvae, the causal agent of American Foulbrood disease (AFB), affects honey bee health worldwide. The present study investigates the effect of bodily fluids from honey bee larvae on growth velocity and transcription for this Gram-positive, endospore-forming bacterium. It was observed that larval fluids accelerate the growth and lead to higher bacterial densities during stationary phase. The genome-wide transcriptional response of in vitro cultures of P. larvae to larval fluids was studied by microarray technology. Early responses of P. larvae to larval fluids are characterized by a general down-regulation of oligopeptide and sugar transporter genes, as well as by amino acid and carbohydrate metabolic genes, among others. Late responses are dominated by general down-regulation of sporulation genes and up-regulation of phage-related genes. A theoretical mechanism of carbon catabolite repression is discussed.

  6. Nonsensical choices? Fall armyworm moths choose seemingly best or worst hosts for their larvae, but neonate larvae make their own choices.

    Directory of Open Access Journals (Sweden)

    Julio C Rojas

    Full Text Available Selecting optimal host plants is critical for herbivorous insects, such as fall armyworm (Spodoptera frugiperda, an important maize pest in the Americas and Africa. Fall armyworm larvae are presumed to have limited mobility, hence female moths are presumed to be largely responsible for selecting hosts. We addressed host selection by fall armyworm moths and neonate and older (3rd-instar larvae, as mediated by resistance and herbivory in maize plants. Thus, we compared discrimination among three maize cultivars with varying degrees of resistance to fall armyworm, and between plants subjected or not to two types of herbivory. The cultivars were: (i susceptible, and deficient in jasmonic acid (JA production and green leaf volatiles (GLV emissions (inbred line B73-lox10; (ii modestly resistant (B73, and; (iii highly resistant (Mp708. The herbivory types were: (i ongoing (= fall armyworm larvae present, and; (ii future (= fall armyworm eggs present. In choice tests, moths laid more eggs on the highly resistant cultivar, and least on the susceptible cultivar, though on those cultivars larvae performed poorest and best, respectively. In the context of herbivory, moths laid more eggs: (i on plants subject to versus free of future herbivory, regardless of whether plants were deficient or not in JA and GLV production; (ii on plants subject versus free of ongoing herbivory, and; (iii on plants not deficient in compared to deficient in JA and GLV production. Neonate larvae dispersed aerially from host plants (i.e. ballooned, and most larvae colonized the modestly resistant cultivar, and fewest the highly resistant cultivar, suggesting quasi-directional, directed aerial descent. Finally, dispersing older larvae did not discriminate among the three maize cultivars, nor between maize plants and (plastic model maize plants, suggesting random, visually-oriented dispersal. Our results were used to assemble a model of host selection by fall armyworm moths and

  7. A preliminary account on the distribution of decapod larvae in the Konkan waters

    Digital Repository Service at National Institute of Oceanography (India)

    Achuthankutty, C.T.; Nair, S.R.S.

    Decapod larval distribution in Konkan coastal waters was studied during the premonsoon season (March-April). Sergestid was the largest group forming 80.55% of the total decapod crustacean larvae. Penaeid larvae constituted only 0.65% and M. dobsoni...

  8. Fine structure of selected mouthpart sensory organs of gypsy moth larvae

    Science.gov (United States)

    Vonnie D.C. Shields

    2011-01-01

    Gypsy moth larvae, Lymantria dispar (L.), are major pest defoliators in most of the United States and destroy millions of acres of trees annually. They are highly polyphagous and display a wide host plant preference, feeding on the foliage of hundreds of plants, such as oak, maple, and sweet gum. Lepidopteran larvae, such as the gypsy moth, depend...

  9. Cryopreservation of third-stage larvae of Strongylus vulgaris (large strongyle of horses).

    Science.gov (United States)

    Titoy, G A; Van Rensburg, L J

    1997-06-01

    A technique for the cryopreservation of third-stage larvae of Strongylus vulgaris is described. Infective larvae of S. vulgaris were exsheathed in a 0.16% sodium hypochlorite solution and then transferred into cryotubes containing 0.09% saline. The samples were stored in the gas phase of liquid nitrogen.

  10. Cluster size influence on the survivability of Rhipicephalus Boophilus microplus larvae under low relative humidity stress

    Science.gov (United States)

    Low relative humidity (RH) levels (=63%) have been previously shown to be a determining factor in the survival of southern cattle fever tick, Rhipicephalus microplus, larvae, regardless of temperature. Supporting this observation, large larval clusters can retain more water than isolated larvae. Th...

  11. A note on the record of Rastrelliger (Mackerel) larvae from the Indian Ocean

    Digital Repository Service at National Institute of Oceanography (India)

    Peter, K.J.

    from Gulf of Thailand and South China Sea They resemble the larvae of a scombrid relative, the Pacific mackerel Pneumatophorous diego, but differ in having less pigmentation and deeper body The larvae have a fairly stubby body, with 30 myomeres big eyes...

  12. Morphogenesis of Strongyloides stercoralis infective larvae requires the DAF-16 ortholog FKTF-1.

    Directory of Open Access Journals (Sweden)

    Michelle L Castelletto

    2009-04-01

    Full Text Available Based on metabolic and morphological similarities between infective third-stage larvae of parasitic nematodes and dauer larvae of Caenorhabditis elegans, it is hypothesized that similar genetic mechanisms control the development of these forms. In the parasite Strongyloides stercoralis, FKTF-1 is an ortholog of DAF-16, a forkhead transcription factor that regulates dauer larval development in C. elegans. Using transgenesis, we investigated the role of FKTF-1 in S. stercoralis' infective larval development. In first-stage larvae, GFP-tagged recombinant FKTF-1b localizes to the pharynx and hypodermis, tissues remodeled in infective larvae. Activating and inactivating mutations at predicted AKT phosphorylation sites on FKTF-1b give constitutive cytoplasmic and nuclear localization of the protein, respectively, indicating that its post-translational regulation is similar to other FOXO-class transcription factors. Mutant constructs designed to interfere with endogenous FKTF-1b function altered the intestinal and pharyngeal development of the larvae and resulted in some transgenic larvae failing to arrest in the infective stage. Our findings indicate that FKTF-1b is required for proper morphogenesis of S. stercoralis infective larvae and support the overall hypothesis of similar regulation of dauer development in C. elegans and the formation of infective larvae in parasitic nematodes.

  13. Protocols to test the activity of antimicrobial peptides against the honey bee pathogen Paenibacillus larvae.

    Science.gov (United States)

    Khilnani, Jasmin C; Wing, Helen J

    2015-10-01

    Paenibacillus larvae is the causal agent of the honey bee disease American Foulbrood. Two enhanced protocols that allow the activity of antimicrobial peptides to be tested against P. larvae are presented. Proof of principle experiments demonstrate that the honey bee antimicrobial peptide defensin 1 is active in both assays. Copyright © 2015 Elsevier B.V. All rights reserved.

  14. Host Recognition Responses of Western (Family: Chrysomelidae) Corn Rootworm Larvae to RNA Interference and Bt Corn.

    Science.gov (United States)

    Zukoff, Sarah N; Zukoff, Anthony L

    2017-01-01

    Western corn rootworm Diabrotica virgifera virgifera LeConte is an important pest of corn whose larvae exhibit particular quantifiable patterns of locomotion after exposure to, and removal from, host roots and nonhost roots. Using EthoVision software, the behavior and locomotion of the western corn rootworm larvae was analyzed to determine the level of host recognition to germinated roots of differing corn hybrids containing either rootworm targeted Bt genes, RNA interference (RNAi) technology, the stack of both Bt and RNAi, or the isoline of these. The behavior of the rootworm larvae indicated a significant host preference response to all corn hybrids (with or without insecticidal traits) compared to the filter paper and oat roots. A weaker host response to the RNAi corn roots was observed in the susceptible larvae when compared to the resistant larvae, but not for the Bt + RNAi vector stack. Additionally, the resistant larvae demonstrated a weaker host response to the isoline corn roots when compared to the susceptible larvae. Although weaker, these host responses were significantly different from those observed in the negative controls, indicating that all hybrids tested do contain the contact cues necessary to elicit a host preference response by both Cry3Bb1-resistant and Cry3Bb1-susceptible larvae that would work to hinder resistance development in refuge in a bag fields. © The Authors 2017. Published by Oxford University Press on behalf of Entomological Society of America.

  15. A strain of Serratia marcescens pathogenic for larvae of Lymantria dispar: Infectivity and mechanisms of pathogenicity

    Science.gov (United States)

    J.D. Podgwaite; B.J. Cosenza

    1976-01-01

    The ED50 of a strain of Serratia marcescens for microinjected instar III and IV gypsy moth larvae was 7.5 and 14.5 viable cells, respectively. Percentage and rate of mortality were found to be highly variable among replicates of the same instar and between instars in free-feeding bioassays. Mortality in second instar larvae...

  16. Feeding by larvae of intertidal invertebrates: assessing their position in pelagic food webs.

    Science.gov (United States)

    Vargas, Cristian A; Manríquez, Patricio H; Navarrete, Sergio A

    2006-02-01

    One of the leading determinants of the structure and dynamics of marine populations is the rate of arrival of new individuals to local sites. While physical transport processes play major roles in delivering larvae to the shore, these processes become most important after larvae have survived the perils of life in the plankton, where they usually suffer great mortality. The lack of information regarding larval feeding makes it difficult to assess the effects of food supply on larval survival, or the role larvae may play in nearshore food webs. Here, we examine the spectrum of food sizes and food types consumed by the larvae of two intertidal barnacle species and of the predatory gastropod Concholepas concholepas. We conducted replicated experiments in which larvae were exposed to the food size spectrum (phytoplankton, microprotozoan and autotrophic picoplankton) found in nearshore waters in central Chile. Results show that barnacle nauplii and gastropod veligers are omnivorous grazers, incorporating significant fractions of heterotrophs in their diets. In accordance with their feeding mechanisms and body size, barnacle nauplii were able to feed on autotrophic picoplankton (concholepas larvae also consumed picoplankton cells, while competent larvae of this species ingested mostly the largest phytoplankton cells and heterotrophic protozoans. Results suggest that persistent changes in the structure of pelagic food webs can have important effects on the species-specific food availability for invertebrate larvae, which can result in large-scale differences in recruitment rates of a given species, and in the relative recruitment success of the different species that make up benthic communities.

  17. Gregarious settlement in cypris larvae: the effects of cyprid age and assay duration

    NARCIS (Netherlands)

    Head, R.M.; Berntsson, K.M.; Dahlström, M.; Overbeke, J.C.; Thomason, J.C.

    2004-01-01

    Gregarious behaviour of marine larvae is perhaps most clearly associated with finding a suitable habitat in a changeable or restricted environment, or with finding other conspecifics with which to mate. Prior work has shown that in settlement assays using cypris larvae of the barnacle Balanus

  18. Description of the larvae of Hydroporus ferrugineus Stephens and H-polaris fall (Coleoptera: Adephaga: Dytiscidae)

    NARCIS (Netherlands)

    Alarie, Y.; Wood, P.J.; Bruyn, de A.M.H.; Cuppen, J.G.M.

    2001-01-01

    Description of structures of the larvae of Hydroporus ferrugineus Stephens and H. polaris Fall is provided including detailed chaetotaxal and porotaxal analyses. Larvae of H. ferrugineus are distinguished from all other species of Hydroporus Clairville by the presence of 1–2 secondary setae on

  19. Chemical Composition and Food Potential of Pachymerus nucleorum Larvae Parasitizing Acrocomia aculeata Kernels.

    Directory of Open Access Journals (Sweden)

    Ariana Vieira Alves

    Full Text Available Insect consumption as food is culturally practiced in various regions of the world. In Brazil, there are more than 130 species of edible insects registered, from nine orders, among which stands out the Coleoptera. The larva of the beetle Pachymerus nucleorum Fabricius, 1792, grows into the bocaiuva fruit (Acrocomia aculeata (Jacq. Lodd. Ex Mart., 1845, which has proven nutritional quality. The aim of this work was to evaluate the nutritional potential of P. nucleorum larvae compared to bocaiuva kernels for human consumption. Proteins were the second largest portion of the larvae nutritional composition (33.13%, with percentage higher than the bocaiuva kernels (14.21%. The larval lipid content (37.87% was also high, very close to the kernels (44.96%. The fraction corresponding to fatty acids in the oil extracted from the larvae was 40.17% for the saturated and 46.52% for the unsaturated. The antioxidant activity value was 24.3 uM trolox/g of oil extracted from larvae. The larvae tryptic activity was 0.032±0.006 nmol BAPNA/min. Both the larvae and the bocaiuva kernel presented absence of anti-nutritional factors. These results favor the use of P. nucleorum larvae as food, which are a great protein and lipid sources with considerable concentrations of unsaturated fatty acids compared to the bocaiuva kernel.

  20. c-orfi and Tnpnin crnssiceps Larvae I Department of Pharmaceutical ...

    African Journals Online (AJOL)

    satisfactorily. The putative first intermediate host is a ground-dwelling coprophagous arthropod that ingests oncospheres and accommodates the development of larvae. It is presumed that vertebrates become hosts for the larvae after ingestion of infected arthropods. This is followed by penetration of the small intestine by a.

  1. Young and old honey bee (Apis mellifera) larvae differentially prime the developmental maturation of their caregivers

    Science.gov (United States)

    In eusocial insects daughters rear the offspring of the queen to adulthood. In the honey bee, Apis mellifera, nurses differentially regulate larval nutrition. Among worker-destined larvae, younger instars receive an unrestricted diet paralleling that of queen larvae in protein composition but with r...

  2. DNA metabarcoding of fish larvae for detection of non-native fishes

    Science.gov (United States)

    Our objective was to evaluate the use of fish larvae for early detection of non-native fishes, comparing traditional and molecular taxonomy approaches to investigate potential efficiencies. Fish larvae present an interesting opportunity for non-native fish early detection because...

  3. Effect of ivermectin on the larvae of Anopheles gambiae and Culex quinquefasciatus

    DEFF Research Database (Denmark)

    Derua, Yahya A.; Malongo, Bernard B.; Simonsen, Paul E.

    2016-01-01

    . Methods: A total of 1800 laboratory reared mosquito larvae of each species were used in the bioassays. Twelve replicates were performed, each testing 6 concentrations of ivermectin (0.0, 0.001, 0.01, 0.1, 1.0 and 10.0 parts per million (ppm)) against third instar larvae of An. gambiae and Cx...

  4. Toxicity of cypermethrin on the embryo and larvae of Gangetic mystus, Mystus cavasius

    NARCIS (Netherlands)

    Ali, Md Haider; Sumon, Kizar Ahmed; Sultana, Marin; Rashid, Harunur

    2018-01-01

    The objective of the present study was to elucidate the effects of cypermethrin on the embryo and the larvae of Gangetic mystus, Mystus cavasius. Therefore, fertilized eggs (n = 100) and 1-day-old larvae (n = 100) were exposed to six different concentrations of cypermethrin (0, 2, 4, 8, 16 and 32 μg

  5. Assessment of Clarias gariepinus as a biological control agent against mosquito larvae.

    Science.gov (United States)

    Chala, Buze; Erko, Berhanu; Animut, Abebe; Degarege, Abraham; Petros, Beyene

    2016-05-31

    The emergence and spread of insecticide resistant mosquitoes renewed interest in investigating the use of larvivorous fish as a biological control agent. The potential of Clarias gariepinus fish in controlling Anopheles arabiensis and culicine larvae was assessed under laboratory and semi-field conditions. Small size (15-20 cm) C. gariepinus fish consumed greater number of mosquito larvae than the large size fish (25-40 cm) in the multivariate regression model (β = 13.36, 95 % CI = 4.57, 22.15). The Anopheles larvae consumed was greater in number than the culicines larvae consumed by the fish (β = 12.10, 95 % CI = 3.31, 20.89). The number of larvae consumed was greater during the night hours than during the light hours (β = 30.06, 95 % CI = 21.27, 38.85). Amount of supplementary fish food did not cause significant differences in the number of mosquito larvae consumed by the fish among different groups. C. gariepinus was observed to feed on mosquito larvae under laboratory and semi-field conditions. C. gariepinus fed on the larvae of An. arabiensis and culicines readily. Hence, it can be used as an alternative mosquito control agent in Ethiopia where the breeding habitats are small and localized.

  6. Chemically mediated group formation in soil-dwelling larvae and pupae of the beetle Trypoxylus dichotomus

    Science.gov (United States)

    Kojima, Wataru; Ishikawa, Yukio; Takanashi, Takuma

    2014-09-01

    Many insects form groups through interactions among individuals, and these are often mediated by chemical, acoustic, or visual cues and signals. In spite of the diversity of soil-dwelling insects, their aggregation behaviour has not been examined as extensively as that of aboveground species. We investigated the aggregation mechanisms of larvae of the Japanese rhinoceros beetle Trypoxylus dichotomus, which live in groups in humus soil. In two-choice laboratory tests, 2nd- and 3rd-instar larvae gathered at conspecific larvae irrespective of the kinship. The ablation of maxillae, which bear chemosensilla, abolished aggregation behaviour. Intact larvae also exhibited aggregation behaviour towards a larval homogenate. These results suggest that larval aggregation is mediated by chemical cues. We also demonstrated that the mature larvae of T. dichotomus built their pupal cells close to a mesh bag containing a conspecific pupal cell, which indicated that larvae utilize chemical cues emanating from these cells to select the pupation site. Thus, the larvae of T. dichotomus may use chemical cues from the conspecifics in two different contexts, i.e. larval aggregation and pupation site selection. Using conspecific cues, larvae may be able to choose suitable locations for foraging or building pupal cells. The results of the present study highlight the importance of chemical information in belowground ecology.

  7. PENGARUH PAKAN ALAMI Chaetoceros spp. TERHADAP PERKEMBANGAN DAN SINTASAN LARVA UDANG WINDU, Penaeus monodon

    Directory of Open Access Journals (Sweden)

    Samuel Lante

    2015-09-01

    Full Text Available Pakan alami berupa mikroalga merupakan salah satu faktor pendukung dalam keberhasilan usaha pembenihan udang windu, Penaeus monodon. Penelitian ini bertujuan untuk mengetahui jenis pakan alami, Chaetoceros spp., yang dapat meningkatkan pertumbuhan dan sintasan larva udang windu. Penelitian ini menggunakan 15 buah bak fiber berukuran 60 cm x 40 cm x 50 cm dengan volume 120 liter yang disi air sebanyak 100 liter. Kepadatan naupli adalah 90 ekor/liter atau 9.000 ekor/bak dan lima jenis pakan alami Chaetoceros spp. yang diuji yaitu: Chaetoceros simplex, Chaetoceros ceratosporum, Chaetoceros calcitrans, Chaetoceros amami, dan Chaetoceros gracilis. Hasil penelitian menunjukkan bahwa aplikasi kelima jenis pakan alami memberikan laju perkembangan larva yang relatif sama sampai stadia PL-1. Aplikasi Chaetoceros gracilis memberikan sintasan larva udang windu tertinggi yaitu 41,48% dan dengan Chaetoceros simplex memberikan sintasan larva terendah (28,02%. Hasil penelitian ini mengindikasikan bahwa aplikasi Chaetoceros spp. yang berbeda pada pemeliharaan larva berpengaruh terhadap sintasan larva udang windu, namun tidak berpengaruh terhadap laju metamorfosis larva. Aplikasi Chaetoceros gracilis sebagai pakan alami adalah terbaik untuk sintasan larva udang windu.

  8. Effects of the Liquids Used to Kill Larvae on the Length of Forensically Important Blow Fly Lucilia sericata Meigen (Diptera: Calliphoridae Larvae

    Directory of Open Access Journals (Sweden)

    Halide Nihal Açıkgöz

    2017-12-01

    Full Text Available Forensic entomological practices rely upon accurate larval identification and measurement of larval length, for the estimation of post-mortem intervals. The methods used for killing larvae may affect the length of larvae. In the autopsy hall, corpses which are contain entomological remains have been washed with grape vinegar. Besides, while collecting and killing the larvae on corpses, crime scene teams use alcohol 70% because it is practical. The aim of this study was to determine which of hot water (90°C, cold vinegar and cold alcohol 96 % method, preserved the best the length of larvae. To achieve this aim, third instar larvae which are reared on 200 g of veal meat were killed using hot water, cold vinegar and cold alcohol. Before killing and after killing the maggots, their length was measured. To determine the difference between the groups to be compared ANOVA test, to reliability and validity analyses Kruskal-Wallis and whether there was any difference between the groups were made with Tukey’s Honestly Significant Difference (Tukey’s HSD Hot water was found to preserve the length of the larvae more accurately than cold vinegar and alcohol.

  9. Infective larvae of Rhabdiasidae (Nematoda): comparative morphology of seven European species.

    Science.gov (United States)

    Kuzmin, Yuriy; Junker, Kerstin; Bain, Odile

    2014-03-01

    The morphology of infective third-stage larvae of Rhabdias bufonis, R. rubrovenosa, R. sphaerocephala, R. fuscovenosa, R. elaphe, Entomelas entomelas and E. dujardini is described. The sheath structure in the studied larvae appeared to be similar to that described in other species of the family Rhabdiasidae, its chequered aspect being caused by a combination of outer longitudinal striations and inner longitudinal as well as transverse ridges. The larvae were similar in general morphology but differed in the presence/absence of anterior apical protuberances (pseudolabia), the shape and ornamentation of the tail tip, and the structure of lateral alae in the caudal region of the body. No relationship between the morphological characters of the larvae of the studied species and their taxonomic position or specificity of adult parasites to a particular host group was observed. Regardless, the larvae of each species can be identified by a combination of morphological peculiarities in the anterior and caudal regions of the body.

  10. Infectivity and development of X-irradiated third-stage larvae of Angiostrongylus cantonensis in rats

    International Nuclear Information System (INIS)

    Fujiu, Yoshinori

    1989-01-01

    Angiostrongylus cantonensis third-stage larvae were exposed to less than 10Krad of X-radiation and then given orally to white rats to examine the effects of X-radiation on infectivity and development of the irradiated third-stage larvae and on fecundity of adults developing from the irradiated third-stage larvae. The deleterious effects of X-radiation were observed at relatively lower dosage in the above three parameters. A degree in susceptibility on X-radiation was shown to be radiation-dose-dependent. Comparing to the irradiation of larvae in vitro, the irradiation of larvae in snails caused less deleterious effects at the same dose of X-irradiation. Application of X-radiation to food hygiene was also discussed. (author)

  11. Ultrastructural characteristics of nurse cell-larva complex of four species of Trichinella in several hosts

    Directory of Open Access Journals (Sweden)

    Sacchi L.

    2001-06-01

    Full Text Available The nurse cell-larva complex of nematodes of the genus Trichinella plays an Important role in the survival of the larva in decaying muscles, frequently favouring the transmission of the parasite in extreme environmental conditions. The ultrastructure of the nurse cell-larva complex in muscles from different hosts infected with T. nativa (a walrus and a polar bear, T. spiralis (horses and humans, T. pseudospiralis (a laboratory mouse and T. papuae (a laboratory mouse were examined. Analysis with transmission electron microscope showed that the typical nurse cell structure was present in all examined samples, irrespective of the species of larva, of the presence of a collagen capsule, of the age of infection and of the host species, suggesting that there exists a molecular mechanism that in the first stage of larva invasion is similar for encapsulated and non-encapsulated species.

  12. Starvation-Induced Dietary Behaviour in Drosophila melanogaster Larvae and Adults.

    Science.gov (United States)

    Ahmad, Muhammad; Chaudhary, Safee Ullah; Afzal, Ahmed Jawaad; Tariq, Muhammad

    2015-09-24

    Drosophila melanogaster larvae are classified as herbivores and known to feed on non-carnivorous diet under normal conditions. However, when nutritionally challenged these larvae exhibit cannibalistic behaviour by consuming a diet composed of larger conspecifics. Herein, we report that cannibalism in Drosophila larvae is confined not only to scavenging on conspecifics that are larger in size, but also on their eggs. Moreover, such cannibalistic larvae develop as normally as those grown on standard cornmeal medium. When stressed, Drosophila melanogaster larvae can also consume a carnivorous diet derived from carcasses of organisms belonging to diverse taxonomic groups, including Musca domestica, Apis mellifera, and Lycosidae sp. While adults are ill-equipped to devour conspecific carcasses, they selectively oviposit on them and also consume damaged cadavers of conspecifics. Thus, our results suggest that nutritionally stressed Drosophila show distinct as well as unusual feeding behaviours that can be classified as detritivorous, cannibalistic and/or carnivorous.

  13. Scanning electron microscope observations of brine shrimp larvae from space shuttle experiments

    Science.gov (United States)

    DeBell, L.; Paulsen, A.; Spooner, B.

    1992-01-01

    Brine shrimp are encysted as gastrula stage embryos, and may remain dehydrated and encysted for years without compromising their viability. This aspect of brine shrimp biology is desirable for studying development of animals during space shuttle flight, as cysts placed aboard a spacecraft may be rehydrated at the convenience of an astronaut, guaranteeing that subsequent brine shrimp development occurs only on orbit and not on the pad during launch delays. Brine shrimp cysts placed in 5 ml syringes were rehydrated with salt water and hatched during a 9 day space shuttle mission. Subsequent larvae developed to the 8th larval stage in the sealed syringes. We studied the morphogenesis of the brine shrimp larvae and found the larvae from the space shuttle experiments similar in rate of growth and extent of development, to larvae grown in sealed syringes on the ground. Extensive differentiation and development of embryos and larvae can occur in a microgravity environment.

  14. Effects of pesticides on DNA and protein of shrimp larvae Litopenaeus stylirostris of the California Gulf.

    Science.gov (United States)

    Galindo Reyes, J Guillermo; Leyva, Nancy R; Millan, Olivia A; Lazcano, Guadalupe A

    2002-10-01

    Recently, diverse pathologies and massive mortalities have been presented in shrimp hatcheries located along the California Gulf; therefore, toxic responses of shrimp larvae were used as biomarkers of pesticide pollution, because in this region intensive agriculture is practiced. Shrimp larvae were exposed to DDT, azinphosmethyl, permethrine, parathion, chlorpyrifos, malathion, endosulfan, and carbaryl, in order to determine LC50, DNA adducts and/or breaks, and total protein in larvae. The results indicate reductions in protein and DNA in larvae exposed to these pesticides, and in those exposed to DDT, breaks and/or adducts were registered. It is possible that pesticide pollution is a cause of these problems, because reduction in protein indicates a decrease in larvae growth rate and DNA breaks or adducts have been related to pathologies and carcinogenesis in many aquatic organisms.

  15. Uncommon Human Urinary Tract Myiasis Due to Psychoda Sp. Larvae, Kashan, Iran: A Case Report.

    Science.gov (United States)

    Rasti, Sima; Dehghani, Rouhullah; Khaledi, Hassan Naeimi; Takhtfiroozeh, Sayed Mahdi; Chimehi, Elahe

    2016-01-01

    Contamination of human and animal body tissues with flies' larvae and diptera cause myiasis. A 26 yr old female patient refers to Kashan Shahid Beheshti Hospital, central Iran because of urogenital infection, pain in the right part of stomach, smelly and reddish vaginal discharge and frequent urination. In the first checking, urine sample was taken. In the sample, active and alive larvae were seen. The live samples were taken to the Environmental Health Department Lab of Kashan University of Medical Sciences in clean glass jars. In the morphological survey, Psychoda sp larvae were identified. In Iran, this study is the first report of this species of larva that causes urinary myiasis. This fly larva is not carnivore or bloodsucker and feeds on bacterial agents. Observance of personal hygiene especially during defecation and urination is essential to prevent contamination of this type of myiasis.

  16. Uncommon Human Urinary Tract Myiasis Due to Psychoda Sp. Larvae, Kashan, Iran: A Case Report

    Directory of Open Access Journals (Sweden)

    Sima RASTI

    2016-10-01

    Full Text Available Contamination of human and animal body tissues with flies’ larvae and diptera cause myiasis. A 26 yr old female patient refers to Kashan Shahid Beheshti Hospital, central Iran because of urogenital infection, pain in the right part of stomach, smelly and reddish vaginal discharge and frequent urination. In the first checking, urine sample was taken. In the sample, active and alive larvae were seen. The live samples were taken to the Environmental Health Department Lab of Kashan University of Medical Sciences in clean glass jars. In the morphological survey, Psychoda sp larvae were identified. In Iran, this study is the first report of this species of larva that causes urinary myiasis. This fly larva is not carnivore or bloodsucker and feeds on bacterial agents. Observance of personal hygiene especially during defecation and urination is essential to prevent contamination of this type of myiasis.

  17. Identification of tissue-embedded ascarid larvae by ribosomal DNA sequencing.

    Science.gov (United States)

    Ishiwata, Kenji; Shinohara, Akio; Yagi, Kinpei; Horii, Yoichiro; Tsuchiya, Kimiyuki; Nawa, Yukifumi

    2004-01-01

    Polymerase chain reaction (PCR) was applied to identify tissue-embedded ascarid nematode larvae. Two sequences of the internal transcribed spacer (ITS) regions of ribosomal DNA (rDNA), ITS1 and ITS2, of the ascarid parasites were amplified and compared with those of ascarid-nematodes registered in a DNA database (GenBank). The ITS sequences of the PCR products obtained from the ascarid parasite specimen in our laboratory were compatible with those of registered adult Ascaris and Toxocara parasites. PCR amplification of the ITS regions was sensitive enough to detect a single larva of Ascaris suum mixed with porcine liver tissue. Using this method, ascarid larvae embedded in the liver of a naturally infected turkey were identified as Toxocara canis. These results suggest that even a single larva embedded in tissues from patients with larva migrans could be identified by sequencing the ITS regions.

  18. Irradiation effect of electronic beam on older larvae of Lasioderma serricorne (Fabricius)

    International Nuclear Information System (INIS)

    Chen Yuntang; Guo Dongquan; Zhang Jianwei; Yang Baoan

    2010-01-01

    Cigarette beetle [ Lasioderma serricorne (Fabricius) ] is an important pest of stored tobacco distributing over the world, and it is also one of the most serious pests in the tobacco warehouse. The larvae is the most serious detriment in the four states of cigarette beetle. The objective of this study was to control the damage on tobacco from cigarette beetle. The irradiation effects of electronic beam on the older larvae of cigarette beetle in tobacco were studied. The results showed that the older larvae irradiated by the doses higher than 480 Gy could prevent the development to adults; and no new generation was found after 300 Gy irradiation for older larvae. Thus 300Gy irradiation could prevent the reproduction of cigarette beetle for the older larvae in the tobacco. (authors)

  19. Efecto de la temperatura sobre la viabilidad de larvas de Trichinella spiralis Effect of temperature on the viability of Trichinella spiralis larvae

    Directory of Open Access Journals (Sweden)

    Viviana R Randazzo

    2011-12-01

    Full Text Available El objetivo de este estudio fue determinar el efecto de diferentes temperaturas sobre la viabilidad de larvas libres y enquistadas de Trichinella spiralis aisladas en el sudoeste de la provincia de Buenos Aires, Argentina. Se trataron larvas libres y enquistadas a diferentes temperaturas (-30 °C, -20 °C, 4 °C, 20 °C, calentamiento gradual entre 0-100 °C. Se determinó el tiempo necesario para matar el 100 % de las larvas. Durante los primeros días, la mortalidad larvaria en todos los tratamientos con frío aumentó signifcativamente en función del tiempo. En todos los casos, las larvas libres sobrevivieron menor cantidad de días que las enquistadas. A -30 °C, -20 °C y 20 °C no se observaron diferencias signifcativas entre las curvas de mortalidad de cada estadio larvario, pero a 4 °C la mortalidad fue menos intensa entre las larvas enquistadas. El calentamiento disminuyó la viabilidad, sin observarse diferencias entre estadios larvarios. La totalidad de las larvas libres y enquistadas había muerto a los 61 y 95 días (-30 °C, a los 160 y 180 días (-20 °C, a los 280 y 330 días (4° C, y a los 460 y 590 días (20 °C, respectivamente. Fue necesaria una cocción durante 15 minutos a 90 °C para matar al 100 % de las larvas libres y a 100 °C para lograr igual mortalidad de las enquistadas. Nuestros resultados indican que la temperatura y los tiempos tradicionalmente utilizados para tratar productos cárnicos con potencial de transmisión de T. spiralis no serían los más efectivos para lograr la inactivación de la totalidad de larvas vivas de este parásito.The aim of this work was to study the effect of temperature on the viability of free and encysted larvae of Trichinella spiralis from southwest Buenos Aires province, Argentina. Larvae were treated at variable temperatures (-30 °C, -20 °C, 4 °C, 20 °C, gradual heating between 0-100 °C. The time necessary to kill 100 % of larvae was calculated. During the frst days of

  20. Seasonal fluctuation in the distribution of eggs and larvae of flat fishes (Pleuronectiformes - Pisces) in the Cochin Backwater

    Digital Repository Service at National Institute of Oceanography (India)

    Devi, C.B.L.

    Attempts have been made to correlate the abundance of eggs and larvae of flat fishes belonging to families Cynoglossidae and Soleidae with the hydrographical parameters of the environment, particularly the salinity. The eggs and larvae were found...

  1. Adaptation to Variance of Stimuli in Drosophila Larva Navigation

    Science.gov (United States)

    Wolk, Jason; Gepner, Ruben; Gershow, Marc

    In order to respond to stimuli that vary over orders of magnitude while also being capable of sensing very small changes, neural systems must be capable of rapidly adapting to the variance of stimuli. We study this adaptation in Drosophila larvae responding to varying visual signals and optogenetically induced fictitious odors using an infrared illuminated arena and custom computer vision software. Larval navigational decisions (when to turn) are modeled as the output a linear-nonlinear Poisson process. The development of the nonlinear turn rate in response to changes in variance is tracked using an adaptive point process filter determining the rate of adaptation to different stimulus profiles. Supported by NIH Grant 1DP2EB022359 and NSF Grant PHY-1455015.

  2. Eggs containing larvae of Enterobius vermicularis in vaginal smear

    Directory of Open Access Journals (Sweden)

    Jyothi B Shetty

    2012-01-01

    Full Text Available Enterobius vermicularis also known commonly as pinworm is the most common intestinal parasite. It is a nematode that inhabits the human terminal ileum, colon and appendix. The fertilized female migrates to the perianal area where eggs are deposited but occasionally introduces itself into adjacent orifices, most commonly the female genitourinary tract. Thus the eggs can be seen in the vaginal smear as a result of contamination. We report a case wherein the patient presented with signs and symptoms of vulvovaginitis. In her vaginal smear there were eggs of Enterobius vermicularis which showed a coiled larva within it. In the background there were plenty of acute inflammatory cells. This patient responded favorably to antihelminthics. We report this case to highlight the morphology of the parasite and also to emphasize that such findings should not be neglected. Timely reporting and appropriate treatment of such cases will prevent further complications of this parasite including endometritis, salphingitis and peritonitis.

  3. Bioluminescence Monitoring of Neuronal Activity in Freely Moving Zebrafish Larvae

    Science.gov (United States)

    Knafo, Steven; Prendergast, Andrew; Thouvenin, Olivier; Figueiredo, Sophie Nunes; Wyart, Claire

    2017-01-01

    The proof of concept for bioluminescence monitoring of neural activity in zebrafish with the genetically encoded calcium indicator GFP-aequorin has been previously described (Naumann et al., 2010) but challenges remain. First, bioluminescence signals originating from a single muscle fiber can constitute a major pitfall. Second, bioluminescence signals emanating from neurons only are very small. To improve signals while verifying specificity, we provide an optimized 4 steps protocol achieving: 1) selective expression of a zebrafish codon-optimized GFP-aequorin, 2) efficient soaking of larvae in GFP-aequorin substrate coelenterazine, 3) bioluminescence monitoring of neural activity from motor neurons in free-tailed moving animals performing acoustic escapes and 4) verification of the absence of muscle expression using immunohistochemistry. PMID:29130058

  4. Evaluation of Lethal Giant Larvae as a Schistosomiasis Vaccine Candidate

    Directory of Open Access Journals (Sweden)

    Yufan Cao

    2016-01-01

    Full Text Available Schistosomiasis is a neglected tropical disease of humans, and it is considered to be the second most devastating parasitic disease after malaria. Eggs produced by normally developed female worms are important in the transmission of the parasite, and they responsible for the pathogenesis of schistosomiasis. The tumor suppressor gene lethal giant larvae (lgl has an essential function in establishing apical-basal cell polarity, cell proliferation, differentiation, and tissue organization. In our earlier study, downregulation of the lgl gene induced a significant reduction in the egg hatching rate of Schistosoma japonicum (Sj eggs. In this study, the Sjlgl gene was used as a vaccine candidate against schistosomiasis, and vaccination achieved and maintained a stable reduction of the egg hatching rate, which is consistent with previous studies, in addition to reducing the worm burden and liver egg burden in some trials.

  5. Morphology and diversity of exocrine glands in lepidopteran larvae.

    Science.gov (United States)

    Vegliante, Francesca; Hasenfuss, Ivar

    2012-01-01

    The morphology of 21 exocrine glands and 13 supposedly exocrine structures recorded for lepidopteran larvae is reviewed. The epitracheal glands, for which a double role (exocrine and endocrine) has been demonstrated, are examined as well. Function is well known for at least 8 glands but completely unknown for 6 glands, for 10 putative glandular structures, and for the exocrine component of the epitracheal glands. Functional studies on the remaining structures are insufficient; in some cases (mandibular gland and adenosma) homologous glands may play a different role depending on the species, and only a few taxa have been examined. The secretions of 13 glandular types have been analyzed chemically. The histology of 11 glands is known at the ultrastructural level, whereas that of 6 glands and 7 putative glandular structures is completely unknown. Comparative anatomical studies of the osmeterium, adenosma, and Verson's glands may yield useful information for phylogenetic reconstructions. Copyright © 2012 by Annual Reviews. All rights reserved.

  6. X-ray inactivation of Caenorhabditis elegans embryos or larvae

    Energy Technology Data Exchange (ETDEWEB)

    Ishi, N; Suzuki, K [Tokai Univ., Isehara, Kanagawa (Japan). School of Medicine

    1990-11-01

    The lethal effects of X-irradiation were examined in staged populations of Caenorhabditis elegans embryos or larvae. Radiation resistance decreased slightly throughout the first, proliferative phase of embryogenesis. This might be due to the increase in target size, since most cells in C. elegans are autonomously determined. Animals irradiated in the second half of embryogenesis were about 40-fold more resistant to the lethal effects of X-rays. This is probably due to the absence of cell divisions during this time. The radiation resistance increased still more with advancing larval stages. A radiation hypersensitive mutant, rad-1, irradiated in the first half of embryogenesis, is about 30-fold more sensitive than wild-type, but in the second half it is the same as wild-type. (author).

  7. Highly polygenic variation in environmental perception determines dauer larvae formation in growing populations of Caenorhabditis elegans.

    Directory of Open Access Journals (Sweden)

    James W M Green

    Full Text Available Determining how complex traits are genetically controlled is a requirement if we are to predict how they evolve and how they might respond to selection. This requires understanding how distinct, and often more simple, life history traits interact and change in response to environmental conditions. In order to begin addressing such issues, we have been analyzing the formation of the developmentally arrested dauer larvae of Caenorhabditis elegans under different conditions.We find that 18 of 22 previously identified quantitative trait loci (QTLs affecting dauer larvae formation in growing populations, assayed by determining the number of dauer larvae present at food patch exhaustion, can be recovered under various environmental conditions. We also show that food patch size affects both the ability to detect QTLs and estimates of effect size, and demonstrate that an allele of nath-10 affects dauer larvae formation in growing populations. To investigate the component traits that affect dauer larvae formation in growing populations we map, using the same introgression lines, QTLs that affect dauer larvae formation in response to defined amounts of pheromone. This identifies 36 QTLs, again demonstrating the highly polygenic nature of the genetic variation underlying dauer larvae formation.These data indicate that QTLs affecting the number of dauer larvae at food exhaustion in growing populations of C. elegans are highly reproducible, and that nearly all can be explained by variation affecting dauer larvae formation in response to defined amounts of pheromone. This suggests that most variation in dauer larvae formation in growing populations is a consequence of variation in the perception of the food and pheromone environment (i.e. chemosensory variation and in the integration of these cues.

  8. Impact of ultraviolet-B radiation on planktonic fish larvae: Alteration of the osmoregulatory function

    Energy Technology Data Exchange (ETDEWEB)

    Sucre, Elliott, E-mail: elliott.sucre@univ-montp2.fr [AEO Team (Adaptation Ecophysiologique et Ontogenese), UMR 5119 Ecosym UM2, CNRS, IRD, Ifremer, UM1, Universite Montpellier 2, cc092, Pl. Eugene Bataillon, 34095 Montpellier, Cx 05 (France); Vidussi, Francesca [RESEAUX Team (Reseaux Planctoniques et Changement Environnemental), UMR 5119 Ecosym UM2, CNRS, IRD, Ifremer, UM1, Universite Montpellier 2, cc093, Pl. Eugene Bataillon, 34095 Montpellier, Cx 05 (France); Mostajir, Behzad [RESEAUX Team (Reseaux Planctoniques et Changement Environnemental), UMR 5119 Ecosym UM2, CNRS, IRD, Ifremer, UM1, Universite Montpellier 2, cc093, Pl. Eugene Bataillon, 34095 Montpellier, Cx 05 (France); Centre d' ecologie marine experimentale MEDIMEER (Mediterranean centre for Marine Ecosystem Experimental Research), Universite Montpellier 2-CNRS (UMS 3301), Station Mediterraneenne de l' Environnement Littoral, MEDIMEER, 2 Rue des Chantiers, 34200 Sete (France); Charmantier, Guy; Lorin-Nebel, Catherine [AEO Team (Adaptation Ecophysiologique et Ontogenese), UMR 5119 Ecosym UM2, CNRS, IRD, Ifremer, UM1, Universite Montpellier 2, cc092, Pl. Eugene Bataillon, 34095 Montpellier, Cx 05 (France)

    2012-03-15

    Coastal marine ecosystems are submitted to variations of several abiotic and biotic parameters, some of them related to global change. Among them the ultraviolet-B (UV-B) radiation (UVBR: 280-320 nm) may strongly impact planktonic fish larvae. The consequences of an increase of UVBR on the osmoregulatory function of Dicentrarchus labrax larvae have been investigated in this study. In young larvae of D. labrax, as in other teleosts, osmoregulation depends on tegumentary ion transporting cells, or ionocytes, mainly located on the skin of the trunk and of the yolk sac. As early D. labrax larvae passively drift in the top water column, ionocytes are exposed to solar radiation. The effect of UVBR on larval osmoregulation in seawater was evaluated through nanoosmometric measurements of the blood osmolality after exposure to different UV-B treatments. A loss of osmoregulatory capability occured in larvae after 2 days of low (50 {mu}W cm{sup -2}: 4 h L/20 h D) and medium (80 {mu}W cm{sup -2}: 4 h L/20 h D) UVBR exposure. Compared to control larvae kept in the darkness, a significant increase in blood osmolality, abnormal behavior and high mortalities were detected in larvae exposed to UVBR from 2 days on. At the cellular level, an important decrease in abundance of tegumentary ionocytes and mucous cells was observed after 2 days of exposure to UVBR. In the ionocytes, two major osmoeffectors were immunolocalized, the Na{sup +}/K{sup +}-ATPase and the Na{sup +}/K{sup +}/2Cl{sup -} cotransporter. Compared to controls, the fluorescent immunostaining was lower in UVBR-exposed larvae. We hypothesize that the impaired osmoregulation in UVBR-exposed larvae originates from the lower number of tegumentary ionocytes and mucous cells. This alteration of the osmoregulatory function could negatively impact the survival of young larvae at the surface water exposed to UVBR.

  9. Biochemistry and molecular biology of the Caenorhabditis elegans dauer larva

    International Nuclear Information System (INIS)

    Wadsworth, W.G.

    1989-01-01

    Biochemical and molecular techniques have been used to study the formation and recovery of the developmentally arrested, non-feeding dauer stage of the nematode Caenorhabditis elegans. While investigating developmental transitions in energy metabolism, a major metabolite isolated from perchloric acid extracts has been identified as a modified uridine nucleotide. The compound was isolated by gel filtration and ion-exchange chromatography and its structure was determined by 1 H NMR and 13 C NMR spectroscopy. This compound is the most abundant metabolite detected in 31 PMR spectra of perchloric acid extracts from growing larvae. In the absence of phosphoarginine or phosphocreatine, this modified nucleotide may have an important function in the nematode's energy metabolism, and it may also be found in several other invertebrates. During recovery from the dauer stage, metabolic activation is accompanied by a decrease in intracellular pH (pH i ). Although metabolic activation has been associated with an alkaline pH i shift in other organisms, in vivo 31 P NMR analysis of recovering dauer larvae shows a pH i decrease from ∼7.3 to ∼6.3 within 3 hr after the animals encounter food. This shift occurs before feeding begins, and coincides with, or soon follows, the development commitment to recover from the dauer stage, suggesting that control of pH i may be important in the regulation of larval development in nematodes. A library enriched for sequences expressed specifically during the L2d (predauer) stage was made by selecting plaques from a genomic lambda library that hybridized to subtracted L2d cDNA probes. Ultimately, three clones that were shown to hybridize only to L2d RNA were selected

  10. Composition of agarose substrate affects behavioral output of Drosophila larvae

    Directory of Open Access Journals (Sweden)

    Anthi Aristomenis Apostolopoulou

    2014-01-01

    Full Text Available In the last decade the Drosophila larva has evolved into a simple model organism offering the opportunity to integrate molecular genetics with systems neuroscience. This led to a detailed understanding of the functional neuronal networks for a number of sensory functions and behaviors including olfaction, vision, gustation and learning and memory. Typically, behavioral assays in use exploit simple Petri dish setups with either agarose or agar as a substrate. However, neither the quality nor the concentration of the substrate is generally standardized across these experiments and there is no data available on how larval behavior is affected by such different substrates. Here, we have investigated the effects of different agarose concentrations on several larval behaviors. We demonstrate that agarose concentration is an important parameter, which affects all behaviors tested: preference, feeding, learning and locomotion. Larvae can discriminate between different agarose concentrations, they feed differently on them, they can learn to associate an agarose concentration with an odor stimulus and crawl faster on a substrate of higher agarose concentration. Additionally, we have investigated the effect of agarose concentration on three quinine based behaviors: preference, feeding and learning. We show that in all cases examined the behavioral output changes in an agarose concentration-dependent manner. Our results suggest that comparisons between experiments performed on substrates differing in agarose concentration should be done with caution. It should be taken into consideration that the agarose concentration can affect the behavioral output and thereby the experimental outcomes per se potentially due to an increased escape response on more rigid substrates.

  11. Biological Role of Paenilarvins, Iturin-Like Lipopeptide Secondary Metabolites Produced by the Honey Bee Pathogen Paenibacillus larvae.

    Science.gov (United States)

    Hertlein, Gillian; Seiffert, Marlene; Gensel, Sebastian; Garcia-Gonzalez, Eva; Ebeling, Julia; Skobalj, Ranko; Kuthning, Anja; Süssmuth, Roderich D; Genersch, Elke

    2016-01-01

    The Gram-positive bacterium Paenibacillus larvae (P. larvae) is the causative agent of a deadly honey bee brood disease called American Foulbrood (AFB). AFB is a notifiable epizootic in most countries and, hence, P. larvae is of considerable relevance for veterinarians and apiculturists alike. Over the last decade, much progress has been made in the understanding of the (patho)biology of P. larvae. Recently, several non-ribosomally produced peptides (NRP) and peptide/polyketide (NRP/PK) hybrids produced by P. larvae were identified. Among these NRPs were iturin-like lipopeptides, the paenilarvins A-C. Iturins are known to exhibit strong anti-fungal activity; for some iturins, cytotoxic activity towards mammalian erythrocytes and human cancer cell lines are described. We here present our results on the analysis of the natural function of the paenilarvins during pathogenesis of P. larvae infections. We demonstrated production of paenilarvins in infected larvae. However, we could neither demonstrate cytotoxicity of paenilarvins towards cultured insect cells nor towards larvae in feeding assays. Accordingly, exposure bioassays performed with larvae infected by wild-type P. larvae and a knockout mutant of P. larvae lacking production of paenilarvins did not substantiate a role for the paenilarvins as virulence factor. Further experiments are necessary to analyze the relevance of the paenilarvins' anti-fungal activity for P. larvae infections in the presence of fungal competitors in the larval midgut or cadaver.

  12. Gelatinous plankton is central to the diet of European eel (Anguilla anguilla) larvae in the Sargasso Sea

    DEFF Research Database (Denmark)

    Ayala, Daniel Jiro; Munk, Peter; Lundgreen, Regitze B. C.

    2018-01-01

    endangered species. Next-generation 18S rRNA gene sequencing data of Sargasso Sea eel larvae gut contents and marine snow aggregates was compared with a reference plankton database to assess the trophic relations of eel larvae. Gut contents of A. anguilla larvae were not well explained by the eukaryotic...

  13. Pengaruh ukuran tubuh ikan Poecilia reticulata pada daya pemangsaannya terhadap larva Culex quinquefasciatus

    Directory of Open Access Journals (Sweden)

    Noer Moehammadi

    1999-06-01

    Full Text Available The research aimed to know the influence of poecilia reticulata body size, in the feeding capacity on Culex quinquifasciatus larvae. The research was experimental method with Complete Random Design., each treatment with 5 replications. The taken body size of Poecilia reticulata were; 1,50 cm; 2.50 cm; and 3.50 cm. the size of fish €™s body was measured from the tip of snout up to the end of fin (cm. The feeding capacity was determined by subtracting the first amount of larvae which was given the rest of larvae after 24 hours. The result showed that the difference of size of Poecilia reticulate body was significantly different in the feeding capacity on Culex quinquifasciatus larvae. The fish whose body size was 1.50 cm had the lowest feeding capacity by eating 77.2 larvae for average, and the highest one was the fist which body size was 2.50 cm by eating 113.6 larvae for average, subsequently the feeding capacity decrease to the fish which body size was 3.50 cm because of eating 100,6 larvae for 24 hours.

  14. [Effects of fermented cattle dung on the growth and development of Tenebrio molitor larvae].

    Science.gov (United States)

    Zeng, Xiang-Wei; Wang, Xia; Guo, Li-Yue; Zhan, Li-Jie; Bo, Wen-Jing; Li, Zhan; Wu, Guang-Lei; Jiang, Gao-Ming

    2012-07-01

    In order to make use of and industrialize the animal dung from large cattle farms, this paper explored the feasibility of using Tenebrio molitor to digest and utilize cattle dung. Cattle dung was mixed with the conventional feed (65% wheat bran, 30% corn flour, and 5% bean pulp) of T. molitor in definite proportions, and fermented with effective microorganisms (EM). The fermented products containing 60% and 80% of cattle dung (FD1 and FD2, respectively) were selected to feed T. molitor larvae, and the effects of the fermented products on the growth curve, death rate, pupation rate, and antioxidant system of the larvae were compared. Compared with CK (conventional deed), the FD1 made the developmental duration of the larvae prolonged by 10 days and the larvae's death rate upraised somewhat, but made the single larva's total food intake, average body mass, crude fat content, and ratio of unsaturated to saturated fat acids increased by 49%, 28%, 26%, and 32%, respectively (P molitor larvae had weak adaptability to FD2. Our findings suggested that using FD1 to feed the 3rd instar of T. molitor larvae would have good practical prospects in industrializing cattle dung.

  15. The Effect of Water Content of Medium Containing Oryctes rhinoceros Larvae on Metarhizium anisopliae Pathogenicity

    Directory of Open Access Journals (Sweden)

    Dyah Rini Indriyanti

    2017-08-01

    Full Text Available The entomopathogenic fungus, Metarhizium anisopliae (Metschnikoff Sorokin (Ascomycota: Hypocrealeswould effectively infect the target host on the appropriate medium water content. The aim of this study was to analyze the influence of water content of medium on the effectiveness of M. anisopliae fungus infection on O. rhinoceros larvae in the laboratory. Fifty healthy third instar larvae of O. rhinoceros were  obtained from field. The M. anisopliae obtained from Estate Crop Protection Board in Salatiga. The conidia density and viability of M. anisopliae were examined before used. The medium for maintaining the larva was the sawdust that had been sterilized. A total of 50 plastic cups were prepared to place 50 larvae (1 larva/cup. Each cup was filled with 100 g medium  of sawdust plus 2 g of M. anisopliae which was then stirred until mixed, with different water content: P1 (20%, P2 (40%, P3 (60%, P4 (80% and P5 (98%. The result indicated that  the water content of the medium affected the effectiveness of M. anisopliae fungus infection on O. rhinoceros larvae. The water content influenced the duration of larval mortality at each treatment. An important finding in this study is that controlling O. rhineceros larvae  with M. anisopliae can be done by manipulating the water content of medium. The benefit of this study may be used for the recommendation of O. rhinoceros pest control using M. anisopliae  with an effective water media content.

  16. Behavioural responses of Acroneuria lycoria (Ins. Plecopt. ) Larvae to acute and chronic acid exposure

    Energy Technology Data Exchange (ETDEWEB)

    McNichol, R.E.; Scherer, E.

    1987-01-01

    This study was designed to investigate the responses of a perlid stonefly, Acroneuria lycorias (Newman), to acute and chronic acid exposure. Larvae of this species are common in streams and rivers impacted by acidic precipitation. It is also a suggested standard toxicity test species, which in previous studies has proven to be very sensitive to some toxicants. The effects of acute and chronic acid exposure on the locomotor activity, microdistribution, and drift behaviour of the stonefly larvae were studied in laboratory streams. When subjected to a reduction in pH from 8.1 to 2.5 over an 8-h period, larvae showed little behavioural response down to pH 4.2. As the pH fell to 3.0, head-rubbing activity appeared and increased in frequency. At pH 3.0 and below, larvae showed increased gill-ventilatory movements and locomotor activity. Most larvae died within 14 h of exposure to pH 2.5; however, they did not abandon their preferred refuges before death. Larvae exposed to 5 pH levels between 4.5 and 8.2 for 30-50 d displayed no significant changes in locomotor activity, drift behaviour or microdistribution when compared to control animals. Results indicate that later instar larvae of this species are relatively acid tolerant. 29 refs 4 figs 1 tab

  17. Ecological Factors Determining Abundance of Parasitic Mites on Aedes spp. Larvae

    Directory of Open Access Journals (Sweden)

    Nurhadi Eko Firmansyah

    2017-12-01

    Full Text Available Ability to infestation and abundance of parasitic mites in Aedes spp. larvae cannot be separated from the influence of various factors. Ecological factors have been suggested to play a role determine the presence of parasitic mites that under certain conditions become a key factor in determining the abundance of parasitic mites on Aedes spp. larvae. The aim of this study to determine the ecological factors affect the abundance of parasitic mites on Aedes spp. larvae in Bogor Regency. Capturing of Aedes spp. larvae was performed directly on the habitats found in indoor and outdoor. Capturing mites in the body of Aedes spp. larvae was performed using insect forceps. Ecological factors measured were dissolved oxygen (DO, pH, temperature, and total dissolved solid (TDS. The influence of ecological factors was analyzed using regression and correlation analysis. The result of mite identification has been obtained three species of mites that are Halacarus sp., Histiostoma sp., and Hydrozetes sp. The result indicated that total dissolved solid (TDS and temperature was the factors that determined the abundance of mites. The factors of pH, and dissolved oxygen (DO did not determine the abundance of parasitic mites of Aedes spp. larvae. The research result can be further developed as a new alternative to Dengue Hemorraghic Fever control and provide information on parasitic mites that infest Aedes spp. larvae. In addition, this results become an early step in controlling of Aedes spp. strategy platform by the parasitic mites.

  18. Effectiveness of Metarhizium anisopliae and Entomopathogenic Nematodes to Control Oryctes rhinoceros Larvae in the Rainy Season.

    Science.gov (United States)

    Indriyanti, Dyah Rini; Widiyaningrum, Priyantini; Haryuni; Slamet, Muji; Maretta, Yoris Adi

    2017-01-01

    Metarhizium anisopliae (MET) and entomopathogenic nematodes (EPN) are microorganisms that attack the larvae of Oryctes rhinoceros. The effects of MET, EPN and the combination of both on the O. rhinoceros larvae were studied during the rainy season in Jepara Indonesia. This study aimed to determine the effectiveness of Metarhizium anisopliae and entomopathogenic nematodes to control Oryctes rhinoceros larvae in the rainy season. There were four level doses of MET, four level doses of EPN and four mixture of MET and EPN. The experiment used 72 containers that were placed in the garden with coconut palm shade. Five kilograms of organic soil that was mixed with biological control agents (MET, EPN and MET+EPN) and ten O. rhinoceros larvae 3rd instar were put in each other container. The data were analyzed by descriptive analysis. Every larvae mortality was observed once a week and observations are for 8 weeks. The result showed that the larval mortality due to MET treatment occurred on 2nd-7th week. Meanwhile, the larval mortality due to EPN treatment took place on 2nd-8th weeks and the larval mortality due to MET+EPN treatment occurred on 1st-5th weeks. The combination of MET and EPN was simultaneously effective to control O. rhinoceros larvae than separate use of MET or EPN. Result of this study showed that using two agents of biocontrol was more effective, so that it can be beneficial for controlling O. rhinoceros larvae in the field.

  19. Effects of irradiation on the biology of the infective larvae of Toxocara canis in the mouse

    Energy Technology Data Exchange (ETDEWEB)

    Barriga, O.O.; Myser, W.C.

    1987-02-01

    Mice were infected with either 2000 normal or irradiated embryonated eggs of Toxocara canis and the number of larvae in their livers, lungs, brains, and carcasses investigated at 5, 20, and 33 days of infection. Mortality of mice infected with normal eggs was 33% between day 4 and 8 postinfection but there was no mortality among mice infected with irradiated eggs. Irradiation with 60, 90, or 150 kr of X-rays inhibited the migration of larvae from the livers and lungs and their accumulation in brain and carcass in proportion to the irradiation dose. By day 33 of infection, the ratio of larvae in liver and lungs to larvae in brain and carcass was 0.16 in normal mice, 0.42 in 60-kr mice, 0.98 in 90-kr mice, and 23.3 in 150-kr mice. Irradiated larvae, particularly those migrating through the peritoneal cavity, died faster than normal larvae until day 20. Irradiation favored survival after day 20. By days 20 and 33 postinfection the total parasite load was 29% and 8%, respectively, of the administered dose in control mice, 18% and 12% in 60-kr mice, 8% and 4% in 90-kr mice, and 0.9% and 0.3% in 150-kr mice. Irradiation of infective T. canis larvae, then, reduces their pathogenicity, inhibits their migration from liver and lungs, kills some of the parasites during the first 3 weeks of infection, but favors their late survival in the host.

  20. Seasonal occurrence and abundance of caridean shrimp larvae at Helgoland, German Bight

    Science.gov (United States)

    Wehrtmann, Ingo S.

    1989-03-01

    Plankton samples were collected from January 1985 to January 1986 three times per week at Helgoland to study seasonal occurrence and abundance of caridean shrimp larvae. A total of eleven species were obtained. Ninety-one % of all larvae collected during the sample period belonged to Crangon crangon L. and Crangon allmanni Kinahan, 6% to Philocheras trispinosus Hailstone and 3% to the remaining eight species. Collections were generally dominated by C. crangon larvae. However, C. allmanni larvae were most abundant in June coinciding with hatching activities of the population near Helgoland. C. allmanni was observed to have the highest density of all species with approximately 8 larvae per m3. Larvae of Eualus occultus (Lebour), Eualus pusiolus (Kroyer), Hippolyte varians Leach and Athanas nitescens Leach were most likely released by populations inhabiting the rocky intertidal zone around Helgoland. The presence of Processa modica Williamson & Rochanaburanon and Processa nouveli holthuisi Al-Adhub & Williamson in the German Bight was verified by observations of a series of different developmental stages. Larvae of the rare species Caridion steveni Lebour were also recorded. The observed shrimp species were placed into three different groups with respect to their seasonal occurrence. Possible advantages of the timing of larval dispersal relative to predation and food availability are given. The results on seasonal occurrence and relative abundance are discussed in relation to environmental factors (temperature, salinity) as well as to the geographical distribution of the species.

  1. Direct Effects of Microalgae and Protists on Herring (Clupea harengus Yolk Sac Larvae.

    Directory of Open Access Journals (Sweden)

    Björn Illing

    Full Text Available This study investigated effects of microalgae (Rhodomonas baltica and heterotrophic protists (Oxyrrhis marina on the daily growth, activity, condition and feeding success of Atlantic herring (Clupea harengus larvae from hatch, through the end of the endogenous (yolk sac period. Yolk sac larvae were reared in the presence and absence of microplankton and, each day, groups of larvae were provided access to copepods. Larvae reared with microalgae and protists exhibited precocious (2 days earlier and ≥ 60% increased feeding incidence on copepods compared to larvae reared in only seawater (SW. In the absence and presence of microalgae and protists, life span and growth trajectories of yolk sac larvae were similar and digestive enzyme activity (trypsin and nutritional condition (RNA-DNA ratio markedly declined in all larvae directly after yolk sac depletion. Thus, microplankton promoted early feeding but was not sufficient to alter life span and growth during the yolk sac phase. Given the importance of early feeding, field programs should place greater emphasis on the protozooplankton-ichthyoplankton link to better understand match-mismatch dynamics and bottom-up drivers of year class success in marine fish.

  2. Resistance Detection of Aedes aegypti Larvae to Cypermethrin from Endemic Area in Cimahi City West Java

    Directory of Open Access Journals (Sweden)

    Endang Puji Astuti

    2014-06-01

    Full Text Available Vector control programs using chemical insecticide e.g organochlorin, organophosphate, carbamate, and pyrethroid (cypermethrin. When those insecticides were applied continuously, it may lead to vector resistance. The aim of this research was to detect any resistance of Ae. aegypti to cypermethrin in endemic areas of Cimahi. This research is a laboratory study that used biochemical test which referred to Lee’s method. Larva samples were collected from 8 villages, which are endemic area. Samples of larvae were collected from 15 villages belonged to dengue endemic areas in town of Cimahi, however, villages that meet the availability of larvae were only 8 villages. To detect the activity of monooxygenase enzyme, a biochemical assay was used in this research by created a reaction between larvae homogenate and sodium acetate substrate. The results of reaction were read using ELISA reader with spectrophotometer wave length of 595 nm. Overall, the results showed that most of the larvae in eight villages of Cimahi is still susceptible to cypermethrin. However, larvae from Cibabat village were 4% resistant, 2% tolerant, and 94% susceptible. On the other hand, Cigugur village showed that 12.7% larvae were tolerant and 87.3% still susceptible. Other villages like Cimahi, Cibeureum, Melong, Baros, Cipageran, and Pasirkaliki still remains susceptible. Resistance detection using biochemical assay of cypermethrin insecticide for Ae.aegypti resulting data stated that in 6 villages were still susceptible but in 3 other villages were already tolerant and 1 village was already resistance.

  3. Larvacidal Effect of Imperata Cylindrical Root Decoction against Culex sp. Larvae

    Directory of Open Access Journals (Sweden)

    Afini Tiara Resi

    2014-08-01

    Full Text Available Background: Filariasis is one of the neglected tropical diseases. About 337 of 401 districts in Indonesia are endemic areas for filariasis, especially in Sumatera, Kalimantan, and Papua. Culex sp. is one of the lymphatic filariasis vectors which can be controlled by insecticide, including larvacide. This study was conducted to determine the larvacidal effect of Imperata cylindrical root decoction against Culex sp. larvae. Methods: This study was conducted at the Laboratory of Parasitology, Faculty of Medicine, Universitas Padjadjaran during the period of September to November 2012. The study object was Culex sp. larvae III/IV instars. The design of this study was experimental laboratory using true experimental approach. The larvae were divided into three groups: negative control (distilled water, reference (Abate®, and decoction. The number of larvae in each group was 25 larvae, and the effects were evaluated by the total number of dead larvae in 48 hours under observation. The data were then analyzed by Mann-Whitney test and Probit test. Results: The result of the Mann-Whitney test to compare Imperata cylindrica root decoction treatment to distilled water as control was significant (p<0.05. However, Abate® gave a better result. The Probit test resultwas LC50: 63% and LC90: 489%. Conclusions: Imperata cylindrical root decoction has a larvacidal effect against Culex sp. larvae.

  4. Studies on immunization with irradiated larvae against dictyocaulus filaria in guinea-pigs

    International Nuclear Information System (INIS)

    Akyol, F.; Cerci, H.; Duzgun, A.

    1986-01-01

    In this study, 32 guinea-pigs were immunized orally with two doses of infective D. filaria attenuated by exposure to 40 krad (group I) and 50 krad (group II) of Cs-137 source at 15 days interval. The first dose was administrated as 1000 larvae and the second was 2000 larvae. After 15 days of the second infection they were challenged with 5000 non-irradiated infective larvae. Eight guinea-pigs were used as control (group III). The control group received the challenge only. The controls developed signs of lungworm disease and 3 animals died after 10 days of challenge. The vaccinated animals showed no clinical signs. All of the surviving animals were killed 12 days after challenge and their lungs were carefully examined for detailed parasitological and pathomorphological examinations. At autopsy, an average of 91 worms was recovered from the lungs of control groups. Four worms recovered from animals given larvae irradiated at 40 krad and the pathological changes were the lightest in this group. It was established that gamma rays at 50 krad attenuated infective larvae of D. filaria to such a degree that their administration did not cause any serious pathomorphological effect in the lungs of the animals. A higher degree of protection against challenge with infective D. filaria larvae was confered on the guinea-pigs by double dose of irradiated larvae. (auhtor)

  5. A new procedure for marinating fresh anchovies and ensuring the rapid destruction of Anisakis larvae.

    Science.gov (United States)

    Sánchez-Monsalvez, I; de Armas-Serra, C; Martínez, J; Dorado, M; Sánchez, A; Rodríguez-Caabeiro, F

    2005-05-01

    The consumption of marinated anchovies is the main route of transmission of anisakiasis in Spain. Because this country is one of the world's major tourist destinations, this traditional food also poses a potential health risk to millions of foreign visitors. Anisakis larvae are not destroyed by the traditional marinating procedure, and alternative methods, such as long-term storage in brine, freezing, or hydrostatic pressure treatment, all present major difficulties. In this study, we used high food-grade acetic acid concentrations (10, 20, 30, and 40% [vol/vol] in line with the quantum satis rule) to destroy these larvae rapidly, and we report data on the survival of Anisakis larvae exposed directly to different marinades and when the larvae are placed under the fish musculature. The percentage of salt and acetic acid in the fish tissue water phase was also determined. A marinating procedure is proposed that ensures the rapid death of Anisakis through the use of strong acetic acid concentrations. Posttreatment washes with water reduce these to levels acceptable to consumers. The sensory characteristics of the product were shown to be satisfactory. The actual selection of an acetic acid concentration for marinating depends on costs and the processing time available. The physiological stress of the larvae exposed to the different marinades was determined by measuring the levels of their stress proteins. The latter are good indicators of injury and might reflect the infectivity of larvae. In addition, we also used a rat model to determine the infectivity of larvae considered microscopically dead.

  6. Direct Effects of Microalgae and Protists on Herring (Clupea harengus) Yolk Sac Larvae.

    Science.gov (United States)

    Illing, Björn; Moyano, Marta; Niemax, Jan; Peck, Myron A

    2015-01-01

    This study investigated effects of microalgae (Rhodomonas baltica) and heterotrophic protists (Oxyrrhis marina) on the daily growth, activity, condition and feeding success of Atlantic herring (Clupea harengus) larvae from hatch, through the end of the endogenous (yolk sac) period. Yolk sac larvae were reared in the presence and absence of microplankton and, each day, groups of larvae were provided access to copepods. Larvae reared with microalgae and protists exhibited precocious (2 days earlier) and ≥ 60% increased feeding incidence on copepods compared to larvae reared in only seawater (SW). In the absence and presence of microalgae and protists, life span and growth trajectories of yolk sac larvae were similar and digestive enzyme activity (trypsin) and nutritional condition (RNA-DNA ratio) markedly declined in all larvae directly after yolk sac depletion. Thus, microplankton promoted early feeding but was not sufficient to alter life span and growth during the yolk sac phase. Given the importance of early feeding, field programs should place greater emphasis on the protozooplankton-ichthyoplankton link to better understand match-mismatch dynamics and bottom-up drivers of year class success in marine fish.

  7. Initial characterization of receptors for molecules that induce the settlement and metamorphosis of Haliotis rufescens larvae

    International Nuclear Information System (INIS)

    Trapido-Rosenthal, H.G.

    1985-01-01

    Larvae of the marine gastropod mollusc Haliotis refescens are induced to undergo metamorphosis by γ-aminobutyric acid (GABA) and stereochemically related compounds. The most potent of these inducers is (-)-β-(parachlorophenyl)-GABA (baclofen). The inductive response exhibits positive cooperatively, and is subject to both facilitation (up-regulation) and habituation (down-regulation). Facilitation is brought about by diamino acids such as L-diaminopropionic acid (L-DAPA), and is characterized by decreased Hill coefficients (n/sub H/) and concentration requirements (EC 50 ) for inducers. Facilitation does not require the simultaneous presence of facilitating and inducing compounds, and the facilitated state is persistent. Larvae are capable of being up-regulated 2 days before they are capable of undergoing settlement and metamorphosis. Habituation can be brought about by exposure of pre-competent larvae to GABA 4 days prior to the attainment of competence; it is then slowly reversible. Larvae specifically bind tritiated (-)-baclofen in a manner that is saturable with both increasing time of exposure of larvae to, and with increasing concentration of, this compound. Specific binding can be competed for by unlabeled GABA-mimetic inducing molecules; the order of effectiveness of these molecules as competitors for specific binding correlates well with their effectiveness as inducers of metamorphosis. Facilitation of larvae by exposure to diamino acids does not alter their specific binding of tritiated (-)-baclofen. It is concluded from these findings that Haliotis larvae possess receptors for GABA-mimetic compounds

  8. Predator response to releases of American shad larvae in the Susquehanna River basin

    Science.gov (United States)

    Johnson, James H.; Ringler, N.H.

    1998-01-01

    Predation on American shad (Alosa sapidissima) larvae within the first two hours of release was examined from 1989 to 1992 on 31 occasions at stocking sites in the Susquehanna River basin. Twenty-two fish species consumed shad larvae; the dominant predators were spotfin shiner (Cyprinella spiloptera), mimic shiner (Notropis volucellus) and juvenile smallmouth bass (Micropterus dolomieu). The number of shad larvae found in predator stomachs ranged from 0 to 900. Mortality of shad larvae at the stocking site was usually less than 2%. The greatest mortality (9.6%) occurred at the highest stocking level (1.5 million larvae). Highly variable predation rates and release levels of shad insufficient to achieve predator satiation hindered the ability to determine a specific type of functional response of predators. Predator numbers increased with stocking density, indicating short-term aggregation at the release site. Because of practical problems associated with releasing the large numbers of larvae that would be required to satiate predators, routine stocking at these levels is probably unreasonable. Releases of 400,000 to 700,000 larvae may reduce predation by offsetting depensatory mechanisms that operate on small releases and the effects of increased predation due to predator aggregation on large releases. Night stocking may reduce predation on larval shad at the release site.

  9. Inclusion of copepod Acartia tonsa nauplii in the feeding of Centropomus undecimalis larvae increases stress resistance

    Directory of Open Access Journals (Sweden)

    Wanessa de Melo-Costa

    2015-09-01

    Full Text Available This research represents the first result of studies of the common snook Centropomus undecimalis larvae from broodstock matured in captivity in Brazil. The aim of this study was to evaluate if the inclusion of Acartia tonsa nauplii improves stress resistance of common snook larvae. The larvae were fed with: rotifers Brachionus plicatilis (10 to 15 mL-1; A. tonsa nauplii (0.25 to 0.5 mL-1 and rotifers (5 to 7.5 mL-1, and A. tonsa nauplii (0.12 to 0.25 mL-1. The average percentage of survival of the treatments was 11.9%. At 20 days of age, larvae were subjected to thermal stress. Subsequently, the stress resistance was evaluated. Common snook larvae fed B. plicatilis+A. tonsa reached a higher weight and length (7.5 ± 0.00 mg and 9.1 ± 0.23 mm, respectively and resisted more heat stress (87.4% than larvae fed other foods, indicating that the feed mixture is satisfactory as a starter diet for larvae of common snook. However, more research is needed to confirm these results.

  10. Successful determination of larval dispersal distances and subsequent settlement for long-lived pelagic larvae.

    Directory of Open Access Journals (Sweden)

    Pelayo Salinas-de-León

    Full Text Available Despite its importance, we still have a poor understanding of the level of connectivity between marine populations in most geographical locations. Taking advantage of the natural features of the southeast coast of New Zealand's North Island, we deployed a series of settlement stations and conducted plankton tows to capture recent settlers and planktonic larvae of the common intertidal gastropod Austrolittorina cincta (6-8 week larval period. Satellite image analysis and ground truthing surveys revealed the absence of suitable intertidal rocky shore habitat for A. cincta over a 100 km stretch of coastline between Kapiti Island to the south and Wanganui to the north. Fifteen settlement stations (3 replicates × 5 sites, which were used to mimic intertidal habitat suitable for A. cincta, were deployed for two months around and north of Kapiti Island (at 0.5, 1, 5, 15, 50 km. In addition, we also conducted plankton tows at each settlement station when the stations were first deployed to collect A. cincta larvae in the water column. On collection, all newly settled gastropods and larvae in the plankton samples were individually isolated, and a species-specific microsatellite marker was used to positively identify A. cincta individuals. Most of the positively identified A. cincta settlers and larvae were collected at the first three sampling stations (<5 km. However, low numbers of A. cincta settlers and larvae were also recorded at the two more distant locations (15 and 50 km. Dispersal curves modeled from our data suggested that <1% of gastropod larvae would travel more than 100 km. While our data show that most larvae are retained close to their natal populations (<5 km, a small proportion of larvae are able to travel much larger geographic distances. Our estimates of larval dispersal and subsequent settlement are one of only a few for marine species with a long-lived larva.

  11. Responses of the metabolism of the larvae of Pocillopora damicornis to ocean acidification and warming.

    Directory of Open Access Journals (Sweden)

    Emily B Rivest

    Full Text Available Ocean acidification and warming are expected to threaten the persistence of tropical coral reef ecosystems. As coral reefs face multiple stressors, the distribution and abundance of corals will depend on the successful dispersal and settlement of coral larvae under changing environmental conditions. To explore this scenario, we used metabolic rate, at holobiont and molecular levels, as an index for assessing the physiological plasticity of Pocillopora damicornis larvae from this site to conditions of ocean acidity and warming. Larvae were incubated for 6 hours in seawater containing combinations of CO2 concentration (450 and 950 µatm and temperature (28 and 30°C. Rates of larval oxygen consumption were higher at elevated temperatures. In contrast, high CO2 levels elicited depressed metabolic rates, especially for larvae released later in the spawning period. Rates of citrate synthase, a rate-limiting enzyme in aerobic metabolism, suggested a biochemical limit for increasing oxidative capacity in coral larvae in a warming, acidifying ocean. Biological responses were also compared between larvae released from adult colonies on the same day (cohorts. The metabolic physiology of Pocillopora damicornis larvae varied significantly by day of release. Additionally, we used environmental data collected on a reef in Moorea, French Polynesia to provide information about what adult corals and larvae may currently experience in the field. An autonomous pH sensor provided a continuous time series of pH on the natal fringing reef. In February/March, 2011, pH values averaged 8.075 ± 0.023. Our results suggest that without adaptation or acclimatization, only a portion of naïve Pocillopora damicornis larvae may have suitable metabolic phenotypes for maintaining function and fitness in an end-of-the century ocean.

  12. Natural variation in gene expression in the early development of dauer larvae of Caenorhabditis elegans

    Directory of Open Access Journals (Sweden)

    Barker Gary LA

    2009-07-01

    Full Text Available Abstract Background The free-living nematode Caenorhabditis elegans makes a developmental decision based on environmental conditions: larvae either arrest as dauer larva, or continue development into reproductive adults. There is natural variation among C. elegans lines in the sensitivity of this decision to environmental conditions; that is, there is variation in the phenotypic plasticity of dauer larva development. We hypothesised that these differences may be transcriptionally controlled in early stage larvae. We investigated this by microarray analysis of different C. elegans lines under different environmental conditions, specifically the presence and absence of dauer larva-inducing pheromone. Results There were substantial transcriptional differences between four C. elegans lines under the same environmental conditions. The expression of approximately 2,000 genes differed between genetically different lines, with each line showing a largely line-specific transcriptional profile. The expression of genes that are markers of larval moulting suggested that the lines may be developing at different rates. The expression of a total of 89 genes was putatively affected by dauer larva or non-dauer larva-inducing conditions. Among the upstream regions of these genes there was an over-representation of DAF-16-binding motifs. Conclusion Under the same environmental conditions genetically different lines of C. elegans had substantial transcriptional differences. This variation may be due to differences in the developmental rates of the lines. Different environmental conditions had a rather smaller effect on transcription. The preponderance of DAF-16-binding motifs upstream of these genes was consistent with these genes playing a key role in the decision between development into dauer or into non-dauer larvae. There was little overlap between the genes whose expression was affected by environmental conditions and previously identified loci involved in

  13. DISTRIBUSI, KELIMPAHAN DAN VARIASI UKURAN LARVA IKAN DI ESTUARIA SUNGAI MUSI

    Directory of Open Access Journals (Sweden)

    Eko Prianto

    2016-03-01

    Full Text Available Penelitian tentang distribusi, kelimpahan dan ukuran larva ikan dilakukan pada bulan Maret, Mei, Juni dan Oktober 2011. Stasiun pengambilan contoh meliputi Muara Delta Upang (stasiun 1, Muara Sungai Musi (stasiun 2 dan Pulau Payung (stasiun 3. Pengambilan larva pada siang hari menggunakan Bongo net yang berukuran mata jaring 250 µm. Hasil identifikasi diperoleh 13 famili ditinjau menurut musim, pada bulan Mei dan Oktober masing-masing diperoleh 7 famili, dan pada bulan juni sebanyak 3 famili. Kelimpahan larva ikan berkisar antara 9-46 ind/m3 dengan jumlah yang tertinggi (46 ind/m3 pada bulan Mei dan terendah pada bulan Juni (9 ind/m3. Larva ikan dari famili Gobiidae memiliki sebaran yang cukup luas baik spasial maupun temporal. Variasi ukuran larva ikan menurut famili setiap bulannya memiliki variasi ukuran yang hampir sama.  Research about the distribution, abundance and size of fish larvae was conducted in March, May, June and October 2011. Sampling stations encompasses Delta Upang (station 1, Muara Sungai Musi (station 2 and Pulau Payung (station 3. Larvae taken during the daytime using a Bongo net with mesh size of 250 µm. Identification results obtained 13 families based on the season, in May and October respectively 7 families, and in June as many as 3 families. Abundance of fish larval around 9-46 ind/m3 with the highest number (46 ind/m3 in May and the lowest in June (9 ind/m3. Larvae of Gobiidae family have a large distribution on spatial and temporal. The variation in size of fish larvae by family on each month are the same.

  14. Color variability and body size of larvae of two Epomis species (Coleoptera: Carabidae in Israel

    Directory of Open Access Journals (Sweden)

    Gil Wizen

    2011-07-01

    Full Text Available Species identification using the characteristics of developmental stages is challenging. However, for insect taxonomy the coloration of larval stages can be an informative feature. The use of live specimens is recommended for this because the color fades in preserved specimens. In this study we examine the possibility of using variation in coloration and color pattern of larvae in order to distinguish between two ground beetles species Epomis dejeani Dejean, 1831 and E. circumscriptus Duftschmid, 1812. We present an atlas and describe the coloration and body size of the three larval stages of the above species based on live specimens. The first instar larvae of the two Epomis species can be easily distinguished based on their color. From the second instar on, the variability in coloration and color patterns increases, creating an overlap in these attributes between larvae of the two species. Except for minor differences in color of the antennae and the base of the mandibles, larvae of the two species are indistinguishable at the second and third larval stages. To the best of our knowledge this is the first attempt to use variation in coloration and color pattern in live larvae in order to identify coleopterans. The color atlas of the larvae enables simple separation of the two Epomis species without requiring sophisticated magnifying devices, although it is less straightforward at the second and third larval stages. We found similar body lengths between the two species for all developmental stages, except for third instar larvae prior to pupation. In the two species the difference in larval body length before pupation positively correlated with that of the adult beetles. More than 70% of the adults' length can be explained by the length of the late third-instar larva; i.e. the large larvae develop into large adults. The larger specimens are the females.

  15. Metal concentrations in Japanese medaka, mosquitofish and insect larvae living in uncontaminated rivers in Kumamoto, Japan

    International Nuclear Information System (INIS)

    Momoshima, N.; Toyoshima, T.; Matsushita, R.; Fukuda, A.; Hibino, K.

    2007-01-01

    Elemental concentrations in Japanese medaka and mosquitofish collected from uncontaminated rivers in Kumamoto, Japan were analyzed by instrumental neutron activation analysis with k 0 standardization method to know the background levels. A statistical analysis indicated the difference in metal concentrations among rivers and species. Background levels of elemental concentrations in some aquatic insect larvae were analyzed and metal concentrations were different among species, though they were collected at the same point. Enrichment factors of heavy metals in insect larvae were in the order of 10 3 -10 4 suggesting effectiveness of insect larvae as bioindicator. (author)

  16. Acute intestinal anisakiasis in Spain: a fourth-stage Anisakis simplex larva

    Directory of Open Access Journals (Sweden)

    Mª José Rosales

    1999-11-01

    Full Text Available A case of acute intestinal anisakiasis has been reported; a nematode larva being found in the submucosa of the ileum of a woman in Jaén (Spain. The source of infection was the ingestion of raw Engraulis encrasicholus. On the basis of its morphology, the worm has been identified as a fourth-stage larva of Anisakis simplex. In Spain, this is the ninth report of human anisakiasis and also probably the first case of anisakiasis caused by a fourth-stage larva of A. simplex.

  17. Comparative susceptibility of veliger larvae of four bivalve mollusks to a Vibrio alginolyticus strain.

    Science.gov (United States)

    Luna-González, A; Maeda-Martínez, A N; Sainz, J C; Ascencio-Valle, F

    2002-06-03

    The susceptibility of 7 d old veliger larvae of the scallops Argopecten ventricosus and Nodipecten subnodosus, the penshell Atrina maura, and the Pacific oyster Crassostrea gigas to a pathogenic strain of Vibrio alginolyticus was investigated by challenging the larvae with different bacterial concentrations in a semi-static assay. The results indicate that the larvae of the 2 scallop species are more susceptible to the V. alginolyticus strain than those of the oyster and the penshell. Signs of the disease were similar to bacillary necrosis described in previous work. Interspecies differences in susceptibility to pathogens are discussed.

  18. Identification of entomopathogenic Bacillus isolated from Simulium (Diptera, Simuliidae larvae and adults

    Directory of Open Access Journals (Sweden)

    Cavados CFG

    2001-01-01

    Full Text Available Entomopathogenic bacteria isolated from Simulium larvae and adults from breeding sites in the states of São Paulo and Rio de Janeiro, Brazil, were identified as 18 strains of Bacillus thuringiensis and one of B. sphaericus. Most of these strains were serotyped according to their flagellar antigens. However, nine of the B. thuringiensis samples, could not be serotyped and were designated as "autoagglutinating"; they were also shown to be toxic in preliminary tests against Aedes aegypti larvae. Additionally, B. sphaericus was also shown to be toxic towards Culex quinquefasciatus larvae.

  19. Habitat stability and occurrences of malaria vector larvae in western Kenya highlands

    Directory of Open Access Journals (Sweden)

    Atieli Harrysone

    2009-10-01

    Full Text Available Abstract Background Although the occurrence of malaria vector larvae in the valleys of western Kenya highlands is well documented, knowledge of larval habitats in the uphill sites is lacking. Given that most inhabitants of the highlands actually dwell in the uphill regions, it is important to develop understanding of mosquito breeding habitat stability in these sites in order to determine their potential for larval control. Methods A total of 128 potential larval habitats were identified in hilltops and along the seasonal streams in the Sigalagala area of Kakamega district, western Kenya. Water availability in the habitats was followed up daily from August 3, 2006 to February 23, 2007. A habitat is defined as stable when it remains aquatic continuously for at least 12 d. Mosquito larvae were observed weekly. Frequencies of aquatic, stable and larvae positive habitats were compared between the hilltop and seasonal stream area using χ2-test. Factors affecting the presence/absence of Anopheles gambiae larvae in the highlands were determined using multiple logistic regression analysis. Results Topography significantly affected habitat availability and stability. The occurrence of aquatic habitats in the hilltop was more sporadic than in the stream area. The percentage of habitat occurrences that were classified as stable during the rainy season is 48.76% and 80.79% respectively for the hilltop and stream area. Corresponding frequencies of larvae positive habitats were 0% in the hilltop and 5.91% in the stream area. After the rainy season, only 23.42% of habitat occurrences were stable and 0.01% larvae positive habitats were found in the hilltops, whereas 89.75% of occurrences remained stable in the stream area resulting in a frequency of 12.21% larvae positive habitats. The logistic regression analysis confirmed the association between habitat stability and larval occurrence and indicated that habitat surface area was negatively affecting the

  20. Toxicity of Buprofezin on the Survival of Embryo and Larvae of African Catfish, Clarias gariepinus (Bloch)

    OpenAIRE

    Marimuthu, Kasi; Muthu, Narmataa; Xavier, Rathinam; Arockiaraj, Jesu; Rahman, M. Aminur; Subramaniam, Sreeramanan

    2013-01-01

    Buprofezin is an insect growth regulator and widely used insecticide in Malaysia. The present study evaluated the toxic effects of buprofezin on the embryo and larvae of African catfish (Clarias gariepinus) as a model organism. The embryos and larvae were exposed to 7 different concentrations (0, 0.05, 0.5, 5, 25, 50 and 100 mg/L) of buprofezin. Each concentration was assessed in five replicates. Eggs were artificially fertilized and 200 eggs and larvae were subjected to a static bath treatme...

  1. BIOLARVASIDA EKSTRAK ETANOL KULIT NANAS (Ananas comosus L. Merr TERHADAP LARVA NYAMUK Culex Sp.

    Directory of Open Access Journals (Sweden)

    Siti Juariah

    2017-10-01

    Full Text Available ABSTRAK   Nanas merupakan salah satu komoditi asal Provinsi Riau. Setiap tahun nanas mengalami peningkatan dengan semakin meningkatnya produksi nanas maka limbah yang dihasilkan akan semakin meningkat. Pada limbah kulit nanas diduga terdapat senyawa alkaloid yang dapat membunuh larva nyamuk Culex Sp. Nyamuk yang termasuk dalam genus Culex dikenal sebagai vektor penular arbovirus, demam kaki gajah, dan malaria pada unggas. Pengendalian serangga umumnya dilakukan menggunakan pestisida sintetik. Penggunaan senyawa kimia yang bersifat sintetik sangat berbahaya bagi pengguna yang terpajan. Tujuan dari penelitian ini adalah untuk menentukan efektifitas ekstrak etanol kulit nanas dan mengetahui jumlah larva yang mati dengan menentukan konsentrasi terbaik dari ekstrak etanol kulit nanas (AnanascomosusL. terhadap larva nyamuk culex Sp. Penelitian ini bersifat Eksperimen Laboratory, yaitu meneliti tentang uji mortalitas larva nyamuk Culex Sp setelah pemberian ekstrak etanol kulit nanas (AnanascomosusL.. Hasil penelitian yang didapatkan bahwa ekstrak etanol kulit nanas dapat dibuktikan pada tingkat konsentrasi 1% angka kematian larva nyamuk telah mencapai 72,5%. Sedangkan pada konsentrasi 4% telah mampu membunuh larva sebesar 97,5%. Kata Kunci        : Ekstraketanol, Kulit nanas, Culex Sp.   ABSTRACT                Pineapple is one of the commodities origin of Riau Province. Each year the pineapple increases with the increasing production of pineapple so the waste generated will increase. In pineapple leaf waste is suspected of alkaloid compounds that can kill the mosquito larvae Culex Sp. The mosquitoes belonging to the genus Culex are known as arbovirus-transmitting vectors, elephant leg fever, and malaria in poultry. Insect control is generally done using synthetic pesticides. The use of synthetic chemicals is very dangerous for exposed users. The purpose of this study was to determine the effectiveness of pineapple ethanol

  2. Modulation of nutrient composition of black soldier fly (Hermetia illucens) larvae by feeding seaweed-enriched media.

    Science.gov (United States)

    Liland, Nina S; Biancarosa, Irene; Araujo, Pedro; Biemans, Daan; Bruckner, Christian G; Waagbø, Rune; Torstensen, Bente E; Lock, Erik-Jan

    2017-01-01

    Black soldier fly (Hermetia illucens) larvae are a promising source of protein and lipid for animal feeds. The nutritional composition of the BSF larvae depend partly on the composition of the feeding medium. The BSF lipid profile in part mimics the feeding media lipid profile, and micronutrients, like minerals and vitamins, can readily accumulate in black soldier fly larvae. However, investigative studies on bioconversion and accumulation of nutrients from media to black soldier fly larvae are scarce. Here we show that inclusion of the brown algae Ascophyllum nodosum in the substrate for black soldier fly larvae can introduce valuable nutrients, commonly associated with the marine environment, into the larvae. The omega-3 fatty acid eicosapentaenoic acid (20:5n-3), iodine and vitamin E concentrations increased in the larvae when more seaweed was included in the diet. When the feeding media consisted of more than 50% seaweed, the larvae experienced poorer growth, lower nutrient retention and lower lipid levels, compared to a pure plant based feeding medium. Our results confirm the plasticity of the nutritional make-up of black soldier fly larvae, allowing it to accumulate both lipid- and water-soluble compounds. A broader understanding of the effect of the composition of the feeding media on the larvae composition can help to tailor black soldier fly larvae into a nutrient profile more suited for specific feed or food purposes.

  3. Modulation of nutrient composition of black soldier fly (Hermetia illucens larvae by feeding seaweed-enriched media.

    Directory of Open Access Journals (Sweden)

    Nina S Liland

    Full Text Available Black soldier fly (Hermetia illucens larvae are a promising source of protein and lipid for animal feeds. The nutritional composition of the BSF larvae depend partly on the composition of the feeding medium. The BSF lipid profile in part mimics the feeding media lipid profile, and micronutrients, like minerals and vitamins, can readily accumulate in black soldier fly larvae. However, investigative studies on bioconversion and accumulation of nutrients from media to black soldier fly larvae are scarce. Here we show that inclusion of the brown algae Ascophyllum nodosum in the substrate for black soldier fly larvae can introduce valuable nutrients, commonly associated with the marine environment, into the larvae. The omega-3 fatty acid eicosapentaenoic acid (20:5n-3, iodine and vitamin E concentrations increased in the larvae when more seaweed was included in the diet. When the feeding media consisted of more than 50% seaweed, the larvae experienced poorer growth, lower nutrient retention and lower lipid levels, compared to a pure plant based feeding medium. Our results confirm the plasticity of the nutritional make-up of black soldier fly larvae, allowing it to accumulate both lipid- and water-soluble compounds. A broader understanding of the effect of the composition of the feeding media on the larvae composition can help to tailor black soldier fly larvae into a nutrient profile more suited for specific feed or food purposes.

  4. Reduction of Escherichia coli, Salmonella Enteritidis and Campylobacter jejuni in poultry manure by rearing of Musca domestica fly larvae

    DEFF Research Database (Denmark)

    Nordentoft, Steen; Fischer, C.; Bjerrum, L.

    2017-01-01

    A major barrier for using animal waste as substrate for production of insects for feed or food is the concern for safety of the end products. In this study we investigated how rearing of fly larvae of Musca domestica in poultry manure influenced the counts of three pathogenic test strains...... of the larvae stage. This study provides data for evaluation of feed safety of fly larvae reared on animal waste. Furthermore suggests a potential use for reduction of these pathogens in manure........ Enteritidis, and C. jejuni was faster in manure with rearing of fly larvae than in manure without larvae; an 8 log10 reduction of all three test bacteria was observed within four days in manure with larvae; compared to manure without larvae where a 1 to 2 log10 was observed. We found no sign of propagation...

  5. Toxic effects of silica nanoparticles on zebrafish embryos and larvae.

    Directory of Open Access Journals (Sweden)

    Junchao Duan

    Full Text Available Silica nanoparticles (SiNPs have been widely used in biomedical and biotechnological applications. Environmental exposure to nanomaterials is inevitable as they become part of our daily life. Therefore, it is necessary to investigate the possible toxic effects of SiNPs exposure. In this study, zebrafish embryos were treated with SiNPs (25, 50, 100, 200 µg/mL during 4-96 hours post fertilization (hpf. Mortality, hatching rate, malformation and whole-embryo cellular death were detected. We also measured the larval behavior to analyze whether SiNPs had adverse effects on larvae locomotor activity. The results showed that as the exposure dosages increasing, the hatching rate of zebrafish embryos was decreased while the mortality and cell death were increased. Exposure to SiNPs caused embryonic malformations, including pericardial edema, yolk sac edema, tail and head malformation. The larval behavior testing showed that the total swimming distance was decreased in a dose-dependent manner. The lower dose (25 and 50 µg/mL SiNPs produced substantial hyperactivity while the higher doses (100 and 200 µg/mL SiNPs elicited remarkably hypoactivity in dark periods. In summary, our data indicated that SiNPs caused embryonic developmental toxicity, resulted in persistent effects on larval behavior.

  6. A digestive prolyl carboxypeptidase in Tenebrio molitor larvae.

    Science.gov (United States)

    Goptar, Irina A; Shagin, Dmitry A; Shagina, Irina A; Mudrik, Elena S; Smirnova, Yulia A; Zhuzhikov, Dmitry P; Belozersky, Mikhail A; Dunaevsky, Yakov E; Oppert, Brenda; Filippova, Irina Yu; Elpidina, Elena N

    2013-06-01

    Prolyl carboxypeptidase (PRCP) is a lysosomal proline specific serine peptidase that also plays a vital role in the regulation of physiological processes in mammals. In this report, we isolate and characterize the first PRCP in an insect. PRCP was purified from the anterior midgut of larvae of a stored product pest, Tenebrio molitor, using a three-step chromatography strategy, and it was determined that the purified enzyme was a dimer. The cDNA of PRCP was cloned and sequenced, and the predicted protein was identical to the proteomic sequences of the purified enzyme. The substrate specificity and kinetic parameters of the enzyme were determined. The T. molitor PRCP participates in the hydrolysis of the insect's major dietary proteins, gliadins, and is the first PRCP to be ascribed a digestive function. Our collective data suggest that the evolutionary enrichment of the digestive peptidase complex in insects with an area of acidic to neutral pH in the midgut is a result of the incorporation of lysosomal peptidases, including PRCP. Published by Elsevier Ltd.

  7. Persistence of host response against glochidia larvae in Micropterus salmoides.

    Science.gov (United States)

    Dodd, Benjamin J; Barnhart, M Christopher; Rogers-Lowery, Constance L; Fobian, Todd B; Dimock, Ronald V

    2006-11-01

    Host fish acquire resistance to the parasitic larvae (glochidia) of freshwater mussels (Unionidae). Glochidia metamorphose into juvenile mussels while encysted on host fish. We investigated the duration of acquired resistance of largemouth bass, Micropterus salmoides (Lacepède, 1802) to glochidia of the broken rays mussel, Lampsilis reeveiana (Call, 1887). Fish received three successive priming infections with glochidia to induce an immune response. Primed fish were held at 22-23 degrees C and were challenged (re-infected) at intervals after priming. Metamorphosis success was quantified as the percent of attached glochidia that metamorphosed to the juvenile stage and were recovered alive. Metamorphosis success at 3, 7, and 12 months after priming was significantly lower on primed fish (26%, 40%, and 68% respectively) than on control fish (85%, 93%, and 92% respectively). A second group of largemouth bass was similarly primed and blood was extracted. Immunoblotting was used to detect host serum antibodies to L. reeveiana glochidia proteins. Serum antibodies were evident in primed fish, but not in naive control fish. Acquired resistance of host fish potentially affects natural reproduction and artificial propagation of unionids, many of which are of conservation concern.

  8. Zebrafish Axenic Larvae Colonization with Human Intestinal Microbiota.

    Science.gov (United States)

    Arias-Jayo, Nerea; Alonso-Saez, Laura; Ramirez-Garcia, Andoni; Pardo, Miguel A

    2018-04-01

    The human intestine hosts a vast and complex microbial community that is vital for maintaining several functions related with host health. The processes that determine the gut microbiome composition are poorly understood, being the interaction between species, the external environment, and the relationship with the host the most feasible. Animal models offer the opportunity to understand the interactions between the host and the microbiota. There are different gnotobiotic mice or rat models colonized with the human microbiota, however, to our knowledge, there are no reports on the colonization of germ-free zebrafish with a complex human intestinal microbiota. In the present study, we have successfully colonized 5 days postfertilization germ-free zebrafish larvae with the human intestinal microbiota previously extracted from a donor and analyzed by high-throughput sequencing the composition of the transferred microbial communities that established inside the zebrafish gut. Thus, we describe for first time which human bacteria phylotypes are able to colonize the zebrafish digestive tract. Species with relevant interest because of their linkage to dysbiosis in different human diseases, such as Akkermansia muciniphila, Eubacterium rectale, Faecalibacterium prausnitzii, Prevotella spp., or Roseburia spp. have been successfully transferred inside the zebrafish digestive tract.

  9. MRI findings of spinal visceral larva migrans of Toxocara canis

    Energy Technology Data Exchange (ETDEWEB)

    Lee, In Ho, E-mail: leeinho1974@hanmail.ne [Department of Radiology and Center for Imaging Science, Samsung Medical Center, Sungkyunkwan University School of Medicine, 50 Ilwon-dong, Gangnam-Gu, Seoul 135-710 (Korea, Republic of); Department of Radiology, Chungnam National University Hospital, 33 Munhwa-ro, Jung-gu, Daejeon 301-721 (Korea, Republic of); Kim, Sung Tae, E-mail: st7.kim@hotmail.co [Department of Radiology and Center for Imaging Science, Samsung Medical Center, Sungkyunkwan University School of Medicine, 50 Ilwon-dong, Gangnam-Gu, Seoul 135-710 (Korea, Republic of); Oh, Dae Kun, E-mail: odk6464@nate.co [Department of Radiology and Center for Imaging Science, Samsung Medical Center, Sungkyunkwan University School of Medicine, 50 Ilwon-dong, Gangnam-Gu, Seoul 135-710 (Korea, Republic of); Kim, Hyung-Jin, E-mail: hyungkim@skku.ed [Department of Radiology and Center for Imaging Science, Samsung Medical Center, Sungkyunkwan University School of Medicine, 50 Ilwon-dong, Gangnam-Gu, Seoul 135-710 (Korea, Republic of); Kim, Keon Ha, E-mail: somatom@skku.ed [Department of Radiology and Center for Imaging Science, Samsung Medical Center, Sungkyunkwan University School of Medicine, 50 Ilwon-dong, Gangnam-Gu, Seoul 135-710 (Korea, Republic of); Jeon, Pyoung, E-mail: drpjeon@gmail.co [Department of Radiology and Center for Imaging Science, Samsung Medical Center, Sungkyunkwan University School of Medicine, 50 Ilwon-dong, Gangnam-Gu, Seoul 135-710 (Korea, Republic of); Byun, Hong Sik, E-mail: byun5474@skku.ed [Department of Radiology and Center for Imaging Science, Samsung Medical Center, Sungkyunkwan University School of Medicine, 50 Ilwon-dong, Gangnam-Gu, Seoul 135-710 (Korea, Republic of)

    2010-08-15

    Purpose: The purpose of this study is to investigate the MRI findings of visceral larva migrans (VLS) of Toxocara canis in spinal cord. Materials and methods: We retrospectively reviewed spinal MRI findings in eight patients with serologically proven Toxocara canis between 2005 and 2008. We evaluated the location, length, extent and migration of the lesion, MR signal intensity (SI), enhancement pattern, and swelling of the spinal cord. We evaluated clinical features including presenting symptoms and signs and treatment response. Results: Total 8 patients (M = 8; age range 36-79 years) were included. The lesions were located in the cervical or thoracic spinal cord in all patients. All lesions showed high SI and minimal or mild swelling of involved spinal cord on T2WI and focal nodular enhancement on posterior or posterolateral segment of spinal cord. The length of involved lesion was relatively short in most patients. There was a migration of lesion in one patient. In spite of albendazole or steroid treatment, neurological symptoms or signs were not significantly improved in all patients. Conclusion: Although all lesions show non-specific imaging findings like non-tumorous myelopathy mimicking transverse myelitis, single lesion, focal nodular enhancement on posterior or posterolateral segment of spinal cord, relatively short segmental involvement and migration of lesion may be characteristic findings of spinal VLM of Toxocara canis. In addition, the reluctant response to the treatment may be characteristic of spinal VLM of Toxocara canis.

  10. MRI findings of spinal visceral larva migrans of Toxocara canis

    International Nuclear Information System (INIS)

    Lee, In Ho; Kim, Sung Tae; Oh, Dae Kun; Kim, Hyung-Jin; Kim, Keon Ha; Jeon, Pyoung; Byun, Hong Sik

    2010-01-01

    Purpose: The purpose of this study is to investigate the MRI findings of visceral larva migrans (VLS) of Toxocara canis in spinal cord. Materials and methods: We retrospectively reviewed spinal MRI findings in eight patients with serologically proven Toxocara canis between 2005 and 2008. We evaluated the location, length, extent and migration of the lesion, MR signal intensity (SI), enhancement pattern, and swelling of the spinal cord. We evaluated clinical features including presenting symptoms and signs and treatment response. Results: Total 8 patients (M = 8; age range 36-79 years) were included. The lesions were located in the cervical or thoracic spinal cord in all patients. All lesions showed high SI and minimal or mild swelling of involved spinal cord on T2WI and focal nodular enhancement on posterior or posterolateral segment of spinal cord. The length of involved lesion was relatively short in most patients. There was a migration of lesion in one patient. In spite of albendazole or steroid treatment, neurological symptoms or signs were not significantly improved in all patients. Conclusion: Although all lesions show non-specific imaging findings like non-tumorous myelopathy mimicking transverse myelitis, single lesion, focal nodular enhancement on posterior or posterolateral segment of spinal cord, relatively short segmental involvement and migration of lesion may be characteristic findings of spinal VLM of Toxocara canis. In addition, the reluctant response to the treatment may be characteristic of spinal VLM of Toxocara canis.

  11. Larvae of fouling organisms and macrofouling at New Mangalore Port, west coast of India

    Digital Repository Service at National Institute of Oceanography (India)

    Khandeparker, D.C.; Anil, A.C.; Venkat, K.

    throughout the year, their representation in the macrofouling community was not prominent and yielded a poor correlation with recruitment. Bryozoan and ascidian larvae were sparsely encountered but indicated as significant correlation with their recruitment...

  12. Cholesterol oxidase interference on the emergence and viability of cotton boll weevil larvae

    Directory of Open Access Journals (Sweden)

    Santos Roseane Cavalcanti

    2002-01-01

    Full Text Available The aim of this work was to evaluate the influence of the enzyme cholesterol oxidase (Coase on emergence and viability of larvae of the cotton boll weevil (Anthonomus grandis Boheman, 1843. A series of bioassays was performed with eggs and neonate larvae exposed to different enzyme concentrations in artificial diet. Larval survival was affected at all enzyme concentrations tested, and the six-day LD50 was 53 mug/mL (CI 95%: 43-59. Coase also interfered with hatching of larvae after eggs were floated for 15 min in Coase solution at different concentrations. Observations at the light and electronic microscopic level of midguts from larvae fed on artificial diet containing 53 mug/mL of Coase and collected at six days revealed highly vacuolated regions in the epithelial cells as well as partial degradation of the basal membrane and microvilli.

  13. Infectivity of Trichinella spiralis larvae in pork buried in the ground

    Directory of Open Access Journals (Sweden)

    Jovic S.

    2001-06-01

    Full Text Available Time of survival and infectivity of Trichinella spiralis larvae in pig muscle tissue, buried at various depths in the ground were assessed. In the pork pieces the number of infective larvae was 250 ML/g. Meat originated from pig halves was divided in 39 equal pieces, 0.7 kg each, disposed in three groups of 1 3, and buried in depths of 30, 50, and 100 centimeters respectively. The pork was dug up at 13 intervals, approximately every week, until 91st day of the experiment. After each time interval, infectivity of larvae was assessed by bioassay on rats. The artificially infected rats were sacrificed on 42nd day after the infection and meat was examined by the following methods - artificial digestion and trichinoscopy. It was found that the larvae during all 90 days preserved infectivity in each depth.

  14. Morphological and molecular identification of nasopharyngeal bot fly larvae infesting red deer (Cervus elaphus) in Austria.

    Science.gov (United States)

    Leitner, Natascha; Schwarzmann, Laurin; Zittra, Carina; Palmieri, Nicola; Eigner, Barbara; Otranto, Domenico; Glawischnig, Walter; Fuehrer, Hans-Peter

    2016-11-01

    Nasopharyngeal myiases are caused by larvae of bot flies (Diptera: Oestridae), which have evolved a high specificity for their hosts. Bot flies (n = 916) were collected from 137 (57.6 %) out of 238 red deer (Cervus elaphus) hunted in Vorarlberg and Tyrol (Western Austria). After being stored in 75 % ethanol, larvae were identified to species level and developmental stage using morphological and morphometric keys. Larvae were also molecularly characterized by polymerase chain reaction (PCR) amplification and partial sequencing of the mitochondrial cytochrome oxidase subunit I gene. Morphological and molecular analysis allowed identification of larvae as Cephenemyia auribarbis and Pharyngomyia picta. Genetic variations were also examined within the specimens collected in both geographical locations.

  15. Evaluation of Metarhizium brunneum F52 (Hypocreales: Clavicipitaceae) for control of Japanese beetle larvae in turfgrass

    Science.gov (United States)

    Experimental and commercial preparations of Metarhizium brunneum strain F52 were evaluated for control of Japanese beetle Popillia japonica Newman (Coleoptera: Scarbaeidae) larvae (white grubs) in the laboratory and under field conditions. Experimental preparations consisted of granule and liquid f...

  16. Toxocara cati larvae in the eye of a child: a case report

    Directory of Open Access Journals (Sweden)

    Mohammad Zibaei

    2014-05-01

    Full Text Available Toxocariasis is a consequence of human infection by Toxocara larvae. There are symptomatic (visceral, ocular and asymptomatic course of toxocariasis. The ocular form is very rare. We present a 6-year-old patient who developed an ocular form of toxocariasis caused by Toxocara cati. He demonstrated lesions in the peripheral retina of the right eye. White granuloma was present in the superior peripheral retina. A positive immunological assay for toxocariasis essentially completed the outcomes. On the basis of clinical manifestations and conducted examinations, a diagnosis of ocular form of toxocariasis was established. Albendazole and corticosteroids were applied in treatment. Current results clearly highlight the usefulness of excretory-secretory antigens derived from larvae of Toxocara cati for the fine diagnosis ocular larva migrans caused by Toxocara larvae.

  17. Swim-training changes the spatio-temporal dynamics of skeletogenesis in zebrafish larvae (Danio rerio)

    NARCIS (Netherlands)

    Fiaz, A.W.; Leon-Kloosterziel, K.M.; Gort, G.; Schulte-Merker, S.; van Leeuwen, J.L.; Kranenbarg, S.

    2012-01-01

    Fish larvae experience many environmental challenges during development such as variation in water velocity, food availability and predation. The rapid development of structures involved in feeding, respiration and swimming increases the chance of survival. It has been hypothesized that mechanical

  18. Structure of recombinant human carboxylesterase 1 isolated from whole cabbage looper larvae

    International Nuclear Information System (INIS)

    Greenblatt, Harry M.; Otto, Tamara C.; Kirkpatrick, Melanie G.; Kovaleva, Elena; Brown, Susan; Buchman, George; Cerasoli, Douglas M.; Sussman, Joel L.

    2012-01-01

    Large quantities of recombinant human carboxylesterase 1 have been produced in an economical whole insect larvae system. The crystal structure of this enzyme is essentially identical to that produced by cell culture techniques. The use of whole insect larvae as a source of recombinant proteins offers a more cost-effective method of producing large quantities of human proteins than conventional cell-culture approaches. Human carboxylesterase 1 has been produced in and isolated from whole Trichoplusia ni larvae. The recombinant protein was crystallized and its structure was solved to 2.2 Å resolution. The results indicate that the larvae-produced enzyme is essentially identical to that isolated from cultured Sf21 cells, supporting the use of this expression system to produce recombinant enzymes for crystallization studies

  19. Ontogenetic development of attack behaviour by turbot larvae when exposed to copepod prey

    DEFF Research Database (Denmark)

    Højgaard, Jacob K.; Bruno, Eleonora; Støttrup, Josianne Gatt

    2018-01-01

    offered small nauplii (129–202 μm), large nauplii (222–278 μm) and copepodites (342–542 μm), of the calanoid copepod Acartia tonsa. At 8 DPH, turbot larvae had the highest capture success (67%) when offered small nauplii, with a lower capture success of large nauplii (27%) but totally lacked...... by the larva on the copepod was examined, and the approach pattern of the larva was identified as a controlling mechanism for their strike distance, with the initial approach speed of larva at DPH 10 being significantly less than at DPH 8. In all successful attacks, the strike distance was less than 1.17 mm...

  20. First record of Naushonia sp. (Decapoda: Laomediidae) larva from the Equatorial Atlantic.

    Science.gov (United States)

    De Albuquerque Lira, Simone Maria; De Santana, Claudeilton Severino; Schwamborn, Ralf

    2018-02-26

    The first zoeal-stage larva of a possibly new species of mud shrimp Naushonia (Decapoda: Gebiidea: Laomediidae) was described from plankton samples taken off the Fernando de Noronha Archipelago, being the first occurrence at the oceanic islands of the Equatorial Atlantic. Five zoea I larvae were obtained and dissected for observation of mouthparts. This zoea I of Naushonia sp. is well distinguished from the first larvae of N. portoricensis (Rathbun 1901) from the Caribbean and N. cangronoides (Kingsley 1897) from the Northwest Atlantic in terms of development and setation of appendages, and possibly belongs to a new, undescribed species. The present study widens the knowledge on tropical oceanic decapod larvae and provides detailed drawings and new photographic illustrations with extended depth of field of these organisms.

  1. Probiotic effects on cobia Rachycentron canadum larvae reared in a recirculating aquaculture system

    Directory of Open Access Journals (Sweden)

    M. Angélica Garrido-Pereira

    2014-11-01

    Full Text Available Cobia (Rachycentron canadum is a marine finfish with good potential for mariculture. This study analyzes the effects of probiotic Bacillus spp. on the performance of cobia larvae reared in a recirculating aquaculture system (RAS. Larvae were stocked into two independent RAS for 26 days after hatching. One of the systems (Probiotic treatment received the addition of a commercial probiotic consisting of B. subtilis, B. licheniformis and B. pumilus directly into the water and by live feed. Survival, final weight and water quality were not affected by probiotics. Results showed larvae of the probiotic treatment demonstrated a greater resistance to salinity stress. Immunohistochemical analysis showed a higher expression of CD4 in probiotic treatment. These results suggest that Bacillus spp. probiotics used in RAS have a potential stimulating impact on immune system differentiation and increases salinity stress resistance of cobia larvae.

  2. A Laboratory Practical on the House Building Behaviour of Caddis Larvae

    Science.gov (United States)

    Hansell, M. H.

    1973-01-01

    Describes a laboratory practical on animal behavior suitable for senior secondary school or university biology classes. Several separate exercises relating to the house building behavior of caddis fly larvae are detailed, together with the time required for preparation. (JR)

  3. Benthic food webs support the production of sympatric flatfish larvae in estuarine nursery habitat

    Science.gov (United States)

    Identifying nursery habitats is of paramount importance to define proper management and conservation strategies for flatfish species. Flatfish nursery studies usually report upon habitat occupation, but few attempted to quantify the importance of those habitats to larvae developm...

  4. Cutaneous larva migrans – a threat to divers in the tropics

    Directory of Open Access Journals (Sweden)

    Olszański Romuald

    2016-09-01

    Full Text Available The article presents a dermatosis that occurs in tropical and subtropical countries. Though the definitive hosts of the cutaneous larva migrans parasite are animals, humans can become accidental hosts and they are infected when their skin comes into contact with damp soil, most frequently sand. The disease is only present in the epidermis where an itch is brought about by the mining activity of the larva. Sunbathers and divers who put on their gear on a beach, on account of the epidermis maceration caused by a prolonged exposure to water, are particularly susceptible to the penetrative activities of the larva. In Poland the cutaneous larva migrans is in most cases mistaken for nettle rash or eczema.

  5. Crown-of-Thorns Starfish Larvae Can Feed on Organic Matter Released from Corals

    Directory of Open Access Journals (Sweden)

    Ryota Nakajima

    2016-10-01

    Full Text Available Previous studies have suggested that Crown-of-Thorns starfish (COTS larvae may be able to survive in the absence of abundant phytoplankton resources suggesting that they may be able to utilize alternative food sources. Here, we tested the hypothesis that COTS larvae are able to feed on coral-derived organic matter using labeled stable isotope tracers (13C and 15N. Our results show that coral-derived organic matter (coral mucus and associated microorganisms can be assimilated by COTS larvae and may be an important alternative or additional food resource for COTS larvae through periods of low phytoplankton biomass. This additional food resource could potentially facilitate COTS outbreaks by reducing resource limitation.

  6. Utilization Efficiency of Yolk Egg on Maanvis (Pterophyllum scalare Embryos and Larvae in Different Incubation Temperatures

    Directory of Open Access Journals (Sweden)

    T. Budiardi

    2007-01-01

    Full Text Available This study was performed to determine the efficiency of yolk egg utilization in embryos and larvae, hatching rate, incubation time to hatch, and growth rate of maanvis (Pterophyllum scalare larvae incubated at room remperature, 27oC, and 30oC.  Results of study showed that yolk egg utilization efficiency of embryos and larvae incubated at 30oC was 73.70% and 0,18%, respectively, and no different with that of room and 27oC incubation temperatures.  Hatching rate of eggs incubated at 30oC (84.75% was also same with that of other treatments.  However, incubation time to hatch (27.41 hours was shorter than that of other treatments.  The growth rate by length of larvae (2.16% and survival rate (75.28% incubated at 30oC was also higher compared with that of other treatments.  Thus, in general, optimum temperature for egg hatching and larval rearing of maanvis was 30oC. Keywords: maanvis, Pterophyllum scalare, egg yolk, larvae, embryo, temperature   ABSTRAK Penelitian ini dilakukan untuk mengetahui efisiensi pemanfaatan kuning telur pada embrio dan larva, derajat penetasan, lama inkubasi telur hingga menetas, dan laju pertumbuhan serta kelangsungan hidup larva ikan maanvis (Pterophyllum scalare yang diinkubasi pada suhu ruang, 27oC dan 30oC.  Hasil penelitian menunjukkan bahwa nilai efisiensi pemanfaatan kuning telur bila diinkubasi pada suhu 30oCsebesar 73,70% pada fase embrio dan 0,18% pada fase larva, dan tidak berbeda dengan suhu ruang dan 27oC.  Demikian juga dengan derajat penetasan telur  (84,75% tidak berbeda dengan perlakuan lainnya.  Sementara itu, lama inkubasi telur hingga menetas (27,41 jam lebih cepat dibandingkan dengan suhu inkubasi perlakuan lainnya. Demikian juga dengan laju pertumbuhan panjang (2,16% dan kelangsungan hidup larva (75,28% lebih tinggi dibandingkan dengan perlakuan lainnya. Dengan demikian, secara umum suhu optimal untuk penetasan dan pemeliharaan larva ikan maanvis adalah 30°C. Kata kunci: ikan maanvis

  7. Ichneumonidae (Hymenoptera) parasitóides de larvas de Lepidoptera associadas a Croton floribundus Spreng (Euphorbiaceae)

    OpenAIRE

    Fernandes, Luciana Bueno dos Reis; Dias Filho, Manoel Martins; Fernandes, Marcelo Adorna; Penteado-Dias, Angelica Maria

    2010-01-01

    Parasitoids of the family Ichneumonidae (Hymenoptera) were obtained during an inventory of Lepidoptera larvae caught feeding in the wild on Croton floribundus (Euphorbiaceae). The Lepidoptera larvae were collected from host plants along trails inside three preserved forest areas in the Brazilian state of São Paulo. Fifteen different species of Ichneumonidae belonging to five subfamilies (Banchinae, Campopleginae, Cremastinae, Mesochorinae and Metopiinae) were obtained. Seven species of Ichneu...

  8. Age estimation of Calliphora (Diptera: Calliphoridae) larvae using cuticular hydrocarbon analysis and Artificial Neural Networks

    OpenAIRE

    Moore, H E; Butcher, J B; Adam, C D; Day, C R; Falko, P D

    2016-01-01

    Cuticular hydrocarbons were extracted daily from the larvae of two closely related blowflies Calliphora vicina and Calliphora vomitoria (Diptera: Calliphoridae). The hydrocarbons were then analysed using Gas Chromatography–Mass Spectrometry (GC–MS), with the aim of observing changes within their chemical profiles in order to determine the larval age. The hydrocarbons were examined daily for each species from 1 day old larvae until pupariation. The results show significant chemical changes occ...

  9. Oceanographic and behavioural assumptions in models of the fate of coral and coral reef fish larvae.

    Science.gov (United States)

    Wolanski, Eric; Kingsford, Michael J

    2014-09-06

    A predictive model of the fate of coral reef fish larvae in a reef system is proposed that combines the oceanographic processes of advection and turbulent diffusion with the biological process of horizontal swimming controlled by olfactory and auditory cues within the timescales of larval development. In the model, auditory cues resulted in swimming towards the reefs when within hearing distance of the reef, whereas olfactory cues resulted in the larvae swimming towards the natal reef in open waters by swimming against the concentration gradients in the smell plume emanating from the natal reef. The model suggested that the self-seeding rate may be quite large, at least 20% for the larvae of rapidly developing reef fish species, which contrasted with a self-seeding rate less than 2% for non-swimming coral larvae. The predicted self-recruitment rate of reefs was sensitive to a number of parameters, such as the time at which the fish larvae reach post-flexion, the pelagic larval duration of the larvae, the horizontal turbulent diffusion coefficient in reefal waters and the horizontal swimming behaviour of the fish larvae in response to auditory and olfactory cues, for which better field data are needed. Thus, the model suggested that high self-seeding rates for reef fish are possible, even in areas where the 'sticky water' effect is minimal and in the absence of long-term trapping in oceanic fronts and/or large-scale oceanic eddies or filaments that are often argued to facilitate the return of the larvae after long periods of drifting at sea. © 2014 The Author(s) Published by the Royal Society. All rights reserved.

  10. Analysis of metallotionein expression and antioxidant enzyme activities in Meretrix meretrix larvae under sublethal cadmium exposure

    Energy Technology Data Exchange (ETDEWEB)

    Wang Qing [Key Laboratory of Marine Ecology and Environmental Sciences, Institute of Oceanology, Chinese Academy of Sciences, 7th Nanhai Road, Qingdao 266071 (China); Graduate University, Chinese Academy of Sciences, Beijing 100049 (China); Wang Xiaomei [Key Laboratory of Experimental Marine Biology, Institute of Oceanology, Chinese Academy of Sciences, Qingdao 266071 (China); Wang Xiaoyu [Key Laboratory of Marine Ecology and Environmental Sciences, Institute of Oceanology, Chinese Academy of Sciences, 7th Nanhai Road, Qingdao 266071 (China); Engineering Research Center of Seawater Utilization Technology, Ministry of Education, Hebei University of Technology, Tianjin 300130 (China); Yang Hongsheng, E-mail: hshyang@ms.qdio.ac.cn [Key Laboratory of Marine Ecology and Environmental Sciences, Institute of Oceanology, Chinese Academy of Sciences, 7th Nanhai Road, Qingdao 266071 (China); Liu Baozhong, E-mail: bzliu@ms.qdio.ac.cn [Key Laboratory of Experimental Marine Biology, Institute of Oceanology, Chinese Academy of Sciences, Qingdao 266071 (China)

    2010-11-15

    To investigate the possible role of metallothioneins (MTs) and antioxidant enzymes in cadmium (Cd) tolerance in Meretrix meretrix larvae, a new MT (designated MmMT) gene was identified and cloned from M. meretrix. The full-length cDNA of MmMT consisted of an open reading frame (ORF) of 231 bp encoding a protein of 76 amino acids, with 21 cysteine residues and a conserved structural pattern Cys-x-Cys-x(3)-Cys-Tyr-Gly-x(3)-Cys-x-Cys-x(3)-Cys-x-Cys-Lys at the C-terminus. The deduced amino acid sequence of MmMT showed about 57-84% identity with previously published MT sequences of mussels and oysters. Real-time PCR was used to analyze the expression level of MmMT mRNA at different M. meretrix larval stages under Cd exposure (25 {mu}g L{sup -1}). Results showed that Cd could induce the expression of MmMT mRNA in the larvae, and the expression level increased 5.04-fold and 3.99-fold in D-shaped larvae and pediveligers, respectively. Immunolocalization of MmMT in the stressed larvae revealed that MmMT was synthesized in almost all of the soft parts at the trochophore and postlarva stages, whereas it was only synthesized in the velum and epidermis at the D-shaped larva and pediveliger stages. The activities of three antioxidant enzymes, superoxide dismutase (SOD), catalase (CAT), and glutathione peroxidase (GPx), also were measured in larvae at different developmental stages. Increased enzymatic activities were detected mainly in D-shaped larvae and pediveligers under Cd stress, suggesting that these enzymes respond synchronously with MT. Our results indicate that MmMT and antioxidant enzymes played important roles in counteracting Cd stress in M. meretrix larvae.

  11. Analysis of metallotionein expression and antioxidant enzyme activities in Meretrix meretrix larvae under sublethal cadmium exposure

    International Nuclear Information System (INIS)

    Wang Qing; Wang Xiaomei; Wang Xiaoyu; Yang Hongsheng; Liu Baozhong

    2010-01-01

    To investigate the possible role of metallothioneins (MTs) and antioxidant enzymes in cadmium (Cd) tolerance in Meretrix meretrix larvae, a new MT (designated MmMT) gene was identified and cloned from M. meretrix. The full-length cDNA of MmMT consisted of an open reading frame (ORF) of 231 bp encoding a protein of 76 amino acids, with 21 cysteine residues and a conserved structural pattern Cys-x-Cys-x(3)-Cys-Tyr-Gly-x(3)-Cys-x-Cys-x(3)-Cys-x-Cys-Lys at the C-terminus. The deduced amino acid sequence of MmMT showed about 57-84% identity with previously published MT sequences of mussels and oysters. Real-time PCR was used to analyze the expression level of MmMT mRNA at different M. meretrix larval stages under Cd exposure (25 μg L -1 ). Results showed that Cd could induce the expression of MmMT mRNA in the larvae, and the expression level increased 5.04-fold and 3.99-fold in D-shaped larvae and pediveligers, respectively. Immunolocalization of MmMT in the stressed larvae revealed that MmMT was synthesized in almost all of the soft parts at the trochophore and postlarva stages, whereas it was only synthesized in the velum and epidermis at the D-shaped larva and pediveliger stages. The activities of three antioxidant enzymes, superoxide dismutase (SOD), catalase (CAT), and glutathione peroxidase (GPx), also were measured in larvae at different developmental stages. Increased enzymatic activities were detected mainly in D-shaped larvae and pediveligers under Cd stress, suggesting that these enzymes respond synchronously with MT. Our results indicate that MmMT and antioxidant enzymes played important roles in counteracting Cd stress in M. meretrix larvae.

  12. Seasonal and Topographical Factors Affecting Breeding Sites of Culex Larvae in Nakhon Si Thammarat, Thailand

    OpenAIRE

    Warabhorn PREECHAPORN; Mullica JAROENSUTASINEE; Krisanadej JAROENSUTASINEE; Jirawat SAETON

    2007-01-01

    This study investigated how the seasons affect the key breeding sites of Culex larvae in three topographical areas: mangrove, rice paddy and mountainous areas. We examined how the number of Culex larvae varied in different types of water containers. Water containers were categorised into the following groups: indoor/outdoor containers, artificial/natural containers, earthen/plastic containers, containers with/without lids and dark/light coloured containers. Samples were collected from 300 hou...

  13. Early Cretaceous trypanosomatids associated with fossil sand fly larvae in Burmese amber

    Directory of Open Access Journals (Sweden)

    George Poinar Jr

    2007-08-01

    Full Text Available Early Cretaceous flagellates with characters typical of trypanosomatids were found in the gut of sand fly larvae, as well as in surrounding debris, in Burmese amber. This discovery supports a hypothesis in which free-living trypanosomatids could have been acquired by sand fly larvae in their feeding environment and then carried transtadially into the adult stage. At some point in time, specific genera were introduced into vertebrates, thus establishing a dixenous life cycle.

  14. A generic review of the Acanthaclisine antlions based on larvae (Neuroptera: Myrmeleontidae)

    OpenAIRE

    Stange, Lionel A.; Miller, Robert B.

    2010-01-01

    The tribe Acanthaclisini Navas contains 14 described genera which we recognize as valid. We have reared larvae of 8 of these (Acanthaclisis Rambur, Centroclisis Navas, Fadrina Navas, Paranthaclisis Banks, Phanoclisis Banks, Synclisis Navas, Syngenes Kolbe, and Vella Navas). In addition, we have studied preserved larvae from Australia which probably represent the genus Heoclisis Navas. This represents the majority of the taxa, lacking only the small genera Avia Navas, Cosina Navas, Madrasta Na...

  15. Performances of local poultry breed fed black soldier fly larvae reared on horse manure

    Directory of Open Access Journals (Sweden)

    Nassim Moula

    2018-03-01

    Full Text Available In poultry, feed based on maggots, like larvae of black soldier fly (Hermetia illucens is an attractive option to substitute current ingredients which are expensive and often in direct or indirect competition with human food. Little information is currently available on the utility of these larvae in poultry feed, so goals of this study were to determine whether larvae could be reared on horse manure under traditional farming conditions and to evaluate the growth performances of a local poultry fed these larvae and the fatty acids profiles of their meat. After freezing and thawing, larvae were introduced in the feed of Ardennaise chickens between 30 and 80 days of age. Birds in the control group received a commercial standard feed, while those in the treatment group received the same commercial feed in which 8% was substituted with whole fresh larvae corresponding to 2% on a dry matter basis. Means ± standard errors of larval length and weight were 20.67 ± 2.21 mm and 0.14 ± 0.02 g, respectively. Mean larval percentages of dry matter and of substances extractable in diethyl ether were 24.6% and 23.1%, respectively. Larval fatty acids profiles were predominantly composed of lauric acid (28.1% and palmitic acid (22.0%. Least squares means of weekly weights of chicken, adjusted for the effects of sex, replication and initial weights, were significantly higher (P < 0.05 by 77.03 ± 53.37 g in larvae-fed than in control chickens. All other measurements were not statistically different between larvae-fed and control chicken, including fatty acid profiles, protein content and ω6/ω3 ratio. Keywords: Insect farming, Chicken, Local breed, Growth performance, Meat quality, Fatty acid profile

  16. Last instar larva of Microstigmus nigrophthalmus Melo (Hymenoptera, Crabronidae, Pemphredoninae, with notes on biology

    Directory of Open Access Journals (Sweden)

    Sandor Christiano Buys

    2002-09-01

    Full Text Available The last instar larva of Microstigmus nigrophthalmus Melo, 1992 is described. It markedly differs from that of M. comes Krombein, 1967 the only other species in the genus whose mature larva have been described, for features as follows: presence of spinnerets; setae on the labrum, maxillae and labium; mandibles with tridentate apex and a bidentate lateral projection; lack of the conical supranal processo Notes on habitat, structure, and content of nests are also presented.

  17. Molecular identification of nematode larvae different from those of the Trichinella genus detected by muscle digestion.

    Science.gov (United States)

    Marucci, Gianluca; Interisano, Maria; La Rosa, Giuseppe; Pozio, Edoardo

    2013-05-20

    Although larvae of the genus Trichinella are the most common parasite species detected in vertebrate muscles using artificial digestion, nematode larvae belonging to other genera are sometimes detected and incorrectly identified as Trichinella. However, it is often very difficult to identify these larvae at the species, genus or family level using microscopy because of the absence of specific morphological characters or cuticle damage, and the only means of identification is PCR and sequencing of specific molecular markers (12S mtDNA; COI; 18S rDNA; and ITS1). From 2008 to 2011, 18 nematode isolates not belonging to the genus Trichinella were collected from different host species. Eleven of these isolates were successfully identified at the species, genus or superfamily level: larvae from two common kestrels, three hooded crows, a hen harrier and a domestic pig were identified as Toxocara cati; larvae from a badger were identified as Toxocara canis; larvae from a domestic pig were identified as a free-living nematode of the genus Panagrolaimus; larvae from a wild boar were identified as belonging to the Metastrongylus genus; and larvae from a rough-legged buzzard were identified as belonging to the superfamily Filarioidea. The recovery of nematodes belonging to genera other than Trichinella during routine meat inspection suggests that the persons performing the analyses need to be informed of the possibility of false positives and that a molecular-based identification system that allows for a rapid and reliable response must be adopted (i.e., a DNA barcoding-like system). Copyright © 2013 Elsevier B.V. All rights reserved.

  18. Rate of sediment intake by midge larvae (Chironomus plumosus: diptera) using a 134Cs tracer

    International Nuclear Information System (INIS)

    Gerking, S.D.; Berg, A.; Gerard, P.

    1976-01-01

    The food intake and assimilation of midge larvae (Chironomus plumosus) were determined by a 134 Cs technique which utilized the principle that the rate of excretion can be substituted for the rate of absorption when the larvae are in 134 Cs equilibrium with their environment. The larvae were introduced into contaminated sediments until they reached 134 Cs equilibrium. The time of reaching equilibrium and levels of radioactivity were the same at 10 and at 15 0 C (70 hr at a level of 1367 dpm/mg of larva) and were both significantly different from that at 20 0 C (40 hr at 1062 dpm/mg of larva). Cesium-134 elimination was followed on equilibrated larvae for as long as 330 hr. One egestion compartment (fast) and two excretion (medium and slow) compartments could be recognized at the three experimental temperatures. The loss rates from the second and third compartments at 10 0 C were slower and stretched out over longer time periods compared with those at 15 0 C, while the loss rate from the first compartment was much more comparable at the two temperatures. The first and second compartments merged at 20 0 C, while the slow compartment rose to almost three times that at 15 0 C. The food intake was nearly the same at the three temperatures (0.0986, 0.0893 and 0.0876 mg dry sediment/mg of larva/day). Thus, the larvae relied on an increase in assimilation to meet increased metabolic requirements at higher temperatures rather than depending upon a higher food intake. The gross growth efficiencies varied with temperature from 9.9 percent at 10 0 C to 15.1 percent at 15 0 C

  19. Influence of UV-irradiation on the nauplius larvae of the barnacle Chthamalus sp

    International Nuclear Information System (INIS)

    Hori, Masayuki; Nagayama, Shougo; Kawabe, Atsushi; Yamashita, Keiji.

    1990-01-01

    The purpose of this study is to investigate the influence of UV-irradiation on the nauplius larvae of the barnacle and to use this as the basis for researching the possibility of UV-irradiation as a new method for anti-macrofouling control. The nauplius larvae in the petri dishes were exposed to UV-irradiation (λ max = 253.7 nm), then the larval states and behaviour were observed. UV-intensisties were 3.0 mW·cm -2 -7.0 mW·cm -2 and the exposure time was 15 sec -10 min. The water in the petri dishes was changed intermittently but the larvae were not fed. The results were as follows: 1) UV-irradiation may have a delayed lethal effect and metamorphosis-inhibitory effect on the nauplius larvae. 2) The lethal effect of the sum of the dosages of UV on the larvae may nearly equate each other despite differences in each UV-intensity. 3) Within ca. 72 hr, 100 % of UV-irradiated larvae were dead with the dosage of at least 672 mW·sec·cm -2 and were incapable of swimming with the dosage of at least 168 mW·sec·cm -2 . 4) UV-irradiated larvae could not exuviate with the dosage of at least 246 mW·sec·cm -2 and could only exuviate with the dosage of 45 mW·sec·cm -2 . 5) After UV-irradiation even the 'actively swimming' larvae may have suffered some sort of physiological damage. (author)

  20. Clash of kingdoms or why Drosophila larvae positively respond to fungal competitors

    Directory of Open Access Journals (Sweden)

    Rohlfs Marko

    2005-01-01

    Full Text Available Abstract Background Competition with filamentous fungi has been demonstrated to be an important cause of mortality for the vast group of insects that depend on ephemeral resources (e.g. fruit, dung, carrion. Recent data suggest that the well-known aggregation of Drosophila larvae across decaying fruit yields a competitive advantage over mould, by which the larvae achieve a higher survival probability in larger groups compared with smaller ones. Feeding and locomotor behaviour of larger larval groups is assumed to cause disruption of fungal hyphae, leading to suppression of fungal growth, which in turn improves the chances of larval survival to the adult stage. Given the relationship between larval density, mould suppression and larval survival, the present study has tested whether fungal-infected food patches elicit communal foraging behaviour on mould-infected sites by which larvae might hamper mould growth more efficiently. Results Based on laboratory experiments in which Drosophila larvae were offered the choice between fungal-infected and uninfected food patches, larvae significantly aggregated on patches containing young fungal colonies. Grouping behaviour was also visible when larvae were offered only fungal-infected or only uninfected patches; however, larval aggregation was less strong under these conditions than in a heterogeneous environment (infected and uninfected patches. Conclusion Because filamentous fungi can be deadly competitors for insect larvae on ephemeral resources, social attraction of Drosophila larvae to fungal-infected sites leading to suppression of mould growth may reflect an adaptive behavioural response that increases insect larval fitness and can thus be discussed as an anti-competitor behaviour. These observations support the hypothesis that adverse environmental conditions operate in favour of social behaviour. In a search for the underlying mechanisms of communal behaviour in Drosophila, this study highlights

  1. Temporal and Spatial Distribution Patterns of Echinoderm Larvae in La Parguera, Puerto Rico

    Directory of Open Access Journals (Sweden)

    Stacey M Williams

    2010-10-01

    Full Text Available This study describes temporal and spatial abundance patterns of echinoderm larvae in La Parguera, Puerto Rico. For the temporal study, larvae were sampled by a series of monthly tows taken with a 64μm mesh net between the new and full moon from April 2005 to July 2006, September 2006 and August 2007. In order to measure spatial variation of echinoderm larval bundances, oblique tows were taken with 64 and 202μm mesh nets at seven different sites within the shelf, at the shelf-edge, and at a nearby oceanic stations during August 2007. Overall, Echinoidea (sea urchin exhibited the highest abundance with a total of 11 921 larvae, representing 52.5% of the total collection. Ophiuroidea (brittle star ranked second in abundance with 45.6% of the total larvae. Holothuroidea (sea cucumber and Asteroidea larvae (sea star accounted for less than 2% of the total echinoderm larval collection. Early larval stages (2-8 day old of Diadema antillarum represented 20% of the total Echinoidea larvae. There was no marked seasonal trend of echinoderm larval abundance; Echinoidea and Ophiuroidea larvae were present in all monthly samples indicating that reproduction occurs year-round. Peak abundances of later-stage Echinoidea larvae were observed during January, July and October and of later-stage Ophiuroidea larvae during June, August and October. The observed peaks of later-stage larval abundances may be indicative of higher recruitment activity during these months. There was a significant difference of echinoderm larval abundance between spatial stations, with higher abundances collected at the shelf-edge. Later-stage (~24 day old D. antillarum larvae were mostly collected at shelf-edge and oceanic locations. In addition, the 64mm mesh net was more efficient for collection of echinoderm larvae than the 202mm mesh net. Rev. Biol. Trop. 58 (Suppl. 3: 81-88. Epub 2010 October 01.Este estudio describe patrones de abundancia temporal y espacial de larvas de

  2. Dipteran larvae and microbes facilitate nutrient sequestration in the Nepenthes gracilis pitcher plant host.

    Science.gov (United States)

    Lam, Weng Ngai; Chong, Kwek Yan; Anand, Ganesh S; Tan, Hugh Tiang Wah

    2017-03-01

    The fluid-containing traps of Nepenthes carnivorous pitcher plants (Nepenthaceae) are often inhabited by organisms known as inquilines. Dipteran larvae are key components of such communities and are thought to facilitate pitcher nitrogen sequestration by converting prey protein into inorganic nitrogen, although this has never been demonstrated in Nepenthes Pitcher fluids are also inhabited by microbes, although the relationship(s) between these and the plant is still unclear. In this study, we examined the hypothesis of digestive mutualism between N. gracilis pitchers and both dipteran larvae and fluid microbes. Using dipteran larvae, prey and fluid volumes mimicking in situ pitcher conditions, we conducted in vitro experiments and measured changes in available fluid nitrogen in response to dipteran larvae and microbe presence. We showed that the presence of dipteran larvae resulted in significantly higher and faster releases of ammonium and soluble protein into fluids in artificial pitchers, and that the presence of fluid microbes did likewise for ammonium. We showed also that niche segregation occurs between phorid and culicid larvae, with the former fragmenting prey carcasses and the latter suppressing fluid microbe levels. These results clarify the relationships between several key pitcher-dwelling organisms, and show that pitcher communities facilitate nutrient sequestration in their host. © 2017 The Author(s).

  3. Maintained larval growth in mussel larvae exposed to acidified under-saturated seawater

    Science.gov (United States)

    Ventura, Alexander; Schulz, Sabrina; Dupont, Sam

    2016-03-01

    Ocean acidification (OA) is known to affect bivalve early life-stages. We tested responses of blue mussel larvae to a wide range of pH in order to identify their tolerance threshold. Our results confirmed that decreasing seawater pH and decreasing saturation state increases larval mortality rate and the percentage of abnormally developing larvae. Virtually no larvae reared at average pHT 7.16 were able to feed or reach the D-shell stage and their development appeared to be arrested at the trochophore stage. However larvae were capable of reaching the D-shell stage under milder acidification (pHT ≈ 7.35, 7.6, 7.85) including in under-saturated seawater with Ωa as low as 0.54 ± 0.01 (mean ± s. e. m.), with a tipping point for normal development identified at pHT 7.765. Additionally growth rate of normally developing larvae was not affected by lower pHT despite potential increased energy costs associated with compensatory calcification in response to increased shell dissolution. Overall, our results on OA impacts on mussel larvae suggest an average pHT of 7.16 is beyond their physiological tolerance threshold and indicate a shift in energy allocation towards growth in some individuals revealing potential OA resilience.

  4. Acute ecotoxicology of natural oil and gas condensate to coral reef larvae.

    Science.gov (United States)

    Negri, Andrew P; Brinkman, Diane L; Flores, Florita; Botté, Emmanuelle S; Jones, Ross J; Webster, Nicole S

    2016-02-19

    Risks posed by oil spills to coral reefs are difficult to evaluate, partially due to the absence of studies that adequately assess toxicity to relevant coral reef species. Here we experimentally tested the acute toxicity of condensate, representing a fraction of light crude oil, to coral (Acropora tenuis) and sponge (Rhopaloeides odorabile) larvae. The metamorphosis of coral larvae was inhibited at total petroleum aromatic hydrocarbon (TPAH) concentrations of water accommodated fractions (WAF) as low as 103 μg l(-1), similar to concentrations detected in seawater following large spills. The sensitivity of coral larvae increased by 40% when co-exposed to UV light that they might encounter in shallow reefal systems. Condensate WAF was more toxic to coral larvae than predicted by summing the toxicity of its main components (benzene, toluene, p-xylene and napthalene). In contrast, the sensitivity of sponge larvae to condensate WAF (>10,000 μg l(-1) TPAH) was far less than coral in the presence and absence of UV, but similar to that of other marine invertebrates. While these results highlight the relative sensitivity of coral larvae to oil, further research is needed to better understand and predict the impacts and risks posed by hydrocarbons to tropical reef systems.

  5. Genomewide analysis indicates that queen larvae have lower methylation levels in the honey bee ( Apis mellifera)

    Science.gov (United States)

    Shi, Yuan Yuan; Yan, Wei Yu; Huang, Zachary Y.; Wang, Zi Long; Wu, Xiao Bo; Zeng, Zhi Jiang

    2013-02-01

    The honey bee is a social insect characterized by caste differentiation, by which a young larva can develop into either a queen or a worker. Despite possessing the same genome, queen and workers display marked differences in reproductive capacity, physiology, and behavior. Recent studies have shown that DNA methylation plays important roles in caste differentiation. To further explore the roles of DNA methylation in this process, we analyzed DNA methylome profiles of both queen larvae (QL) and worker larvae (WL) of different ages (2, 4, and 6 day old), by using methylated DNA immunoprecipitation-sequencing (meDIP-seq) technique. The global DNA methylation levels varied between the larvae of two castes. DNA methylation increased from 2-day- to 4-day-old QL and then decreased in 6-day-old larvae. In WL, methylation levels increased with age. The methylcytosines in both larvae were enriched in introns, followed by coding sequence (CDS) regions, CpG islands, 2 kbp downstream and upstream of genes, and 5' and 3' untranslated regions (UTRs). The number of differentially methylated genes (DMGs) in 2-, 4-, and 6-day-old QL and WL was 725, 3,013, and 5,049, respectively. Compared to 4- and 6-day-old WL, a large number of genes in QL were downmethylated, which were involved in many processes including development, reproduction, and metabolic regulation. In addition, some DMGs were concerned with caste differentiation.

  6. Optimised selenium enrichment of Artemia sp. feed to improve red drum (Sciaenops ocellatus) larvae rearing.

    Science.gov (United States)

    Juhász, Péter; Lengyel, Szvetlana; Udvari, Zsolt; Sándor, Alex Nagy; Stündl, László

    2017-09-01

    Selenium is an essential microelement for the normal functioning of life processes. Moreover, it is a component of enzymes with antioxidant effects. However, it has the smallest window of any micronutrient between requirement and toxicity. Selenium is a regularly used element in fish feeds; moreover, enriching zooplankton with selenium to rear larvae is also a well-known technology. It is accepted that the most common starter foods of fish larvae, natural rotifers contain the smallest dosage of selenium, but providing selenium enriched Artemia sp. instead could increase survival and growth rate of fish. However, no such references are available for the red drum (Sciaenops ocellatus) larvae. Therefore, in this study, Artemia sp. was enriched with nano-selenium of verified low toxicity and easy availability in 5 treatments (1, 5, 10, 50, 100 mg/l Se), and then, fish larvae were fed with four of these enriched Artemia stocks (1, 5, 10, 50 mg/l Se) and a control group. At the end of the 9-day-long experiment, survival rate (S) and growth parameters (SL, W, K-factor, SGR) of fish larvae were calculated as well as their selenium retention and glutathione peroxidase enzyme activity were analysed. It was revealed that a moderate level of selenium enrichment (~4 mg/kg dry matter) of Artemia sp. positively influences the rearing efficiency (i.e. survival and growth) of fish larvae, but higher dosages of selenium could cause adverse effects.

  7. Development changes of cuticular hydrocarbons in Chrysomya rufifacies larvae: potential for determining larval age.

    Science.gov (United States)

    Zhu, G H; Ye, G Y; Hu, C; Xu, X H; Li, K

    2006-12-01

    Age determination is the basis of determining the postmortem interval using necrophagous fly larvae. To explore the potential of using cuticular hydrocarbons for determining the ages of fly larvae, changes of cuticular hydrocarbons in developing larvae of Chrysomya rufifacies (Macquart) (Diptera: Calliphoridae) were investigated using gas chromatography with flame-ionization detection and gas chromatography-mass spectrometry. This study showed that the larvae produced cuticular hydrocarbons typical of insects. Most of the hydrocarbons identified were alkanes with the carbon chain length of 21-31, plus six kinds of alkenes. The hydrocarbon composition of the larvae correlated with age. The statistical results showed that simple peak ratios of n-C29 divided by another eight selected peaks increased significantly with age; their relationships with age could be modelled using exponential or power functions with R(2) close to or > 0.80. These results suggest that cuticular hydrocarbon composition is a useful indicator for determining the age of larval C. rufifacies, especially for post-feeding larvae, which are difficult to differentiate by morphology.

  8. Density, Viability Conidia And Symptoms of Metarhizium anisopliae infection on Oryctes rhinoceros larvae

    Science.gov (United States)

    Indriyanti, D. R.; Putri, R. I. P.; Widiyaningrum, P.; Herlina, L.

    2017-04-01

    M. anisopliae is parasitic fungus on insect pests; it is used as a biocontrol agent. M. anisopliae can be propagated on maize or rice substrate. M. anisopliae is currently sold in the form of kaolin powder formulations. Before it is used to check the density, viability and pathogenicity of M. anisopliae. However the problem is the kaolin powder very soft, so it difficult to distinguish between kaolin and conidia. This article gives information on how to calculate conidia density, viability and symptoms of M. anisopliae infection on Oryctes rhinoceros larvae. The study was conducted in the laboratory to determine the density and viability. The pathogenicity testing was done using pots. The Pot is containing soil substrate mixed with M. Anispoliae and ten tails O. Rhinoceros larvae per pot. The results showed that the density of M. anisopliae conidia was 1.81 x 108 conidia mL-1 and the viability was 94% within 24 hours. The larval mortality began to emerge in the 1st week, and all larvae died at the sixth week. The symptom of M. anisopliae infection on Oryctes rhinoceros larvae, there was a black spot on the larval integument. The larvae movements become slow and poor appetite; it will die within 3-7 days. The larvae die hard, and the white hyphae grow on the body surface that turns green.

  9. An appraisal of certain larval behavioural activities as affected by gamma irradiation of Spodoptera larvae

    International Nuclear Information System (INIS)

    Seth, R.K.; Sehgal, S.S.

    1987-01-01

    Gamma irradiation of Spodoptera litura larvae induced an abatement in their locomotor activity. The food perception range and feeding behaviour of the larvae were also impaired. Of various dosages tested, 4 Krad (the sterilizing dose for larvae) caused a decline in locomotor speed. The first instar larvae, for instance showed decline in a speed of 3.74 cm/min to 2.96 cm/min. Similarly at this dose, the third instar larvae exhibited a reduction in speed to the extent of 38 to 45 per cent, the normal speed being 8.02 cm/min. The reactive distances of the first and third instar normal larvae were 5.30 cm and 7.36, respectively. This reactive distance was reduced by about 25 per cent after irradiation at 4 Krad, thus decreasing the food perception capacity significantly. The feeding behaviour too was significantly affected whereas the dose range less than 4 Krad did not induce such a marked impact. (author). 9 refs., 2 tables

  10. Efficacy of photodynamic therapy against larvae of Aedes aegypti: confocal microscopy and fluorescence-lifetime imaging

    Science.gov (United States)

    de Souza, L. M.; Pratavieira, S.; Inada, N. M.; Kurachi, C.; Corbi, J.; Guimarães, F. E. G.; Bagnato, V. S.

    2014-03-01

    Recently a few demonstration on the use of Photodynamic Reaction as possibility to eliminate larvae that transmit diseases for men has been successfully demonstrated. This promising tool cannot be vastly used due to many problems, including the lake of investigation concerning the mechanisms of larvae killing as well as security concerning the use of photosensitizers in open environment. In this study, we investigate some of the mechanisms in which porphyrin (Photogem) is incorporated on the Aedes aegypti larvae previously to illumination and killing. Larvae at second instar were exposed to the photosensitizer and after 30 minutes imaged by a confocal fluorescence microscope. It was observed the presence of photosensitizer in the gut and at the digestive tract of the larva. Fluorescence-Lifetime Imaging showed greater photosensitizer concentration in the intestinal wall of the samples, which produces a strong decrease of the Photogem fluorescence lifetime. For Photodynamic Therapy exposition to different light doses and concentrations of porphyrin were employed. Three different light sources (LED, Fluorescent lamp, Sun light) also were tested. Sun light and fluorescent lamp shows close to 100% of mortality after 24 hrs. of illumination. These results indicate the potential use of photodynamic effect against the LARVAE of Aedes aegypti.

  11. The gut microbiota in larvae of the housefly Musca domestica and their horizontal transfer through feeding.

    Science.gov (United States)

    Zhao, Yao; Wang, Wanqiang; Zhu, Fen; Wang, Xiaoyun; Wang, Xiaoping; Lei, Chaoliang

    2017-12-01

    House fly larvae provide a prolific and sustainable source of proteins used in poultry and fish feed. Wheat bran is a superior diet for house fly larvae and has been widely investigated to exploit its potential in the food and feed area. Using Illumina MiSeq 16S rDNA sequencing, this study investigated the gut microbiota of house fly larvae feeding on wheat bran and the bacterial community in the wheat bran. The bacterial communities in the house fly larvae were dominated by the phyla Proteobacteria and Firmicutes. Enterobacteriaceae and Providencia were the predominant bacteria at the family and genus levels, respectively. Some bacteria in the phyla Actinobacteria, Proteobacteria, Bacteroidetes and Firmicutes may be transferred from the gut of house flies to the wheat bran during feeding and may be involved in degrading and utilizing polysaccharides in the cell wall of wheat bran. The significance of the gut microbiota of house fly larvae, their transferring and roles in degradation of wheat bran is discussed. These findings regarding the gut microbiota of house fly larvae will provide opportunities for research on the impact of microbial communities on poultry and fish.

  12. Studies with normal and gamma irradiated third stage larvae of Oesophagostomum columbianum in lambs

    International Nuclear Information System (INIS)

    Sharma, R.L.; Dhar, D.N.

    1979-01-01

    Results of work on the host-parasite relationship of Oesophagostomum columbianum in sheep, carried out at the Regional Centre, Srinagar, are presented. Primary infections with small numbers of O. columbianum third larvae in lambs caused establishment of more adult worms in the intestine. As the number of larvae administered to lambs in primary infections was increased, a significant decrease in the establishment of adult worms in the intestine was observed. Higher levels of primary infections in lambs resulted in stunting of both male and female adult worms in intestine but this did not affect the resultant egg production by the worms. The severity of the disease in lambs was directly related to the number of larvae administered in primary infections. Attenuation of the third stage larvae of O.columbianum was obtained when they were irradiated at 40 and 50 Krad doses from a gamma source. Whereas it was possible to stimulate only a partial protection in young lambs to O. columbianum with a single dose of 2000, 40 Krad irradiated larvae. Vaccination with the same numbers of larvae, but irradiated at 50 Krad failed to protect the animals. The presence of adult worms of O.columbianum in sites outside the intestine in lambs has been reported for the first time. (auth.)

  13. Influence of nutrient substrates on the expression of cellulases in Cerambyx cerdo L. (Coleoptera: Cerambycidae larvae

    Directory of Open Access Journals (Sweden)

    Pavlović R.

    2012-01-01

    Full Text Available The expression and distribution of digestive cellulases along the midgut of Cerambyx cerdo larvae were analyzed for the first time and are presented in this article. Four groups of larvae were examined: larvae developed in the wild; larvae taken from the wild and successively reared on an artificial diet based on polenta; and larvae hatched in the laboratory and reared on two different artificial diets. Seven endocellulase and seven β-D-glucosidase isoforms were detected in all midgut extracts of C. cerdo with a zymogram after native PAGE. We observed that C. cerdo larvae are capable of producing cellulase isoforms with different PAGE mobilities depending on the nutrient substrate. From our findings it can be assumed that, depending on the distribution of endocellulase and β-D-glucosidase, cellulose molecules are first fragmented in the anterior and middle midgut by endo-β-1,4-glucanase; subsequently, the obtained fragments are broken down by β-D-glucosidase mostly in middle midgut.

  14. Temporal variability of fish larvae assemblages: influence of natural and anthropogenic disturbances

    Directory of Open Access Journals (Sweden)

    David A. Reynalte-Tataje

    Full Text Available Natural and induced disturbances greatly influence the temporal distribution of ichthyoplankton abundance. This study assesses and compares the temporal variability of fish larvae assemblages in controlled and free environments to determine the influence of environment variables on the main taxa in these systems. The study was conducted at the Chapecó (without dam impact and Ligeiro (with dam impact river mouths, which are located in the upper Uruguay River. Samples were made between October 2001 and March 2004 during three reproductive periods. The larvae assemblages were composed of small and medium-sized Characiformes and Siluriformes. The variation in the distribution of larvae was mainly temporal (>85%. When the three reproductive periods were compared, it was observed in the second period, characterized by a larger water flow and a lower temperature, that there was a reduction in abundance, a lower number of taxa, an absence of stages in post-flexion and a high dissimilarity in larvae assemblage structure. In general, the environmental variables of water flow and temperature most influenced the distribution of egg and larvae abundance. In the studied area, a smaller temporal variability was observed in the structure of larvae assemblages at the sampling sites in the Chapecó River mouth than in in the Ligeiro River mouth under the influence of dams.

  15. AKTIVITAS INSEKTISIDA BAGIAN TUMBUHAN CALOPHYLLUM SOULTTRI BURM.F. (CLU IACEAE TERHADAP LARVA LEPIDOPTERA

    Directory of Open Access Journals (Sweden)

    Edy Syahputra

    2014-08-01

    Full Text Available The objective of this test was evaluate the insecticidal activity of ectract of some parts of Calophyllum soulattri (Clusiaceae against larvae of three species of Lepidoptera, i. e Crocidolomia pavonana, Plutella xylostela, and Pieris sp.. Extraction of plant materials was done by infusion method using ethanol. The bioassays were conducted by leaf-feeding method. Second-instar larvae were fed extract-treated broccoli leaves of 48 hours, then they were presented with untreated leaves until the surviving larvae larvae reached the fourth-instar stage. The number of dead larvae was recorded daily an larval mortality date were analyzed by probit method. The result showed the gummy bark exudates and bark extract of old and young C. soulattri plants were highly active against C. pavonana. The abrk extact of old C. soulattri plant was also effective against P. xilostella and Pieris sp. The gummy exudates possessed strong insecticidal activity against C. pavonana larvae with LC50 of 0.04% and prolonged the developmental time from second to fourth instar of C. soulattri 2.03-7.25 days compared with control. The bark excudate gave positive respon to alkaloid flavonoid, and tannin test. Futher studies are needed to identify insecticidal compound in those active extracts.

  16. Genetic and Biochemical Diversity of Paenibacillus larvae Isolated from Tunisian Infected Honey Bee Broods

    Directory of Open Access Journals (Sweden)

    Chadlia Hamdi

    2013-01-01

    Full Text Available Paenibacillus larvae is the causative agent of American foulbrood (AFB, a virulent disease of honeybee (Apis mellifera larvae. In Tunisia, AFB has been detected in many beekeeping areas, where it causes important economic losses, but nothing is known about the diversity of the causing agent. Seventy-five isolates of P. larvae, identified by biochemical tests and 16S rRNA gene sequencing, were obtained from fifteen contaminated broods showing typical AFB symptoms, collected in different locations in the northern part of the country. Using BOX-PCR, a distinct profile of P. larvae with respect to related Paenibacillus species was detected which may be useful for its identification. Some P. larvae-specific bands represented novel potential molecular markers for the species. BOX-PCR fingerprints indicated a relatively high intraspecific diversity among the isolates not described previously with several molecular polymorphisms identifying six genotypes on polyacrylamide gel. Polymorphisms were also detected in several biochemical characters (indol production, nitrate reduction, and methyl red and oxidase tests. Contrary to the relatively high intraspecies molecular and phenotypic diversity, the in vivo virulence of three selected P. larvae genotypes did not differ significantly, suggesting that the genotypic/phenotypic differences are neutral or related to ecological aspects other than virulence.

  17. Metamorfosis del aparato digestivo de larvas carnívoras de Ceratophrys cranwelli (Anura: Leptodactylidae

    Directory of Open Access Journals (Sweden)

    Ulloa Kreisel, Zandra E.

    2000-12-01

    Full Text Available Las larvas carnívoras de Ceratophrys cranwelli presentan un tubo digestivo más corto que la mayoría de las larvas de anuros, tiene 6 veces la longitud del cuerpo del renacuajo y se caracteriza también por tener un estómago larval. El presente trabajo tiene como objetivo el determinar el grado de transformaciones en la cavidad bucofaríngea y tubo digestivo en larvas de esta especie durante la metamorfosis y comparar las estructuras digestivas estudiadas en otras especies de Leptodactylidae de la subfamilia Ceratophryinae y especies con otros hábitos alimenticios. Carnivorous larvae from Ceratophrys cranwelli present a digestive tube shorter than most of the anuran larvae, have 6 times a tadpole’s body length and they are also characterized by the presence of a larval stomach. The aim of this work is determine the grade of transformations in the buccopharyngeal cavity and digestive tube during the metamorphosis in larvae of this species and compare the digestive structures studied in other species of Leptodactylidae of the subfamily Ceratophryinae and another species with different diets.

  18. Effects of algal diets and starvation on growth, survival and fatty acid composition of Solen marginatus (Bivalvia: Solenidae larvae

    Directory of Open Access Journals (Sweden)

    Fiz Da Costa

    2012-08-01

    Full Text Available The aim of this study was to investigate whether it is necessary to feed Solen marginatus (Pennánt, 1777 larvae externally and the evolution of fatty acids in the neutral and polar lipids during larval development in starved larvae and larvae fed on two different microalgal diets. Larvae were subjected to three different treatments: 1. 10 equivalent cells (Isochrysis galbana, Pavlova lutheri and Chaetoceros calcitrans plus 20 equivalent cells of Tetraselmis suecica; 2. 80 equivalent cells of I. galbana and 3. starvation during eight days, and then individuals were re-fed on diet 1. The best results for growth were observed in larvae fed on diet 1. Starved larvae reached the best survival rate at day 8 (66%. However, three days after re-feeding all larvae died, suggesting that the “point of no return” was exceeded. In spite of the large size of S. marginatus eggs and the great amount of stored reserves, the larvae need to feed on microalgae to undergo metamorphosis. Non-methyle-interrupted dienoic fatty acids and their precursors 16:1n-7 and 18:1n-9 are of great importance in starved larvae. Saturated fatty acids, especially 16:0, fuel larval development. A certain degree of bioconversion of 18:2n-6 to 20:4n-6 was observed in S. marginatus larvae.

  19. Honey bees consider larval nutritional status rather than genetic relatedness when selecting larvae for emergency queen rearing.

    Science.gov (United States)

    Sagili, Ramesh R; Metz, Bradley N; Lucas, Hannah M; Chakrabarti, Priyadarshini; Breece, Carolyn R

    2018-05-16

    In honey bees and many other social insects, production of queens is a vital task, as colony fitness is dependent on queens. The factors considered by honey bee workers in selecting larvae to rear new queens during emergency queen rearing are poorly understood. Identifying these parameters is critical, both in an evolutionary and apicultural context. As female caste development in honey bees is dependent on larval diet (i.e. nutrition), we hypothesized that larval nutritional state is meticulously assessed and used by workers in selection of larvae for queen rearing. To test this hypothesis, we conducted a series of experiments manipulating the nutritional status of one day old larvae by depriving them of brood food for a four-hour period, and then allowing workers to choose larvae for rearing queens from nutritionally deprived and non-deprived larvae. We simultaneously investigated the role of genetic relatedness in selection of larvae for queen rearing. In all the experiments, significantly greater numbers of non-deprived larvae than deprived larvae were selected for queen rearing irrespective of genetic relatedness. Our results demonstrate that honey bees perceive the nutritional state of larvae and use that information when selecting larvae for rearing queens in the natural emergency queen replacement process.

  20. The in vitro effect of prolactin on the growth, motility and expression of prolactin receptors in larvae of Toxocara canis.

    Science.gov (United States)

    Chávez-Güitrón, L E; Morales-Montor, J; Muñoz-Guzmán, M A; Nava-Castro, K E; Ramírez-Álvarez, H; Moreno-Méndoza, N A; Hernández-Cervantes, R; Alba-Hurtado, F

    2016-07-15

    The in vitro effect of prolactin (PRL) on the growth and motility of Toxocara canis larvae was assessed. Additionally, the expression and location of prolactin receptors (PRL-Rs) were determined in the larvae. Larvae of T. canis were incubated with different concentrations of PRL for different periods of time. The stimulated larvae accelerated their enlargement and increased their motility. The mean percentage of PRL-R+ cells in non-stimulated larvae, measured by flow cytometry was 7.3±0.3%. Compared with non-stimulated larvae, the mean fluorescence intensity (pPCR. The sequence of this fragment showed 99% similarity with the gene fragment that codes for the PRL-R of the domestic dog. A high concentration of PRL-Rs was immune-located in the posterior region of the larval intestine; therefore, the intestinal cells in this region were most likely the targets for this hormone. Based on these results, PRL-Rs were identified in T. canis larvae, and the in vitro stimulation with PRL increased the number of these receptors, accelerated the growth and modified the activity of larvae. All of the above suggest that T. canis larvae are evolutionarily adapted to recognize the PRL of their definitive host and furthermore might explain the reactivation of tissue-arrested larvae during the gestation of bitches, which does not occur in gestating females of other species. Copyright © 2016 Elsevier B.V. All rights reserved.

  1. Behavioral Responses of Concholepas concholepas (Bruguière, 1789) Larvae to Natural and Artificial Settlement Cues and Microbial Films.

    Science.gov (United States)

    Rodriguez, S R; Riquelme, C; Campos, E O; Chavez, P; Brandan, E; Inestrosa, N C

    1995-12-01

    The behavioral responses of veliger larvae of the gastropod Concholepas concholepas were studied in the presence of different natural and artificial settlement cues and microbial films. Early pre-competent larvae stopped swimming, sank (due to ciliary arrests, retraction of the velum into the shell, or both), and remained inactive on the substratum when exposed to conspecific mucus and hemolymph. In both cases the effect was time-dependent and the number of larvae showing these behaviors decreased over time. Larvae exposed to NH4Cl (ammonium ion) showed a similar time- and dose-dependent response. A positive and time-dependent response was also observed when larvae were exposed to different extracellular matrix (ECM) components (i.e., collagen, gelatin, and fibronectin) and sulfated polysaccharides (i.e., carrageenan, heparin, and chondroitin sulfate). In this case the larvae remained attached to the substratum. However, the effect of sulfated polysaccharides on C. concholepas larval behavior was faster than that observed with other ECM molecules. We also studied the responses of premetamorphic C. concholepas larvae exposed to different microbial films. In chemotaxis experiments with different films, with glass as the substratum, larvae showed a significant preference for multispecific and diatoms films. When shells of C. concholepas were used as the substratum, the preference for multispecific films was clear and significant. Likewise, larvae showed velar contractions in the presence of all the films tested. Larvae exposed to multispecific films and to the microalga Prasinocladus marinus showed an increased ciliar movement. The finding that mucus and hemolymph of conspecific adults and ECM molecules (mainly sulfated polysaccharides) induce the cessation of swimming of C. concholepas larvae suggests a possible role for cell-surface receptors in mediating the larval response of marine organisms. Likewise, the positive chemotaxis responses of C. concholepas larvae to

  2. Enantioselective bioaccumulation of diniconazole in Tenebrio molitor larvae.

    Science.gov (United States)

    Liu, Chen; LV, Xiao Tian; Zhu, Wen Xue; QU, Hao Yang; Gao, Yong Xin; Guo, Bao Yuan; Wang, Hui Li

    2013-12-01

    The enantioselective bioaccumulation of diniconazole in Tenebrio molitor Linne larva was investigated with liquid chromatography tandem mass spectrometry based on the ChiralcelOD-3R[cellulose tri-(3,5-dimethylphenyl carbamate)] column. In this study we documented the effects of dietary supplementation with wheat bran contaminated by racemic diniconazole at two dose levels of 20 mg kg(-1) and 2 mg kg(-1) (dry weight) in Tenebrio molitor. The results showed that both doses of diniconazole were taken up by Tenebrio molitor rapidly in the first few days, the concentrations of R-enantiomer and S-enantiomer at high doses reached the highest level of 0.55 mg kg(-1) and 0.48 mg kg(-1) , respectively, on the 1(st) d, and the concentrations of them obtained a maxima of 0.129 mg kg(-1) and 0.128 mg kg(-1) at low dose, respectively, on the 3(rd) d, which means that the concentration of diniconazole was proportional to the time of achieving the highest accumulated level. It afterwards attained equilibrium after a sharp decline at both 20 mg kg(-1) and 2 mg kg(-1) of diniconazole. The determination results from the feces of Tenebrio molitor demonstrated that the extraction recovery (ER) values of the high dose group were higher than that of the low dose group and the values were all above 1; therefore, it could be inferred that enantiomerization existed in Tenebrio molitor. Additionally, the biota accumulation factor was used to evaluate the bioaccumulation of diniconazole enantiomers, showing that the bioaccumulation of diniconazole in Tenebrio molitor was enantioselective with preferential accumulation of S-enantiomer. © 2013 Wiley Periodicals, Inc.

  3. In Vivo Cardiotoxicity Induced by Sodium Aescinate in Zebrafish Larvae

    Directory of Open Access Journals (Sweden)

    Jinfeng Liang

    2016-02-01

    Full Text Available Sodium aescinate (SA is a widely-applied triterpene saponin product derived from horse chestnut seeds, possessing vasoactive and organ-protective activities with oral or injection administration in the clinic. To date, no toxicity or adverse events in SA have been reported, by using routine models (in vivo or in vitro, which are insufficient to predict all aspects of its pharmacological and toxicological actions. In this study, taking advantage of transparent zebrafish larvae (Danio rerio, we evaluated cardiovascular toxicity of SA at doses of 1/10 MNLC, 1/3 MNLC, MNLC and LC10 by yolk sac microinjection. The qualitative and quantitative cardiotoxicity in zebrafish was assessed at 48 h post-SA treatment, using specific phenotypic endpoints: heart rate, heart rhythm, heart malformation, pericardial edema, circulation abnormalities, thrombosis and hemorrhage. The results showed that SA at 1/10 MNLC and above doses could induce obvious cardiac and pericardial malformations, whilst 1/3 MNLC and above doses could induce significant cardiac malfunctions (heart rate and circulation decrease/absence, as compared to untreated or vehicle-treated control groups. Such cardiotoxic manifestations occurred in more than 50% to 100% of all zebrafish treated with SA at MNLC and LC10. Our findings have uncovered the potential cardiotoxicity of SA for the first time, suggesting more attention to the risk of its clinical application. Such a time- and cost-saving zebrafish cardiotoxicity assay is very valid and reliable for rapid prediction of compound toxicity during drug research and development.

  4. Competência de peixes como predadores de larvas de Aedes aegypti, em condições de laboratório Efficacy of fish as predators of Aedes aegypti larvae, under laboratory conditions

    Directory of Open Access Journals (Sweden)

    Luciano Pamplona de Góes Cavalcanti

    2007-08-01

    Full Text Available OBJETIVO: Avaliar a competência de peixes na predação de larvas de Aedes aegypti, em condições de laboratório. MÉTODOS: Foram testados machos e fêmeas de cinco espécies de peixe. Os testes de predação duravam cinco semanas para cada espécie. Cada ensaio compreendia quatro caixas testes e quatro caixas controles. Das caixas controle, duas tinham somente um peixe e as outras duas, apenas larvas. Cada caixa teste continha um peixe e larvas. Na primeira semana foram expostas 100 larvas em cada caixa, e a cada semana acrescentavam-se 100 larvas por caixa/dia, até se obter um máximo de 500 larvas/dia. Comprimento e peso dos peixes foram medidos semanalmente. RESULTADOS: Foram utilizadas 369.000 larvas no total. O Trichogaster trichopteros foi a única espécie em que ambos os sexos predaram 100% das larvas oferecidas. O Betta splendens deixou de predar apenas 15 larvas. Machos do Poecilia reticulata apresentaram baixa capacidade larvófaga quando comparados às fêmeas da mesma espécie. Em relação ao peso e tamanho o Betta splendens mostrou-se capaz de predar 523 larvas/grama/dia. CONCLUSÕES: Fêmeas e machos de Trichogaster trichopteros e de Astyanax fasciatus, e fêmeas de Betta splendens e de Poecillia sphenops foram os peixes que apresentaram maior competência para predar as larvas. Embora com competência menor, machos de Poecillia sphenops e fêmeas de Poecilia reticulata foram capazes de eliminar o número de larvas de Aedes aegypti que possam emergir durante 24 horas num criadouro, em condições naturais. Machos de Poecilia reticulata não foram predadores eficazes.OBJECTIVE: To evaluate the efficacy of fish as predators of the Aedes aegypti larvae in laboratory conditions. METHODS: The male and female of five different fish were included in the experiment. The tests to measure their consumption ability lasted five weeks for each species. Each trial involved four test tanks and four control tanks. Two control tanks

  5. Controle de larvas de Boophilus microplus por Metarhizium anisopliae em pastagens infestadas artificialmente Control of Boophilus microplus larvae by Metarhizium anisopliae in artificially infested pastures

    Directory of Open Access Journals (Sweden)

    Lúcia Mara de Souza Basso

    2005-06-01

    Full Text Available O objetivo deste trabalho foi avaliar a eficiência do controle exercido por Metarhizium anisopliae na população de Boophilus microplus, em pastagens de Brachiaria brizantha, e do híbrido Tifton 85 (Cynodon spp., artificialmente infestadas com fêmeas ingurgitadas do carrapato. Trinta canteiros com 1 m² de área cada foram distribuídos aleatoriamente. Quinze foram pulverizados com esporos do fungo e quinze controles em cada forrageira, constituindo cinco repetições de cada tratamento, foram infestados com número e peso padronizados de fêmeas ingurgitadas do ácaro. Aplicou-se o fungo, na concentração de 1,8x10(8 conídios mL-1, em três situações: pulverização antes da infestação com o carrapato, após a infestação e posterioriormente à emergência das primeiras larvas nos capins. A ação do fungo foi avaliada no 35º, 38º, 41º, 48º, 55º e 61º dia pós-infestação, por meio da contagem de larvas recuperadas. Obteve-se controle de larvas do ácaro, que, nas avaliações realizadas entre o 35º e o 48º dia pós-infestação, variou entre 87% e 94%. As médias das contagens de estágios larvares do carrapato foram menores em todas as amostragens realizadas no capim-Tifton 85, indicando que houve efeito da pastagem na ação do fungo. A situação de aplicação influencia a atividade do fungo, com melhor resultado nas coletas realizadas entre o 41º e 55º dia após infestação em B. brizantha, e aplicação dos conídios logo após a emergência das primeiras larvas.The objective of this work was to evaluate the efficiency of Metarhizium anisopliae fungus against Boophilus microplus population in Brachiaria brizantha and Tifton 85 (Cynodon pastures, artificially infested with tick engorged females. Thirty plots of 1 m² each were randomly distributed in fifteen treated and fifteen control groups per type of grass, establishing five repetitions for each treatment. Pastures were infested with engorged tick females

  6. Elementary budget of stag beetle larvae associated with selective utilization of nitrogen in decaying wood.

    Science.gov (United States)

    Tanahashi, Masahiko; Ikeda, Hiroshi; Kubota, Kôhei

    2018-05-03

    Wood degradation by insects plays important roles for the forest matter cycling. Since wood is deficient in nitrogen compared to the insect body, wood-feeding insects need to assimilate the nitrogen selectively and discard an excess carbon. Such a stoichiometric imbalance between food and body will cause high metabolic cost; therefore, wood-feeding insects may somehow alleviate the stoichiometric imbalance. Here, we investigated the carbon and nitrogen budgets of the larvae of stag beetle, Dorcus rectus, which feed on decaying wood. Assimilation efficiency of ingested wood was 22%, and those values based on the carbon and nitrogen were 27 and 45%, respectively, suggesting the selective digestion of nitrogen in wood. Element-based gross growth efficiency was much higher for nitrogen (45%) than for carbon (3%). As a result, the larvae released 24% of the ingested carbon as volatile, whereas almost no gaseous exchange was observed for nitrogen. Moreover, solubility-based elementary analysis revealed that the larvae mainly utilized alkaline-soluble-water-insoluble fraction of wood, which is rich in nitrogen. Actually, the midgut of the larvae was highly alkaline (pH 10.3). Stag beetle larvae are known to exhibit coprophagy, and here we also confirmed that alkaline-soluble-water-insoluble nitrogen increased again from fresh feces to old feces in the field. Stable isotope analysis suggested the utilization of aerial nitrogen by larvae; however, its actual contribution is still disputable. Those results suggest that D. rectus larvae selectively utilize alkaline-soluble nitrogenous substrates by using their highly alkaline midgut, and perhaps associate with microbes that enhance the nitrogen recycling in feces.

  7. Salinity tolerance of northern Brazilian mangrove crab larvae, Ucides cordatus (Ocypodidae): Necessity for larval export?

    Science.gov (United States)

    Diele, Karen; Simith, Darlan J. B.

    2006-07-01

    The life cycle of the semiterrestrial mangrove crab Ucides cordatus includes pelagic larvae that are released into estuarine waters during the wet season and who may thus encounter potentially stressful low and variable salinity conditions. The effect of salinity on the survival of the zoea larvae, the number of zoeal stages and the duration of development from hatching to megalopa was experimentally studied by rearing larvae from the Caeté estuary, Northern Brazil, in seven salinity treatments (0, 5, 10, 15, 20, 25, and 30). For a better interpretation of the laboratory results, estuarine salinities were measured over five consecutive years during the species' reproductive season. The survival of the zoea larvae varied significantly with salinity, while the number of stages and the duration of their development remained constant. Development to megalopa took 20.77 ± 1.57 days and comprised five zoeal stages with ZI and ZII being euryhaline and later stages stenohaline. The newly hatched larvae stayed alive for up to 6 days in freshwater (average 4.32 ± 0.82 days), but did not moult to the second zoeal stage. ZII larvae first occurred from salinity 5 onwards and later zoeal stages at all tested salinities ≥10. However, the larvae only survived to megalopa at salinities ≥15, with highest numbers at salinity 30 (72%) and lowest at 15 (16%). Lethal salinities ≤10 occurred frequently in the estuary during the reproductive season. This suggests a need for larval export to offshore and thus more saline waters to allow for significant larval survival and maintenance of viable populations of this commercially important species. A regional rather than local approach for management is suggested due to the likelihood of long distance larval dispersal by offshore currents.

  8. Maggot Instructor: Semi-Automated Analysis of Learning and Memory in Drosophila Larvae

    Directory of Open Access Journals (Sweden)

    Urte Tomasiunaite

    2018-06-01

    Full Text Available For several decades, Drosophila has been widely used as a suitable model organism to study the fundamental processes of associative olfactory learning and memory. More recently, this condition also became true for the Drosophila larva, which has become a focus for learning and memory studies based on a number of technical advances in the field of anatomical, molecular, and neuronal analyses. The ongoing efforts should be mentioned to reconstruct the complete connectome of the larval brain featuring a total of about 10,000 neurons and the development of neurogenic tools that allow individual manipulation of each neuron. By contrast, standardized behavioral assays that are commonly used to analyze learning and memory in Drosophila larvae exhibit no such technical development. Most commonly, a simple assay with Petri dishes and odor containers is used; in this method, the animals must be manually transferred in several steps. The behavioral approach is therefore labor-intensive and limits the capacity to conduct large-scale genetic screenings in small laboratories. To circumvent these limitations, we introduce a training device called the Maggot Instructor. This device allows automatic training up to 10 groups of larvae in parallel. To achieve such goal, we used fully automated, computer-controlled optogenetic activation of single olfactory neurons in combination with the application of electric shocks. We showed that Drosophila larvae trained with the Maggot Instructor establish an odor-specific memory, which is independent of handling and non-associative effects. The Maggot Instructor will allow to investigate the large collections of genetically modified larvae in a short period and with minimal human resources. Therefore, the Maggot Instructor should be able to help extensive behavioral experiments in Drosophila larvae to keep up with the current technical advancements. In the longer term, this condition will lead to a better understanding of

  9. Elementary budget of stag beetle larvae associated with selective utilization of nitrogen in decaying wood

    Science.gov (United States)

    Tanahashi, Masahiko; Ikeda, Hiroshi; Kubota, Kôhei

    2018-06-01

    Wood degradation by insects plays important roles for the forest matter cycling. Since wood is deficient in nitrogen compared to the insect body, wood-feeding insects need to assimilate the nitrogen selectively and discard an excess carbon. Such a stoichiometric imbalance between food and body will cause high metabolic cost; therefore, wood-feeding insects may somehow alleviate the stoichiometric imbalance. Here, we investigated the carbon and nitrogen budgets of the larvae of stag beetle, Dorcus rectus, which feed on decaying wood. Assimilation efficiency of ingested wood was 22%, and those values based on the carbon and nitrogen were 27 and 45%, respectively, suggesting the selective digestion of nitrogen in wood. Element-based gross growth efficiency was much higher for nitrogen (45%) than for carbon (3%). As a result, the larvae released 24% of the ingested carbon as volatile, whereas almost no gaseous exchange was observed for nitrogen. Moreover, solubility-based elementary analysis revealed that the larvae mainly utilized alkaline-soluble-water-insoluble fraction of wood, which is rich in nitrogen. Actually, the midgut of the larvae was highly alkaline (pH 10.3). Stag beetle larvae are known to exhibit coprophagy, and here we also confirmed that alkaline-soluble-water-insoluble nitrogen increased again from fresh feces to old feces in the field. Stable isotope analysis suggested the utilization of aerial nitrogen by larvae; however, its actual contribution is still disputable. Those results suggest that D. rectus larvae selectively utilize alkaline-soluble nitrogenous substrates by using their highly alkaline midgut, and perhaps associate with microbes that enhance the nitrogen recycling in feces.

  10. Biological control of Anopheles darlingi, Aedes aegypti and Culex quinquefasciatus larvae using shrimps

    Directory of Open Access Journals (Sweden)

    Willian Marinho Dourado Coelho

    2017-08-01

    Full Text Available Mosquitoes can act as vectors of important diseases such as malaria, dengue, Zika virus, yellow fever, Chikungunya and Mayaro fever, in addition to filariasis. The use of insecticides, larvicides, bed nets and repellents, besides the use of drugs as chemoprevention and the treatment of the sick are currently the pillars of the control of these vectors. We studied the biological control against of Anopheles darlingi, Aedes aegypti and Culex quinquefasciatus larvae using shrimps of the species M. pantanalense, M. amazonicum, M. brasiliense and M. jelskii. Larvae of mosquitoes were collected from the breeding environment and placed in a 500 and 1000 l tank containing 60 shrimps/m2. The predatory activity was evaluated for 30 days and, in all groups it was observed that 100% of the larvae were consumed in few minutes. In the environment, these same species of crustaceans were released in water bodies with the presence of larvae of these insects. In just 72 h there was a marked reduction of the larvae in the release sites of shrimps. Similarly, there was a reduction in the number of adult mosquitoes caught near the breeding sites, allowing to infer that, in places where the crustaceans were released, the predatory activity on the larvae of mosquitoes was sufficient to reduce the number of adult mosquitoes p ≤ 0,05. This is the first description of the predatory activity of M. pantanalense, M. amazonicum, M. brasiliense and M. jelskii on An. darlingi, A. aegypti and C. quinquefasciatus larvae, constituting an important tool of biological control of these parasites-vectors.

  11. Looking for Larvae Above an Erupting Submarine Volcano, NW Rota-1, Mariana Arc

    Science.gov (United States)

    Beaulieu, S.; Hanson, M.; Tunnicliffe, V.; Chadwick, W. W., Jr.; Breuer, E. R.

    2016-02-01

    In 2009 the first marine protected areas for deep-sea hydrothermal vents in U.S. waters were established as part of the Volcanic Unit of the Marianas Trench Marine National Monument. In this region, hydrothermal vents are located along the Mariana Arc and back-arc spreading center. In particular hydrothermal vents are located near the summit of NW Rota-1, an active submarine volcano on the Mariana Arc which was erupting between 2003 and 2010 and ceased as of 2014. NW Rota-1 experienced a massive landslide in late 2009, decimating the habitat on the southern side of the volcano. This project looked at zooplankton tow samples taken from the water column above NW Rota-1 in 2010, searching for larvae which have the potential to recolonize the sea floor after such a major disturbance. Samples were sorted in entirety into coarse taxa, and then larvae were removed for DNA barcoding. Overall zooplankton composition was dominated by copepods, ostracods, and chaetognaths, the majority of which are pelagic organisms. Comparatively few larvae of benthic invertebrates were found, but shrimp, gastropod, barnacle, and polychaete larvae did appear in low numbers in the samples. Species-level identification obtained via genetic barcoding will allow for these larvae to be matched to species known to inhabit the benthic communities at NW Rota-1. Identified larvae will give insight into the organisms which can re-colonize the seafloor vent communities after a disturbance such as the 2009 landslide. Communities at hydrothermal vents at other submarine volcanoes in the Monument may act as sources for these larvae, but connectivity in this region of complex topography is unknown. As the microinvertebrate biodiversity in the Monument has yet to be fully characterized, our project also provides an opportunity to better describe both the zooplankton and benthic community composition in this area of the Monument.

  12. Distribution of Lepidopteran Larvae on Norway Spruce: Effects of Slope and Crown Aspect.

    Science.gov (United States)

    Kulfan, Ján; Dvořáčková, Katarína; Zach, Peter; Parák, Michal; Svitok, Marek

    2016-04-01

    Lepidoptera associated with Norway spruce, Picea abies (L.) Karsten, play important roles in ecosystem processes, acting as plant pests, prey for predators, and hosts for parasites and parasitoids. Their distribution patterns in spruce crowns and forests are only poorly understood. We examined how slope and crown aspect affect the occurrence and abundance of moth larvae on solitary spruce trees in a montane region in Central Europe. Moth larvae were collected from southern and northern crowns of trees growing on south- and north-facing slopes (four treatments) using emergence boxes at the end of winter and by the beating method during the growing season. Species responses to slope and crown aspect were not uniform. Treatment effects on moth larvae were stronger in the winter than during the growing season. In winter, the abundance of bud-boring larvae was significantly higher in northern than in southern crowns regardless of the slope aspect, while both slope and aspect had marginally significant effects on abundance of miners. During the growing season, the occurrence of free-living larvae was similar among treatments. Emergence boxes and beating spruce branches are complementary techniques providing valuable insights into the assemblage structure of moth larvae on Norway spruce. Due to the uneven distribution of larvae detected in this study, we recommend adoption of a protocol that explicitly includes sampling of trees from contrasting slopes and branches from contrasting crown aspect in all seasons. © The Authors 2016. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  13. Effect of titanium dioxide nanoparticles on the bioavailability, metabolism, and toxicity of pentachlorophenol in zebrafish larvae

    International Nuclear Information System (INIS)

    Fang, Qi; Shi, Xiongjie; Zhang, Liping; Wang, Qiangwei; Wang, Xianfeng; Guo, Yongyong; Zhou, Bingsheng

    2015-01-01

    Highlights: • Effects of n-TiO 2 on toxicity of PCP in zebrafish larvae were investigated. • Co-exposure n-TiO 2 enhanced metabolism of PCP to tetrachlorohydroquinone in larvae. • Co-exposure n-TiO 2 increased oxidative damage and developmental toxicity in larvae. • NPs may influence toxicity of associated organic pollutants in the aquatic environment. - Abstract: This study investigated the influence of titanium dioxide nanoparticles (n-TiO 2 ) on the bioavailability, metabolism, and toxicity of pentachlorophenol (PCP) in fish. Zebrafish (Danio rerio) embryos or larvae (2-h post-fertilization) were exposed to PCP (0, 3, 10, and 30 μg/L) alone or in combination with n-TiO 2 (0.1 mg/L) until 6 days post-fertilization. Results showed that n-TiO 2 treatment alone did not induce lipid peroxidation, DNA damage, as well as the generation of reactive oxygen species (ROS) in the larvae. As compared with PCP treatment, the co-exposure of PCP and n-TiO 2 enhanced the induction of ROS generation, eventually leading to lipid peroxidation and DNA damage. The nuclear factor erythroid 2-related factor 2 gene transcriptions were significantly upregulated in both PCP treatment alone and in combination with n-TiO 2 . Chemical analysis and histological examination showed that n-TiO 2 adsorb PCP, and n-TiO 2 are taken up by developing zebrafish larvae; however, PCP content was not enhanced in the presence of n-TiO 2 , but the metabolism of PCP to tetrachlorohydroquinone was enhanced in larvae. The results indicate that n-TiO 2 enhanced the metabolism of PCP and caused oxidative damage and developmental toxicity, suggesting that NPs can influence the fate and toxicity of associated organic pollutants in the aquatic environment

  14. The innate immune and systemic response in honey bees to a bacterial pathogen, Paenibacillus larvae

    Directory of Open Access Journals (Sweden)

    Foster Leonard J

    2009-08-01

    Full Text Available Abstract Background There is a major paradox in our understanding of honey bee immunity: the high population density in a bee colony implies a high rate of disease transmission among individuals, yet bees are predicted to express only two-thirds as many immunity genes as solitary insects, e.g., mosquito or fruit fly. This suggests that the immune response in bees is subdued in favor of social immunity, yet some specific immune factors are up-regulated in response to infection. To explore the response to infection more broadly, we employ mass spectrometry-based proteomics in a quantitative analysis of honey bee larvae infected with the bacterium Paenibacillus larvae. Newly-eclosed bee larvae, in the second stage of their life cycle, are susceptible to this infection, but become progressively more resistant with age. We used this host-pathogen system to probe not only the role of the immune system in responding to a highly evolved infection, but also what other mechanisms might be employed in response to infection. Results Using quantitative proteomics, we compared the hemolymph (insect blood of five-day old healthy and infected honey bee larvae and found a strong up-regulation of some metabolic enzymes and chaperones, while royal jelly (food and energy storage proteins were down-regulated. We also observed increased levels of the immune factors prophenoloxidase (proPO, lysozyme and the antimicrobial peptide hymenoptaecin. Furthermore, mass spectrometry evidence suggests that healthy larvae have significant levels of catalytically inactive proPO in the hemolymph that is proteolytically activated upon infection. Phenoloxidase (PO enzyme activity was undetectable in one or two-day-old larvae and increased dramatically thereafter, paralleling very closely the age-related ability of larvae to resist infection. Conclusion We propose a model for the host response to infection where energy stores and metabolic enzymes are regulated in concert with direct

  15. Effect of titanium dioxide nanoparticles on the bioavailability, metabolism, and toxicity of pentachlorophenol in zebrafish larvae

    Energy Technology Data Exchange (ETDEWEB)

    Fang, Qi [State Key Laboratory of Freshwater Ecology and Biotechnology, Institute of Hydrobiology, Chinese Academy of Sciences, Wuhan 430072 (China); Graduate University of Chinese Academy of Sciences, Beijing 100039 (China); Shi, Xiongjie [College of Life Sciences, Wuhan University, Wuhan 430072 (China); Zhang, Liping [State Key Laboratory of Freshwater Ecology and Biotechnology, Institute of Hydrobiology, Chinese Academy of Sciences, Wuhan 430072 (China); Wang, Qiangwei; Wang, Xianfeng [State Key Laboratory of Freshwater Ecology and Biotechnology, Institute of Hydrobiology, Chinese Academy of Sciences, Wuhan 430072 (China); Graduate University of Chinese Academy of Sciences, Beijing 100039 (China); Guo, Yongyong [State Key Laboratory of Freshwater Ecology and Biotechnology, Institute of Hydrobiology, Chinese Academy of Sciences, Wuhan 430072 (China); Zhou, Bingsheng, E-mail: bszhou@ihb.ac.cn [State Key Laboratory of Freshwater Ecology and Biotechnology, Institute of Hydrobiology, Chinese Academy of Sciences, Wuhan 430072 (China)

    2015-02-11

    Highlights: • Effects of n-TiO{sub 2} on toxicity of PCP in zebrafish larvae were investigated. • Co-exposure n-TiO{sub 2} enhanced metabolism of PCP to tetrachlorohydroquinone in larvae. • Co-exposure n-TiO{sub 2} increased oxidative damage and developmental toxicity in larvae. • NPs may influence toxicity of associated organic pollutants in the aquatic environment. - Abstract: This study investigated the influence of titanium dioxide nanoparticles (n-TiO{sub 2}) on the bioavailability, metabolism, and toxicity of pentachlorophenol (PCP) in fish. Zebrafish (Danio rerio) embryos or larvae (2-h post-fertilization) were exposed to PCP (0, 3, 10, and 30 μg/L) alone or in combination with n-TiO{sub 2} (0.1 mg/L) until 6 days post-fertilization. Results showed that n-TiO{sub 2} treatment alone did not induce lipid peroxidation, DNA damage, as well as the generation of reactive oxygen species (ROS) in the larvae. As compared with PCP treatment, the co-exposure of PCP and n-TiO{sub 2} enhanced the induction of ROS generation, eventually leading to lipid peroxidation and DNA damage. The nuclear factor erythroid 2-related factor 2 gene transcriptions were significantly upregulated in both PCP treatment alone and in combination with n-TiO{sub 2}. Chemical analysis and histological examination showed that n-TiO{sub 2} adsorb PCP, and n-TiO{sub 2} are taken up by developing zebrafish larvae; however, PCP content was not enhanced in the presence of n-TiO{sub 2}, but the metabolism of PCP to tetrachlorohydroquinone was enhanced in larvae. The results indicate that n-TiO{sub 2} enhanced the metabolism of PCP and caused oxidative damage and developmental toxicity, suggesting that NPs can influence the fate and toxicity of associated organic pollutants in the aquatic environment.

  16. Energy density of zooplankton and fish larvae in the southern Catalan Sea (NW Mediterranean)

    Science.gov (United States)

    Barroeta, Ziortza; Olivar, M. Pilar; Palomera, Isabel

    2017-06-01

    In marine communities, energy of small planktonic organisms is transferred to their predators through feeding. The energy accumulated as organic substances by the different plankton organisms (Energetic Density content, ED) has been analysed in high latitudes and tropical areas, but not in the Mediterranean Sea. In this study, we approach this type of investigation for Mediterranean plankton through measures of total calorimetric content using an oxygen bomb calorimeter. We examined the spatiotemporal variation in the ED of microplankton (50-200 μm) and mesozooplankton (200-2000 μm), and two plankton-consumers, sardine (Sardina pilchardus) and anchovy (Engraulis encrasicolus) larvae. The study was carried out during the winter and summer of 2013 off the Ebro River Delta (NW Mediterranean Sea). Both plankton fractions showed a more coastal distribution and higher biomasses during winter, the period of sardine larvae occurrences, in front of a wider cross-shelf distribution and lower biomasses in summer, when anchovy appeared. ED values increased with the size of each plankton component, i.e., microzooplankton < mesozooplankton < fish larvae. A tendency for higher plankton ED in the winter period was observed, although being only significant for coastal zone, associated to the more productive waters there. Sardine and anchovy larvae showed an increasing trend in the amount of energy during development, with significantly lower ED between early larvae (6-10 mm standard length) and late postflexion stages (16-20 mm standard length). Small larvae of both species departed from a similarly low ED content, but in the next two size classes sardine larvae showed higher ED values than anchovy, being significantly higher in the 16-20 mm size class. Information on larval feeding patterns and larval growth rates for each species were used to discuss differences in energy allocation strategies.

  17. Sensory Flask Cells in Sponge Larvae Regulate Metamorphosis via Calcium Signaling.

    Science.gov (United States)

    Nakanishi, Nagayasu; Stoupin, Daniel; Degnan, Sandie M; Degnan, Bernard M

    2015-12-01

    The Porifera (sponges) is one of the earliest phyletic lineages to branch off the metazoan tree. Although the body-plan of sponges is among the simplest in the animal kingdom and sponges lack nervous systems that communicate environmental signals to other cells, their larvae have sensory systems that generate coordinated responses to environmental cues. In eumetazoans (Cnidaria and Bilateria), the nervous systems of larvae often regulate metamorphosis through Ca(2+)-dependent signal transduction. In sponges, neither the identity of the receptor system that detects an inductive environmental cue (hereafter "metamorphic cues") nor the signaling system that mediates settlement and metamorphosis are known. Using a combination of behavioral assays and surgical manipulations, we show here that specialized epithelial cells-referred to as flask cells-enriched in the anterior third of the Amphimedon queenslandica larva are most likely to be the sensory cells that detect the metamorphic cues. Surgical removal of the region enriched in flask cells in a larva inhibits the initiation of metamorphosis. The flask cell has an apical sensory apparatus with a cilium surrounded by an apical F-actin-rich protrusion, and numerous vesicles, hallmarks of eumetazoan sensory-neurosecretory cells. We demonstrate that these flask cells respond to metamorphic cues by elevating intracellular Ca(2+) levels, and that this elevation is necessary for the initiation of metamorphosis. Taken together, these analyses suggest that sponge larvae have sensory-secretory epithelial cells capable of converting exogenous cues into internal signals via Ca(2+)-mediated signaling, which is necessary for the initiation of metamorphosis. Similarities in the morphology, physiology, and function of the sensory flask cells in sponge larvae with the sensory/neurosecretory cells in eumetazoan larvae suggest this sensory system predates the divergence of Porifera and Eumetazoa. © The Author 2015. Published by Oxford

  18. Temperature-dependent settlement of planula larvae of two scyphozoan jellyfish from the North Sea

    Science.gov (United States)

    Gambill, Maria; McNaughton, Sadie L.; Kreus, Markus; Peck, Myron A.

    2018-02-01

    Exploring the settlement dynamics of the planula larvae is critical to understanding the establishment of polyp populations that can give rise to blooms of scyphozoan jellyfish. We conducted experiments to examine the effects of temperature on settlement of planulae of the scyphozoans Cyanea lamarckii and Chrysaora hysoscella, two jellyfish commonly encountered within the North Sea. When provided immediate access to substrate, larvae of C. lamarckii were able to settle at each of 12 temperatures between 9 and 27 °C. Most settlement occurred within the first five days and warmer temperatures were not only associated with decreased time to settlement but also increased settlement success. When not allowed access to substrate and maintained in the water column, planula larvae remained competent to settle for 21, 21 and 14 days at 11.3, 13.4 and 19.4 °C, respectively. Based on these maximum times of competency, hydrodynamic model simulations suggested that the planula larvae of C. lamarckii released in May could be transported up to 100 km before settlement. A substrate choice experiment indicated that larvae of C. hysoscella settled in similar numbers onto PET, wood and concrete. Settlement was highest at 20 °C and a 12/12 light/dark regime and lower at 10 °C and 15 °C in total darkness. The results of all three experiments suggest that projected warming of the North Sea will not impede the settlement of planula larvae of resident C. lamarckii and C. hysoscella populations. Species- and/or population-specific differences may exist in the ecophysiology of planula larvae and additional experiments are needed to understand the mechanisms promoting the establishment of new benthic populations of polyps. That information, combined with process knowledge on the productivity of benthic polyps, will be needed to better understand and predict climate-dependent changes in the production of scyphozoans and other gelatinous plankton.

  19. Egg Predation Risk Trigger Adult Hoverfly (Diptera: Syrphidae to Avoid Laying Eggs in Patches Attended by Ladybird Larvae (Coleoptera: Coccinellidae

    Directory of Open Access Journals (Sweden)

    Nugroho Susetya Putra

    2005-12-01

    Full Text Available Oviposition preference of a predatory hoverfly, Episyrphus balteatus on the presence of its potential predators, the ladybird larvae which are inflicted serious impacts on its eggs was examined in a non-choice test. Our results revealed that the biggest and the most aggressive species of ladybird, Harmonia axyridis caused the worst impact on hoverfly eggs by attacking and feeding on. The species and developmental stages of ladybird were attributed to the level of predation risk. We correlated the oviposition site selection by hoverfly females to the egg predation risk level inflicted by ladybird larvae. Hoverfly females laid the least number of eggs on the patches attended by the strongest competitor, the larva of H. axyridis, and tended to lay the highest number of eggs on colonies attended by the weakest competitor, the larva of Scymnus posticalis. In addition, the impact of the fourth instar larva of ladybirds was stronger than of the first instar larva.

  20. SURVEI DARAH JARI FILARIASIS DI DESA BATUMARTA X KEC. MADANG SUKU III KABUPATEN OGAN KOMERING ULU (OKU TIMUR, SUMATERA SELATAN TAHUN 2012

    Directory of Open Access Journals (Sweden)

    R. Irpan Pahlepi

    2015-01-01

    Full Text Available AbstrakFilariasis atau penyakit kaki gajah adalah golongan penyakit menular yang disebabkan oleh cacing filaria  yang  ditularkan  melalui  berbagai  jenis  nyamuk.  Penyebaran  filariasis  hampir  meliputi  seluruh wilayah di Indonesia termasuk Kabupaten Ogan Komering Ulu (OKU Timur. Angka kesakitan filarisis di Kabupaten OKU Timur tahun 2007 sebesar 1,05%. Kegiatan pengobatan massal di Kabupaten OKU Timur belum pernah dilakukan sampai saat ini, sehingga perlu dilakukan penelitian yang bertujuan untuk mengetahui tingkat penyebaran penyakit filariasis. Penelitian ini merupakan penelitian survei dengan desain potong lintang. Pengambilan dan pemeriksaan sediaan darah jari dilakukan pada malam hari dimulai pukul 19.00 WIB. Jumlah penduduk yang diperiksa sebanyak 502. Hasil pemeriksaan diperoleh 4 orang positif mikrofilaria (Mf_ rate 0,8% dengan spesies Brugia  malayi  dan  kepadatan  rata-rata  200mf/ml.  Seluruh  kasus  yang  ditemukan  merupakan  kasus baru. Hasil penelitian ini menunjukkan bahwa penularan filariasis masih terjadi di Kabupaten OKU Timur sehingga perlu adanya pengobatan massal untuk mencegah penularan lebih lanjut.Kata kunci : Filariasis, Brugia malayi, Survei darah jari, OKU TimurAbstractFilariasis or elephantiasis is an infectious diseases caused by filarial worms that transmitted by various species of mosquitoes. Filariasis distributions almost covers all districts in Indonesia including East Ogan Komering Ulu (OKU. Filarisais morbidity in East OKU regency in 2007 was 1.05 %. Mass treatment in the district of East OKU have not been done yet, so it is necessary to do a research that aim to determine the prevalen of filariasis. This study is a cross-sectional survey design. Collection and examination of finger’s blood was done at night starting at 19:00. Number of people examined were 502. Examination results obtained 4 positive microfilariae (Mf_ rate 0.8 % of Brugia malayi and the average density of 200

  1. Effects of parsley and camphor oils on mortality and trace elements of Chrysomyia albiceps larvae

    International Nuclear Information System (INIS)

    Rizk, S.A.; El- Sebaay, S.S.; Amin, M.M.

    2010-01-01

    The use of plant oils to protect sheep and other animals from infestation and myiasis of medical and veterinary pests are limited. This study aimed to evaluate the effect of parsley oil (Petroselimum crispum) and camphor oil (Cinnamomum camphora) on mortality of Chrysomayia albiceps larvae and their effects on metal contents of the larvae. When the parsley oil used at the concentrations of 25, 50 and 100%, the larval mortality percent was increased with the decrease of the concentration and it reached 100% when the solvent used alone without oil. The pupation and the emergence percents decreased with the decrease of the concentration. The sex ratio was in favor of males at all concentrations except at the concentration of 100% where it was in favor of females. When camphor oil was used at concentrations of 25, 50, and 100%, the larval mortality percent was decreased with the decrease of the concentration and it reached 100% when the solvent was used alone without oil. The pupation percent increased with the decrease of the concentration. The emergence percent were similar in different treatments. The sex ratio was in favor of males at all concentrations except in the concentration of 50% it was in favor of females. In addition, the present study investigated the effect of parsley and camphor oils on the trace elements in the larval whole body. Eleven elements in C. albiceps larvae (untreated and treated with solvent (ethyl alcohol) and different concentrations of parsley oil) were detected. In untreated larvae Phosphorous was the most abundant element followed by magnesium and the least abundant element was ferric. In larvae treated with the solvent only (ethyl alcohol) potassium was the most abundant element followed by phosphorous and the least abundant element was ferric. In larvae treated with parsley oil at concentration of 25%, the elemental arrangement appeared to be similar to that of larvae treated with the solvent only. On the other hand, at the

  2. Early larvae ontogeny of the Neotropical fishes: Prochilodus costatus and P. argenteus (Characiformes: Prochilodontidae).

    Science.gov (United States)

    dos Santos, José Enemir; Sales, Naiara Guimarães; dos Santos, Marcella Lourenço; Arantes, Fábio Pereira; Godinho, Hugo Pereira

    2016-06-01

    Early development of fish larvae is a highly dynamic process and its study may provide important information about ontogenetic development, bioenergetic growth, behaviour, taxonomic characteristics for identification in natural environments, identification of spawning areas, and population monitoring. With the aim to provide knowledge about their growth and behaviour, to support larval rearing, and also taxonomic purposes, we studied the life history of the Prochilodus argenteus and P. costatus from hatching until the complete absorption of the yolk. Larvae were obtained through artificial reproduction at the Hydrobiology and Aquaculture Station of Três Marias, Minas Gerais, Brazil. Immediately after hatching, 100 larvae of each species were put in two plastic incubators for conditioning. On a daily basis, larvae behavior was recorded and 14 larvae of each species were collected to analyse body morphology. On the first day after hatching, larvae of P. costatus and P. argenteus showed an elongated and transparent body; the yolk sac was filled with individualized yolk globules. In both species, the embryonic fin rounded the caudal region of the body, the retina was non-pigmented and the gut was obliterated. At the second day post-hatching, larvae of both species dendritic chromatophores had emerged, the mouth was obliterated and the pectoral fin was observed. The larvae showed 38-43 myomeres in P. costatus and 42-43 in P. argenteus. For both species, the gas bladder was inflated and the lumen of the gut was already open. On the third day post-hatching, the mouth of P. costatus and P. argenteus was already open in a sub-terminal position; the retina was pigmented; the gill arches had lamellar protrusions and were partially covered by the operculum. On the fourth day post-hatching, the pigmentation pattern was maintained with greater intensity; the mouth occupied a terminal position, the yolk sac was almost completely reabsorbed, and the pectoral and caudal fins

  3. Hemocyte quantitative changes in Anticarsia gemmatalis (Lepidoptera: Noctuidae larvae infected by AgMNPV

    Directory of Open Access Journals (Sweden)

    Fábio Goulart de Andrade

    2010-04-01

    Full Text Available The initial effects of the infection by AgMNPV in the total and differential counts of the hemocytes in Anticarsia gemmatalis (Lepidoptera: Noctuidae larvae were studied. The total number of the hemocytes did not decrease in infected larvae, as it occurred in non infected larvae. In infected larvae, the hemocyte types showed the following frequencies: plasmatocytes - 47.8%, esferulocytes - 25.9%, granulocytes - 15.8%, oenocytoids - 7.2%, prohemocytes - 2.8%, vermicytes - 0,5%. Only the percentage of the granulocytes was different among infected and non infected larvae, indicating that these cells responded quickly to the initial viral infection. These results showed the effective role of the hemocytes in the response of the A. gemmatalis to the infection by AgMNPV. The comprehension of the immunological mechanisms of this insect is an important tool to understand its biological control.Os efeitos iniciais da infecção por AgMNPV nas contagens total e diferencial dos hemócitos em Anticarsia gemmatalis (Lepidoptera: Noctuidae foram estudados. O número total de hemócitos não diminuiu nas larvas infectadas, como ocorreu nas larvas não infectadas. Nas larvas infectadas, os tipos de hemócitos apresentaram as seguintes freqüências: plasmatócitos - 47,8%, esferulócitos - 25,9%, granulócitos - 15,8%, oenocitóides - 7,2%, prohemócitos - 2,8%, vermiformes - 0,5%. Apenas a porcentagem de granulócitos foi diferente entre larvas infectadas e não infectadas, indicando que estas células responderam rapidamente à infecção viral inicial. Estes resultados mostraram o papel efetivo que dos hemócitos na resposta de A. gemmatalis à infecção por AgMNPV. A compreensão dos mecanismos imunológicos deste inseto é uma ferramenta importante para compreender seu controle biológico.

  4. Sustainable production of housefly (Musca domestica) larvae as a protein-rich feed ingredient by utilizing cattle manure

    Science.gov (United States)

    Hussein, Mahmoud; Pillai, Viju V.; Goddard, Joshua M.; Park, Hui G.; Kothapalli, Kumar S.; Ross, Deborah A.; Ketterings, Quirine M.; Brenna, J. Thomas; Milstein, Mark B.; Marquis, Helene; Johnson, Patricia A.; Nyrop, Jan P.

    2017-01-01

    The common housefly, Musca domestica, is a considerable component of nutrient recycling in the environment. Use of housefly larvae to biodegrade manure presents an opportunity to reduce waste disposal while the rapidly assimilated insect biomass can also be used as a protein rich animal feed. In this study, we examine the biodegradation of dairy cattle manure using housefly larvae, and the nutritional value of the resulting larva meal as a feed ingredient. Our results demonstrated that dairy cattle manure presents a balanced substrate for larval growth, and the spent manure showed reductions in concentration of total nitrogen (24.9%) and phosphorus (6.2%) with an overall reduction in mass. Larva yield at an optimum density was approximately 2% of manure weight. Nutritional analysis of M. domestica larva meal showed values comparable to most high protein feed ingredients. Larva meal was 60% protein with a well-balanced amino acid profile, and 20% fat with 57% monounsaturated fatty acids, and 39% saturated fatty acids. Larva meal lacked any significant amount of omega-3 fatty acids. Evaluation of micronutrients in larva meal suggested that it is a good source of calcium and phosphorus (0.5% and 1.1% respectively). The nutritional value of larva meal closely matches that of fishmeal, making it a potentially attractive alternative for use as a protein-rich feed ingredient for livestock and aquaculture operations. PMID:28170420

  5. Feeding Behaviour on Host Plants May Influence Potential Exposure to Bt Maize Pollen of Aglais Urticae Larvae (Lepidoptera, Nymphalidae).

    Science.gov (United States)

    Lang, Andreas; Otto, Mathias

    2015-08-31

    Non-target butterfly larvae may be harmed by feeding on host plants dusted with Bt maize pollen. Feeding patterns of larvae and their utilization of host plants can affect the adverse Bt impact because the maize pollen is distributed unequally on the plant. In a field study, we investigated the feeding of larvae of the Small Tortoiseshell, Aglais urticae, on nettles, Urtica dioica. Young larvae used smaller host plants than older larvae. In general, the position of the larvae was in the top part of the host plant, but older larvae showed a broader vertical distribution on the nettles. Leaf blades and leaf tips were the plant parts most often consumed. Leaf veins were consumed but midribs were fed on to a lesser extent than other plant veins, particularly by young larvae. The feeding behavior of the larvae may increase possible exposure to Bt maize pollen because pollen densities are expected to be higher on the top parts and along leaf veins of nettles.

  6. Feeding Behaviour on Host Plants May Influence Potential Exposure to Bt Maize Pollen of Aglais Urticae Larvae (Lepidoptera, Nymphalidae

    Directory of Open Access Journals (Sweden)

    Andreas Lang

    2015-08-01

    Full Text Available Non-target butterfly larvae may be harmed by feeding on host plants dusted with Bt maize pollen. Feeding patterns of larvae and their utilization of host plants can affect the adverse Bt impact because the maize pollen is distributed unequally on the plant. In a field study, we investigated the feeding of larvae of the Small Tortoiseshell, Aglais urticae, on nettles, Urtica dioica. Young larvae used smaller host plants than older larvae. In general, the position of the larvae was in the top part of the host plant, but older larvae showed a broader vertical distribution on the nettles. Leaf blades and leaf tips were the plant parts most often consumed. Leaf veins were consumed but midribs were fed on to a lesser extent than other plant veins, particularly by young larvae. The feeding behavior of the larvae may increase possible exposure to Bt maize pollen because pollen densities are expected to be higher on the top parts and along leaf veins of nettles.

  7. Luminous vibriosis in rock lobster Jasus verreauxi (Decapoda: Palinuridae) phyllosoma larvae associated with infection by Vibrio harveyi.

    Science.gov (United States)

    Diggles, B K; Moss, G A; Carson, J; Anderson, C D

    2000-11-14

    Studies were conducted to determine the cause of outbreaks of luminous vibriosis in phyllosoma larvae of the packhorse rock lobster Jasus verreauxi reared in an experimental culture facility. On 2 separate occasions mortalities of up to 75% over a period of 4 wk were observed in 4th to 5th and 8th to 10th instar phyllosomas at water temperatures of 20 and 23 degrees C, respectively. Affected larvae became opaque, exhibited small red spots throughout the body and pereiopods, and were faintly luminous when viewed in the dark. Histopathology showed that the gut and hepatopancreas tubules of moribund phyllosomas contained massive bacterial plaques. The hepatopancreas tubules of moribund larvae were atrophic and some contained necrotic cells sloughed into the lumen. Dense, pure cultures of a bacterium identified as Vibrio harveyi were isolated from moribund larvae. The disease syndrome was reproduced by in vivo challenge and V. harveyi was successfully reisolated from diseased larvae after apparently healthy larvae were exposed by immersion to baths of more than 10(4) V. harveyi ml(-1) at 24 degrees C. Injured larvae were more susceptible to infection than were healthy larvae. Survival of larvae experimentally and naturally exposed to V. harveyi was improved when antibiotics were administered via bath exposures.

  8. Use of liquid nitrogen and albendazole in successfully treating cutaneous larva migrans

    International Nuclear Information System (INIS)

    Kapadia, N.; Farooqui, M.; Borhany, T.

    2013-01-01

    Objective: To determine the efficacy of combination treatment of Albendazole along with liquid nitrogen in cutaneous larva migrans. Study Design: Quasi-experimental study. Place and Duration of Study: Abbasi Shaheed Hospital and The Aga Khan Hospital, Karachi, from December 2008 to December 2010. Methodology: Eighteen cases of cutaneous larva migrans were collected and divided into two groups. Group-A was administered oral Albendazole 400 mg once per day along with topical steroid and oral cetrizine 10 mg once at night for 7 days. Group-B also received oral Albendazole 400 mg once per day along with cetrizine 10 mg once at night but they also received single application of liquid nitrogen to freeze the larva. Results: It was found that in Group-A only 2 out of 9 (22%) showed improvement whereas 78% had to be given liquid nitrogen cryotherapy 3 - 7 days after Albendazole to prevent migration of larva. In Group-B, the improvement was 100% and all 9 patients were successfully treated. Conclusion: Use of liquid nitrogen along with oral anti-helminths is very effective in treating cutaneous larva migrans than Albendazole alone. (author)

  9. Furuncular myiasis of the breast caused by the larvae of the Tumbu fly (Cordylobia anthropophaga

    Directory of Open Access Journals (Sweden)

    Mbanaso Augustus

    2004-02-01

    Full Text Available Abstract Background Cutaneous myiasis of the breast due to infestation by the larva of Cordylobia anthropophaga is rare. To the best of our knowledge, only one case has been reported in the English literature. This rarity calls for an awareness of its possibility as a cause of furuncular breast lesions, especially in areas where the C. anthropophaga (Tumbu fly is endemic or in patients returning from such areas. As it can be easily confused with other furuncular breast lesions (like tuberculosis, mycosis, actinomycosis, furunculosis, chronic breast abscess and fungating malignancies, this awareness is important to avoid misdiagnosis or delay in diagnosis. We present a case of furuncular breast myiasis due to the larvae of C. anthropophaga earlier misdiagnosed as mastitis in a patient living in tropical Africa (Nigeria where the Tumbu fly is endemic. Case presentation We report a 70 year old woman who presented with a week history of itchy multiple discharging sinuses of the right breast. The sinuses contained wriggling larvae of C. anthropophaga. Fourteen larvae were extracted from the breast and the sinuses healed quite well after the extraction. Conclusions Cutaneous myiasis of the breast is rare, hence, an awareness of its clinical features is necessary when a patient presents with furuncular skin lesions especially in endemic areas or people returning from such areas. Diagnosis is mainly clinical and lesions heal well after the extraction of the larvae. Preventive measures such as ironing after drying of dresses and a good personal hygiene are crucial in controlling C. anthropophaga infestation.

  10. Stereoselectivity in bioaccumulation and excretion of epoxiconazole by mealworm beetle (Tenebrio molitor) larvae.

    Science.gov (United States)

    Lv, Xiaotian; Liu, Chen; Li, Yaobin; Gao, Yongxin; Wang, Huili; Li, Jianzhong; Guo, Baoyuan

    2014-09-01

    Stereoselectivity in bioaccumulation and excretion of stereoisomers of epoxiconazole by mealworm beetle (Tenebrio molitor) larvae through dietary exposure was investigated. Liquid chromatography tandem mass spectrometry (HPLC-MS/MS) method that use a ChiralcelOD-3R[cellulosetris-Tris-(3, 5-dichlorophenyl-carbamate)] chromatography column was applied to carry out chiral separation of the stereoisomers. Wheat bran was spiked with racemic epoxiconazole at two dose levels of 20mg/kg and 2mg/kg (dry weight) to feed T. molitor larvae. The results showed that both the doses of epoxiconazole were taken up by Tenebrio molitor larvae rapidly at the initial stages. There was a significant trend of stereoselective bioaccumulation in the larvae with a preferential accumulation of (-)-epoxiconazole in the 20mg/kg dose. The stereoselectivity in bioaccumulation in the 2mg/kg dosage was not obvious compared to the 20mg/kg group. Results of excretion indicated an active excretion is an important pathway for the larvae to eliminate epoxiconazole which was a passive transport process with non stereoselectivity. The faster elimination might be the reason for the low accumulation of epoxiconazole, as measured by bioaccumulation factor (BAF). Copyright © 2014 Elsevier Inc. All rights reserved.

  11. Effects of gamma radiation on larvae of Spodoptera frugiperda (Smith, 1797) (Lepidoptera: Noctuidae) fall armyworm

    International Nuclear Information System (INIS)

    Arthur, Valter; Arthur, Paula B.; Silva, Lucia C.A.S.; Franco, Jose G.; Harder, Marcia N.C.; Franco, Suely S.H.; Machi, Andre R.

    2013-01-01

    One of the most harmful insects the corn culture is the Spodoptera frugiperda (J.E. Smith, 1797) (Lepidoptera: Noctuidae), known commonly as fall armyworm, it is would originate of the tropical and subtropical areas of the American continent; its economical importance is due polyphagism, attacking countless grassy, such as corn, sorghum, wheat, barley, rice and pastures. One of the methods more used in the moment is the chemical control that during several applications the insect can turn resistant, then news researches has been made to the control of the insects. Due what was exposed the objective of the research was evaluated the effects of gamma radiation on larvae of S. frugiperda. Insects were rear in artificial diet. Each treatment had 5 repetitions with 20 larvae with 15-20 days of age in the total of 100 larvae per treatment. The larvae were irradiated with doses of gamma radiation of: 0 (control), 50, 100, 200 and 300 Gy, in source of Cobalt-60, type Gammacell-220, at dose rate of 0,508 kGy/hour. After irradiation the insects were keep in room with climatic conditions of 25 ± 5 dec C and 70 ± 5% R.H. Were evaluated the emergence of adults. The results showed that the dose of 300 Gy was the lethal dose to larvae irradiated, and 200 Gy the sterilizing dose to adults. (author)

  12. 60Co accumulation from sediment and planktonic algae by midge larvae (Chironomus luridus)

    International Nuclear Information System (INIS)

    Baudin, J.P.; Nucho, R.

    1992-01-01

    This paper reports the results of several experiments carried out to evaluate uptake and retention by a limicolous midge larva of 60 Co retained in sediment, either adsorbed on mineral particles or bound to planktonic algae. In order to determine their relative contributions in radionuclide accumulation, the different vectors (water, algae and sediment) were first labelled individually and then simultaneously. 60 Co accumulation from water and from algae results in a maximum concentration factor of 30 and in a mean trophic transfer factor of 4·5 × 10 −3 . The level of contamination of midge larvae from sediment is markedly influenced by the presence of endogenous organic matter. Thus the radionuclide transfer factor is about twice as high for larvae placed in labelled raw sediment than for larvae placed in labelled incinerated sediment, in the presence as in the absence of contaminated planktonic algae. Irrespective of the contamination conditions, 60 Co depuration from midge larvae is a very rapid phenomenon that corresponds, in all cases, to a radionuclide half-life of only a few days

  13. PREFERENSI PENEMPELAN, PERTUMBUHAN, DAN SINTASAN LARVA TERIPANG PASIR, Holothuria scabra PADA SUBSTRAT LAMUN YANG BERBEDA

    Directory of Open Access Journals (Sweden)

    Lisa Fajar Indriana

    2017-01-01

    Sandfish Holothuria scabra is marine commodities with a high economic value. Overfishing of natural stocks has compelled an interest to begin aquaculture practice. Settlement is a critical phase for the planktonic larvae as they will transform to benthic form in the presence of substrate. This study aims to evaluate the settlement preferences, growth, and survival rate of H. scabra larvae settled on different seagrass leaves. The research was conducted using the Completely randomized design with four different species of seagrass leaves and five replications. The treatments consist of Enhalus acoroides (L-1, Syringodium isoetifolium (L-2, Cymodocea serrulata (L-3, and Cymodocea rotundata (L-4. Initial number of larvae was 1,000 individuals and the substrate was set with same widthof 12 cm x 17 cm for each unit. Results of the experiment indicated that settlement preference and survival rate of H. scabra larvae was significantly affected by seagrass used as substrate while no significantly differences was observed for growth of larvae. E. acoroides showed the best result with 0.26 ind. cm-2 settelement preference and 10.66% survival rate, so that suitable to be used as settlement substrate in H. scabra hatchery.

  14. Effects of coded-wire-tagging on stream-dwelling Sea Lamprey larvae

    Science.gov (United States)

    Johnson, Nicholas; Swink, William D.; Dawson, Heather A.; Jones, Michael L.

    2016-01-01

    The effects of coded wire tagging Sea Lamprey Petromyzon marinus larvae from a known-aged stream-dwelling population were assessed. Tagged larvae were significantly shorter on average than untagged larvae from 3 to 18 months after tagging. However, 30 months after tagging, the length distribution of tagged and untagged larvae did not differ and tagged Sea Lampreys were in better condition (i.e., higher condition factor) and more likely to have undergone metamorphosis than the untagged population. The reason why tagged larvae were more likely to metamorphose is not clear, but the increased likelihood of metamorphosis could have been a compensatory response to the period of slower growth after tagging. Slower growth after tagging was consistent across larval size-classes, so handling and displacement from quality habitat during the early part of the growing season was likely the cause rather than the tag burden. The tag effects observed in this study, if caused by displacement and handling, may be minimized in future studies if tagging is conducted during autumn after growth has concluded for the year.

  15. Andrographolide powder treatment as antifeedant decreased digestive enzyme activity from Plutella xylostella (L.) larvae midgut

    Science.gov (United States)

    Madihah, Malini, Desak Made; Roviani, Hana; Rani, Nessa Vidya; Hermawan, Wawan

    2018-02-01

    Andrographolide, an active compound of Andrographis paniculata, has shown antifeedant activity against Plutella xylostella larvae by disrupting the midgut histological structures. This study aims to determine the activity of andrographolide in crystallized powder form against several digestive enzymes from the midgut of 4th instar P. xylostella larvae. The concentrations used were 0 (control), 1000, 1600, 2500, 4000 and 6500 ppm with four replications each. No-choice antifeedant test with leaf disc method is used in a bioassay for 24 hours. The midgut was dissected from 2nd until 6th segment of 4th instar larvae and was homogenized in iced-buffer solution. Furthermore, larvae's midgut samples were centrifuged at 10,000 rpm, 4°C for 20 min and the supernatant is used as enzyme source. The results showed that andrographolide significantly reduces the amylase, invertase, protease and trypsin activity, as well as total protein concentration compared with control (p<0.05) in a dose-dependent manner. This study provides information about the mode of action of andrographolide in inhibiting feed activity by the reduced digestive enzyme activity of 4th instar P. xylostella larvae.

  16. Overwintering biology and limits of cold tolerance in larvae of pistachio twig borer, Kermania pistaciella.

    Science.gov (United States)

    Mollaei, M; Izadi, H; Šimek, P; Koštál, V

    2016-08-01

    Pistachio twig borer, Kermania pistaciella is an important pest of pistachio trees. It has an univoltine life-cycle and its larvae tunnel and feed inside pistachio twigs for almost 10 months each year. The last larval instars overwinter inside the twigs. Survival/mortality associated with low temperatures during overwintering stage is currently unknown. We found that overwintering larvae of the Rafsanjan (Iran) population of K. pistaciella rely on maintaining a stably high supercooling capacity throughout the cold season. Their supercooling points (SCPs) ranged between -19.4 and -22.7°C from October to February. Larvae were able to survive 24 h exposures to -15°C anytime during the cold season. During December and January, larvae were undergoing quiescence type of dormancy caused probably by low ambient temperatures and/or changes in host tree physiology (tree dormancy). Larvae attain highest cold tolerance (high survival at -20°C) during dormancy, which offers them sufficient protection against geographically and ecologically relevant cold spells. High cold tolerance during dormancy was not associated with accumulation of any low-molecular mass cryoprotective substances. The SCP sets the limit of cold tolerance in pistachio twig borer, meaning that high mortality of overwintering populations can be expected only in the regions or years where or when the temperatures fall below the average larval SCP (i.e., below -20°C). Partial mortality can be expected also when temperatures repeatedly drop close to the SCP on a diurnal basis.

  17. STUDI AKTIVITAS ENZIM PENCERNAAN LARVA IKAN KUWE, Gnathanodon speciosus YANG DIPELIHARA DENGAN JENIS PAKAN AWAL BERBEDA

    Directory of Open Access Journals (Sweden)

    Titiek Aslianti

    2012-04-01

    Full Text Available Upaya kontinuitas produksi benih ikan kuwe, Gnathanodon speciosus telah dilakukan namun sintasan yang diperoleh belum stabil. Jenis dan ukuran pakan pada larva stadia awal seringkali menjadi penyebab utama kegagalan produksi benih. Aktivitas enzim pencernaan diketahui sangat terkait dengan jenis pakan yang dikonsumsi larva sehingga berdampak terhadap pertumbuhan dan sintasannya. Enzim protease, amilase, dan lipase merupakan indikator biologis yang dapat menunjukkan kesesuaian jenis pakan yang dikonsumsi larva melalui kemampuannya untuk mencerna. Penelitian bertujuan untuk mengetahui aktivitas enzim pencernaan larva ikan kuwe yang diberi ransum pakan awal berbeda yaitu rotifer, gonad kerang, dan kuning telur ayam. Penelitian dilakukan dengan menggunakan rancangan acak lengkap 3 perlakuan dengan 3 ulangan. Hasil penelitian menunjukkan bahwa aktivitas enzim protease, amilase, dan lipase pada ketiga perlakuan mempunyai korelasi positif terhadap pertumbuhan. Aktivitas enzim pencernaan cenderung meningkat pada saat larva mulai menerima pakan eksogen (D-2, kemudian menurun pada D-3–D-7 selanjutnya relatif stabil hingga akhir penelitian (D-30. Pakan awal kuning telur menghasilkan pertumbuhan (TL = 13,3±1,77 mm dan sintasan benih (55,42% paling tinggi daripada rotifer (TL = 10,6±1,51 mm; SR 52,42% maupun gonad kerang (TL = 12,7±2,67 mm; 52,45%. Hasil penelitian diharapkan dapat meningkatkan produksi benih sebagai pasok yang kontinu dalam mendukung pengembangan budidaya.

  18. Aquatic respiration as a potential survival mechanism of Brephidium pseudofea (Lepidoptera: Lycaenidae) larvae to intertidal environments.

    Science.gov (United States)

    Warren, V; Daniels, J C; Hahn, D A

    2011-10-01

    The eastern pygmy blue, Brephidium pseudofea (Morrison) (Lepidoptera: Lycaenidae: Polyommatinae), inhabits intertidal environments that are periodically flooded. The immature stages are subject to salt or brackish water inundation during this time and therefore must endure many stressors, including respiratory limitation and salt exposure. Our goal was to investigate possible mechanisms used by the larval stages of B. pseudofea to endure periodic tidal inundation by using physiological and morphological analyses in comparison with several species of terrestrial lepidopteran larvae. A review of tidal charts showed that the immature stages of B. pseudofea would be prone to complete inundation two to five times per month during the summer months (May to August) and partial submersion for up to 20 d per month during the rest of the year. Larvae of several terrestrial lepidopteran species studied consumed oxygen under water for a limited period, but B. pseudofea demonstrated substantially higher oxygen consumption. Light microscopy of B. pseudofea larvae revealed small air pockets in and around the spiracles when submerged in tap water; these air pockets disappeared when exposed to detergent solution. The resulting air pockets may function as a diffusion layer for oxygen to be absorbed from the surrounding water or may act in conjunction with trans-cuticular gas exchange to meet the larva's respiratory needs. Morphological examination by scanning electron microscopy showed that B. psudofea larvae have distinctively small, clavate setae that appear insufficient to effectively support a functional plastron.

  19. High mortality of the larvae of the common mussel at low concentrations of tributyltin

    Energy Technology Data Exchange (ETDEWEB)

    Beaumont, A.R.; Budd, M.D.

    1984-11-01

    Laboratory reared veliger larvae of the common mussel Mytilus edulis were grown for 15 days in filtered seawater containing 10 ..mu..g l/sup -1/, 1 ..mu..g l/sup -1/ and 0.1 ..mu..g l/sup -1/ tributyltin oxide, (TBTO), the biocide in recent antifouling paint formulations. No larvae survived longer than 5 days in 10 ..mu..g l/sup -1/ TBTO. Approximately half the larvae subjected to 0.1 ..mu..g/sup -1/ TBTO were dead by day 15 (approximately 15 day LC/sub 50/ = 0.1 ..sqrt..g l/sup -1/ TBTO) and most of the surviving larvae were moribund and had grown significantly more slowly than controls. It is noted that current recorded levels of TBT at several UK estuarine sites are higher than 0.1 ..mu..g l/sup -1/ and there has therefore probably been a high mortality of mussel larvae at such sites. The results are discussed in relation to the reported short-term toxicity of organotins to other marine organisms and the value of carrying out longer term tests at low levels of TBT is pointed out.

  20. Survival Rate and Growth of Fighting Fish Larvae (Betta splendens Regan Fed on Various Live Foods

    Directory of Open Access Journals (Sweden)

    T. Budiardi

    2007-01-01

    Full Text Available Larval of fighting fish (Betta splendens Regan requires precise live foods for its growth and survival. In this experiment, fish larvae were fed on either Paramecium + Artemia, Paramecium + Artemia + Tubifex, Paramecium + Moina, or Paramecium + Moina + Tubifex. The fish were fed Paramecium from day-2 till day-7 after hatching. There after, the live food was changed according to the treatments till day-28.  Results showed that fish fed on Paramecium + Artemia significantly had the highest total length (12.63 mm than other treatments (11.86 mm. On the other hand, survival rate of fish had no significant affected by the treatments. Keywords: fighting fish, Betta splendens, Paramecium, Moina, Artemia, Tubifex, larvae   ABSTRAK Larva ikan betta (Betta splendens Regan membutuhkan jenis pakan alami yang tepat bagi kelangsungan hidup dan pertumbuhannya. Pada penelitian ini, larva ikan diberi pakan berupa Paramecium + Artemia, Paramecium + Artemia + Tubifex, Paramecium + Moina, atau Paramecium + Moina + Tubifex.  Ikan diberi pakan pakan berupa Paramecium dari hari ke-2 hingga hari ke-7. Setelah itu, pemberian pakan alami diubah berdasarkan masing-masing perlakuan hingga hari ke-28.  Hasil penelitian menunjukkan bahwa ikan yang diberi pakan Paramecium + Artemia memiliki tubuh secara signifikan lebih panjang (12,63 mm dibandingkan perlakuan lainnya (11,86 mm.  Sementara itu, kelangsungan hidup tidak dipengatuhi oleh perlakuan. Kata kunci: ikan betta, Betta splendens, Paramecium, Moina, Artemia, Tubifex, larva