WorldWideScience

Sample records for brugia malayi larvae

  1. Anti-idiotypic antibodies function as a surrogate surface epitope of Brugia malayi infective larvae.

    Science.gov (United States)

    Carlow, C K; Busto, P; Storey, N; Philipp, M

    1990-07-01

    Anti-idiotypic (AB2) antibodies were generated in rabbits following immunization with a murine IgM monoclonal antibody (AB1) recognizing a surface determinant of Brugia malayi infective stage larvae. AB2 specifically inhibited the binding of AB1 to B. malayi larvae. Furthermore, AB2 had the ability to mimic the original antigen since mice immunized with AB2 possessed serum antibodies (AB3) specific for the B. malayi surface determinant. The presence of anti-surface antibodies (AB3 and AB1) induced either by AB2 immunization or by administration of AB1, did not alter the outcome of an intraperitoneal infection of B. malayi larvae in BABL/c mice when compared to untreated animals. AB3 antibodies like AB1, were IgM, thus indicating an isotype restricted response to the B. malayi epitope. There were no detectable cell mediated responses to the surface determinant in mice immunized with AB2, assessed by lymphocyte blastogenesis or IL3 production in vitro in response to the idiotope as presented by living larvae. The lack of cellular responses and/or the previously demonstrated rapid shedding of the epitope may explain the inability of AB1 or AB2 to protect mice against larval challenge in this study.

  2. Brugia malayi: vaccination of jirds with /sup 60/cobalt-attenuated infective stage larvae protects against homologous challenge

    Energy Technology Data Exchange (ETDEWEB)

    Yates, J.A.; Higashi, G.I.

    1985-11-01

    Vaccination of inbred jirds (Meriones unguiculatus) with /sup 60/cobalt radiation-attenuated Brugia malayi infective stage larvae (L3) protected against homologous challenge given either subcutaneously (sc) or by the intraperitoneal (ip) route. Groups of jirds vaccinated once sc with 75, 15 Krad L3 showed from 69% to 91% reduction in recovered worms after ip challenge infection compared to infection in non-vaccinated control jirds, while 75% reduction in mean worm burden was seen in jirds receiving sc challenge infection. A single sc vaccination with 75, 10 or 20 Krad L3 produced no protection (10 Krad) and 64% reduction in recovered worms (20 Krad). Therefore the 15 Krad dose appeared to be best. A marked increase in anti-B. malayi antibody in vaccinated jirds was seen (by ELISA) immediately after challenge infection and an immunofluorescence assay showed that L3 incubated in serum from vaccinated jirds were completely and uniformly covered with specific antibody. Eosinophil-rich granulomas containing dead and moribund L3 were recovered from vaccinated jirds. This model of protective immunity in a Brugia-susceptible small rodent may provide a useful system for identification of molecularly defined filarial-protective immunogens.

  3. 蚊体内马来丝虫幼虫的基因检测%Studies on Gene Detection of Brugia malayi Larvae in Mosquito

    Institute of Scientific and Technical Information of China (English)

    陈锡欣; 黄炳成; 刘慎良; 韩广东; 刘新

    2001-01-01

    目的:探索蚊体内马来丝虫幼虫基因检测的新方法,并用于丝虫病监测。方法:利用基因工程技术合成马来丝虫寡核苷酸片段,经32P标记后作为探针,以斑点杂交法检测蚊体内马来丝虫幼虫。结果:该探针可从多种标本中特异地检出马来幼丝虫DNA,敏感性为2ng靶DNA量,蚊体内含1条幼虫即可出现阳性杂交。结论:该技术具有良好的实用性,可用于蚊体内马来丝虫幼虫的基因检测。%Objective:To establish a new method for gene detection of Brugiamalayi larvae in mosquito and use it in filariasis surveillance. Methods:Oligonucleotide fragment of Brugia malayi synthesized by genetic engineering technique was labeled with 32P and used as probe. The B.malayi larvae in mosquito was detected with dot blot. Results: Brugia malayi larvae DNA could be specifically detected in different samples with this probe and the sensitivity was 2 ng target DNA of B.malayi. Even only one larvae in mosquito could be detected after hybridization. Conclusions:This method is practicable and reliable for gene detection of Brugia malayi larvae in mosquito.

  4. Distribution of Brugia malayi larvae and DNA in vector and non-vector mosquitoes: implications for molecular diagnostics

    Directory of Open Access Journals (Sweden)

    Christensen Bruce M

    2009-11-01

    Full Text Available Abstract Background The purpose of this study was to extend prior studies of molecular detection of Brugia malayi DNA in vector (Aedes aegypti- Liverpool and non-vector (Culex pipiens mosquitoes at different times after ingestion of infected blood. Results Parasite DNA was detected over a two week time course in 96% of pooled thoraces of vector mosquitoes. In contrast, parasite DNA was detected in only 24% of thorax pools from non-vectors; parasite DNA was detected in 56% of midgut pools and 47% of abdomen pools from non-vectors. Parasite DNA was detected in vectors in the head immediately after the blood meal and after 14 days. Parasite DNA was also detected in feces and excreta of the vector and non-vector mosquitoes which could potentially confound results obtained with field samples. However, co-housing experiments failed to demonstrate transfer of parasite DNA from infected to non-infected mosquitoes. Parasites were also visualized in mosquito tissues by immunohistololgy using an antibody to the recombinant filarial antigen Bm14. Parasite larvae were detected consistently after mf ingestion in Ae. aegypti- Liverpool. Infectious L3s were seen in the head, thorax and abdomen of vector mosquitoes 14 days after Mf ingestion. In contrast, parasites were only detected by histology shortly after the blood meal in Cx. pipiens, and these were not labeled by the antibody. Conclusion This study provides new information on the distribution of filarial parasites and parasite DNA in vector and non-vector mosquitoes. This information should be useful for those involved in designing and interpreting molecular xenomonitoring studies.

  5. Detection of Brugia malayi infected mosquitoes with a species specific DNA probe

    International Nuclear Information System (INIS)

    A species specific DNA probe (pβm15) was used in a field area where two filarial infections coexist: Brugia malayi in man and Brugia pahangi in cats. In our laboratory at Jakarta, this DNA probe proved to be sensitive enough to detect 500 pg of purified Brugia malayi microfilarial DNA. One to two infective larvae of Brugia malayi could be detected with ease. This DNA probe did not react with infective larvae of Brugia pahangi, Wuchereria bancrofti and Dirofilaria spp. Mosquitoes, which are vectors in Riau, were collected and fed on microfilaremic patients of Riau. The set of mosquitoes were tested in parallel with mosquitoes infected with Brugia pahangi from cats. All fed mosquitoes were tested after 10-12 days. Only mosquitoes infected with Brugia malayi reacted with the assay. This study shows that we have succeeded in applying the DNA probe technique in Jakarta. Further application in the field should be encouraged, with some modification of the DNA probing techniques for cheaper and easier implementation. 6 refs, 3 figs, 1 tab

  6. In vitro silencing of Brugia malayi trehalose-6-phosphate phosphatase impairs embryogenesis and in vivo development of infective larvae in jirds.

    Directory of Open Access Journals (Sweden)

    Susheela Kushwaha

    Full Text Available BACKGROUND: The trehalose metabolic enzymes have been considered as potential targets for drug or vaccine in several organisms such as Mycobacterium, plant nematodes, insects and fungi due to crucial role of sugar trehalose in embryogenesis, glucose uptake and protection from stress. Trehalose-6-phosphate phosphatase (TPP is one of the enzymes of trehalose biosynthesis that has not been reported in mammals. Silencing of tpp gene in Caenorhabditis elegans revealed an indispensable functional role of TPP in nematodes. METHODOLOGY AND PRINCIPAL FINDINGS: In the present study, functional role of B. malayi tpp gene was investigated by siRNA mediated silencing which further validated this enzyme to be a putative antifilarial drug target. The silencing of tpp gene in adult female B. malayi brought about severe phenotypic deformities in the intrauterine stages such as distortion and embryonic development arrest. The motility of the parasites was significantly reduced and the microfilarial production as well as their in vitro release from the female worms was also drastically abridged. A majority of the microfilariae released in to the culture medium were found dead. B. malayi infective larvae which underwent tpp gene silencing showed 84.9% reduced adult worm establishment after inoculation into the peritoneal cavity of naïve jirds. CONCLUSIONS/SIGNIFICANCE: The present findings suggest that B. malayi TPP plays an important role in the female worm embryogenesis, infectivity of the larvae and parasite viability. TPP enzyme of B. malayi therefore has the potential to be exploited as an antifilarial drug target.

  7. Identification of Brugia malayi in vectors with a species-specific DNA probe.

    Science.gov (United States)

    Sim, B K; Mak, J W; Cheong, W H; Sutanto, I; Kurniawan, L; Marwoto, H A; Franke, E; Campell, J R; Wirth, D F; Piessens, W F

    1986-05-01

    We evaluated the potential value of a cloned sequence of genomic DNA of Brugia malayi as a species-specific probe. Clone pBm 15 reacted with all stages of 8 different geographic isolates of B. malayi and cross-hybridized with microfilariae of B. timori. It did not hybridize with Wuchereria bancrofti or with B. pahangi, W. kalimantani, Dirofilaria repens, Breinlia booliati or Cardiofilaria species, animal filariids that can be sympatric with B. malayi. P32-labeled clone pBm 15 correctly identified mosquitoes infected even with 1 infective larva of B. malayi. This specific DNA probe should be an invaluable tool to monitor control programs of Brugian filariasis. PMID:3518507

  8. Draft genome of the filarial nematode parasite Brugia malayi.

    Science.gov (United States)

    Ghedin, Elodie; Wang, Shiliang; Spiro, David; Caler, Elisabet; Zhao, Qi; Crabtree, Jonathan; Allen, Jonathan E; Delcher, Arthur L; Guiliano, David B; Miranda-Saavedra, Diego; Angiuoli, Samuel V; Creasy, Todd; Amedeo, Paolo; Haas, Brian; El-Sayed, Najib M; Wortman, Jennifer R; Feldblyum, Tamara; Tallon, Luke; Schatz, Michael; Shumway, Martin; Koo, Hean; Salzberg, Steven L; Schobel, Seth; Pertea, Mihaela; Pop, Mihai; White, Owen; Barton, Geoffrey J; Carlow, Clotilde K S; Crawford, Michael J; Daub, Jennifer; Dimmic, Matthew W; Estes, Chris F; Foster, Jeremy M; Ganatra, Mehul; Gregory, William F; Johnson, Nicholas M; Jin, Jinming; Komuniecki, Richard; Korf, Ian; Kumar, Sanjay; Laney, Sandra; Li, Ben-Wen; Li, Wen; Lindblom, Tim H; Lustigman, Sara; Ma, Dong; Maina, Claude V; Martin, David M A; McCarter, James P; McReynolds, Larry; Mitreva, Makedonka; Nutman, Thomas B; Parkinson, John; Peregrín-Alvarez, José M; Poole, Catherine; Ren, Qinghu; Saunders, Lori; Sluder, Ann E; Smith, Katherine; Stanke, Mario; Unnasch, Thomas R; Ware, Jenna; Wei, Aguan D; Weil, Gary; Williams, Deryck J; Zhang, Yinhua; Williams, Steven A; Fraser-Liggett, Claire; Slatko, Barton; Blaxter, Mark L; Scott, Alan L

    2007-09-21

    Parasitic nematodes that cause elephantiasis and river blindness threaten hundreds of millions of people in the developing world. We have sequenced the approximately 90 megabase (Mb) genome of the human filarial parasite Brugia malayi and predict approximately 11,500 protein coding genes in 71 Mb of robustly assembled sequence. Comparative analysis with the free-living, model nematode Caenorhabditis elegans revealed that, despite these genes having maintained little conservation of local synteny during approximately 350 million years of evolution, they largely remain in linkage on chromosomal units. More than 100 conserved operons were identified. Analysis of the predicted proteome provides evidence for adaptations of B. malayi to niches in its human and vector hosts and insights into the molecular basis of a mutualistic relationship with its Wolbachia endosymbiont. These findings offer a foundation for rational drug design.

  9. The Immunodominant Brugia malayi Paramyosin as a Marker of Current Infection with Wuchereria bancrofti Adult Worms

    OpenAIRE

    Langy, Sandra; Plichart, Catherine; Luquiaud, Patrick; Williams, Steven A.; Nicolas, Luc

    1998-01-01

    The full-length cDNA sequence encoding Brugia malayi L3 paramyosin has been isolated by immunoscreening a cDNA library with a mouse antiserum raised against Wuchereria bancrofti L3 infective larvae. A recombinant truncated form of paramyosin was expressed as a glutathione S-transferase fusion protein and used to evaluate humoral responses of adults from a W. bancrofti-endemic area in French Polynesia according to their parasitological status. Immunoglobulin G4 (IgG4) preferentially bound to p...

  10. Whole body lymphangioscintigraphy in ferrets chronically infected with Brugia malayi

    Energy Technology Data Exchange (ETDEWEB)

    Witte, M.; McNeill, G.; Crandall, C.; Case, T.; Witte, C.; Crandall, R.; Hall, J.; Williams, W.

    1988-12-01

    Whole body lymphangioscintigraphy was performed after intradermal injection of /sup 99m/technetium human serum albumin or antimony colloid in the distal hindlimbs and forelimbs of ferrets chronically infected with Brugia malayi. The findings were compared with control ferrets and those with surgical interruption of the iliac lymphatics. While only one infected ferret manifested chronic hindlimb lymphedema, all exhibited delayed transport of radioisotope from the hindpaw with obstruction in the groin, poor or absent visualization of central lymphatic channels and regional lymph nodes, a picture similar to that following surgically induced lymphatic obstruction. In control ferrets, there was prompt visualization of peripheral lymphatic channels and regional lymph nodes with sharper and more extensive channel visualization after radiolabeled albumin and more intense sustained nodal visualization after radiolabeled antimony colloid. This noninvasive technique provides a readily repeatable investigative tool adaptable to small animals to study the evolution of lymphatic filariasis and other conditions associated with lymphatic obstruction.

  11. The effect of chitin synthesis inhibitors on the development of Brugia malayi in Aedes aegypti.

    Science.gov (United States)

    Mohapatra, R; Ranjit, M R; Dash, A P

    1996-09-01

    Two chitin synthesis inhibitors (CSIs) viz., triflumuron and hexaflumuron interfere++ with the development of Brugia malayi in Aedes aegypti (a black-eyed Liverpool strain). The development of B. malayi was slow in both the treated populations and the infection rate, infectivity rate and L3 load per mosquito decreased significantly (P triflumuron. PMID:8984113

  12. Moxidectin causes adult worm mortality of human lymphatic filarial parasite Brugia malayi in rodent models.

    Science.gov (United States)

    Verma, Meenakshi; Pathak, Manisha; Shahab, Mohd; Singh, Kavita; Mitra, Kalyan; Misra-Bhattacharya, Shailja

    2014-12-01

    Moxidectin is a macrocyclic lactone belonging to milbemycin family closely related to ivermectin and is currently progressing towards Phase III clinical trial against human infection with the filaria Onchocerca volvulus (Leuckart, 1894). There is a single report on the microfilaricidal and embryostatic activity of moxidectin in case of the human lymphatic filarial parasite Brugia malayi (Brug, 1927) in Mastomys coucha (Smith) but without any adulticidal action. In the present study, the in vitro and in vivo antifilarial efficacy of moxidectin was evaluated on, B. malayi. In vitro moxidectin showed 100% reduction in adult female worm motility at 0.6 μM concentration within 7 days with 68% inhibition in the reduction of MTT (3-(4, 5-dimethylthiazol-2-yl)-2,5-diphenyl tetrazolium bromide dye) (which is used to detect viability of worms). A 50% inhibitory concentration (IC50) of moxidectin for adult female parasite was 0.242 μM, for male worm 0.186 μM and for microfilaria IC50 was 0.813 μM. In adult B. malayi-transplanted primary screening model (Meriones unguiculatus Milne-Edwards), moxidectin at a single optimal dose of 20 mg/kg by oral and subcutaneous route was found effective on both adult parasites and microfilariae. In secondary screening (M coucha, subcutaneously inoculated with infective larvae), moxidectin at the same dose by subcutaneous route brought about death of 49% of adult worms besides causing sterilisation in 54% of the recovered live female worms. The treated animals exhibited a continuous and sustained reduction in peripheral blood microfilaraemia throughout the observation period of 90 days. The mechanism of action of moxidectin is suggested to be similar to avermectins. The in silico studies were also designed to explore the interaction of moxidectin with glutamate-gated chloride channels of B. malayi. The docking results revealed a close interaction of moxidectin with various GluCl ligand sites of B. malayi. PMID:25651699

  13. Dissection and PCR-based detection of Brugia malayi on Mansonia spp in Tanjung Jabung Timur District

    Directory of Open Access Journals (Sweden)

    Santoso

    2015-06-01

    Full Text Available Filariasis is a public health problem in East Tanjung Jabung. Eventhough that mass treatment had been carried out since 2002, there were still villages with microfilaria rate >1%. This study aims to detect filarial worm larvae in the mosquitoes with dissections and PCR method. The mosquitoes used in this study were Mansonia spp. The number of mosquitoes that examined was 450,133 and some of Mansonia mosquitoes were checked by PCR. The result showed that microscopic dissection did not found stage 3 (L3 of filarial worm larvae in the mosquitoes. The results from PCR test showed the presence of B. malayi DNA in 8 samples of Ma. indiana. Mansonia indiana is a potential vectors for Brugia malayi filariasis in East Tanjung Jabung. PCR method is more sensitive examination in detecting microfilaria compared with dissection method.

  14. A STUDY ON THE MICROFILARIAL PERIODICITY AT BIREUEN, THE TYPE LOCALITY OF BRUGIA MALAYI (BRUG, 1927

    Directory of Open Access Journals (Sweden)

    Menabu Sasa

    2012-09-01

    Full Text Available Brugia malayi ('Brug, 1927 adalah salah satu bibit penyakit filaría yang ditemukan di Indonesia yang dilaporkan pertama kali oleh Brug ditahun 1927 dari daerah endemis Bireuen, Aceh Utara. Walaupun akhir-akhir ini diketahui di Indonesia bahwa B. malayi ini mempunyai sifat periodisitas yang periodik nokturna dan juga sub-periodik nokturna, namun dari daerah endemis Bireuen dimana parasit ini pertama kali ditemukan dan dilaporkan belum jelas sifat periodisitasnya. Oleh sebab itulah dilakukan penyelidikan didaerah ini guna menentukan sifat periodisitas dari B. malayi didaerah endemis dimana pertama kali bibit penyakit dilaporkan. Dari hasil penyelidikan didaerah endemis Bireuen pada bulan Agustus tahun 1974 ini ternyata bahwa B. malayi yang ditemukan mempunyai sifat periodisitas yang periodik nokturna. Disamping itu ditemukan pula bibit penyakit filaría dari jenis Wuchereria bancrofti yang juga mempunyai sifat periodisitas yang periodik nokturna.

  15. The genome of Brugia malayi – all worms are not created equal

    OpenAIRE

    Scott, Alan; Ghedin, Elodie

    2008-01-01

    Filarial nematode parasites, the causative agents of elephantiasis and river blindness, undermine the livelihoods of over one hundred millions people in the developing world. Recently, the Filarial Genome Project reported the draft sequence of the ~95 Mb genome of the human filarial parasite Brugia malayi - the first parasitic nematode genome to be sequenced. Comparative genome analysis with the prevailing model nematode Caenorhabditis elegans revealed similarities and differences in genome s...

  16. Modeling analysis of GST (glutathione-S-transferases) from Wuchereria bancrofti and Brugia malayi

    OpenAIRE

    Bhargavi, Rayavarapu; Vishwakarma, Siddharth; Murty, Upadhyayula Suryanarayana

    2005-01-01

    GST (glutathione S-transferases) are a family of detoxification enzymes that catalyze the conjugation of reduced GSH (glutathione) to xenobiotic (endogenous electrophilic) compounds. GST from Wb (Wuchereria bancrofti) and Bm (Brugia malayi) are significantly different from human GST in sequence and structure. Thus, Wb-GST and Bm-GST are potential chemotherapeutic targets for anti-filarial treatment. Comparison of modeled Wb and Bm GST with human GST show structural difference between them. An...

  17. Diversity and expression of microRNAs in the filarial parasite, Brugia malayi.

    Directory of Open Access Journals (Sweden)

    Catherine B Poole

    Full Text Available Human filarial parasites infect an estimated 120 million people in 80 countries worldwide causing blindness and the gross disfigurement of limbs and genitals. An understanding of RNA-mediated regulatory pathways in these parasites may open new avenues for treatment. Toward this goal, small RNAs from Brugia malayi adult females, males and microfilariae were cloned for deep-sequencing. From ∼ 30 million sequencing reads, 145 miRNAs were identified in the B. malayi genome. Some microRNAs were validated using the p19 RNA binding protein and qPCR. B. malayi miRNAs segregate into 99 families each defined by a unique seed sequence. Sixty-one of the miRNA families are highly conserved with homologues in arthropods, vertebrates and helminths. Of those miRNAs not highly conserved, homologues of 20 B. malayi miRNA families were found in vertebrates. Nine B. malayi miRNA families appear to be filarial-specific as orthologues were not found in other organisms. The miR-2 family is the largest in B. malayi with 11 members. Analysis of the sequences shows that six members result from a recent expansion of the family. Library comparisons found that 1/3 of the B. malayi miRNAs are differentially expressed. For example, miR-71 is 5-7X more highly expressed in microfilariae than adults. Studies suggest that in C.elegans, miR-71 may enhance longevity by targeting the DAF-2 pathway. Characterization of B. malayi miRNAs and their targets will enhance our understanding of their regulatory pathways in filariads and aid in the search for novel therapeutics.

  18. Diversity and expression of microRNAs in the filarial parasite, Brugia malayi.

    Science.gov (United States)

    Poole, Catherine B; Gu, Weifeng; Kumar, Sanjay; Jin, Jingmin; Davis, Paul J; Bauche, David; McReynolds, Larry A

    2014-01-01

    Human filarial parasites infect an estimated 120 million people in 80 countries worldwide causing blindness and the gross disfigurement of limbs and genitals. An understanding of RNA-mediated regulatory pathways in these parasites may open new avenues for treatment. Toward this goal, small RNAs from Brugia malayi adult females, males and microfilariae were cloned for deep-sequencing. From ∼ 30 million sequencing reads, 145 miRNAs were identified in the B. malayi genome. Some microRNAs were validated using the p19 RNA binding protein and qPCR. B. malayi miRNAs segregate into 99 families each defined by a unique seed sequence. Sixty-one of the miRNA families are highly conserved with homologues in arthropods, vertebrates and helminths. Of those miRNAs not highly conserved, homologues of 20 B. malayi miRNA families were found in vertebrates. Nine B. malayi miRNA families appear to be filarial-specific as orthologues were not found in other organisms. The miR-2 family is the largest in B. malayi with 11 members. Analysis of the sequences shows that six members result from a recent expansion of the family. Library comparisons found that 1/3 of the B. malayi miRNAs are differentially expressed. For example, miR-71 is 5-7X more highly expressed in microfilariae than adults. Studies suggest that in C.elegans, miR-71 may enhance longevity by targeting the DAF-2 pathway. Characterization of B. malayi miRNAs and their targets will enhance our understanding of their regulatory pathways in filariads and aid in the search for novel therapeutics.

  19. Molecular evidence for a functional ecdysone signaling system in Brugia malayi.

    Directory of Open Access Journals (Sweden)

    George Tzertzinis

    Full Text Available BACKGROUND: Filarial nematodes, including Brugia malayi, the causative agent of lymphatic filariasis, undergo molting in both arthropod and mammalian hosts to complete their life cycles. An understanding of how these parasites cross developmental checkpoints may reveal potential targets for intervention. Pharmacological evidence suggests that ecdysteroids play a role in parasitic nematode molting and fertility although their specific function remains unknown. In insects, ecdysone triggers molting through the activation of the ecdysone receptor: a heterodimer of EcR (ecdysone receptor and USP (Ultraspiracle. METHODS AND FINDINGS: We report the cloning and characterization of a B. malayi EcR homologue (Bma-EcR. Bma-EcR dimerizes with insect and nematode USP/RXRs and binds to DNA encoding a canonical ecdysone response element (EcRE. In support of the existence of an active ecdysone receptor in Brugia we also cloned a Brugia rxr (retinoid X receptor homolog (Bma-RXR and demonstrate that Bma-EcR and Bma-RXR interact to form an active heterodimer using a mammalian two-hybrid activation assay. The Bma-EcR ligand-binding domain (LBD exhibits ligand-dependent transactivation via a GAL4 fusion protein combined with a chimeric RXR in mammalian cells treated with Ponasterone-A or a synthetic ecdysone agonist. Furthermore, we demonstrate specific up-regulation of reporter gene activity in transgenic B. malayi embryos transfected with a luciferase construct controlled by an EcRE engineered in a B. malayi promoter, in the presence of 20-hydroxy-ecdysone. CONCLUSIONS: Our study identifies and characterizes the two components (Bma-EcR and Bma-RXR necessary for constituting a functional ecdysteroid receptor in B. malayi. Importantly, the ligand binding domain of BmaEcR is shown to be capable of responding to ecdysteroid ligands, and conversely, ecdysteroids can activate transcription of genes downstream of an EcRE in live B. malayi embryos. These results together

  20. Mining predicted essential genes of Brugia malayi for nematode drug targets.

    Science.gov (United States)

    Kumar, Sanjay; Chaudhary, Kshitiz; Foster, Jeremy M; Novelli, Jacopo F; Zhang, Yinhua; Wang, Shiliang; Spiro, David; Ghedin, Elodie; Carlow, Clotilde K S

    2007-01-01

    We report results from the first genome-wide application of a rational drug target selection methodology to a metazoan pathogen genome, the completed draft sequence of Brugia malayi, a parasitic nematode responsible for human lymphatic filariasis. More than 1.5 billion people worldwide are at risk of contracting lymphatic filariasis and onchocerciasis, a related filarial disease. Drug treatments for filariasis have not changed significantly in over 20 years, and with the risk of resistance rising, there is an urgent need for the development of new anti-filarial drug therapies. The recent publication of the draft genomic sequence for B. malayi enables a genome-wide search for new drug targets. However, there is no functional genomics data in B. malayi to guide the selection of potential drug targets. To circumvent this problem, we have utilized the free-living model nematode Caenorhabditis elegans as a surrogate for B. malayi. Sequence comparisons between the two genomes allow us to map C. elegans orthologs to B. malayi genes. Using these orthology mappings and by incorporating the extensive genomic and functional genomic data, including genome-wide RNAi screens, that already exist for C. elegans, we identify potentially essential genes in B. malayi. Further incorporation of human host genome sequence data and a custom algorithm for prioritization enables us to collect and rank nearly 600 drug target candidates. Previously identified potential drug targets cluster near the top of our prioritized list, lending credibility to our methodology. Over-represented Gene Ontology terms, predicted InterPro domains, and RNAi phenotypes of C. elegans orthologs associated with the potential target pool are identified. By virtue of the selection procedure, the potential B. malayi drug targets highlight components of key processes in nematode biology such as central metabolism, molting and regulation of gene expression.

  1. Mining predicted essential genes of Brugia malayi for nematode drug targets.

    Directory of Open Access Journals (Sweden)

    Sanjay Kumar

    Full Text Available We report results from the first genome-wide application of a rational drug target selection methodology to a metazoan pathogen genome, the completed draft sequence of Brugia malayi, a parasitic nematode responsible for human lymphatic filariasis. More than 1.5 billion people worldwide are at risk of contracting lymphatic filariasis and onchocerciasis, a related filarial disease. Drug treatments for filariasis have not changed significantly in over 20 years, and with the risk of resistance rising, there is an urgent need for the development of new anti-filarial drug therapies. The recent publication of the draft genomic sequence for B. malayi enables a genome-wide search for new drug targets. However, there is no functional genomics data in B. malayi to guide the selection of potential drug targets. To circumvent this problem, we have utilized the free-living model nematode Caenorhabditis elegans as a surrogate for B. malayi. Sequence comparisons between the two genomes allow us to map C. elegans orthologs to B. malayi genes. Using these orthology mappings and by incorporating the extensive genomic and functional genomic data, including genome-wide RNAi screens, that already exist for C. elegans, we identify potentially essential genes in B. malayi. Further incorporation of human host genome sequence data and a custom algorithm for prioritization enables us to collect and rank nearly 600 drug target candidates. Previously identified potential drug targets cluster near the top of our prioritized list, lending credibility to our methodology. Over-represented Gene Ontology terms, predicted InterPro domains, and RNAi phenotypes of C. elegans orthologs associated with the potential target pool are identified. By virtue of the selection procedure, the potential B. malayi drug targets highlight components of key processes in nematode biology such as central metabolism, molting and regulation of gene expression.

  2. Glucose and Glycogen Metabolism in Brugia malayi Is Associated with Wolbachia Symbiont Fitness.

    Science.gov (United States)

    Voronin, Denis; Bachu, Saheed; Shlossman, Michael; Unnasch, Thomas R; Ghedin, Elodie; Lustigman, Sara

    2016-01-01

    Wolbachia are endosymbiotic bacteria found in the majority of arthropods and filarial nematodes of medical and veterinary importance. They have evolved a wide range of symbiotic associations. In filarial nematodes that cause human lymphatic filariasis (Wuchereria bancrofti, Brugia malayi) or onchocerciasis (Onchocerca volvulus), Wolbachia are important for parasite development, reproduction and survival. The symbiotic bacteria rely in part on nutrients and energy sources provided by the host. Genomic analyses suggest that the strain of Wolbachia found in B. malayi (wBm) lacks the genes for two glycolytic enzymes--6-phosphofructokinase and pyruvate kinase--and is thus potentially unable to convert glucose into pyruvate, an important substrate for energy generation. The Wolbachia surface protein, wBm00432, is complexed to six B. malayi glycolytic enzymes, including aldolase. In this study we characterized two B. malayi aldolase isozymes and found that their expression is dependent on Wolbachia fitness and number. We confirmed by immuno-transmission electron microscopy that aldolase is associated with the Wolbachia surface. RNAi experiments suggested that aldolase-2 plays a significant role in both Wolbachia survival and embryogenesis in B. malayi. Treatment with doxycycline reduced Wolbachia fitness and increased the amount of both glucose and glycogen detected in the filarial parasite, indicating that glucose metabolism and glycogen storage in B. malayi are associated with Wolbachia fitness. This metabolic co-dependency between Wolbachia and its filarial nematode indicates that glycolysis could be a shared metabolic pathway between the bacteria and B. malayi, and thus a potential new target for anti-filarial therapy. PMID:27078260

  3. Insights into the structure-function relationship of Brugia malayi thymidylate kinase (BmTMK).

    Science.gov (United States)

    Doharey, Pawan Kumar; Singh, Sudhir Kumar; Verma, Pravesh; Verma, Anita; Rathaur, Sushma; Saxena, Jitendra Kumar

    2016-07-01

    Lymphatic filariasis is a debilitating disease caused by lymph dwelling nematodal parasites like Wuchereria bancrofti, Brugia malayi and Brugia timori. Thymidylate kinase of B. malayi is a key enzyme in the de novo and salvage pathways for thymidine 5'-triphosphate (dTTP) synthesis. Therefore, B. malayi thymidylate kinase (BmTMK) is an essential enzyme for DNA biosynthesis and an important drug target to rein in filariasis. In the present study, the structural and functional changes associated with recombinant BmTMK, in the presence of protein denaturant GdnHCl, urea and pH were studied. GdnHCl and urea induced unfolding of BmTMK is non-cooperative and influence the functional property of the enzyme much lower than their Cm values. The study delineate that BmTMK is more prone to ionic perturbation. The dimeric assembly of BmTMK is an absolute requirement for enzymatic acitivity and any subtle change in dimeric conformation due to denaturation leads to loss of enzymatic activity. The pH induced changes on structure and activity suggests that selective modification of active site microenvironment pertains to difference in activity profile. This study also envisages that chemical moieties which acts by modulating oligomeric assembly, could be used for better designing of inhibitors against BmTMK enzyme. PMID:27044348

  4. Effects of Doxycycline on gene expression in Wolbachia and Brugia malayi adult female worms in vivo

    Directory of Open Access Journals (Sweden)

    Rao Ramakrishna U

    2012-02-01

    Full Text Available Abstract Background Most filarial nematodes contain Wolbachia symbionts. The purpose of this study was to examine the effects of doxycycline on gene expression in Wolbachia and adult female Brugia malayi. Methods Brugia malayi infected gerbils were treated with doxycycline for 6-weeks. This treatment largely cleared Wolbachia and arrested worm reproduction. RNA recovered from treated and control female worms was labeled by random priming and hybridized to the Version 2- filarial microarray to obtain expression profiles. Results and discussion Results showed significant changes in expression for 200 Wolbachia (29% of Wolbachia genes with expression signals in untreated worms and 546 B. malayi array elements after treatment. These elements correspond to known genes and also to novel genes with unknown biological functions. Most differentially expressed Wolbachia genes were down-regulated after treatment (98.5%. In contrast, doxycycline had a mixed effect on B. malayi gene expression with many more genes being significantly up-regulated after treatment (85% of differentially expressed genes. Genes and processes involved in reproduction (gender-regulated genes, collagen, amino acid metabolism, ribosomal processes, and cytoskeleton were down-regulated after doxycycline while up-regulated genes and pathways suggest adaptations for survival in response to stress (energy metabolism, electron transport, anti-oxidants, nutrient transport, bacterial signaling pathways, and immune evasion. Conclusions Doxycycline reduced Wolbachia and significantly decreased bacterial gene expression. Wolbachia ribosomes are believed to be the primary biological target for doxycycline in filarial worms. B. malayi genes essential for reproduction, growth and development were also down-regulated; these changes are consistent with doxycycline effects on embryo development and reproduction. On the other hand, many B. malayi genes involved in energy production, electron

  5. UDP-galactopyranose mutase, a potential drug target against human pathogenic nematode Brugia malayi.

    Science.gov (United States)

    Misra, Sweta; Valicherla, Guru R; Mohd Shahab; Gupta, Jyoti; Gayen, Jiaur R; Misra-Bhattacharya, Shailja

    2016-08-01

    Lymphatic filariasis, a vector-borne neglected tropical disease affects millions of population in tropical and subtropical countries. Vaccine unavailability and emerging drug resistance against standard antifilarial drugs necessitate search of novel drug targets for developing alternate drugs. Recently, UDP-galactopyranose mutases (UGM) have emerged as a promising drug target playing an important role in parasite virulence and survival. This study deals with the cloning and characterization of Brugia malayi UGM and further exploring its antifilarial drug target potential. The recombinant protein was actively involved in conversion of UDP-galactopyranose (substrate) to UDP-galactofuranose (product) revealing Km and Vmax to be ∼51.15 μM and ∼1.27 μM/min, respectively. The purified protein appeared to be decameric in native state and its 3D homology modeling using Aspergillus fumigatus UGM enzyme as template revealed conservation of active site residues. Two specific prokaryotic inhibitors (compounds A and B) of the enzyme inhibited B. malayi UGM enzymatic activity competitively depicting Ki values ∼22.68 and ∼23.0 μM, respectively. These compounds were also active in vitro and in vivo against B. malayi The findings suggest that B. malayi UGM could be a potential antifilarial therapeutic drug target. PMID:27465638

  6. In vitro antifilarial effects of three plant species against adult worms of subperiodic Brugia malayi.

    Science.gov (United States)

    Zaridah, M Z; Idid, S Z; Omar, A W; Khozirah, S

    2001-11-01

    Five aqueous extracts from three plant species, i.e., dried husks (HX), dried seeds (SX) and dried leaves (LX) of Xylocarpus granatum (Meliaceae), dried stems (ST) of Tinospora crispa (Menispermaceae) and dried leaves (LA) of Andrographis paniculata (Acanthaceae) were tested in vitro against adult worms of subperiodic Brugia malayi. The relative movability (RM) value of the adult worms over the 24-h observation period was used as a measure of the antifilarial activity of the aqueous extracts. SX extract of X. granatum demonstrated the strongest activity, followed by the LA extract of A. paniculata, ST extract of T. crispa, HX extract and LX extract of X. granatum. PMID:11585692

  7. The genome of Brugia malayi - all worms are not created equal.

    Science.gov (United States)

    Scott, Alan L; Ghedin, Elodie

    2009-03-01

    Filarial nematode parasites, the causative agents of elephantiasis and river blindness, undermine the livelihoods of over one hundred million people in the developing world. Recently, the Filarial Genome Project reported the draft sequence of the ~95 Mb genome of the human filarial parasite Brugia malayi - the first parasitic nematode genome to be sequenced. Comparative genome analysis with the prevailing model nematode Caenorhabditis elegans revealed similarities and differences in genome structure and organization that will prove useful as additional nematode genomes are completed. The Brugia genome provides the first opportunity to comprehensively compare the full gene repertoire of a free-living nematode species and one that has evolved as a human pathogen. The Brugia genome also provides an opportunity to gain insight into genetic basis for mutualism, as Brugia, like a majority of filarial species, harbors an endosybiotic bacterium (Wolbachia). The goal of this review is to provide an overview of the results of genomic analysis and how these observations provide new insights into the biology of filarial species. PMID:18952001

  8. Suppression of Brugia malayi (sub-periodic larval development in Aedes aegypti (Liverpool strain fed on blood of animals immunized with microfilariae

    Directory of Open Access Journals (Sweden)

    K Athisaya Mary

    2005-07-01

    Full Text Available Preliminary studies were carried out to investigate the role of filarial specific antibodies, raised in an animal model against the filarial parasite, Brugia malayi (sub-periodic, in blocking their early development in an experimental mosquito host, Aedes aegypti (Liverpool strain. In order to generate filarial specific antibodies, Mongolian gerbils, Meriones unguiculatus, were immunized either with live microfilariae (mf of B. malayi or their homogenate. Mf were harvested from the peritoneal cavity of Mongolian gerbils with patent infection of B. malayi and fed to A. aegypti along with the blood from immunized animals. Development of the parasite in infected mosquitoes was monitored until they reached infective stage larvae (L3. Fewer number of parasites developed to first stage (L1 and subsequently to L2 and L3 in mosquitoes fed with blood of immunized animals, when compared to those fed with blood of control animals. The results thus indicated that filarial parasite specific antibodies present in the blood of the immunized animals resulted in the reduction of number of larvae of B. malayi developing in the mosquito host.

  9. Yeast-Based High-Throughput Screens to Identify Novel Compounds Active against Brugia malayi.

    Directory of Open Access Journals (Sweden)

    Elizabeth Bilsland

    2016-01-01

    Full Text Available Lymphatic filariasis is caused by the parasitic worms Wuchereria bancrofti, Brugia malayi or B. timori, which are transmitted via the bites from infected mosquitoes. Once in the human body, the parasites develop into adult worms in the lymphatic vessels, causing severe damage and swelling of the affected tissues. According to the World Health Organization, over 1.2 billion people in 58 countries are at risk of contracting lymphatic filariasis. Very few drugs are available to treat patients infected with these parasites, and these have low efficacy against the adult stages of the worms, which can live for 7-15 years in the human body. The requirement for annual treatment increases the risk of drug-resistant worms emerging, making it imperative to develop new drugs against these devastating diseases.We have developed a yeast-based, high-throughput screening system whereby essential yeast genes are replaced with their filarial or human counterparts. These strains are labeled with different fluorescent proteins to allow the simultaneous monitoring of strains with parasite or human genes in competition, and hence the identification of compounds that inhibit the parasite target without affecting its human ortholog. We constructed yeast strains expressing eight different Brugia malayi drug targets (as well as seven of their human counterparts, and performed medium-throughput drug screens for compounds that specifically inhibit the parasite enzymes. Using the Malaria Box collection (400 compounds, we identified nine filarial specific inhibitors and confirmed the antifilarial activity of five of these using in vitro assays against Brugia pahangi.We were able to functionally complement yeast deletions with eight different Brugia malayi enzymes that represent potential drug targets. We demonstrated that our yeast-based screening platform is efficient in identifying compounds that can discriminate between human and filarial enzymes. Hence, we are confident

  10. The Effect of In Vitro Cultivation on the Transcriptome of Adult Brugia malayi.

    Directory of Open Access Journals (Sweden)

    Cristina Ballesteros

    2016-01-01

    Full Text Available Filarial nematodes cause serious and debilitating infections in human populations of tropical countries, contributing to an entrenched cycle of poverty. Only one human filarial parasite, Brugia malayi, can be maintained in rodents in the laboratory setting. It has been a widely used model organism in experiments that employ culture systems, the impact of which on the worms is unknown.Using Illumina RNA sequencing, we characterized changes in gene expression upon in vitro maintenance of adult B. malayi female worms at four time points: immediately upon removal from the host, immediately after receipt following shipment, and after 48 h and 5 days in liquid culture media. The dramatic environmental change and the 24 h time lapse between removal from the host and establishment in culture caused a globally dysregulated gene expression profile. We found a maximum of 562 differentially expressed genes based on pairwise comparison between time points. After an initial shock upon removal from the host and shipping, a few stress fingerprints remained after 48 h in culture and until the experiment was stopped. This was best illustrated by a strong and persistent up-regulation of several genes encoding cuticle collagens, as well as serpins.These findings suggest that B. malayi can be maintained in culture as a valid system for pharmacological and biological studies, at least for several days after removal from the host and adaptation to the new environment. However, genes encoding several stress indicators remained dysregulated until the experiment was stopped.

  11. Identification of a highly immunoreactive epitope of Brugia malayi TPx recognized by the endemic sera.

    Science.gov (United States)

    Madhumathi, Jayaprakasam; Prince, Prabhu Rajaiah; Gayatri, Subash Chellam; Aparnaa, Ramanathan; Kaliraj, Perumal

    2010-12-01

    Filarial thiordoxin peroxidase is a major antioxidant that plays a crucial role in parasite survival. Although Brugia malayi TPx has been shown to be a potential vaccine candidate, it shares 63% homology with its mammalian counterpart, limiting its use as a vaccine or drug target. In silico analysis of TPx sequence revealed a linear B epitope in the host's nonhomologous region. The peptide sequence (TPx peptide(27-48)) was synthesized, and its reactivity with clinical sera from an endemic region was analyzed. The peptide showed significantly high reactivity (P patent infection. The high reactivity of the peptide with endemic immune sera equivalent to that of whole protein shows that it forms a dominant B epitope of TPx protein and thus could be utilized for incorporation into a multiepitope vaccine construct for filariasis. PMID:21158641

  12. The Wolbachia endosymbiont of Brugia malayi has an active pyruvate phosphate dikinase.

    Science.gov (United States)

    Raverdy, Sylvine; Foster, Jeremy M; Roopenian, Erica; Carlow, Clotilde K S

    2008-08-01

    Genome analysis of the glycolytic/gluconeogenic pathway in the Wolbachia endosymbiont from the filarial parasite Brugia malayi (wBm) has revealed that wBm lacks pyruvate kinase (PK) and may instead utilize the enzyme pyruvate phosphate dikinase (PPDK; ATP:pyruvate, orthophosphate phosphotransferase, EC 2.7.9.1). PPDK catalyses the reversible conversion of AMP, PPi and phosphoenolpyruvate (PEP) into ATP, Pi and pyruvate. The glycolytic pathway of most organisms, including mammals, contains exclusively PK for the production of pyruvate from PEP. Therefore, the absence of PPDK in mammals makes the enzyme an attractive Wolbachia drug target. In the present study, we have cloned and expressed an active wBm-PPDK, thereby providing insight into the energy metabolism of the endosymbiont. Our results support the development of wBm-PPDK as a promising new drug target in an anti-symbiotic approach to controlling filarial infection.

  13. Brugia malayi excreted/secreted proteins at the host/parasite interface: stage- and gender-specific proteomic profiling.

    Directory of Open Access Journals (Sweden)

    Sasisekhar Bennuru

    Full Text Available Relatively little is known about the filarial proteins that interact with the human host. Although the filarial genome has recently been completed, protein profiles have been limited to only a few recombinants or purified proteins of interest. Here, we describe a large-scale proteomic analysis using microcapillary reverse-phase liquid chromatography-tandem-mass spectrometry to identify the excretory-secretory (ES products of the L3, L3 to L4 molting ES, adult male, adult female, and microfilarial stages of the filarial parasite Brugia malayi. The analysis of the ES products from adult male, adult female, microfilariae (Mf, L3, and molting L3 larvae identified 852 proteins. Annotation suggests that the functional and component distribution was very similar across each of the stages studied; however, the Mf contributed a higher proportion to the total number of identified proteins than the other stages. Of the 852 proteins identified in the ES, only 229 had previous confirmatory expressed sequence tags (ESTs in the available databases. Moreover, this analysis was able to confirm the presence of 274 "hypothetical" proteins inferred from gene prediction algorithms applied to the B. malayi (Bm genome. Not surprisingly, the majority (160/274 of these "hypothetical" proteins were predicted to be secreted by Signal IP and/or SecretomeP 2.0 analysis. Of major interest is the abundance of previously characterized immunomodulatory proteins such as ES-62 (leucyl aminopeptidase, MIF-1, SERPIN, glutathione peroxidase, and galectin in the ES of microfilariae (and Mf-containing adult females compared to the adult males. In addition, searching the ES protein spectra against the Wolbachia database resulted in the identification of 90 Wolbachia-specific proteins, most of which were metabolic enzymes that have not been shown to be immunogenic. This proteomic analysis extends our knowledge of the ES and provides insight into the host-parasite interaction.

  14. Cloning and characterization of high mobility group box protein 1 (HMGB1) of Wuchereria bancrofti and Brugia malayi

    OpenAIRE

    Thirugnanam, Sivasakthivel; Munirathinam, Gnanasekar; Veerapathran, Anandharaman; Dakshinamoorthy, Gajalakshmi; Reddy, Maryada V.; RAMASWAMY, KALYANASUNDARAM

    2012-01-01

    A human homologue of high mobility group box 1 (HMGB1) protein was cloned and characterized from the human filarial parasites Wuchereria bancrofti and Brugia malayi. Sequence analysis showed that W. bancrofti HMGB1 (WbHMGB1) and B. malayi HMGB1 (BmHMGB1) proteins share 99 % sequence identity. Filarial HMGB1 showed typical architectural sequence characteristics of HMGB family of proteins and consisted of only a single HMG box domain that had significant sequence similarity to the pro-inflammat...

  15. The heme biosynthetic pathway of the obligate Wolbachia endosymbiont of Brugia malayi as a potential anti-filarial drug target.

    Directory of Open Access Journals (Sweden)

    Bo Wu

    Full Text Available BACKGROUND: Filarial parasites (e.g., Brugia malayi, Onchocerca volvulus, and Wuchereria bancrofti are causative agents of lymphatic filariasis and onchocerciasis, which are among the most disabling of neglected tropical diseases. There is an urgent need to develop macro-filaricidal drugs, as current anti-filarial chemotherapy (e.g., diethylcarbamazine [DEC], ivermectin and albendazole can interrupt transmission predominantly by killing microfilariae (mf larvae, but is less effective on adult worms, which can live for decades in the human host. All medically relevant human filarial parasites appear to contain an obligate endosymbiotic bacterium, Wolbachia. This alpha-proteobacterial mutualist has been recognized as a potential target for filarial nematode life cycle intervention, as antibiotic treatments of filarial worms harboring Wolbachia result in the loss of worm fertility and viability upon antibiotic treatments both in vitro and in vivo. Human trials have confirmed this approach, although the length of treatments, high doses required and medical counter-indications for young children and pregnant women warrant the identification of additional anti-Wolbachia drugs. METHODS AND FINDINGS: Genome sequence analysis indicated that enzymes involved in heme biosynthesis might constitute a potential anti-Wolbachia target set. We tested different heme biosynthetic pathway inhibitors in ex vivo B. malayi viability assays and report a specific effect of N-methyl mesoporphyrin (NMMP, which targets ferrochelatase (FC, the last step. Our phylogenetic analysis indicates evolutionarily significant divergence between Wolbachia heme genes and their human homologues. We therefore undertook the cloning, overexpression and analysis of several enzymes of this pathway alongside their human homologues, and prepared proteins for drug targeting. In vitro enzyme assays revealed a approximately 600-fold difference in drug sensitivities to succinyl acetone (SA between

  16. Detection and quantification of Wuchereria bancrofti and Brugia malayi DNA in blood samples and mosquitoes using duplex droplet digital polymerase chain reaction.

    Science.gov (United States)

    Jongthawin, Jurairat; Intapan, Pewpan M; Lulitanond, Viraphong; Sanpool, Oranuch; Thanchomnang, Tongjit; Sadaow, Lakkhana; Maleewong, Wanchai

    2016-08-01

    Lymphatic filariasis, a mosquito-borne disease, is still a major public health problem in tropical and sub-tropical countries. Effective diagnostic tools are required for identification of infected individuals, for epidemiological assessment, and for monitoring of control programs. A duplex droplet digital polymerase chain reaction (ddPCR) was conducted to differentiate and quantify Wuchereria bancrofti DNA by targeting the long DNA repeat (LDR) element and Brugia malayi DNA by targeting the HhaI element in blood samples and mosquito vectors. The analytical sensitivity and specificity were evaluated. Our results indicated that the duplex ddPCR assay could differentiate and quantify W. bancrofti and B. malayi DNA from blood samples and mosquitoes. DNA from a single larva in 50 μl of a blood sample, or in one mosquito vector, could be detected. The analytical sensitivity and specificity for W. bancrofti are both 100 %. Corresponding values for B. malayi are 100 and 98.3 %, respectively. Therefore, duplex ddPCR is a potential tool for simultaneous diagnosis and monitoring of bancroftian and brugian filariasis in endemic areas. PMID:27085707

  17. Computational prediction of essential genes in an unculturable endosymbiotic bacterium, Wolbachia of Brugia malayi

    Directory of Open Access Journals (Sweden)

    Carlow Clotilde KS

    2009-11-01

    Full Text Available Abstract Background Wolbachia (wBm is an obligate endosymbiotic bacterium of Brugia malayi, a parasitic filarial nematode of humans and one of the causative agents of lymphatic filariasis. There is a pressing need for new drugs against filarial parasites, such as B. malayi. As wBm is required for B. malayi development and fertility, targeting wBm is a promising approach. However, the lifecycle of neither B. malayi nor wBm can be maintained in vitro. To facilitate selection of potential drug targets we computationally ranked the wBm genome based on confidence that a particular gene is essential for the survival of the bacterium. Results wBm protein sequences were aligned using BLAST to the Database of Essential Genes (DEG version 5.2, a collection of 5,260 experimentally identified essential genes in 15 bacterial strains. A confidence score, the Multiple Hit Score (MHS, was developed to predict each wBm gene's essentiality based on the top alignments to essential genes in each bacterial strain. This method was validated using a jackknife methodology to test the ability to recover known essential genes in a control genome. A second estimation of essentiality, the Gene Conservation Score (GCS, was calculated on the basis of phyletic conservation of genes across Wolbachia's parent order Rickettsiales. Clusters of orthologous genes were predicted within the 27 currently available complete genomes. Druggability of wBm proteins was predicted by alignment to a database of protein targets of known compounds. Conclusion Ranking wBm genes by either MHS or GCS predicts and prioritizes potentially essential genes. Comparison of the MHS to GCS produces quadrants representing four types of predictions: those with high confidence of essentiality by both methods (245 genes, those highly conserved across Rickettsiales (299 genes, those similar to distant essential genes (8 genes, and those with low confidence of essentiality (253 genes. These data facilitate

  18. A deep sequencing approach to comparatively analyze the transcriptome of lifecycle stages of the filarial worm, Brugia malayi.

    Directory of Open Access Journals (Sweden)

    Young-Jun Choi

    2011-12-01

    Full Text Available BACKGROUND: Developing intervention strategies for the control of parasitic nematodes continues to be a significant challenge. Genomic and post-genomic approaches play an increasingly important role for providing fundamental molecular information about these parasites, thus enhancing basic as well as translational research. Here we report a comprehensive genome-wide survey of the developmental transcriptome of the human filarial parasite Brugia malayi. METHODOLOGY/PRINCIPAL FINDINGS: Using deep sequencing, we profiled the transcriptome of eggs and embryos, immature (≤3 days of age and mature microfilariae (MF, third- and fourth-stage larvae (L3 and L4, and adult male and female worms. Comparative analysis across these stages provided a detailed overview of the molecular repertoires that define and differentiate distinct lifecycle stages of the parasite. Genome-wide assessment of the overall transcriptional variability indicated that the cuticle collagen family and those implicated in molting exhibit noticeably dynamic stage-dependent patterns. Of particular interest was the identification of genes displaying sex-biased or germline-enriched profiles due to their potential involvement in reproductive processes. The study also revealed discrete transcriptional changes during larval development, namely those accompanying the maturation of MF and the L3 to L4 transition that are vital in establishing successful infection in mosquito vectors and vertebrate hosts, respectively. CONCLUSIONS/SIGNIFICANCE: Characterization of the transcriptional program of the parasite's lifecycle is an important step toward understanding the developmental processes required for the infectious cycle. We find that the transcriptional program has a number of stage-specific pathways activated during worm development. In addition to advancing our understanding of transcriptome dynamics, these data will aid in the study of genome structure and organization by facilitating

  19. Localization of Brugia malayi (sub-periodic) adults in different organs of Mastomys coucha and its influence on microfilaraemia and host antibody response

    OpenAIRE

    K Athisaya Mary; SL Hoti; Paily KP

    2006-01-01

    Lymphatic filariasis caused by nematode parasites Wuchereria bancrofti or Brugia malayi is a spectral disease and produces wide range of immune responses and varying levels ofmicrofilaraemia in infected individuals. The relationship between the immune response of host and the developmental stage of the parasite as well as the microfilariae (mf) density and specific location of the adult worms is yet to be understood. As an experimental model, B. malayi adapted in the experimental animal Masto...

  20. Expression of five acetylcholine receptor subunit genes in Brugia malayi adult worms.

    Science.gov (United States)

    Li, Ben-Wen; Rush, Amy C; Weil, Gary J

    2015-12-01

    Acetylcholine receptors (AChRs) are required for body movement in parasitic nematodes and are targets of "classical" anthelmintic drugs such as levamisole and pyrantel and of newer drugs such as tribendimidine and derquantel. While neurotransmission explains the effects of these drugs on nematode movement, their effects on parasite reproduction are unexplained. The levamisole AChR type (L-AChRs) in Caenorhabditis elegans is comprised of five subunits: Cel-UNC-29, Cel-UNC-38, Cel-UNC-63, Cel-LEV-1 and Cel-LEV-8. The genome of the filarial parasite Brugia malayi contains nine AChRs subunits including orthologues of Cel-unc-29, Cel-unc-38, and Cel-unc-63. We performed in situ hybridization with RNA probes to localize the expression of five AChR genes (Bm1_35890-Bma-unc-29, Bm1_20330-Bma-unc-38, Bm1_38195-Bma-unc-63, Bm1_48815-Bma-acr-26 and Bm1_40515-Bma-acr-12) in B. malayi adult worms. Four of these genes had similar expression patterns with signals in body muscle, developing embryos, spermatogonia, uterine wall adjacent to stretched microfilariae, wall of V as deferens, and lateral cord. Three L-AChR subunit genes (Bma-unc-29, Bma-unc-38 and Bma-unc-63) were expressed in body muscle, which is a known target of levamisole. Bma-acr-12 was co-expressed with these levamisole subunit genes in muscle, and this suggests that its protein product may form receptors with other alpha subunits. Bma-acr-26 was expressed in male muscle but not in female muscle. Strong expression signals of these genes in early embryos and gametes in uterus and testis suggest that AChRs may have a role in nervous system development of embryogenesis and spermatogenesis. This would be consistent with embryotoxic effects of drugs that target these receptors in filarial worms. Our data show that the expression of these receptor genes is tightly regulated with regard to localization in adult worms and developmental stage in embryos and gametes. These results may help to explain the broad effects of

  1. Potential involvement of Brugia malayi cysteine proteases in the maintenance of the endosymbiotic relationship with Wolbachia

    Directory of Open Access Journals (Sweden)

    Sara Lustigman

    2014-12-01

    Full Text Available Brugia malayi, a parasitic nematode that causes lymphatic filariasis, harbors endosymbiotic intracellular bacteria, Wolbachia, that are required for the development and reproduction of the worm. The essential nature of this endosymbiosis led to the development of anti-Wolbachia chemotherapeutic approaches for the treatment of human filarial infections. Our study is aimed at identifying specific proteins that play a critical role in this endosymbiotic relationship leading to the identification of potential targets in the adult worms. Filarial cysteine proteases are known to be involved in molting and embryogenesis, processes shown to also be Wolbachia dependent. Based on the observation that cysteine protease transcripts are differentially regulated in response to tetracycline treatment, we focused on defining their role in symbiosis. We observe a bimodal regulation pattern of transcripts encoding cysteine proteases when in vitro tetracycline treated worms were examined. Using tetracycline-treated infertile female worms and purified embryos we established that the first peak of the bimodal pattern corresponds to embryonic transcripts while the second takes place within the hypodermis of the adult worms. Localization studies of the native proteins corresponding to Bm-cpl-3 and Bm-cpl-6 indicate that they are present in the area surrounding Wolbachia, and, in some cases, the proteins appear localized within the bacteria. Both proteins were also found in the inner bodies of microfilariae. The possible role of these cysteine proteases during development and endosymbiosis was further characterized using RNAi. Reduction in Bm-cpl-3 and Bm-cpl-6 transcript levels was accompanied by hindered microfilarial development and release, and reduced Wolbachia DNA levels, making these enzymes strong drug target candidates.

  2. The Effects of Ivermectin on Brugia malayi Females In Vitro: A Transcriptomic Approach

    Science.gov (United States)

    O’Neill, Maeghan; Burkman, Erica; Zaky, Weam I.; Xia, Jianguo; Moorhead, Andrew; Williams, Steven A.; Geary, Timothy G.

    2016-01-01

    Background Lymphatic filariasis and onchocerciasis are disabling and disfiguring neglected tropical diseases of major importance in developing countries. Ivermectin is the drug of choice for mass drug administration programs for the control of onchocerciasis and lymphatic filariasis in areas where the diseases are co-endemic. Although ivermectin paralyzes somatic and pharyngeal muscles in many nematodes, these actions are poorly characterized in adult filariae. We hypothesize that paralysis of pharyngeal pumping by ivermectin in filariae could result in deprivation of essential nutrients, especially iron, inducing a wide range of responses evidenced by altered gene expression, changes in metabolic pathways, and altered developmental states in embryos. Previous studies have shown that ivermectin treatment significantly reduces microfilariae release from females within four days of exposure in vivo, while not markedly affecting adult worms. However, the mechanisms responsible for reduced production of microfilariae are poorly understood. Methodology/Principal Findings We analyzed transcriptomic profiles from Brugia malayi adult females, an important model for other filariae, using RNAseq technology after exposure in culture to ivermectin at various concentrations (100 nM, 300 nM and 1 μM) and time points (24, 48, 72 h, and 5 days). Our analysis revealed drug-related changes in expression of genes involved in meiosis, as well as oxidative phosphorylation, which were significantly down-regulated as early as 24 h post-exposure. RNA interference phenotypes of the orthologs of these down-regulated genes in C. elegans include “maternal sterile”, “embryonic lethal”, “larval arrest”, “larval lethal” and “sick”. Conclusion/Significance These changes provide insight into the mechanisms involved in ivermectin-induced reduction in microfilaria output and impaired fertility, embryogenesis, and larval development. PMID:27529747

  3. Production of Brugia malayi BmSXP Recombinant Protein Expressed in Escherichia coli

    Directory of Open Access Journals (Sweden)

    Khoo, T. K.

    2010-01-01

    Full Text Available A rapid antibody detection test is very useful for detection of lymphatic filariasis, especially for certification and surveillance of post-mass drug administration. One such kit, panLF RapidTM (commercialized by Malaysian BioDiagnostic Research Sdn. Bhd. had been developed in our laboratory for the detection of all species of filarial infections. It is based on the detection of anti-filarial IgG4 antibodies that react with recombinant Brugia malayi antigens, BmR1 and BmSXP. In this study, the growth of recombinant bacteria that produce BmSXP was optimized under shake flask fermentation for high yield of the recombinant antigen. The optimizations involved selection of suitable growth medium, IPTG concentration and induction time. The medium that yielded the highest biomass as well as total protein was Terrific Broth (TB medium, which is an undefined medium. Initiation of induction of protein expression was found to be best at mid-log phase (OD600 = 1.5, with IPTG concentration of 1.0 mM, and harvest time at 9 h post-induction. This study showed that under the optimized conditions, the shake flask culture produced 4 g/L biomass (dry cell weight of recombinant Escherichia coli BmSXP/pPROEXHTa/TOP10F’, which yielded 2.42 mg/L of purified BmSXP recombinant antigen. The purified antigen was analyzed by SDS-PAGE and the antigenicity of protein was confirmed by Western blot.

  4. Tissue and stage-specific distribution of Wolbachia in Brugia malayi.

    Directory of Open Access Journals (Sweden)

    Kerstin Fischer

    2011-05-01

    Full Text Available BACKGROUND: Most filarial parasite species contain Wolbachia, obligatory bacterial endosymbionts that are crucial for filarial development and reproduction. They are targets for alternative chemotherapy, but their role in the biology of filarial nematodes is not well understood. Light microscopy provides important information on morphology, localization and potential function of these bacteria. Surprisingly, immunohistology and in situ hybridization techniques have not been widely used to monitor Wolbachia distribution during the filarial life cycle. METHODS/PRINCIPAL FINDINGS: A monoclonal antibody directed against Wolbachia surface protein and in situ hybridization targeting Wolbachia 16S rRNA were used to monitor Wolbachia during the life cycle of B. malayi. In microfilariae and vector stage larvae only a few cells contain Wolbachia. In contrast, large numbers of Wolbachia were detected in the lateral chords of L4 larvae, but no endobacteria were detected in the genital primordium. In young adult worms (5 weeks p.i., a massive expansion of Wolbachia was observed in the lateral chords adjacent to ovaries or testis, but no endobacteria were detected in the growth zone of the ovaries, uterus, the growth zone of the testis or the vas deferens. Confocal laser scanning and transmission electron microscopy showed that numerous Wolbachia are aligned towards the developing ovaries and single endobacteria were detected in the germline. In inseminated females (8 weeks p.i. Wolbachia were observed in the ovaries, embryos and in decreasing numbers in the lateral chords. In young males Wolbachia were found in distinct zones of the testis and in large numbers in the lateral chords in the vicinity of testicular tissue but never in mature spermatids or spermatozoa. CONCLUSIONS: Immunohistology and in situ hybridization show distinct tissue and stage specific distribution patterns for Wolbachia in B. malayi. Extensive multiplication of Wolbachia occurs in the

  5. Immunization of Mastomys coucha with Brugia malayi recombinant trehalose-6-phosphate phosphatase results in significant protection against homologous challenge infection.

    Directory of Open Access Journals (Sweden)

    Susheela Kushwaha

    Full Text Available Development of a vaccine to prevent or reduce parasite development in lymphatic filariasis would be a complementary approach to existing chemotherapeutic tools. Trehalose-6-phosphate phosphatase of Brugia malayi (Bm-TPP represents an attractive vaccine target due to its absence in mammals, prevalence in the major life stages of the parasite and immunoreactivity with human bancroftian antibodies, especially from endemic normal subjects. We have recently reported on the cloning, expression, purification and biochemical characterization of this vital enzyme of B. malayi. In the present study, immunoprophylactic evaluation of Bm-TPP was carried out against B. malayi larval challenge in a susceptible host Mastomys coucha and the protective ability of the recombinant protein was evaluated by observing the adverse effects on microfilarial density and adult worm establishment. Immunization caused 78.4% decrease in microfilaremia and 71.04% reduction in the adult worm establishment along with sterilization of 70.06% of the recovered live females. The recombinant protein elicited a mixed Th1/Th2 type of protective immune response as evidenced by the generation of both pro- and anti-inflammatory cytokines IL-2, IFN-γ, TNF-α, IL-4 and an increased production of antibody isotypes IgG1, IgG2a, IgG2b and IgA. Thus immunization with Bm-TPP conferred considerable protection against B. malayi establishment by engendering a long-lasting effective immune response and therefore emerges as a potential vaccine candidate against lymphatic filariasis (LF.

  6. Molecular characterization of NAD+-dependent DNA ligase from Wolbachia endosymbiont of lymphatic filarial parasite Brugia malayi.

    Directory of Open Access Journals (Sweden)

    Nidhi Shrivastava

    Full Text Available The lymphatic filarial parasite, Brugia malayi contains Wolbachia endobacteria that are essential for development, viability and fertility of the parasite. Therefore, wolbachial proteins have been currently seen as the potential antifilarial drug targets. NAD(+-dependent DNA ligase is characterized as a promising drug target in several organisms due to its crucial, indispensable role in DNA replication, recombination and DNA repair. We report here the cloning, expression and purification of NAD(+-dependent DNA ligase of Wolbachia endosymbiont of B. malayi (wBm-LigA for its molecular characterization. wBm-LigA has all the domains that are present in nearly all the eubacterial NAD(+-dependent DNA ligases such as N-terminal adenylation domain, OB fold, helix-hairpin-helix (HhH and BRCT domain except zinc-binding tetracysteine domain. The purified recombinant protein (683-amino acid was found to be biochemically active and was present in its native form as revealed by the circular dichroism and fluorescence spectra. The purified recombinant enzyme was able to catalyze intramolecular strand joining on a nicked DNA as well as intermolecular joining of the cohesive ends of BstEII restricted lamda DNA in an in vitro assay. The enzyme was localized in the various life-stages of B. malayi parasites by immunoblotting and high enzyme expression was observed in Wolbachia within B. malayi microfilariae and female adult parasites along the hypodermal chords and in the gravid portion as evident by the confocal microscopy. Ours is the first report on this enzyme of Wolbachia and these findings would assist in validating the antifilarial drug target potential of wBm-LigA in future studies.

  7. DETECTION OF BRUGIA MALAYI INFECTED MOSQUITOES WITH SPECIES SPECIFIC DNA PROBE pBm 15, IN RIAU, INDONESIA

    Directory of Open Access Journals (Sweden)

    L. Kurniawan

    2012-09-01

    Full Text Available A species specific DNA probe (pBm15 was used in a field area where 2 filarial infections coexist: B.malayi in man and B.pahangi in cats. In our laboratory in Jakarta, this DNA probe proved to be sensitive enough to detect 500 ng DNA. One to two infective larvae of B.malayi could be detected with ease. This DNA probe did not react with infective larvae of wuchereria bancrofti, B.pahangi, and Dirofilaria spp. Non specific binding caused by undefined mosquito components was overcome with proteinase K and chitinase treatment. This additional step, made it possible for whole body mosquitoes to be squashed directly onto nitrocellulose paper. A comparative study of experimental infections of laboratory bred mosquitoes infected with B.malayi, showed no difference in infection rate between the group examined by dissection or by DNA probing. Mosquitoes which are vectors in Riau were collected and fed on microfilaremic patients of Riau. The set of mosquitoes were tested in parallel with mosquitoes infected with B.pahangi from cats. All fed mosquitoes were tested after 10-12 days. Only mosquitoes infected with B.malayi reacted in the assay. This study shows a success in applying the DNA probe technique in Jakarta. Further application in the field should be encouraged, with some modification of the DNA probing technique, for cheaper and easier implementation.

  8. The Wolbachia endosymbiont of Brugia malayi has an active phosphoglycerate mutase: a candidate target for anti-filarial therapies.

    Science.gov (United States)

    Foster, Jeremy M; Raverdy, Sylvine; Ganatra, Mehul B; Colussi, Paul A; Taron, Christopher H; Carlow, Clotilde K S

    2009-04-01

    Phosphoglycerate mutases (PGM) interconvert 2- and 3-phosphoglycerate in the glycolytic and gluconeogenic pathways. A putative cofactor-independent phosphoglycerate mutase gene (iPGM) was identified in the genome sequence of the Wolbachia endosymbiont from the filarial nematode, Brugia malayi (wBm). Since iPGM has no sequence or structural similarity to the cofactor-dependent phosphoglycerate mutase (dPGM) found in mammals, it may represent an attractive Wolbachia drug target. In the present study, wBm-iPGM cloned and expressed in Escherichia coli was mostly insoluble and inactive. However, the protein was successfully produced in the yeast Kluyveromyces lactis and the purified recombinant wBm-iPGM showed typical PGM activity. Our results provide a foundation for further development of wBm-iPGM as a promising new drug target for novel anti-filarial therapies that selectively target the endosymbiont.

  9. Release of Small RNA-containing Exosome-like Vesicles from the Human Filarial Parasite Brugia malayi.

    Directory of Open Access Journals (Sweden)

    Mostafa Zamanian

    Full Text Available Lymphatic filariasis (LF is a socio-economically devastating mosquito-borne Neglected Tropical Disease caused by parasitic filarial nematodes. The interaction between the parasite and host, both mosquito and human, during infection, development and persistence is dynamic and delicately balanced. Manipulation of this interface to the detriment of the parasite is a promising potential avenue to develop disease therapies but is prevented by our very limited understanding of the host-parasite relationship. Exosomes are bioactive small vesicles (30-120 nm secreted by a wide range of cell types and involved in a wide range of physiological processes. Here, we report the identification and partial characterization of exosome-like vesicles (ELVs released from the infective L3 stage of the human filarial parasite Brugia malayi. Exosome-like vesicles were isolated from parasites in culture media and electron microscopy and nanoparticle tracking analysis were used to confirm that vesicles produced by juvenile B. malayi are exosome-like based on size and morphology. We show that loss of parasite viability correlates with a time-dependent decay in vesicle size specificity and rate of release. The protein cargo of these vesicles is shown to include common exosomal protein markers and putative effector proteins. These Brugia-derived vesicles contain small RNA species that include microRNAs with host homology, suggesting a potential role in host manipulation. Confocal microscopy shows J774A.1, a murine macrophage cell line, internalize purified ELVs, and we demonstrate that these ELVs effectively stimulate a classically activated macrophage phenotype in J774A.1. To our knowledge, this is the first report of exosome-like vesicle release by a human parasitic nematode and our data suggest a novel mechanism by which human parasitic nematodes may actively direct the host responses to infection. Further interrogation of the makeup and function of these bioactive

  10. Rapid Detection and Identification of Wuchereria bancrofti, Brugia malayi, B. pahangi, and Dirofilaria immitis in Mosquito Vectors and Blood Samples by High Resolution Melting Real-Time PCR

    OpenAIRE

    Thanchomnang, Tongjit; Intapan, Pewpan M.; Tantrawatpan, Chairat; Lulitanond, Viraphong; Chungpivat, Sudchit; Taweethavonsawat, Piyanan; Kaewkong, Worasak; Sanpool, Oranuch; Janwan, Penchom; Choochote, Wej; Maleewong, Wanchai

    2013-01-01

    A simple, rapid, and high-throughput method for detection and identification of Wuchereria bancrofti, Brugia malayi, Brugia pahangi, and Dirofilaria immitis in mosquito vectors and blood samples was developed using a real-time PCR combined with high-resolution melting (HRM) analysis. Amplicons of the 4 filarial species were generated from 5S rRNA and spliced leader sequences by the real-time PCR and their melting temperatures were determined by the HRM method. Melting of amplicons from W. ban...

  11. Immunogenicity and Protective Efficacy of Brugia malayi Heavy Chain Myosin as Homologous DNA, Protein and Heterologous DNA/Protein Prime Boost Vaccine in Rodent Model.

    Directory of Open Access Journals (Sweden)

    Jyoti Gupta

    Full Text Available We earlier demonstrated the immunoprophylactic efficacy of recombinant heavy chain myosin (Bm-Myo of Brugia malayi (B. malayi in rodent models. In the current study, further attempts have been made to improve this efficacy by employing alternate approaches such as homologous DNA (pcD-Myo and heterologous DNA/protein prime boost (pcD-Myo+Bm-Myo in BALB/c mouse model. The gene bm-myo was cloned in a mammalian expression vector pcDNA 3.1(+ and protein expression was confirmed in mammalian Vero cell line. A significant degree of protection (79.2%±2.32 against L3 challenge in pcD-Myo+Bm-Myo immunized group was observed which was much higher than that exerted by Bm-Myo (66.6%±2.23 and pcD-Myo (41.6%±2.45. In the heterologous immunized group, the percentage of peritoneal leukocytes such as macrophages, neutrophils, B cells and T cells marginally increased and their population augmented further significantly following L3 challenge. pcD-Myo+Bm-Myo immunization elicited robust cellular and humoral immune responses as compared to pcD-Myo and Bm-Myo groups as evidenced by an increased accumulation of CD4+, CD8+ T cells and CD19+ B cells in the mouse spleen and activation of peritoneal macrophages. Though immunized animals produced antigen-specific IgG antibodies and isotypes, sera of mice receiving pcD-Myo+Bm-Myo or Bm-Myo developed much higher antibody levels than other groups and there was profound antibody-dependent cellular adhesion and cytotoxicity (ADCC to B. malayi infective larvae (L3. pcD-Myo+Bm-Myo as well as Bm-Myo mice generated a mixed T helper cell phenotype as evidenced by the production of both pro-inflammatory (IL-2, IFN-γ and anti-inflammatory (IL-4, IL-10 cytokines. Mice receiving pcD-Myo on contrary displayed a polarized pro-inflammatory immune response. The findings suggest that the priming of animals with DNA followed by protein booster generates heightened and mixed pro- and anti-inflammatory immune responses that are capable of

  12. Vaccination of Gerbils with Bm-103 and Bm-RAL-2 Concurrently or as a Fusion Protein Confers Consistent and Improved Protection against Brugia malayi Infection.

    Directory of Open Access Journals (Sweden)

    Sridhar Arumugam

    2016-04-01

    Full Text Available The Brugia malayi Bm-103 and Bm-RAL-2 proteins are orthologous to Onchocerca volvulus Ov-103 and Ov-RAL-2, and which were selected as the best candidates for the development of an O. volvulus vaccine. The B. malayi gerbil model was used to confirm the efficacy of these Ov vaccine candidates on adult worms and to determine whether their combination is more efficacious.Vaccine efficacy of recombinant Bm-103 and Bm-RAL-2 administered individually, concurrently or as a fusion protein were tested in gerbils using alum as adjuvant. Vaccination with Bm-103 resulted in worm reductions of 39%, 34% and 22% on 42, 120 and 150 days post infection (dpi, respectively, and vaccination with Bm-RAL-2 resulted in worm reductions of 42%, 22% and 46% on 42, 120 and 150 dpi, respectively. Vaccination with a fusion protein comprised of Bm-103 and Bm-RAL-2 resulted in improved efficacy with significant reduction of worm burden of 51% and 49% at 90 dpi, as did the concurrent vaccination with Bm-103 and Bm-RAL-2, with worm reduction of 61% and 56% at 90 dpi. Vaccination with Bm-103 and Bm-RAL-2 as a fusion protein or concurrently not only induced a significant worm reduction of 61% and 42%, respectively, at 150 dpi, but also significantly reduced the fecundity of female worms as determined by embryograms. Elevated levels of antigen-specific IgG were observed in all vaccinated gerbils. Serum from gerbils vaccinated with Bm-103 and Bm-RAL-2 individually, concurrently or as a fusion protein killed third stage larvae in vitro when combined with peritoneal exudate cells.Although vaccination with Bm-103 and Bm-RAL-2 individually conferred protection against B. malayi infection in gerbils, a more consistent and enhanced protection was induced by vaccination with Bm-103 and Bm-RAL-2 fusion protein and when they were used concurrently. Further characterization and optimization of these filarial vaccines are warranted.

  13. Sequences necessary for trans-splicing in transiently transfected Brugia malayi

    OpenAIRE

    Liu, Canhui; Oliveira, Ana; Higazi, Tarig B.; Ghedin, Elodie; DePasse, Jay; Thomas R Unnasch

    2007-01-01

    Many genes in parasitic nematodes are both cis- and trans-spliced. Previous studies have demonstrated that a 7nt element encoded in the first intron of the B. malayi 70 kDa heat shock protein (BmHSP70) gene was necessary to permit trans-splicing of transgenic mRNAs in embryos transfected with constructs encoding portions of the BmHSP70 gene. Here we demonstrate that this element (the B. malayi HSP70 trans-splicing motif, or BmHSP70 TSM) is necessary and sufficient to direct trans-splicing of ...

  14. Structure of the trehalose-6-phosphate phosphatase from Brugia malayi reveals key design principles for anthelmintic drugs.

    Science.gov (United States)

    Farelli, Jeremiah D; Galvin, Brendan D; Li, Zhiru; Liu, Chunliang; Aono, Miyuki; Garland, Megan; Hallett, Olivia E; Causey, Thomas B; Ali-Reynolds, Alana; Saltzberg, Daniel J; Carlow, Clotilde K S; Dunaway-Mariano, Debra; Allen, Karen N

    2014-07-01

    Parasitic nematodes are responsible for devastating illnesses that plague many of the world's poorest populations indigenous to the tropical areas of developing nations. Among these diseases is lymphatic filariasis, a major cause of permanent and long-term disability. Proteins essential to nematodes that do not have mammalian counterparts represent targets for therapeutic inhibitor discovery. One promising target is trehalose-6-phosphate phosphatase (T6PP) from Brugia malayi. In the model nematode Caenorhabditis elegans, T6PP is essential for survival due to the toxic effect(s) of the accumulation of trehalose 6-phosphate. T6PP has also been shown to be essential in Mycobacterium tuberculosis. We determined the X-ray crystal structure of T6PP from B. malayi. The protein structure revealed a stabilizing N-terminal MIT-like domain and a catalytic C-terminal C2B-type HAD phosphatase fold. Structure-guided mutagenesis, combined with kinetic analyses using a designed competitive inhibitor, trehalose 6-sulfate, identified five residues important for binding and catalysis. This structure-function analysis along with computational mapping provided the basis for the proposed model of the T6PP-trehalose 6-phosphate complex. The model indicates a substrate-binding mode wherein shape complementarity and van der Waals interactions drive recognition. The mode of binding is in sharp contrast to the homolog sucrose-6-phosphate phosphatase where extensive hydrogen-bond interactions are made to the substrate. Together these results suggest that high-affinity inhibitors will be bi-dentate, taking advantage of substrate-like binding to the phosphoryl-binding pocket while simultaneously utilizing non-native binding to the trehalose pocket. The conservation of the key residues that enforce the shape of the substrate pocket in T6PP enzymes suggest that development of broad-range anthelmintic and antibacterial therapeutics employing this platform may be possible.

  15. Structure of the trehalose-6-phosphate phosphatase from Brugia malayi reveals key design principles for anthelmintic drugs.

    Directory of Open Access Journals (Sweden)

    Jeremiah D Farelli

    2014-07-01

    Full Text Available Parasitic nematodes are responsible for devastating illnesses that plague many of the world's poorest populations indigenous to the tropical areas of developing nations. Among these diseases is lymphatic filariasis, a major cause of permanent and long-term disability. Proteins essential to nematodes that do not have mammalian counterparts represent targets for therapeutic inhibitor discovery. One promising target is trehalose-6-phosphate phosphatase (T6PP from Brugia malayi. In the model nematode Caenorhabditis elegans, T6PP is essential for survival due to the toxic effect(s of the accumulation of trehalose 6-phosphate. T6PP has also been shown to be essential in Mycobacterium tuberculosis. We determined the X-ray crystal structure of T6PP from B. malayi. The protein structure revealed a stabilizing N-terminal MIT-like domain and a catalytic C-terminal C2B-type HAD phosphatase fold. Structure-guided mutagenesis, combined with kinetic analyses using a designed competitive inhibitor, trehalose 6-sulfate, identified five residues important for binding and catalysis. This structure-function analysis along with computational mapping provided the basis for the proposed model of the T6PP-trehalose 6-phosphate complex. The model indicates a substrate-binding mode wherein shape complementarity and van der Waals interactions drive recognition. The mode of binding is in sharp contrast to the homolog sucrose-6-phosphate phosphatase where extensive hydrogen-bond interactions are made to the substrate. Together these results suggest that high-affinity inhibitors will be bi-dentate, taking advantage of substrate-like binding to the phosphoryl-binding pocket while simultaneously utilizing non-native binding to the trehalose pocket. The conservation of the key residues that enforce the shape of the substrate pocket in T6PP enzymes suggest that development of broad-range anthelmintic and antibacterial therapeutics employing this platform may be possible.

  16. Functional analysis of the cathepsin-like cysteine protease genes in adult Brugia malayi using RNA interference.

    Directory of Open Access Journals (Sweden)

    Louise Ford

    Full Text Available BACKGROUND: Cathepsin-like enzymes have been identified as potential targets for drug or vaccine development in many parasites, as their functions appear to be essential in a variety of important biological processes within the host, such as molting, cuticle remodeling, embryogenesis, feeding and immune evasion. Functional analysis of Caenorhabditis elegans cathepsin L (Ce-cpl-1 and cathepsin Z (Ce-cpz-1 has established that both genes are required for early embryogenesis, with Ce-cpl-1 having a role in regulating in part the processing of yolk proteins. Ce-cpz-1 also has an important role during molting. METHODS AND FINDINGS: RNA interference assays have allowed us to verify whether the functions of the orthologous filarial genes in Brugia malayi adult female worms are similar. Treatment of B. malayi adult female worms with Bm-cpl-1, Bm-cpl-5, which belong to group Ia of the filarial cpl gene family, or Bm-cpz-1 dsRNA resulted in decreased numbers of secreted microfilariae in vitro. In addition, analysis of the intrauterine progeny of the Bm-cpl-5 or Bm-cpl Pro dsRNA- and siRNA-treated worms revealed a clear disruption in the process of embryogenesis resulting in structural abnormalities in embryos and a varied differential development of embryonic stages. CONCLUSIONS: Our studies suggest that these filarial cathepsin-like cysteine proteases are likely to be functional orthologs of the C. elegans genes. This functional conservation may thus allow for a more thorough investigation of their distinct functions and their development as potential drug targets.

  17. In vitro flubendazole-induced damage to vital tissues in adult females of the filarial nematode Brugia malayi.

    Science.gov (United States)

    O'Neill, Maeghan; Geary, James F; Agnew, Dalen W; Mackenzie, Charles D; Geary, Timothy G

    2015-12-01

    The use of a microfilaricidal drug for the control of onchocerciasis and lymphatic filariasis necessitates prolonged yearly dosing. Prospects for elimination or eradication of these diseases would be enhanced by availability of a macrofilaricidal drug. Flubendazole (FLBZ), a benzimidazole anthelmintic, is an appealing candidate macrofilaricide. FLBZ has demonstrated profound and potent macrofilaricidal effects in a number of experimental filarial rodent models and one human trial. Unfortunately, FLBZ was deemed unsatisfactory for use in mass drug administration (MDA) campaigns due to its markedly limited oral bioavailability. However, a new formulation that provided sufficient bioavailability following oral administration could render FLBZ an effective treatment for onchocerciasis and LF. This study characterized the effects of FLBZ and its reduced metabolite (FLBZ-R) on filarial nematodes in vitro to determine the exposure profile which results in demonstrable damage. Adult female Brugia malayi were exposed to varying concentrations of FLBZ or FLBZ-R (100 nM-10 μM) for up to five days, after which worms were fixed for histology. Morphological damage following exposure to FLBZ was observed prominently in the hypodermis and developing embryos at concentrations as low as 100 nM following 24 h exposure. The results indicate that damage to tissues required for reproduction and survival can be achieved at pharmacologically relevant concentrations. PMID:26288741

  18. An In Vitro/In Vivo Model to Analyze the Effects of Flubendazole Exposure on Adult Female Brugia malayi.

    Directory of Open Access Journals (Sweden)

    Maeghan O'Neill

    2016-05-01

    Full Text Available Current control strategies for onchocerciasis and lymphatic filariasis (LF rely on prolonged yearly or twice-yearly mass administration of microfilaricidal drugs. Prospects for near-term elimination or eradication of these diseases would be improved by availability of a macrofilaricide that is highly effective in a short regimen. Flubendazole (FLBZ, a benzimidazole anthelmintic registered for control of human gastrointestinal nematode infections, is a potential candidate for this role. FLBZ has profound and potent macrofilaricidal effects in many experimental animal models of filariases and in one human trial for onchocerciasis after parental administration. Unfortunately, the marketed formulation of FLBZ provides very limited oral bioavailability and parenteral administration is required for macrofilaricidal efficacy. A new formulation that provided sufficient oral bioavailability could advance FLBZ as an effective treatment for onchocerciasis and LF. Short-term in vitro culture experiments in adult filariae have shown that FLBZ damages tissues required for reproduction and survival at pharmacologically relevant concentrations. The current study characterized the long-term effects of FLBZ on adult Brugia malayi by maintaining parasites in jirds for up to eight weeks following brief drug exposure (6-24 hr to pharmacologically relevant concentrations (100 nM-10 μM in culture. Morphological damage following exposure to FLBZ was observed prominently in developing embryos and was accompanied by a decrease in microfilarial output at 4 weeks post-exposure. Although FLBZ exposure clearly damaged the parasites, exposed worms recovered and were viable 8 weeks after treatment.

  19. In vitro flubendazole-induced damage to vital tissues in adult females of the filarial nematode Brugia malayi

    Directory of Open Access Journals (Sweden)

    Maeghan O'Neill

    2015-12-01

    Full Text Available The use of a microfilaricidal drug for the control of onchocerciasis and lymphatic filariasis necessitates prolonged yearly dosing. Prospects for elimination or eradication of these diseases would be enhanced by availability of a macrofilaricidal drug. Flubendazole (FLBZ, a benzimidazole anthelmintic, is an appealing candidate macrofilaricide. FLBZ has demonstrated profound and potent macrofilaricidal effects in a number of experimental filarial rodent models and one human trial. Unfortunately, FLBZ was deemed unsatisfactory for use in mass drug administration (MDA campaigns due to its markedly limited oral bioavailability. However, a new formulation that provided sufficient bioavailability following oral administration could render FLBZ an effective treatment for onchocerciasis and LF. This study characterized the effects of FLBZ and its reduced metabolite (FLBZ-R on filarial nematodes in vitro to determine the exposure profile which results in demonstrable damage. Adult female Brugia malayi were exposed to varying concentrations of FLBZ or FLBZ-R (100 nM–10 μM for up to five days, after which worms were fixed for histology. Morphological damage following exposure to FLBZ was observed prominently in the hypodermis and developing embryos at concentrations as low as 100 nM following 24 h exposure. The results indicate that damage to tissues required for reproduction and survival can be achieved at pharmacologically relevant concentrations.

  20. An In Vitro/In Vivo Model to Analyze the Effects of Flubendazole Exposure on Adult Female Brugia malayi

    Science.gov (United States)

    O’Neill, Maeghan; Mansour, Abdelmoneim; DiCosty, Utami; Geary, James; Dzimianski, Michael; McCall, Scott D.; McCall, John W.; Mackenzie, Charles D.; Geary, Timothy G.

    2016-01-01

    Current control strategies for onchocerciasis and lymphatic filariasis (LF) rely on prolonged yearly or twice-yearly mass administration of microfilaricidal drugs. Prospects for near-term elimination or eradication of these diseases would be improved by availability of a macrofilaricide that is highly effective in a short regimen. Flubendazole (FLBZ), a benzimidazole anthelmintic registered for control of human gastrointestinal nematode infections, is a potential candidate for this role. FLBZ has profound and potent macrofilaricidal effects in many experimental animal models of filariases and in one human trial for onchocerciasis after parental administration. Unfortunately, the marketed formulation of FLBZ provides very limited oral bioavailability and parenteral administration is required for macrofilaricidal efficacy. A new formulation that provided sufficient oral bioavailability could advance FLBZ as an effective treatment for onchocerciasis and LF. Short-term in vitro culture experiments in adult filariae have shown that FLBZ damages tissues required for reproduction and survival at pharmacologically relevant concentrations. The current study characterized the long-term effects of FLBZ on adult Brugia malayi by maintaining parasites in jirds for up to eight weeks following brief drug exposure (6–24 hr) to pharmacologically relevant concentrations (100 nM—10 μM) in culture. Morphological damage following exposure to FLBZ was observed prominently in developing embryos and was accompanied by a decrease in microfilarial output at 4 weeks post-exposure. Although FLBZ exposure clearly damaged the parasites, exposed worms recovered and were viable 8 weeks after treatment. PMID:27145083

  1. Detection of Brugia malayi in laboratory and wild-caught Mansonioides mosquitoes (Diptera: Culicidae) using Hha I PCR assay.

    Science.gov (United States)

    Hoti, S L; Vasuki, V; Lizotte, M W; Patra, K P; Ravi, G; Vanamail, P; Manonmani, A; Sabesan, S; Krishnamoorthy, K; Williams, S A

    2001-04-01

    An Hha 1 based polymerase chain reaction (PCR) assay developed for the detection of Brugia malayi, the causative agent of Brugian lymphatic filariasis, was evaluated for its sensitivity in the laboratory and for its usefulness in measuring changes in transmission of the disease in the field. Laboratory studies showed that the new assay was highly sensitive in comparison with the standard dissection and microscopy technique. The assay can detect as little as 4 pg of parasite DNA or a single microfilaria in pools of up to 100 mosquitoes. The optimum pool size for convenience was found to be 50 mosquitoes per pool. The efficacy of PCR assay was evaluated in filariasis control programmes in operation in endemic areas of Kerala State, South India. The infection rates obtained by the Hha I PCR assay and the conventional dissection and microscopy technique were 1.2% and 1.7% respectively in operational areas and 8.3% and 4.4% respectively, in check areas, which were not significantly different (P used as a new epidemiological tool for assessing parasite infection in field-collected mosquitoes. PMID:11260722

  2. An In Vitro/In Vivo Model to Analyze the Effects of Flubendazole Exposure on Adult Female Brugia malayi.

    Science.gov (United States)

    O'Neill, Maeghan; Mansour, Abdelmoneim; DiCosty, Utami; Geary, James; Dzimianski, Michael; McCall, Scott D; McCall, John W; Mackenzie, Charles D; Geary, Timothy G

    2016-05-01

    Current control strategies for onchocerciasis and lymphatic filariasis (LF) rely on prolonged yearly or twice-yearly mass administration of microfilaricidal drugs. Prospects for near-term elimination or eradication of these diseases would be improved by availability of a macrofilaricide that is highly effective in a short regimen. Flubendazole (FLBZ), a benzimidazole anthelmintic registered for control of human gastrointestinal nematode infections, is a potential candidate for this role. FLBZ has profound and potent macrofilaricidal effects in many experimental animal models of filariases and in one human trial for onchocerciasis after parental administration. Unfortunately, the marketed formulation of FLBZ provides very limited oral bioavailability and parenteral administration is required for macrofilaricidal efficacy. A new formulation that provided sufficient oral bioavailability could advance FLBZ as an effective treatment for onchocerciasis and LF. Short-term in vitro culture experiments in adult filariae have shown that FLBZ damages tissues required for reproduction and survival at pharmacologically relevant concentrations. The current study characterized the long-term effects of FLBZ on adult Brugia malayi by maintaining parasites in jirds for up to eight weeks following brief drug exposure (6-24 hr) to pharmacologically relevant concentrations (100 nM-10 μM) in culture. Morphological damage following exposure to FLBZ was observed prominently in developing embryos and was accompanied by a decrease in microfilarial output at 4 weeks post-exposure. Although FLBZ exposure clearly damaged the parasites, exposed worms recovered and were viable 8 weeks after treatment. PMID:27145083

  3. Inflammatory mediator release byBrugia malayi from macrophages of susceptible hostMastomys coucha andTHP-1 andRAW 264.7 cell lines

    Institute of Scientific and Technical Information of China (English)

    Shiv Kumar Verma; Vikas Kushwaha; Vijaya Dubey; Kirti Saxena; Aakanksha Sharma; Puvvada Kalpana Murthy

    2011-01-01

    Objective:To investigate which life stage of the parasite has the ability to stimulate release of pro- or anti-inflammatory mediators from macrophages.Methods: The human macrophage/monocyte cell lineTHP-1, the mouse macrophage cell lineRAW 264.7 and naive peritoneal macrophages(PM)from the rodent hostMastomys coucha (M. coucha)were incubated at37 ℃in 5% CO2atmosphere with extracts of microfilariae(Mf), third stage infective larvae(L3) and adult worms (Ad)ofBrugia malayi. After48 hr post exposure,IL-1β, IL-6, TNF-α, IL-10 and nitric oxide (NO) in cell-free supernatants were estimated.Results: Extracts of all the life stages of the parasite were capable of stimulating pro-(IL-1β, IL-6 andTNF-α) and anti-inflammatory (IL-10)cytokines in both the cell lines and peritoneal macrophages ofM. coucha. Mf was the strongest stimulator of pro-inflammatory cytokines followed by L3 and Ad; however, Ad was a strong stimulator ofIL-10 release. Mf was found to have potential to modulateLPS-inducedNO release inRAW cells. Ad-inducedNO release was concentration dependent with maximum at 20 μg/mL in bothRAW andPMs.Conclusions:The results show that parasites at all life stages were capable of stimulating pro- (IL-1β, IL-6 and TNF-α) and anti-inflammatory(IL-10) cytokines andNO release from macrophages of susceptible hostM. coucha, human and mouse macrophage cell lines.Mf can suppress theLPS-inducedNO release inRAW cells. The findings also show that the two cell lines may provide a convenientin vitro system for assaying parasite-induced inflammatory mediator release.

  4. Detection of enzymes dehydrogenases and proteases inBrugia malayi filarial parasites.

    Science.gov (United States)

    Bhandary, Y P; Krithika, K N; Kulkarni, Sandeep; Reddy, M V R; Harinath, B C

    2006-03-01

    Lymphatic filariasis caused mainly by infection fromW. bancrofti andB. malayi remains a major cause of clinical morbidity in tropical and subtropical countries. Analysis ofB. malayi mf, infective larval and adult worm lysates for the activity of enzymes led to the demonstration of activities of three key enzymes of carbohydrate metabolism viz., Malate dehydrogenase (MDH), Malic enzyme (ME) and Glucose-6-phosphate dehydrogenase (G6PDH) in all the three stages of the parasite. The specific activity of all the three dehydrogenases was significantly high in mf lysate compared to their activity in lysates of the other two stages (PFlouride (PMSF). In sodium do-decyl sulphate polyacrylamide gel electrophoresis (SDS-PAGE), using gelatin copolymerized gel, the microfilarial lysate showed 3 protease molecules of 40 kDa, 180 kDa and 200 kDa and the L(3) larval lysate had 6 protease molecules of 18, 25, 37, 49, 70 and 200 kDa size.

  5. Characterization of transcription factors that regulate the type IV secretion system and riboflavin biosynthesis in Wolbachia of Brugia malayi.

    Directory of Open Access Journals (Sweden)

    Zhiru Li

    Full Text Available The human filarial parasite Brugia malayi harbors an endosymbiotic bacterium Wolbachia (wBm that is required for parasite survival. Consequently, targeting wBm is a promising approach for anti-filarial drug development. The Type IV secretion system (T4SS plays an important role in bacteria-host interactions and is under stringent regulation by transcription factors. In wBm, most T4SS genes are contained in two operons. We show the wBm is active since the essential assembly factor virB8-1, is transcribed in adult worms and larval stages, and VirB8-1 is present in parasite lysates. We also identify two transcription factors (wBmxR1 and wBmxR2 that bind to the promoter region of several genes of the T4SS. Gel shift assays show binding of wBmxR1 to regions upstream of the virB9-2 and wBmxR2 genes, whereas wBmxR2 binds to virB4-2 and wBmxR1 promoter regions. Interestingly, both transcription factors bind to the promoter of the ribA gene that precedes virB8-1, the first gene in operon 1 of the wBm T4SS. RT-PCR reveals ribA and virB8-1 genes are co-transcribed as one operon, indicating the ribA gene and T4SS operon 1 are co-regulated by both wBmxR1 and wBmxR2. RibA encodes a bi-functional enzyme that catalyzes two essential steps in riboflavin (Vitamin B2 biosynthesis. Importantly, the riboflavin pathway is absent in B. malayi. We demonstrate the pathway is functional in wBm, and observe vitamin B2 supplementation partially rescues filarial parasites treated with doxycycline, indicating Wolbachia may supply the essential vitamin to its worm host. This is the first characterization of a transcription factor(s from wBm and first report of co-regulation of genes of the T4SS and riboflavin biosynthesis pathway. In addition, our results demonstrate a requirement of vitamin B2 for worm health and fertility, and imply a nutritional role of the symbiont for the filarial parasite host.

  6. Characterization of transcription factors that regulate the type IV secretion system and riboflavin biosynthesis in Wolbachia of Brugia malayi.

    Science.gov (United States)

    Li, Zhiru; Carlow, Clotilde K S

    2012-01-01

    The human filarial parasite Brugia malayi harbors an endosymbiotic bacterium Wolbachia (wBm) that is required for parasite survival. Consequently, targeting wBm is a promising approach for anti-filarial drug development. The Type IV secretion system (T4SS) plays an important role in bacteria-host interactions and is under stringent regulation by transcription factors. In wBm, most T4SS genes are contained in two operons. We show the wBm is active since the essential assembly factor virB8-1, is transcribed in adult worms and larval stages, and VirB8-1 is present in parasite lysates. We also identify two transcription factors (wBmxR1 and wBmxR2) that bind to the promoter region of several genes of the T4SS. Gel shift assays show binding of wBmxR1 to regions upstream of the virB9-2 and wBmxR2 genes, whereas wBmxR2 binds to virB4-2 and wBmxR1 promoter regions. Interestingly, both transcription factors bind to the promoter of the ribA gene that precedes virB8-1, the first gene in operon 1 of the wBm T4SS. RT-PCR reveals ribA and virB8-1 genes are co-transcribed as one operon, indicating the ribA gene and T4SS operon 1 are co-regulated by both wBmxR1 and wBmxR2. RibA encodes a bi-functional enzyme that catalyzes two essential steps in riboflavin (Vitamin B2) biosynthesis. Importantly, the riboflavin pathway is absent in B. malayi. We demonstrate the pathway is functional in wBm, and observe vitamin B2 supplementation partially rescues filarial parasites treated with doxycycline, indicating Wolbachia may supply the essential vitamin to its worm host. This is the first characterization of a transcription factor(s) from wBm and first report of co-regulation of genes of the T4SS and riboflavin biosynthesis pathway. In addition, our results demonstrate a requirement of vitamin B2 for worm health and fertility, and imply a nutritional role of the symbiont for the filarial parasite host.

  7. Brugia malayi Microfilariae Induce a Regulatory Monocyte/Macrophage Phenotype That Suppresses Innate and Adaptive Immune Responses

    Science.gov (United States)

    Venugopal, Gopinath; Rao, Gopala B.; Lucius, Richard; Srikantam, Aparna; Hartmann, Susanne

    2014-01-01

    Background Monocytes and macrophages contribute to the dysfunction of immune responses in human filariasis. During patent infection monocytes encounter microfilariae in the blood, an event that occurs in asymptomatically infected filariasis patients that are immunologically hyporeactive. Aim To determine whether blood microfilariae directly act on blood monocytes and in vitro generated macrophages to induce a regulatory phenotype that interferes with innate and adaptive responses. Methodology and principal findings Monocytes and in vitro generated macrophages from filaria non-endemic normal donors were stimulated in vitro with Brugia malayi microfilarial (Mf) lysate. We could show that monocytes stimulated with Mf lysate develop a defined regulatory phenotype, characterised by expression of the immunoregulatory markers IL-10 and PD-L1. Significantly, this regulatory phenotype was recapitulated in monocytes from Wuchereria bancrofti asymptomatically infected patients but not patients with pathology or endemic normals. Monocytes from non-endemic donors stimulated with Mf lysate directly inhibited CD4+ T cell proliferation and cytokine production (IFN-γ, IL-13 and IL-10). IFN-γ responses were restored by neutralising IL-10 or PD-1. Furthermore, macrophages stimulated with Mf lysate expressed high levels of IL-10 and had suppressed phagocytic abilities. Finally Mf lysate applied during the differentiation of macrophages in vitro interfered with macrophage abilities to respond to subsequent LPS stimulation in a selective manner. Conclusions and significance Conclusively, our study demonstrates that Mf lysate stimulation of monocytes from healthy donors in vitro induces a regulatory phenotype, characterized by expression of PD-L1 and IL-10. This phenotype is directly reflected in monocytes from filarial patients with asymptomatic infection but not patients with pathology or endemic normals. We suggest that suppression of T cell functions typically seen in lymphatic

  8. Rapid detection and identification of Wuchereria bancrofti, Brugia malayi, B. pahangi, and Dirofilaria immitis in mosquito vectors and blood samples by high resolution melting real-time PCR.

    Science.gov (United States)

    Thanchomnang, Tongjit; Intapan, Pewpan M; Tantrawatpan, Chairat; Lulitanond, Viraphong; Chungpivat, Sudchit; Taweethavonsawat, Piyanan; Kaewkong, Worasak; Sanpool, Oranuch; Janwan, Penchom; Choochote, Wej; Maleewong, Wanchai

    2013-12-01

    A simple, rapid, and high-throughput method for detection and identification of Wuchereria bancrofti, Brugia malayi, Brugia pahangi, and Dirofilaria immitis in mosquito vectors and blood samples was developed using a real-time PCR combined with high-resolution melting (HRM) analysis. Amplicons of the 4 filarial species were generated from 5S rRNA and spliced leader sequences by the real-time PCR and their melting temperatures were determined by the HRM method. Melting of amplicons from W. bancrofti, B. malayi, D. immitis, and B. pahangi peaked at 81.5±0.2℃, 79.0±0.3℃, 76.8±0.1℃, and 79.9±0.1℃, respectively. This assay is relatively cheap since it does not require synthesis of hybridization probes. Its sensitivity and specificity were 100%. It is a rapid and technically simple approach, and an important tool for population surveys as well as molecular xenomonitoring of parasites in vectors. PMID:24516268

  9. Localization of Brugia malayi (sub-periodic adults in different organs of Mastomys coucha and its influence on microfilaraemia and host antibody response

    Directory of Open Access Journals (Sweden)

    K Athisaya Mary

    2006-05-01

    Full Text Available Lymphatic filariasis caused by nematode parasites Wuchereria bancrofti or Brugia malayi is a spectral disease and produces wide range of immune responses and varying levels ofmicrofilaraemia in infected individuals. The relationship between the immune response of host and the developmental stage of the parasite as well as the microfilariae (mf density and specific location of the adult worms is yet to be understood. As an experimental model, B. malayi adapted in the experimental animal Mastomys coucha has been used widely for various studies in filariasis. The present study was to assess microfilaraemia as well as the humoral immune response of M. coucha during various stages of B. malayi development and their localization in different organs. The result showed that the density of mf in the circulating blood of the experimental animal depended upon the number of female worms as well as the location and co-existence of male and female worms. The mf density in the blood increased with the increase in the number of females. The clearance of inoculated infective stage (L3 or single sex infection or segregation of male and female to different organs of infected host resulted in amicrofilaraemic condition. With respect to antibody response, those animals cleared L3 after inoculation and those with adult worm as well as mf showed low antibody levels. But those with developmental fourth stage and/or adult worms without mf showed significantly higher antibody levels.

  10. Protection against filarial infection by 45-49 kDa molecules of Brugia malayi via IFN-γ-mediated iNOS induction.

    Science.gov (United States)

    Verma, Shiv K; Joseph, Sujith K; Verma, Richa; Kushwaha, Vikas; Parmar, Naveen; Yadav, Pawan K; Thota, Jagadeshwar Reddy; Kar, Susanta; Murthy, P Kalpana

    2015-01-15

    Nitric oxide (NO) mediated mechanisms have been implicated in killing of some life-stages of Brugia malayi/Wuchereria bancrofti and protect the host through type 1 responses and IFN-γ stimulated toxic mediators' release. However, the identity of NO stimulating molecules of the parasites is not known. Three predominantly NO-stimulating SDS-PAGE resolved fractions F8 (45.24-48.64 kDa), F11 (33.44-38.44 kDa) and F12 (28.44-33.44 kDa) from B. malayi were identified and their proteins were analyzed by 2-DE and MALDI-TOF/TOF. Tropomyosin, calponin and de novo peptides were identified by 2-DE and MALDI-TOF/TOF in F8 and immunization with F8 conferred most significant protection against L3-initiated infection in Mastomys coucha. Immunized animals showed upregulated F8-induced NO, IFN-γ, TNF-α, IL-1β, IL-10, TGF-β release, cellular proliferative responses and specific IgG and IgG1. Anti-IFN-γ, anti-TNF-α, and anti-IL-1β significantly reduced F8-mediated NO generation and iNOS induction at protein levels. Anti-IFN-γ treated cells showed maximum reduction (>74%) in NO generation suggesting a predominant role of IFN-γ in iNOS induction. In conclusion, the findings suggest that F8 which contains tropomyosin, calponin and de novo peptides protects the host via IFN-γ mediated iNOS induction and may hold promise as vaccine candidate(s). This is also the first report of identification of tropomyosin and calponin in B. malayi. PMID:25454090

  11. Exome and transcriptome sequencing of Aedes aegypti identifies a locus that confers resistance to Brugia malayi and alters the immune response.

    Science.gov (United States)

    Juneja, Punita; Ariani, Cristina V; Ho, Yung Shwen; Akorli, Jewelna; Palmer, William J; Pain, Arnab; Jiggins, Francis M

    2015-03-01

    Many mosquito species are naturally polymorphic for their abilities to transmit parasites, a feature which is of great interest for controlling vector-borne disease. Aedes aegypti, the primary vector of dengue and yellow fever and a laboratory model for studying lymphatic filariasis, is genetically variable for its capacity to harbor the filarial nematode Brugia malayi. The genome of Ae. aegypti is large and repetitive, making genome resequencing difficult and expensive. We designed exome captures to target protein-coding regions of the genome, and used association mapping in a wild Kenyan population to identify a single, dominant, sex-linked locus underlying resistance. This falls in a region of the genome where a resistance locus was previously mapped in a line established in 1936, suggesting that this polymorphism has been maintained in the wild for the at least 80 years. We then crossed resistant and susceptible mosquitoes to place both alleles of the gene into a common genetic background, and used RNA-seq to measure the effect of this locus on gene expression. We found evidence for Toll, IMD, and JAK-STAT pathway activity in response to early stages of B. malayi infection when the parasites are beginning to die in the resistant genotype. We also found that resistant mosquitoes express anti-microbial peptides at the time of parasite-killing, and that this expression is suppressed in susceptible mosquitoes. Together, we have found that a single resistance locus leads to a higher immune response in resistant mosquitoes, and we identify genes in this region that may be responsible for this trait. PMID:25815506

  12. Exome and transcriptome sequencing of Aedes aegypti identifies a locus that confers resistance to Brugia malayi and alters the immune response.

    Directory of Open Access Journals (Sweden)

    Punita Juneja

    2015-03-01

    Full Text Available Many mosquito species are naturally polymorphic for their abilities to transmit parasites, a feature which is of great interest for controlling vector-borne disease. Aedes aegypti, the primary vector of dengue and yellow fever and a laboratory model for studying lymphatic filariasis, is genetically variable for its capacity to harbor the filarial nematode Brugia malayi. The genome of Ae. aegypti is large and repetitive, making genome resequencing difficult and expensive. We designed exome captures to target protein-coding regions of the genome, and used association mapping in a wild Kenyan population to identify a single, dominant, sex-linked locus underlying resistance. This falls in a region of the genome where a resistance locus was previously mapped in a line established in 1936, suggesting that this polymorphism has been maintained in the wild for the at least 80 years. We then crossed resistant and susceptible mosquitoes to place both alleles of the gene into a common genetic background, and used RNA-seq to measure the effect of this locus on gene expression. We found evidence for Toll, IMD, and JAK-STAT pathway activity in response to early stages of B. malayi infection when the parasites are beginning to die in the resistant genotype. We also found that resistant mosquitoes express anti-microbial peptides at the time of parasite-killing, and that this expression is suppressed in susceptible mosquitoes. Together, we have found that a single resistance locus leads to a higher immune response in resistant mosquitoes, and we identify genes in this region that may be responsible for this trait.

  13. Exome and Transcriptome Sequencing of Aedes aegypti Identifies a Locus That Confers Resistance to Brugia malayi and Alters the Immune Response

    KAUST Repository

    Juneja, Punita

    2015-03-27

    Many mosquito species are naturally polymorphic for their abilities to transmit parasites, a feature which is of great interest for controlling vector-borne disease. Aedes aegypti, the primary vector of dengue and yellow fever and a laboratory model for studying lymphatic filariasis, is genetically variable for its capacity to harbor the filarial nematode Brugia malayi. The genome of Ae. aegypti is large and repetitive, making genome resequencing difficult and expensive. We designed exome captures to target protein-coding regions of the genome, and used association mapping in a wild Kenyan population to identify a single, dominant, sex-linked locus underlying resistance. This falls in a region of the genome where a resistance locus was previously mapped in a line established in 1936, suggesting that this polymorphism has been maintained in the wild for the at least 80 years. We then crossed resistant and susceptible mosquitoes to place both alleles of the gene into a common genetic background, and used RNA-seq to measure the effect of this locus on gene expression. We found evidence for Toll, IMD, and JAK-STAT pathway activity in response to early stages of B. malayi infection when the parasites are beginning to die in the resistant genotype. We also found that resistant mosquitoes express anti-microbial peptides at the time of parasite-killing, and that this expression is suppressed in susceptible mosquitoes. Together, we have found that a single resistance locus leads to a higher immune response in resistant mosquitoes, and we identify genes in this region that may be responsible for this trait.

  14. A recombinant plasmid of composite cysteine proteinase inhibitor/glyceraldehyde-3-phosphate dehydrogenase gene of periodic Brugia malayi functions on DNA immunity in the host

    Directory of Open Access Journals (Sweden)

    Z Fang

    2016-01-01

    Full Text Available Objectives: Both cysteine proteinase inhibitors (CPIs and glyceraldehyde-3-phosphate dehydrogenase (GAPDH play important roles in the pathogenesis of parasites and their relationship with the hosts. We constructed a new eukaryotic recombinant expression plasmid pcDNA3.1(+-BmCPI/BmGAPDH of periodic Brugia malayi for investigation of the DNA vaccine-elicited immune responses. Materials and Methods: We cloned a gene encoding the CPIs and GAPDH from periodic B. malayi into vector pcDNA3.1. The composited plasmid or the control was injected into the tibialis anterior muscle of the hind leg in BALB/c mice, respectively. The target genes were detected by reverse transcription-polymerase chain reaction in muscle tissues. The stimulation index (SI of T-lymphocyte proliferation and the levels of interferon-gamma (INF-g and interleukin-4 ( IL-4 in serum were detected by thiazolyl blue tetrazolium blue and enzyme-linked immunosorbent assays. Results: The pcDNA3.1(+-BmCPI/BmGAPDH was amplified from muscle tissues of the mice after immunisation. The SI of the immunised group was significantly higher than that of the two control groups (P < 0.05. The levels of INF-g and IL-4 of pcDNA3.1(+-BmCPI/BmGAPDH group were both higher than those of the two control groups (P < 0.05. The level of INF-g of pcDNA3.1(+-BmCPI/BmGAPDH group was significantly higher than that of pcDNA3.1(+-BmCPI/CpG group (P < 0.05. Conclusions: We conclude that the recombinant plasmid pcDNA3.1(+-BmCPI/BmGAPDH could elicit specific humoural and cellular immune responses in mice.

  15. Cloning, expression and characterization of UDP-N-acetylglucosamine enolpyruvyl transferase (MurA from Wolbachia endosymbiont of human lymphatic filarial parasite Brugia malayi.

    Directory of Open Access Journals (Sweden)

    Mohd Shahab

    Full Text Available Wolbachia, an endosymbiont of filarial nematode, is considered a promising target for treatment of lymphatic filariasis. Although functional characterization of the Wolbachia peptidoglycan assembly has not been fully explored, the Wolbachia genome provides evidence for coding all of the genes involved in lipid II biosynthesis, a part of peptidoglycan biosynthesis pathway. UDP-N-acetylglucosamine enolpyruvyl transferase (MurA is one of the lipid II biosynthesis pathway enzymes and it has inevitably been recognized as an antibiotic target. In view of the vital role of MurA in bacterial viability and survival, MurA ortholog from Wolbachia endosymbiont of Brugia malayi (wBm-MurA was cloned, expressed and purified for further molecular characterization. The enzyme kinetics and inhibition studies were undertaken using fosfomycin. wBm-MurA was found to be expressed in all the major life stages of B. malayi and was immunolocalized in Wolbachia within the microfilariae and female adults by the confocal microscopy. Sequence analysis suggests that the amino acids crucial for enzymatic activity are conserved. The purified wBm-MurA was shown to possess the EPSP synthase (3-phosphoshikimate 1-carboxyvinyltransferase like activity at a broad pH range with optimal activity at pH 7.5 and 37°C temperature. The apparent affinity constant (Km for the substrate UDP-N-acetylglucosamine was found to be 0.03149 mM and for phosphoenolpyruvate 0.009198 mM. The relative enzymatic activity was inhibited ∼2 fold in presence of fosfomycin. Superimposition of the wBm-MurA homology model with the structural model of Haemophilus influenzae (Hi-MurA suggests binding of fosfomycin at the same active site. The findings suggest wBm-MurA to be a putative antifilarial drug target for screening of novel compounds.

  16. PENENTUAN JENIS NYAMUK MansoniaSEBAGAI TERSANGKA VEKTOR FILARIASIS Brugia malayi DAN HEWAN ZOONOSIS DI KABUPATEN MUARO JAMBI

    OpenAIRE

    Santoso Santoso; Yahya Yahya; Milana Salim

    2015-01-01

    AbstrakFilariasis merupakan penyakit yang tidak mudah menular. Filariasis adalah penyakit yang ditularkan oleh nyamuk sebagai vector. Jenis nyamuk yang dapat berperan sebagai vector filariasis dipengaruhi oleh jenis cacing penyebab filaria. Brugia spp. umumnya ditularkan oleh nyamuk Mansonia spp dan Anopheles spp. Vektor dan hewan zoonosis merupakan salah satu factor yang dapat perlu mendapat perhatian dalam pengendalian filariasis. Penelitian terhadap vector dan hewan zoonosis telah dilakuka...

  17. Bm-CPI-2, a cystatin from Brugia malayi nematode parasites, differs from Caenorhabditis elegans cystatins in a specific site mediating inhibition of the antigen-processing enzyme AEP.

    Science.gov (United States)

    Murray, Janice; Manoury, Bénédicte; Balic, Adam; Watts, Colin; Maizels, Rick M

    2005-02-01

    The filarial parasite Brugia malayi survives for many years in the human lymphatic system. One immune evasion mechanism employed by Brugia is thought to be the release of cysteine protease inhibitors (cystatins), and we have previously shown that the recombinant cystatin Bm-CPI-2 interferes with protease-dependent antigen processing in the MHC class II antigen presentation pathway. Analogy with vertebrate cystatins suggested that Bm-CPI-2 is bi-functional, with one face of the protein blocking papain-like proteases, and the other able to inhibit legumains such as asparaginyl endopeptidase (AEP). Site-directed mutagenesis was carried out on Bm-CPI-2 at Asn-77, the residue on which AEP inhibition is dependent in vertebrate homologues. Two mutations at this site (to Asp and Lys) showed 10-fold diminished and ablated activity respectively, in assays of AEP inhibition, while blocking of papain-like proteases was reduced by only a small degree. Comparison of the B. malayi cystatins with two homologues encoded by the free-living model organism, Caenorhabditis elegans, suggested that while the papain site may be intact, the AEP site would not be functional. This supposition was tested with recombinant C. elegans proteins, Ce-CPI-1 (K08B4.6) and Ce-CPI-2 (R01B10.1), both of which block cathepsins and neither of which possess the ability to block AEP. Thus, Brugia CPI-2 may have convergently evolved to inhibit an enzyme important only in the mammalian environment.

  18. Brugia malayi Antigen (BmA Inhibits HIV-1 Trans-Infection but Neither BmA nor ES-62 Alter HIV-1 Infectivity of DC Induced CD4+ Th-Cells.

    Directory of Open Access Journals (Sweden)

    Emily E I M Mouser

    Full Text Available One of the hallmarks of HIV-1 disease is the association of heightened CD4+ T-cell activation with HIV-1 replication. Parasitic helminths including filarial nematodes have evolved numerous and complex mechanisms to skew, dampen and evade human immune responses suggesting that HIV-1 infection may be modulated in co-infected individuals. Here we studied the effects of two filarial nematode products, adult worm antigen from Brugia malayi (BmA and excretory-secretory product 62 (ES-62 from Acanthocheilonema viteae on HIV-1 infection in vitro. Neither BmA nor ES-62 influenced HIV-1 replication in CD4+ enriched T-cells, with either a CCR5- or CXCR4-using virus. BmA, but not ES-62, had the capacity to bind the C-type lectin dendritic cell-specific intercellular adhesion molecule-3-grabbing non-integrin (DC-SIGN thereby inhibiting HIV-1 trans-infection of CD4+ enriched T-cells. As for their effect on DCs, neither BmA nor ES-62 could enhance or inhibit DC maturation as determined by CD83, CD86 and HLA-DR expression, or the production of IL-6, IL-10, IL-12 and TNF-α. As expected, due to the unaltered DC phenotype, no differences were found in CD4+ T helper (Th cell phenotypes induced by DCs treated with either BmA or ES-62. Moreover, the HIV-1 susceptibility of the Th-cell populations induced by BmA or ES-62 exposed DCs was unaffected for both CCR5- and CXCR4-using HIV-1 viruses. In conclusion, although BmA has the potential capacity to interfere with HIV-1 transmission or initial viral dissemination through preventing the virus from interacting with DCs, no differences in the Th-cell polarizing capacity of DCs exposed to BmA or ES-62 were observed. Neither antigenic source demonstrated beneficial or detrimental effects on the HIV-1 susceptibility of CD4+ Th-cells induced by exposed DCs.

  19. 周期型马来丝虫3-磷酸甘油醛脱氢酶基因真核表达载体的构建及DNA免疫研究%Construction of pcDNA3. 1-Brugia malayi glyceraldehyde phosphate dehydrogenase eukaryotic recombinant plasmid and study on its role in DNA immunity

    Institute of Scientific and Technical Information of China (English)

    童海燕; 方政; 谢东方; 黄为群; 方浩; 徐邦生

    2009-01-01

    Objective To construct the pcDNA3. 1-Brugia malayi (Bm) glyceraldehyde-3-phosphate dehydrogenase (GAPDH) eukaryotic recombinant plasmid and to study its effect on mouse cellular immunity response. Methods Total RNA was prepared from periodic Bm. The target gene fragments were amplified by reverse transcription-polymerase chain reaction (RT-PCR) technique and then were inserted into the cloning vector. pGEM-T Easy, and sub-cloned into pcDNA3. 1. Purified pcDNA 3. 1-BmGAPDH recombinant plasmid and CpG were injected into the anterior tibial muscle of BALB/c mice in order to induce host immunity response. Mice injected with PBS and mice injected with blank plasmid were prepared as controls. The mouse models were immunized for 3 times with an interval of 2 weeks. RT-PCR was utilized to detect target gene expression in the muscle tissue. MTT method was used to measure the immunized mice T lymphocytes stimulation index, while enzyme-linked immunoassay (ELISA) was used to determine the serum interleukin (IL)-4 and interferon (IFN)-γ level. Means were compared using t test with SPSS software. Results The recombinant plasmid pcDNA3. 1-BmGAPDH was constructed sucessfully. The target gene was 1020 bp long and its homology with known gene sequence in database was 99%. BmGAPDH gene in the injected muscle of the immunized mice was detected by PCR. The proliferation of spleen T lymphocytes was higher in pcDNA3-BmGAPDH group than in the 2 control groups which were 1. 398, 1. 006 and 1. 017,respectively (P< 0. 05). The levels of IFN-γ and IL-4 in serums from the immunized mice were significantly higher than those of the PBS control group and blank plasmid control group which were 163.905, 58.589, 51. 317 and 107. 906, 27.111, 34.627, respectively (P<0. 05). Immune adjuvant CpG could accelerate and boost antigen-specific immune responses induced by vaccine, which presented as significant increase of IFN-γ and lymphocyte proliferation at 4 weeks after immunization.Conclusion The

  20. A reverse transcriptase-PCR assay for detecting filarial infective larvae in mosquitoes.

    Directory of Open Access Journals (Sweden)

    Sandra J Laney

    Full Text Available BACKGROUND: Existing molecular assays for filarial parasite DNA in mosquitoes cannot distinguish between infected mosquitoes that contain any stage of the parasite and infective mosquitoes that harbor third stage larvae (L3 capable of establishing new infections in humans. We now report development of a molecular L3-detection assay for Brugia malayi in vectors based on RT-PCR detection of an L3-activated gene transcript. METHODOLOGY/PRINCIPAL FINDINGS: Candidate genes identified by bioinformatics analysis of EST datasets across the B. malayi life cycle were initially screened by PCR using cDNA libraries as templates. Stage-specificity was confirmed using RNA isolated from infected mosquitoes. Mosquitoes were collected daily for 14 days after feeding on microfilaremic cat blood. RT-PCR was performed with primer sets that were specific for individual candidate genes. Many promising candidates with strong expression in the L3 stage were excluded because of low-level transcription in less mature larvae. One transcript (TC8100, which encodes a particular form of collagen was only detected in mosquitoes that contained L3 larvae. This assay detects a single L3 in a pool of 25 mosquitoes. CONCLUSIONS/SIGNIFICANCE: This L3-activated gene transcript, combined with a control transcript (tph-1, accession # U80971 that is constitutively expressed by all vector-stage filarial larvae, can be used to detect filarial infectivity in pools of mosquito vectors. This general approach (detection of stage-specific gene transcripts from eukaryotic pathogens may also be useful for detecting infective stages of other vector-borne parasites.

  1. Effects of gamma radiation on development of Brugia pahangi in a susceptible strain of Aedes aegypti

    Energy Technology Data Exchange (ETDEWEB)

    Richey, T.J.; Rodriguez, P.H.

    1976-08-01

    Female mosquitoes were fed on an infected jird having a microfilarial density of 201 per mm/sup 3/ of blood. Mosquitoes were exposed to doses of 3,000 and 5,000 rads of gamma radiation before and after infection. Mosquitoes were dissected 8 to 10 days later and the number of active larvae was recorded. Results indicated that postinfection radiation affected the development of Brugia pahangi. (HLW)

  2. Proinflammatory Cytokine Gene Expression by Murine Macrophages in Response to Brugia malayi Wolbachia Surface Protein

    Directory of Open Access Journals (Sweden)

    Chantima Porksakorn

    2007-01-01

    Full Text Available Wolbachia, an endosymbiotic bacterium found in most species of filarial parasites, is thought to play a significant role in inducing innate inflammatory responses in lymphatic filariasis patients. However, the Wolbachia-derived molecules that are recognized by the innate immune system have not yet been identified. In this study, we exposed the murine macrophage cell line RAW 264.7 to a recombinant form of the major Wolbachia surface protein (rWSP to determine if WSP is capable of innately inducing cytokine transcription. Interleukin (IL-1β, IL-6, and tumor necrosis factor (TNF mRNAs were all upregulated by the rWSP stimulation in a dose-dependant manner. TNF transcription peaked at 3 hours, whereas IL-1β and IL-6 transcription peaked at 6 hours post-rWSP exposure. The levels of innate cytokine expression induced by a high-dose (9.0 μg/mL rWSP in the RAW 264.7 cells were comparable to the levels induced by 0.1 μg/mL E. coli-derived lipopolysaccharides. Pretreatment of the rWSP with proteinase-K drastically reduced IL-1β, IL-6, and TNF transcription. However, the proinflammatory response was not inhibited by polymyxin B treatment. These results strongly suggest that the major Wolbachia surface protein molecule WSP is an important inducer of innate immune responses during filarial infections.

  3. Novel drug designing rationale againstBrugia malayi microfilariae using herbal extracts

    Institute of Scientific and Technical Information of China (English)

    SharmaRD; PetareS; ShindeGB; KalyanGoswami; ReddyMVR

    2010-01-01

    Objective:To explore the effect of herbal polyphenolics on filariasisin vitro.Methods: Two herbal extracts, methanolic extracts of roots ofVitex negundo Linn. (Nirgundi) and leaves ofAegle marmelos Juss. (Beal) in different concentrations ranging from40-80ng/mL were tested for their antifilarial activity either alone or in combination with diethyl carbonate (DEC)(300μg/mL) and/orH2O2 (0.5 mM).Results:Combination of DEC and each extract had significant anti-filarial effect. And fractions of both extracts were not effective as crude herbal extract.Conclusions:Such unique pharmacodynamics reported in this study might provide new drug development stratagem against filariasis.

  4. A multicenter evaluation of a new antibody test kit for lymphatic filariasis employing recombinant Brugia malayi antigen Bm-14

    OpenAIRE

    Weil, Gary J; Curtis, Kurt C.; Fischer, Peter U.; Kimberly Y Won; Lammie, Patrick J; Joseph, Hayley; Melrose, Wayne D; Brattig, Norbert W.

    2010-01-01

    Antibody tests are useful for mapping the distribution of lymphatic filariasis (LF) in countries and regions and for monitoring progress in elimination programs based on mass drug administration (MDA). Prior antibody tests have suffered from poor sensitivity and/or specificity or from a lack of standardization. We conducted a multicenter evaluation of a new commercial ELISA that detects IgG4 antibodies to the recombinant filarial antigen Bm14. Four laboratories tested a shared panel of coded ...

  5. Effectiveness of two rounds of mass drug administration using DEC combined with albendazole on the prevalence of Brugia malayi

    OpenAIRE

    Santoso Santoso; Aprioza Yenni; Reni Oktarina; Tri Wurisastuti

    2015-01-01

    Background: Filariasis mass drug administration carried out for 5 consecutive years aims to reduce the prevalence rate of < 1%. Evaluation of treatment needs to be done, one of them with a finger blood survey. This study aims to assess the effectiveness of mass treatment and factors that influence. Methods:The study design was cross-sectional study. Blood sampling performed at night in four selected villages with a number of samples for blood tests as many as 1,209 people. Results:The numb...

  6. Effectiveness of two rounds of mass drug administration using DEC combined with albendazole on the prevalence of Brugia malayi

    Directory of Open Access Journals (Sweden)

    Santoso Santoso

    2015-11-01

    Full Text Available Background: Filariasis mass drug administration carried out for 5 consecutive years aims to reduce the prevalence rate of < 1%. Evaluation of treatment needs to be done, one of them with a finger blood survey. This study aims to assess the effectiveness of mass treatment and factors that influence. Methods:The study design was cross-sectional study. Blood sampling performed at night in four selected villages with a number of samples for blood tests as many as 1,209 people. Results:The number of microfilaria positive population of 10 people. The Village with the most number of cases (6 people with a microfilaria rate of 2.08% is Nibung Putih villages. History of fever, behavior taking medication, age and gender related to the incidence of filariasis. Regency East Tanjung Jabung is endemic filariasis because they found villages with Mf rate > 1%. Conclusions: Implementation of filariasis mass treatment was less effective because they can not derive filariasis endemicity. Recommendation: Implementation of filariasis mass treatment needs to be improved by increasing the participation of local community leaders in order to reach all levels of society, including isolated communities.

  7. Brugia lepori sp. n. (Filarioidea: Onchocercidae) from rabbits (Sylvilagus aquaticus, S. floridanus) in Louisiana.

    Science.gov (United States)

    Eberhard, M L

    1984-08-01

    Brugia lepori sp. n., a filarial nematode from the abdominal lymphatics and subcutaneous tissues of rabbits (Sylvilagus aquaticus, S. floridanus), from St. Tammany Parish, Louisiana, is described. Brugia lepori is of moderate size (males 12 to 19 mm, females 39 to 45 mm) and within the genus most closely resembles Brugia beaveri of the raccoon, from which it can be distinguished by its larger size, smaller spicules, and smaller microfilaria which has a shorter cephalic space. Brugia lepori is only the second species of Brugia described from North America and the third species reported from the Western Hemisphere. PMID:6502360

  8. A member of the TGF-beta receptor gene family in the parasitic nematode Brugia pahangi.

    Science.gov (United States)

    Gomez-Escobar, N; van den Biggelaar, A; Maizels, R

    1997-10-15

    The full length cDNA sequence of a Type I transforming growth factor-beta (TGF-beta) receptor has been isolated from the filarial parasitic nematode Brugia pahangi. This new gene, designated Bp-trk-1, encodes a predicted 645 amino acid sequence with an N-terminal hydrophobic stretch which may act as a signal peptide. The extracellular portion (residues 15-187) is cysteine-rich and has three potential N-glycosylation sites. At positions 250-255 the protein contains the glycine-serine rich motif characteristic of Type I receptors. The closest homologue is a Caenorhabditis elegans gene (Q09488) in cosmid C32D5.2 which shares 67% amino acid identity with Bp-trk-1 in the most conserved kinase domain (aa 259-482). Other type I receptors such as C. elegans daf-1 and Drosophila tkv show 38-53% identity in the same region. Some residues conserved in Drosophila and vertebrates are not present in the B. pahangi sequence. RT-PCR amplification has been used to show that the transcript is expressed in the three main stages of the B. pahangi life cycle: microfilariae, infective larvae and adults. The ligand remains unknown at this time but is likely to be most similar to that for C. elegans Q09488. PMID:9358045

  9. Diagnosis of Brugian Filariasis by Loop-Mediated Isothermal Amplification

    OpenAIRE

    Poole, Catherine B.; Tanner, Nathan A.; Zhang, Yinhua; Thomas C Evans; Carlow, Clotilde K. S.

    2012-01-01

    Author Summary Brugian filariasis is a debilitating neglected tropical disease caused by infection with the filarial parasites Brugia malayi or Brugia timori. Adult worms live in the lymphatic system and produce large numbers of microfilariae that predominantly circulate in the blood at night. Bloodsucking mosquitoes spread the disease by ingesting microfilariae that develop into infective stage larvae in the insect. In rural areas, diagnosis still relies largely on microscopic examination of...

  10. Possible implication of oxidative stress in anti filarial effect of certain traditionally used medicinal plants in vitro against Brugia malayi microfilariae

    Directory of Open Access Journals (Sweden)

    R D Sharma

    2010-01-01

    Full Text Available Introduction: Tropical disease research scheme of World Health Organization has duly recognized traditional medicine as alternative for antifilarial drug development. Polyphenolic compounds present in traditionally used herbal medicines are natural antioxidants; however, paradoxically they may exert pro-oxidant effect. Popular drug diethyl carbamazine citrate harnesses the innate inflammatory response and the consequent oxidative assault to combat invading microbes. Methods: With this perspective, extracts of Vitex negundo L. (roots, Butea monosperma L. (leaves, Aegle marmelos Corr. (leaves, and Ricinus communis L. (leaves were selected to explore the possible role of oxidative rationale in the antifilarial effect in vitro. Results: Apart from the last, other three plant extracts were reported to have polyphenolic compounds. Dose-dependent increase was found in the levels of lipid peroxidation and protein carbonylation for all the three plant extracts except Ricinus communis L. (leaves. Such increase in oxidative parameters also showed some degree of plant-specific predilection in terms of relatively higher level of particular oxidative parameter. High degree of correlation was observed between the antifilarial effect and the levels of corresponding oxidative stress parameters for these three plants. However, extracts of Ricinus communis L. (leaves which is relatively deficient in polyphenolic ingredients recorded maximum 30% loss of motility and also did not show any significant difference in various stress parameters from corresponding control levels. Conclusion: These results reveal that targeted oxidative stress might be crucial in the pharmacodynamics.

  11. Gene : CBRC-TTRU-01-0063 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available AMILY PROTEIN [Brugia malayi] gb|EDP39170.1| PPE FAMILY PROTEIN, putative [Brugia malayi] 6e-73 33% METVHMVKVPRVTLPMVTVLMVT...MPMVMVLMVKLPIVTVPMVIVPVVTVLTVKVPMVTLPTVITLKVTELTVIVAMLTVPLLRVLMVILLTVTVPMVRVLMLRLLMMTTLMVAVPMVT...MLIVAVLMVIVLMLTVLPVTLSMVSVSMVTVLTMILLTVAVLLVTLLRVTVCTVPMVSVPTVTFPMVTVPTVTVSMVRVCMETVHIVTFPTVKMPMVT...VLTMTVPMVTVPMVTVPMVIVPMVTVLMVTVPMVRVLMVTVPMVTVTTVTMPMLTVLTIKMLIVTVPMVILPMGSVLTVKVPMVTLPTVIVHKVRVLTVLVPMVT...VPMVAVPMVTVPMVIVLMVIEPMVTVPMVAVPMVTMFTVSMPMVTLLMVTVLTVKVLTVLVLTVIVLMVIAPW ...

  12. Brugia timori INFECTION IN LEKEBAI, FLORES: clinical aspects

    Directory of Open Access Journals (Sweden)

    Arbain Joesoef

    2012-09-01

    Full Text Available Pengamatan filariasis pada penduduk Nualolo-Lekebai, Pulau Flores telah dilakukan pada bulan Februari 1975. Kampung Nualolo-Lekebai berpenduduk 680 jiwa, pekerjaan bertani dan menganut agama Nasrani. Kebiasaan hidup di antara penduduk di daerah ini adalah menyerahkan pelaksanaan pekerjaan berat pada kaum wanita, baik di rumah ataupun di kebun. Dalam perjalanan jauh baik ke kebun atau ke pasar, kaum wanitanya selalu berjalan kaki sedangkan kaum prianya menunggang kuda. Sejumlah 80% dari penduduk kampung ini telah diperiksa terhadap infeksi parasit filaria dan terhadap gejala filariasis. Dari hasil yang ditemukan ternyata penduduk kampung ini menderita infeksi Brugia timori dengan angka derajat infeksi sebesar 7.0% dan angka derajat elephantiasis sebesar 10.3%. Hal yang menarik yang ditemukan dalam pengamatan ini adalah tingginya angka derajat elephantiasis pada kaum wanita dibandingkan dengan pada kaum pria. Fenomena ini mungkin disebabkan oleh kebiasaan hidup kaum wanita di daerah ini sehari-hari yang bekerja lebih berat dan berjalan kaki lebih sering dan lebih jauh dibandingkan kaum prianya.

  13. [Larva migrans].

    Science.gov (United States)

    Chabasse, D; Le Clec'h, C; de Gentile, L; Verret, J L

    1995-01-01

    Larbish, cutaneous larva migrans or creeping eruption, is a serpiginous cutaneous eruption caused by skin penetration of infective larva from various animal nematodes. Hookworms (Ancylostoma brasiliense, A. caninum) are the most common causative parasites. They live in the intestines of dogs and cats where their ova are deposited in the animal feces. In sandy and shady soil, when temperature and moisture are elevated, the ova hatch and mature into infective larva. Infection occurs when humans have contact with the infected soil. Infective larva penetrate the exposed skin of the body, commonly around the feet, hands and buttocks. In humans, the larva are not able to complete their natural cycle and remain trapped in the upper dermis of the skin. The disease is widespread in tropical or subtropical regions, especially along the coast on sandy beaches. The diagnosis is easy for the patient who is returning from a tropical or subtropical climate and gives a history of beach exposure. The characteristic skin lesion is a fissure or erythematous cord which is displaced a few millimeters each day in a serpiginous track. Scabies, the larva currens syndrome due to Strongyloides stercoralis, must be distinguished from other creeping eruptions and subcutaneous swelling lesions caused by other nematodes or myiasis. Medical treatments are justified because it shortens the duration of the natural evolution of the disease. Topical tiabendazole is safe for localized invasions, but prolonged treatment may be necessary. Oral thiabendazole treatment for three days is effective, but sometimes is associated with adverse effects. Trials using albendazole for one or four consecutive days appear more efficacious. More recent trials using ivermectine showed that a single oral dose can cure 100% of the patients; thus, this drug looks very promising as a new form of therapy. Individual prophylaxis consists of avoiding skin contact with soil which has been contaminated with dog or cat feces

  14. Effect of cyclophosphamide on the immune responsiveness of jirds infected with Brugia pahangi.

    OpenAIRE

    Katz, S P; Lammie, P. J.

    1984-01-01

    The in vitro immune responsiveness of lymphocytes from Brugia pahangi-infected jirds was examined after serial administration of cyclophosphamide (20 mg/kg). Cyclophosphamide had no effect on parasite burdens, anti-B. pahangi antibody titers, or suppressed spleen cell reactivity to B. pahangi antigens. Cyclophosphamide restored cellular responsiveness to the mitogens phytohemagglutinin, concanavalin A, and pokeweed mitogen.

  15. Brugia filariasis differentially modulates persistent Helicobacter pylori gastritis in the gerbil model

    OpenAIRE

    Martin, Heather R.; Shakya, Krishna P.; MUTHUPALANI, SURESHKUMAR; Ge, Zhongming; Klei, Thomas R.; Whary, Mark T.; James G Fox

    2010-01-01

    In select Helicobacter pylori-infected populations with low gastric cancer, nematode coinfections are common and both helicobacter gastritis and filariasis are modeled in gerbils. We evaluated gastritis, worm counts, tissue cytokine gene expression levels and Th1/Th2-associated antibody responses in H. pylori and Brugia pahangi mono- and coinfected gerbils. H. pylori-associated gastritis indices were significantly lower 21 weeks post-infection in coinfected gerbils (p ≤ 0.05) and were inverse...

  16. Assay strategies for the discovery and validation of therapeutics targeting Brugia pahangi Hsp90.

    Directory of Open Access Journals (Sweden)

    Tony Taldone

    Full Text Available The chemotherapy of lymphatic filariasis relies upon drugs such as diethylcarbamazine and ivermectin that largely target the microfilarial stages of the parasite, necessitating continued treatment over the long reproductive life span of the adult worm. The identification of compounds that target adult worms has been a long-term goal of WHO. Here we describe a fluorescence polarization assay for the identification of compounds that target Hsp90 in adult filarial worms. The assay was originally developed to identify inhibitors of Hsp90 in tumor cells, and relies upon the ability of small molecules to inhibit the binding of fluorescently labelled geldanamycin to Hsp90. We demonstrate that the assay works well with soluble extracts of Brugia, while extracts of the free-living nematode C. elegans fail to bind the probe, in agreement with data from other experiments. The assay was validated using known inhibitors of Hsp90 that compete with geldanamycin for binding to Hsp90, including members of the synthetic purine-scaffold series of compounds. The efficacy of some of these compounds against adult worms was confirmed in vitro. Moreover, the assay is sufficiently sensitive to differentiate between binding of purine-scaffold compounds to human and Brugia Hsp90. The assay is suitable for high-throughput screening and provides the first example of a format with the potential to identify novel inhibitors of Hsp90 in filarial worms and in other parasitic species where Hsp90 may be a target.

  17. Extensive larva migrans

    Directory of Open Access Journals (Sweden)

    Mehta Vandana Rai

    2004-01-01

    Full Text Available Larva migrans is characterized by tortuous migratory lesions of the skin caused by larvae of nematodes. A 26-year-old fisherman presented to us with complaints of an itchy eruption on his back and arms of two months′ duration. Clinical examination revealed multiple wavy serpentine tracts and fork like lesions with a raised absolute eosinophil count of 3800 cells/cmm. Biopsy was inconclusive. This case is reported to highlight the extensive involvement by larva migrans.

  18. Extensive larva migrans

    Directory of Open Access Journals (Sweden)

    Mehta Vandana Rai

    2004-11-01

    Full Text Available Larva migrans is characterized by tortuous migratory lesions of the skin caused by larvae of nematodes. A 26-year-old fisherman presented to us with complaints of an itchy eruption on his back and arms of two months′ duration. Clinical examination revealed multiple wavy serpentine tracts and fork like lesions with a raised absolute eosinophil count of 3800 cells/cmm. Biopsy was inconclusive. This case is reported to highlight the extensive involvement by larva migrans.

  19. Larvae for layers

    DEFF Research Database (Denmark)

    Bjerrum, Lotte; Fischer, Christian Holst; Nordentoft, Steen

    2013-01-01

    Companies and researchers are in close collaboration developing a container- based system for cultivating fly larvae at organic poultry farms. In a one week process, manure will be converted to compost and the live larvae will be harvested and used for feeding laying hens. The larvae are expected...... to have a beneficial effect on the growth performance, intestinal health and on animal behavior in flocks....

  20. A PRELIMINARY STUDY OF MALAYAN FILARIASIS IN PUDING VILLAGE, JAMBI PROVINCE (SUMATERA, INDONESIA

    Directory of Open Access Journals (Sweden)

    Sudomo M.

    2012-09-01

    Full Text Available Beberapa daerah di Propinsi Jambi akan dikembangkan menjadi daerah transmigrasi, satu di antara­nya adalah daerah Kumpeh yang terletak berdekatan dengan daerah endemik filariasis malayi. Desa yang paling dekat dengan lokasi transmigrasi tersebut adalah desa Puding. Penelitian pendahuluan tentang penyakit filariasis telah dikerjakan di desa Puding untuk mengetahui tingkat endemisitas, periodisitas B. malayi, fauna nyamuk, jenis nyamuk yang potensial menjadi vektor filariasis, hospes reservoir dan keadaan sosial-ekonomi-budaya penduduk setempat. Mf rate pada penduduk desa Puding adalah 18,7% dan dari B. malayi jenis subperiodiknokturna. Nyamuk yang tertangkap terdiri dari enam genera yaitu genus Anopheles, Aedes, Culex, Coquilletidia, Mansonia dan Tripteroides. Dari enam genera tersebut yang potensial untuk menjadi vektor filariasis adalah genus Mansonia dan ini didukung dengan diketemukannyd larva stadium L3 (infektif Brugia sp di tubuh nyamuk tersebut. Keadaan sosial-ekonomi-budaya, khususnya menyangkut adat istiadat dan kebiasaan penduduk setempat, telah dipelajari.

  1. GAMBARAN PERKEMBANGAN ANTIBODI TERHADAP KOMPONEN PROTEIN CACING MIKROFILARIA MALAYI DARI TRANSMIGRAN DI SULAWESI TENGGARA

    Directory of Open Access Journals (Sweden)

    Basundari Sri Utami

    2012-09-01

    Full Text Available The immune response to microfilarial antigen in malayan filariasis was found more prominent in ami-crofilaremic individuals than in the micro filaremics. It has been shown that in amicrofilaremic individuals antibody plays a role in reducing micro filaremiae. The targets antigens of antibody (IgG were shown to be protein components of microfilariae with molecular weight of 75, 70 and 25 Kd. This prospective study was aimed at detecting IgG against microfilariae in transmigrats, who had settled into an filarial endemic area. Sera of 10 individuals at 8, 13, 26, 39 and 52 moths after settling, were examined by ELISA and Wes­tern Blott against microfilaria of B. malayi. Four out of 10 transmigrants showed IgG that recognized the protein components of 77, 70 and 31 Kd and were shown at 39, 52 and 8 months after settling respectively, The IgG against components of 77 and 70 Kd were revealed later than the one against 31 Kd.

  2. Mosquito infection responses to developing filarial worms.

    Directory of Open Access Journals (Sweden)

    Sara M Erickson

    Full Text Available Human lymphatic filariasis is a mosquito-vectored disease caused by the nematode parasites Wuchereria bancrofti, Brugia malayi and Brugia timori. These are relatively large roundworms that can cause considerable damage in compatible mosquito vectors. In order to assess how mosquitoes respond to infection in compatible mosquito-filarial worm associations, microarray analysis was used to evaluate transcriptome changes in Aedes aegypti at various times during B. malayi development. Changes in transcript abundance in response to the different stages of B. malayi infection were diverse. At the early stages of midgut and thoracic muscle cell penetration, a greater number of genes were repressed compared to those that were induced (20 vs. 8. The non-feeding, intracellular first-stage larvae elicited few differences, with 4 transcripts showing an increased and 9 a decreased abundance relative to controls. Several cecropin transcripts increased in abundance after parasites molted to second-stage larvae. However, the greatest number of transcripts changed in abundance after larvae molted to third-stage larvae and migrated to the head and proboscis (120 induced, 38 repressed, including a large number of putative, immunity-related genes (approximately 13% of genes with predicted functions. To test whether the innate immune system of mosquitoes was capable of modulating permissiveness to the parasite, we activated the Toll and Imd pathway controlled rel family transcription factors Rel1 and Rel2 (by RNA interference knockdown of the pathway's negative regulators Cactus and Caspar during the early stages of infection with B. malayi. The activation of either of these immune signaling pathways, or knockdown of the Toll pathway, did not affect B. malayi in Ae. aegypti. The possibility of LF parasites evading mosquito immune responses during successful development is discussed.

  3. Baylisascaris larva migrans

    Science.gov (United States)

    Kazacos, Kevin R.; Abbott, Rachel C.; Van Riper, Charles

    2016-05-26

    SummaryBaylisascaris procyonis, the common raccoon roundworm, is the most commonly recognized cause of clinical larva migrans (LM) in animals, a condition in which an immature parasitic worm or larva migrates in a host animal’s tissues, causing obvious disease. Infection with B. procyonis is best known as a cause of fatal or severe neurologic disease that results when the larvae invade the brain, the spinal cord, or both; this condition is known as neural larva migrans (NLM). Baylisascariasis is a zoonotic disease, that is, one that is transmissible from animals to humans. In humans, B. procyonis can cause damaging visceral (VLM), ocular (OLM), and neural larva migrans. Due to the ubiquity of infected raccoons around humans, there is considerable human exposure and risk of infection with this parasite. The remarkable disease-producing capability of B. procyonis in animals and humans is one of the most significant aspects of the biology of ascarids (large roundworms) to come to light in recent years. Infection with B. procyonis has important health implications for a wide variety of free-ranging and captive wildlife, zoo animals, domestic animals, as well as human beings, on both an individual and population level. This report, eighth in the series of U.S. Geological Survey Circulars on zoonotic diseases, will help us to better understand the routes of Baylisascaris procyonis infections and how best to adequately monitor this zoonotic disease.

  4. NCBI nr-aa BLAST: CBRC-TTRU-01-0887 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TTRU-01-0887 ref|XP_001902801.1| Transmembrane amino acid transporter protein ...[Brugia malayi] gb|EDP28347.1| Transmembrane amino acid transporter protein [Brugia malayi] XP_001902801.1 0.065 28% ...

  5. NCBI nr-aa BLAST: CBRC-TTRU-01-1053 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TTRU-01-1053 ref|XP_001901891.1| endoplasmic reticulum multispan transmembrane... protein [Brugia malayi] gb|EDP29450.1| endoplasmic reticulum multispan transmembrane protein, putative [Brugia malayi] XP_001901891.1 0.15 23% ...

  6. NCBI nr-aa BLAST: CBRC-CREM-01-1342 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CREM-01-1342 ref|YP_198592.1| Predicted permease [Wolbachia endosymbiont strai...n TRS of Brugia malayi] gb|AAW71350.1| Predicted permease [Wolbachia endosymbiont strain TRS of Brugia malayi] YP_198592.1 2e-05 25% ...

  7. NCBI nr-aa BLAST: CBRC-FCAT-01-1234 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-FCAT-01-1234 ref|YP_198404.1| 50S ribosomal protein L13 [Wolbachia endosymbion...t strain TRS of Brugia malayi] gb|AAW71162.1| Ribosomal protein L13 [Wolbachia endosymbiont strain TRS of Brugia malayi] YP_198404.1 3.4 26% ...

  8. Macrofilaricidal and microfilaricidal effects of Neurolaena lobata, a Guatemalan medicinal plant, on Brugia pahangi.

    Science.gov (United States)

    Fujimaki, Y; Kamachi, T; Yanagi, T; Cáceres, A; Maki, J; Aoki, Y

    2005-03-01

    Twelve extracts of 11 Guatemalan medicinal plants were initially screened in vitro for potential macrofilaricidal activity against Brugia pahangi, a lymphatic dwelling filarial worm, using concentrations from 125 to 1000 microg ml(-1) of each extract that could be dissolved in the culture medium. Of 12 extracts used, the ethanol extract of leaves of Neurolaena lobata showed the strongest activity against the motility of adult worms. Subsequently, the extract of N. lobata was extensively examined in vitro for macro- and micro-filaricidal effects using a series of concentrations of 500, 250, 100, 50 and 10 microg ml(-1). The effects were assessed by worm motility, microfilarial release by female worms and a MTT assay. The effect on the motility of adult worms was observed in a concentration- and time-dependent manner. The time required to stop motility of both sexes of adult worms was 6 h at 500 microg ml(-1), 24 h at 250 microg ml(-1), and 3 days for females and 4 days for males at 100 microg ml(-1). The movement of females ceased at 4 days at a concentration of 50 microg ml(-1) whereas the motility of males was only reduced. The loss of worm's viability was confirmed by the MTT assay and was similar to the motility results. These concentrations, including 10 microg ml(-1), prevented microfilarial release by females in a concentration- and time-dependent manner. Concentrations higher than 100 microg ml(-1) even induced mortality of the microfilariae. The present study suggested that the ethanol extract of Neurolaena lobata has potential macro- and micro-filaricidal activities. PMID:15831109

  9. Disseminated Cutaneous Larva Migrans

    Directory of Open Access Journals (Sweden)

    Karthikeyan Kaliaperumal

    2002-01-01

    Full Text Available A 30 year old male agricultural labourer presented with generalized itchy lesions over the back and extremities of 5 days duration. Cutaneous examination revealed multiple erythematous linear to serpentine lesions (numbering about 40 about 1-2 mm in width and ranging in length from 7 to 9 cm. The patient had eosinophilia and classical skin lesions, which responded very well to albendazole therapy. All these features supported the clinical diagnosis of dissenmintal cutaneous larva migrans.

  10. Mosquitoes feeding on insect larvae.

    Science.gov (United States)

    Harris, P; Riordan, D F; Cooke, D

    1969-04-11

    Caged Aedes aegypti and Culex tarsalis are attracted to insect larvae, engorge on their body fluids, and produce viable eggs. Attractiveness of the larvae is related to their size, shape, and color but not to their movement. The possibility that wild mosquitoes substitute insect hemolymph for vertebrate blood is discussed. PMID:5774191

  11. STATUS OF BRUGIAN FILARIASIS RESEARCH IN INDONESIA AND FUTURE STUDIES

    Directory of Open Access Journals (Sweden)

    Lim Boo Liat

    2012-09-01

    Full Text Available Penyebab penyakit filariasis di Indonesia adalah Brugia malayi dan B. timori. Penyebaran kedua jenis parasit tersebut, serta berbagai masalah perbedaan geografis dari B. malayi, baik pengobatannya dengan chemotherapy maupun immunodiagnosisnya telah diketahui. B. pahangi yang bersumber pada binatang juga telah dilaporkan. Nyamuk-nyamuk sebagai vector untuk B. malayi dan B. timori telah pula disebut. Binatang-binatang liar juga telah dilaporkan sebagai sumber penularan yang sangat potensial melalui subperiodic B. malayi.

  12. Midgut barrier imparts selective resistance to filarial worm infection in Culex pipiens pipiens.

    Directory of Open Access Journals (Sweden)

    Michelle L Michalski

    Full Text Available Mosquitoes in the Culex pipiens complex thrive in temperate and tropical regions worldwide, and serve as efficient vectors of Bancroftian lymphatic filariasis (LF caused by Wuchereria bancrofti in Asia, Africa, the West Indies, South America, and Micronesia. However, members of this mosquito complex do not act as natural vectors for Brugian LF caused by Brugia malayi, or for the cat parasite B. pahangi, despite their presence in South Asia where these parasites are endemic. Previous work with the Iowa strain of Culex pipiens pipiens demonstrates that it is equally susceptible to W. bancrofti as is the natural Cx. p. pipiens vector in the Nile Delta, however it is refractory to infection with Brugia spp. Here we report that the infectivity barrier for Brugia spp. in Cx. p. pipiens is the mosquito midgut, which inflicts internal and lethal damage to ingested microfilariae. Following per os Brugia exposures, the prevalence of infection is significantly lower in Cx. p. pipiens compared to susceptible mosquito controls, and differs between parasite species with <50% and <5% of Cx. p. pipiens becoming infected with B. pahangi and B. malayi, respectively. When Brugia spp. mf were inoculated intrathoracically to bypass the midgut, larvae developed equally well as in controls, indicating that, beyond the midgut, Cx. p. pipiens is physiologically compatible with Brugia spp. Mf isolated from Cx. p. pipiens midguts exhibited compromised motility, and unlike mf derived from blood or isolated from the midguts of Ae. aegypti, failed to develop when inoculated intrathoracically into susceptible mosquitoes. Together these data strongly support the role of the midgut as the primary infection barrier for Brugia spp. in Cx. p. pipiens. Examination of parasites recovered from the Cx. p. pipiens midgut by vital staining, and those exsheathed with papain, suggest that the damage inflicted by the midgut is subcuticular and disrupts internal tissues. Microscopic studies

  13. Nitric Oxide Limits the Expansion of Antigen-Specific T Cells in Mice Infected with the Microfilariae of Brugia pahangi

    Science.gov (United States)

    O'Connor, Richard A.; Devaney, Eileen

    2002-01-01

    Infection of BALB/c mice with the microfilariae (Mf) of the filarial nematode Brugia pahangi results in an antigen-specific proliferative defect that is induced by high levels of NO. Using carboxyfluorescein diacetate succinimydl ester and cell surface labeling, it was possible to identify a population of antigen-specific T cells from Mf-infected BALB/c mice that expressed particularly high levels of CD4 (CD4hi). These cells proliferated in culture only when inducible NO synthase was inhibited and accounted for almost all of the antigen-specific proliferative response under those conditions. CD4hi cells also expressed high levels of CD44, consistent with their status as activated T cells. A similar population of CD4hi cells was observed in cultures from Mf-infected gamma interferon receptor knockout (IFN-γR−/−) mice. Terminal deoxynucleotidyltransferase-mediated dUTP-biotin nick end labeling staining revealed that the CD4+ T cells from Mf-infected wild-type mice were preferentially susceptible to apoptosis compared to CD4+ T cells from IFN-γR−/− mice. These studies suggest that the expansion of antigen-specific T cells in Mf-infected mice is limited by NO. PMID:12379675

  14. The uptake in vitro of dyes, monosaccharides and amino acids by the filarial worm Brugia pahangi

    International Nuclear Information System (INIS)

    The uptake of D-glucose and L-leucine by B. pahangi was demonstrated using autoradiographic and scintillation counting techniques and incorporation into worm tissues was detected. Glucose was found to be readily incorporated in the apical, glycogen-rich areas of the myocytes of worms of all ages studied and in the uterine epithelium of the adult female. In contrast, a lower incorporation of D-glucose was found in the eggs, embryos and vas deferens and especially in the gut. The incorporation of L-leucine occurred throughout the tissue of the worms during a 30 min incubation. Labelling was also located over the surface of the cuticle of the worms, when incubated for a period of 15 to 60 min in L-[3H]leucine. Scintillation counting techniques demonstrated that there was no uptake of 14C-labelled L-glucose or sucrose by B. pahangi. The data presented on the uptake in vitro of nutrients or other compounds by infective larvae and adult stages of B. pahangi did not demonstrate an intestinal route of uptake but indicated that the transcuticular route of uptake may be employed. (author)

  15. Diversity in parasitic nematode genomes: the microRNAs of Brugia pahangi and Haemonchus contortus are largely novel

    Directory of Open Access Journals (Sweden)

    Winter Alan D

    2012-01-01

    Full Text Available Abstract Background MicroRNAs (miRNAs play key roles in regulating post-transcriptional gene expression and are essential for development in the free-living nematode Caenorhabditis elegans and in higher organisms. Whether microRNAs are involved in regulating developmental programs of parasitic nematodes is currently unknown. Here we describe the the miRNA repertoire of two important parasitic nematodes as an essential first step in addressing this question. Results The small RNAs from larval and adult stages of two parasitic species, Brugia pahangi and Haemonchus contortus, were identified using deep-sequencing and bioinformatic approaches. Comparative analysis to known miRNA sequences reveals that the majority of these miRNAs are novel. Some novel miRNAs are abundantly expressed and display developmental regulation, suggesting important functional roles. Despite the lack of conservation in the miRNA repertoire, genomic positioning of certain miRNAs within or close to specific coding genes is remarkably conserved across diverse species, indicating selection for these associations. Endogenous small-interfering RNAs and Piwi-interacting (piRNAs, which regulate gene and transposon expression, were also identified. piRNAs are expressed in adult stage H. contortus, supporting a conserved role in germline maintenance in some parasitic nematodes. Conclusions This in-depth comparative analysis of nematode miRNAs reveals the high level of divergence across species and identifies novel sequences potentially involved in development. Expression of novel miRNAs may reflect adaptations to different environments and lifestyles. Our findings provide a detailed foundation for further study of the evolution and function of miRNAs within nematodes and for identifying potential targets for intervention.

  16. Bacterial endosymbionts of plant-parasitic nematodes

    Science.gov (United States)

    Several groups of bacteria have been reported as endosymbionts of various orders of nematodes including the filarial nematodes (Brugia malayi, Wucheria bancrofti and Onchocerca volvulus (Spiruida)), the entomopathogenic nematodes (Steinernema spp., and Heterorhabditis spp. (Rhabditida)), and plant-p...

  17. Workbook on the Identification of Mosquito Larvae.

    Science.gov (United States)

    Pratt, Harry D.; And Others

    This self-instructional booklet is designed to enable public health workers identify larvae of some important North American mosquito species. The morphological features of larvae of the various genera and species are illustrated in a programed booklet, which also contains illustrated taxonomic keys to the larvae of 11 North American genera and to…

  18. Isolamento de esporos de Paenibacillus larvae subsp. larvae no Brasil Detectionof Paenibacillus larvae subsp. larvae spores in Brazil

    Directory of Open Access Journals (Sweden)

    Dulce Maria Tocchetto Schuch

    2003-03-01

    Full Text Available Este trabalho objetivou detectar presença de esporos de Paenibacillus larvae subsp. larvae em produtos de um entreposto do interior do Estado do Rio Grande do Sul, a identificação de possíveis fontes de contaminação e a avaliação da possibilidade da transferência de esporos para colméias de apiários adjacentes a partir de produtos importados contaminados. Foram analisados mel e pólen importados disponíveis no entreposto, favo do ninho (crias, pólen e mel colhido de uma colméia sadia, mel estocado em um dos apiários e abelhas adultas. Os resultados foram positivosem relação ao mel e pólen importados, a três grupos de abelhas adultas e ao mel do favo.The objective of this work was to detect the presence of Paenibacillus larvae subsp. larvae spores in products from a warehouse located in Rio Grande do Sul State, Brazil, the identification of possible contamination sources, and the assessment of spores transference possibility from contaminated imported products from the warehouse to apiaries located in the surrounding area. Samples of imported pollen and bulk honey stocked in the warehouse, and honeycomb (brood, honey and pollen from a healthy hive, honey from one apiary and adult bees were analyzed. Imported honey and pollen, and three groups of adult bees and the honey collected from the honeycomb resulted positive.

  19. Taste processing in Drosophila larvae

    Directory of Open Access Journals (Sweden)

    Anthi A. Apostolopoulou

    2015-10-01

    Full Text Available The sense of taste allows animals to detect chemical substances in their environment to initiate appropriate behaviors: to find food or a mate, to avoid hostile environments and predators. Drosophila larvae are a promising model organism to study gustation. Their simple nervous system triggers stereotypic behavioral responses, and the coding of taste can be studied by genetic tools at the single cell level. This review briefly summarizes recent progress on how taste information is sensed and processed by larval cephalic and pharyngeal sense organs. The focus lies on several studies, which revealed cellular and molecular mechanisms required to process sugar, salt, and bitter substances.

  20. Biology of Paenibacillus larvae, a deadly pathogen of honey bee larvae.

    Science.gov (United States)

    Ebeling, Julia; Knispel, Henriette; Hertlein, Gillian; Fünfhaus, Anne; Genersch, Elke

    2016-09-01

    The gram-positive bacterium Paenibacillus larvae is the etiological agent of American Foulbrood of honey bees, a notifiable disease in many countries. Hence, P. larvae can be considered as an entomopathogen of considerable relevance in veterinary medicine. P. larvae is a highly specialized pathogen with only one established host, the honey bee larva. No other natural environment supporting germination and proliferation of P. larvae is known. Over the last decade, tremendous progress in the understanding of P. larvae and its interactions with honey bee larvae at a molecular level has been made. In this review, we will present the recent highlights and developments in P. larvae research and discuss the impact of some of the findings in a broader context to demonstrate what we can learn from studying "exotic" pathogens. PMID:27394713

  1. Repurposing auranofin as a lead candidate for treatment of lymphatic filariasis and onchocerciasis.

    Directory of Open Access Journals (Sweden)

    Christina A Bulman

    2015-02-01

    Full Text Available Two major human diseases caused by filariid nematodes are onchocerciasis, or river blindness, and lymphatic filariasis, which can lead to elephantiasis. The drugs ivermectin, diethylcarbamazine (DEC, and albendazole are used in control programs for these diseases, but are mainly effective against the microfilarial stage and have minimal or no effect on adult worms. Adult Onchocerca volvulus and Brugia malayi worms (macrofilariae can live for up to 15 years, reproducing and allowing the infection to persist in a population. Therefore, to support control or elimination of these two diseases, effective macrofilaricidal drugs are necessary, in addition to current drugs. In an effort to identify macrofilaricidal drugs, we screened an FDA-approved library with adult worms of Brugia spp. and Onchocerca ochengi, third-stage larvae (L3s of Onchocerca volvulus, and the microfilariae of both O. ochengi and Loa loa. We found that auranofin, a gold-containing drug used for rheumatoid arthritis, was effective in vitro in killing both Brugia spp. and O. ochengi adult worms and in inhibiting the molting of L3s of O. volvulus with IC50 values in the low micromolar to nanomolar range. Auranofin had an approximately 43-fold higher IC50 against the microfilariae of L. loa compared with the IC50 for adult female O. ochengi, which may be beneficial if used in areas where Onchocerca and Brugia are co-endemic with L. loa, to prevent severe adverse reactions to the drug-induced death of L. loa microfilariae. Further testing indicated that auranofin is also effective in reducing Brugia adult worm burden in infected gerbils and that auranofin may be targeting the thioredoxin reductase in this nematode.

  2. Repurposing auranofin as a lead candidate for treatment of lymphatic filariasis and onchocerciasis.

    Science.gov (United States)

    Bulman, Christina A; Bidlow, Chelsea M; Lustigman, Sara; Cho-Ngwa, Fidelis; Williams, David; Rascón, Alberto A; Tricoche, Nancy; Samje, Moses; Bell, Aaron; Suzuki, Brian; Lim, K C; Supakorndej, Nonglak; Supakorndej, Prasit; Wolfe, Alan R; Knudsen, Giselle M; Chen, Steven; Wilson, Chris; Ang, Kean-Hooi; Arkin, Michelle; Gut, Jiri; Franklin, Chris; Marcellino, Chris; McKerrow, James H; Debnath, Anjan; Sakanari, Judy A

    2015-02-01

    Two major human diseases caused by filariid nematodes are onchocerciasis, or river blindness, and lymphatic filariasis, which can lead to elephantiasis. The drugs ivermectin, diethylcarbamazine (DEC), and albendazole are used in control programs for these diseases, but are mainly effective against the microfilarial stage and have minimal or no effect on adult worms. Adult Onchocerca volvulus and Brugia malayi worms (macrofilariae) can live for up to 15 years, reproducing and allowing the infection to persist in a population. Therefore, to support control or elimination of these two diseases, effective macrofilaricidal drugs are necessary, in addition to current drugs. In an effort to identify macrofilaricidal drugs, we screened an FDA-approved library with adult worms of Brugia spp. and Onchocerca ochengi, third-stage larvae (L3s) of Onchocerca volvulus, and the microfilariae of both O. ochengi and Loa loa. We found that auranofin, a gold-containing drug used for rheumatoid arthritis, was effective in vitro in killing both Brugia spp. and O. ochengi adult worms and in inhibiting the molting of L3s of O. volvulus with IC50 values in the low micromolar to nanomolar range. Auranofin had an approximately 43-fold higher IC50 against the microfilariae of L. loa compared with the IC50 for adult female O. ochengi, which may be beneficial if used in areas where Onchocerca and Brugia are co-endemic with L. loa, to prevent severe adverse reactions to the drug-induced death of L. loa microfilariae. Further testing indicated that auranofin is also effective in reducing Brugia adult worm burden in infected gerbils and that auranofin may be targeting the thioredoxin reductase in this nematode. PMID:25700363

  3. Metalloprotease production by Paenibacillus larvae during the infection of honeybee larvae.

    Science.gov (United States)

    Antúnez, Karina; Arredondo, Daniela; Anido, Matilde; Zunino, Pablo

    2011-05-01

    American foulbrood is a bacterial disease of worldwide distribution that affects larvae of the honeybee Apis mellifera. The causative agent is the Gram-positive, spore-forming bacterium Paenibacillus larvae. Several authors have proposed that P. larvae secretes metalloproteases that are involved in the larval degradation that occurs after infection. The aim of the present work was to evaluate the production of a metalloprotease by P. larvae during larval infection. First, the complete gene encoding a metalloprotease was identified in the P. larvae genome and its distribution was evaluated by PCR in a collection of P. larvae isolates from different geographical regions. Then, the complete gene was amplified, cloned and overexpressed, and the recombinant metalloprotease was purified and used to generate anti-metalloprotease antibodies. Metalloprotease production was evaluated by immunofluorescence and fluorescence in situ hybridization. The gene encoding a P. larvae metalloprotease was widely distributed in isolates from different geographical origins in Uruguay and Argentina. Metalloprotease was detected inside P. larvae vegetative cells, on the surface of P. larvae spores and secreted to the external growth medium. Its production was also confirmed in vivo, during the infection of honeybee larvae. This protein was able to hydrolyse milk proteins as described for P. larvae, suggesting that could be involved in larval degradation. This work contributes to the knowledge of the pathogenicity mechanisms of a bacterium of great economic significance and is one step in the characterization of potential P. larvae virulence factors. PMID:21330433

  4. Molecular Characterization of Ancylostoma braziliense Larvae in a Patient with Hookworm-Related Cutaneous Larva Migrans

    OpenAIRE

    Joncour, Alexandre Le; Lacour, Sandrine A.; Lecso, Gabriel; Regnier, Stéphanie; Guillot, Jacques; Caumes, Eric

    2012-01-01

    We report a case of hookworm-related cutaneous larva migrans diagnosed microscopically. Viable hookworm larvae were found by microscopic examination of a skin scraping from follicular lesions. Amplification and sequencing of the internal transcribed spacer 2 allowed the specific identification of the larvae as Ancylostoma braziliense.

  5. Coral larvae move toward reef sounds

    OpenAIRE

    Vermeij, Mark J.A.; Marhaver, Kristen L; Huijbers, Chantal M.; Ivan Nagelkerken; Simpson, Stephen D.

    2010-01-01

    Free-swimming larvae of tropical corals go through a critical life-phase when they return from the open ocean to select a suitable settlement substrate. During the planktonic phase of their life cycle, the behaviours of small coral larvae (

  6. Coral larvae move toward reef sounds.

    Science.gov (United States)

    Vermeij, Mark J A; Marhaver, Kristen L; Huijbers, Chantal M; Nagelkerken, Ivan; Simpson, Stephen D

    2010-01-01

    Free-swimming larvae of tropical corals go through a critical life-phase when they return from the open ocean to select a suitable settlement substrate. During the planktonic phase of their life cycle, the behaviours of small coral larvae (noise as a cue for orientation, the alleviation of noise pollution in the marine environment may gain further urgency. PMID:20498831

  7. Coral larvae move toward reef sounds

    NARCIS (Netherlands)

    Vermeij, M.J.A.; Marhaver, K.L.; Huijbers, C.M.; Nagelkerken, I.; Simpson, S.D.

    2010-01-01

    Free-swimming larvae of tropical corals go through a critical life-phase when they return from the open ocean to select a suitable settlement substrate. During the planktonic phase of their life cycle, the behaviours of small coral larvae (<1 mm) that influence settlement success are difficult to ob

  8. Workbook on Identification of Aedes Aegypti Larvae.

    Science.gov (United States)

    Pratt, Harry D.; And Others

    This self-instructional booklet is designed to enable yellow fever control workers to identify the larvae of "Aedes aegypti." The morphological features of mosquito larvae are illustrated in this partially programed text, and the distinguishing features of "A. aegypti" indicated. A glossary is included. (AL)

  9. Behavior of Settling Marine Larvae in Flow

    Science.gov (United States)

    Hernandez, J.; Koehl, M. A.

    2012-12-01

    Many bottom-dwelling marine animals produce microscopic larvae that are dispersed by ambient water currents. These larvae can only recruit to habitats on which they have landed if they can resist being washed away by ambient water flow. We found that larvae on marine surfaces do not experience steady water flow, but rather are exposed to brief pulses of water movement as turbulent eddies sweep across them. We made video recordings of larvae of the tube worm, Hydroides elegans, (important members of the community of organisms growing on docks and ships) on surfaces subjected to measured realistic flow pulses to study factors that might affect their dislodgement from surfaces in nature. We found that the response of a larva of H. elegans to a realistic pulse of water flow depended on its behavior at the time of the pulse and on its recent history of exposure to flow pulses, and that stationary larvae were less likely than locomoting larvae to be blown away when hit by the first pulse of water flow.; ;

  10. Single stimulus learning in zebrafish larvae

    OpenAIRE

    O’Neale, Ashley; Ellis, Joseph; Creton, Robbert; Colwill, Ruth M.

    2013-01-01

    Learning about a moving visual stimulus was examined in zebrafish larvae using an automated imaging system and a t1-t2 design. In three experiments, zebrafish larvae were exposed to one of two inputs at t1 (either a gray bouncing disk or an identical but stationary disk) followed by a common test at t2 (the gray bouncing disk). Using 7 days post-fertilization (dpf) larvae and 12 stimulus exposures, Experiment 1 established that these different treatments produced differential responding to th...

  11. Cutaneous Larva Migrans in Early Infancy.

    Science.gov (United States)

    Siddalingappa, Karjigi; Murthy, Sambasiviah Chidambara; Herakal, Kallappa; Kusuma, Marganahalli Ramachandra

    2015-01-01

    Cutaneous larva migrans or creeping eruptions is a cutaneous dermatosis caused by hookworm larvae, Ancylostoma braziliense. A 2-month-old female child presented with a progressive rash over the left buttock of 4 days duration. Cutaneous examination showed an urticarial papule progressing to erythematous, tortuous, thread-like tract extending a few centimeters from papule over the left gluteal region. A clinical diagnosis of cutaneous larva migrans was considered. Treatment with albendazole led to complete resolution, confirming the diagnosis. This is to the best of our knowledge, the youngest age at which this condition is being reported. PMID:26538729

  12. Habitat selection by emperor fish larvae

    OpenAIRE

    Nakamura, Y; Shibuno, T.; Lecchini, David; Watanabe, Y.

    2009-01-01

    One of the great puzzles of coral reef fish ecology is how pelagic larvae locate the habitat in which they settle. The present study explored whether offshore emperor fish (Lethrinidae) larvae selected a specific reef and/or habitat at settlement. Although older juveniles are known to use back-reef seagrass beds as a potential nursery habitat, information is scarce regarding pre-settlement larvae. Using light traps anchored on the reef slopes at seagrass-replete and seagrass-free reefs (lshig...

  13. Lethal infection thresholds of Paenibacillus larvae for honeybee drone and worker larvae (Apis mellifera).

    Science.gov (United States)

    Behrens, Dieter; Forsgren, Eva; Fries, Ingemar; Moritz, Robin F A

    2010-10-01

    We compared the mortality of honeybee (Apis mellifera) drone and worker larvae from a single queen under controlled in vitro conditions following infection with Paenibacillus larvae, a bacterium causing the brood disease American Foulbrood (AFB). We also determined absolute P. larvae cell numbers and lethal titres in deceased individuals of both sexes up to 8 days post infection using quantitative real-time PCR (qPCR). Our results show that in drones the onset of infection induced mortality is delayed by 1 day, the cumulative mortality is reduced by 10% and P. larvae cell numbers are higher than in worker larvae. Since differences in bacterial cell titres between sexes can be explained by differences in body size, larval size appears to be a key parameter for a lethal threshold in AFB tolerance. Both means and variances for lethal thresholds are similar for drone and worker larvae suggesting that drone resistance phenotypes resemble those of related workers. PMID:20545737

  14. TIME management by medicinal larvae.

    Science.gov (United States)

    Pritchard, David I; Čeřovský, Václav; Nigam, Yamni; Pickles, Samantha F; Cazander, Gwendolyn; Nibbering, Peter H; Bültemann, Anke; Jung, Wilhelm

    2016-08-01

    Wound bed preparation (WBP) is an integral part of the care programme for chronic wounds. The acronym TIME is used in the context of WBP and describes four barriers to healing in chronic wounds; namely, dead Tissue, Infection and inflammation, Moisture imbalance and a non-migrating Edge. Larval debridement therapy (LDT) stems from observations that larvae of the blowfly Lucilia sericata clean wounds of debris. Subsequent clinical studies have proven debriding efficacy, which is likely to occur as a result of enzymatically active alimentary products released by the insect. The antimicrobial, anti-inflammatory and wound healing activities of LDT have also been investigated, predominantly in a pre-clinical context. This review summarises the findings of investigations into the molecular mechanisms of LDT and places these in context with the clinical concept of WBP and TIME. It is clear from these findings that biotherapy with L. sericata conforms with TIME, through the enzymatic removal of dead tissue and its associated biofilm, coupled with the secretion of defined antimicrobial peptides. This biotherapeutic impact on the wound serves to reduce inflammation, with an associated capacity for an indirect effect on moisture imbalance. Furthermore, larval serine proteinases have the capacity to alter fibroblast behaviour in a manner conducive to the formation of granulation tissue. PMID:26179750

  15. Coral larvae move toward reef sounds.

    Directory of Open Access Journals (Sweden)

    Mark J A Vermeij

    Full Text Available Free-swimming larvae of tropical corals go through a critical life-phase when they return from the open ocean to select a suitable settlement substrate. During the planktonic phase of their life cycle, the behaviours of small coral larvae (<1 mm that influence settlement success are difficult to observe in situ and are therefore largely unknown. Here, we show that coral larvae respond to acoustic cues that may facilitate detection of habitat from large distances and from upcurrent of preferred settlement locations. Using in situ choice chambers, we found that settling coral larvae were attracted to reef sounds, produced mainly by fish and crustaceans, which we broadcast underwater using loudspeakers. Our discovery that coral larvae can detect and respond to sound is the first description of an auditory response in the invertebrate phylum Cnidaria, which includes jellyfish, anemones, and hydroids as well as corals. If, like settlement-stage reef fish and crustaceans, coral larvae use reef noise as a cue for orientation, the alleviation of noise pollution in the marine environment may gain further urgency.

  16. Late presentation of cutaneous larva migrans: a case report

    OpenAIRE

    Archer, Michael

    2009-01-01

    Introduction Cutaneous larva migrans is caused by infection with hookworm larvae in tropical and sub-tropical areas. A history of recent travel to the tropics is usually elicited. Case presentation A case of cutaneous larva migrans is described in which symptoms did not appear until five months after travel to Tanzania. Conclusion Although the lesion of cutaneous larva migrans may appear immediately, the larvae may lie dormant for many months and presentation may therefore occur a long time a...

  17. Attraction to and learning from social cues in fruitfly larvae

    OpenAIRE

    Durisko, Zachary; Dukas, Reuven

    2013-01-01

    We examined the use of social information in fruitfly larvae, which represent an ideal model system owing to their robust learning abilities, small number of neurons and well-studied neurogenetics. Focal larvae showed attraction to the distinct odour emanating from food occupied by other larvae. In controlled learning experiments, focal larvae preferred novel odours previously paired with food occupied by other larvae over novel odours previously paired with unoccupied food. When we gave grou...

  18. CalCOFI Larvae Counts, Scientific Names SD to SI

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring...

  19. CalCOFI Larvae Counts, Scientific Names SB to SC

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring...

  20. CalCOFI Larvae Counts, Scientific Names C to CE

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring...

  1. CalCOFI Larvae Counts, Scientific Names CI to CO

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring...

  2. Evolution of foraging behavior in Drosophilid larvae

    Science.gov (United States)

    Rivera-Alba, Marta; Kabra, Mayank; Branson, Kristin; Mirth, Christen

    2015-03-01

    Drosophilids, like other insects, go through a larval phase before metamorphosing into adults. Larvae increase their body weight by several orders of magnitude in a few days. We therefore hypothesized that foraging behavior is under strong evolutionary pressure to best fit the larval environment. To test our hypothesis we used a multidisciplinary approach to analyze foraging behavior across species and larval stages. First, we recorded several videos of larvae foraging for each of 47 Drosophilid species. Then, using a supervised machine learning approach, we automatically annotated the video collection for the foraging sub-behaviors, including crawling, turning, head casting or burrowing. We also computed over 100 features to describe the posture and dynamics of each animal in each video frame. From these data, we fit models to the behavior of each species. The models each had the same parametric form, but differed in the exact parameters. By simulating larva behavior in virtual arenas we can infer which properties of the environments are better for each species. Comparisons between these inferred environments and the actual environments where these animals live will give us a deeper understanding about the evolution of foraging behavior in Drosophilid larvae.

  3. Suppressing bullfrog larvae with carbon dioxide

    Science.gov (United States)

    Gross, Jackson A.; Ray, Andrew; Sepulveda, Adam J.; Watten, Barnaby J.; Densmore, Christine L.; Layhee, Megan J.; Mark Abbey-Lambert,; ,

    2014-01-01

    Current management strategies for the control and suppression of the American Bullfrog (Lithobates catesbeianus = Rana catesbeiana Shaw) and other invasive amphibians have had minimal effect on their abundance and distribution. This study evaluates the effects of carbon dioxide (CO2) on pre- and prometamorphic Bullfrog larvae. Bullfrogs are a model organism for evaluating potential suppression agents because they are a successful invader worldwide. From experimental trials we estimated that the 24-h 50% and 99% lethal concentration (LC50 and LC99) values for Bullfrog larvae were 371 and 549 mg CO2/L, respectively. Overall, larvae that succumbed to experimental conditions had a lower body condition index than those that survived. We also documented sublethal changes in blood chemistry during prolonged exposure to elevated CO2. Specifically, blood pH decreased by more than 0.5 pH units after 9 h of exposure and both blood partial pressure of CO2 (pCO2) and blood glucose increased. These findings suggest that CO2 treatments can be lethal to Bullfrog larvae under controlled laboratory conditions. We believe this work represents the necessary foundation for further consideration of CO2 as a potential suppression agent for one of the most harmful invaders to freshwater ecosystems.

  4. ISOLASI BACILLUS THURINGIENSIS DARI LARVA DAN PENGUJIAN PATOGENISITASNYA TERHADAP LARVA NYAMUK VEKTOR

    Directory of Open Access Journals (Sweden)

    Blondine Ch. P.

    2012-09-01

    Full Text Available A study to evaluate pathogenic organisms as cause of mosquito larvae death was conducted at Wonokerto and Pabelan villages, Salatiga Luar Kota subdistrict, Semarang regency in Central Java from May 1991 through December 1991. Bacterial isolation from dead larvae showed that 31 B. thuringicnsis isolates were obtained from 31 larvae samples collected from 2 location e.g Wonokerto village (3 samples, Pabelan village (28 samples. Nineteen isolates (61,3% showed a pathogenicity of more than 50% to third toward instar larvae of Aedes aegypti and Culex quinquefasciatus respectively 24 hours after exposure. This study shows the possible use of B. thuringiensis for biologic control of mosquitoes which can act as vectors for human diseases.

  5. Larva migrans visceral: relato de caso Visceral larva migrans: case report

    Directory of Open Access Journals (Sweden)

    Alexandre Bortoli Machado

    2003-04-01

    Full Text Available Larva migrans visceral é doença infecciosa, adquirida por ingestão de ovos provenientes dos vermes Toxocara canis e/ou Toxocara cati que infestam cães e gatos; as larvas penetram a parede intestinal e migram através dos tecidos levando a alterações diversas, conseqüentes a uma resposta inflamatória imune.¹ Os autores descrevem um caso clínico de larva migrans visceral com apresentação clínica atípica.Visceral larva migrans is an infectious human disease that occurs following ingestion of eggs from the environment originating from roundworms which commonly infect dogs and cats, Toxocara canis and Toxocara cati. The larvae penetrate the gut wall and migrate through the tissues causing disorders consequent to an inflammatory immune response¹. The authors describe a clinical case of visceral larva migrans with an unusual clinical presentation and also its clinical aspects, diagnosis and treatment are reviewed.

  6. Larva of Palaemnema brasiliensis Machado (Odonata: Platystictidae), from Amazonas, Brazil.

    Science.gov (United States)

    Neiss, Ulisses Gaspar; Hamada, Neusa

    2016-01-01

    The larva of Palaemnema brasiliensis Machado, 2009 is described and illustrated based on last-instar larvae and exuviae of reared larvae collected in a blackwater stream in Barcelos and Presidente Figueiredo municipalities, Amazonas state, Brazil. The larva of P. brasiliensis can be distinguished from the two South American species of the genus with described larvae (P. clementia Selys and P. mutans Calvert), mainly by presence of a single obtuse cusp on the labial palp, the presence and configuration of setae in the caudal lamellae, and the proportional length of terminal filaments of the caudal lamellae. The family is recorded here for the first time in Brazilian state of Amazonas. PMID:27395963

  7. Cutaneous Larva Migrans - a Typical Case Report

    OpenAIRE

    Santos, G.; João, A

    2013-01-01

    A larva migrans cutânea é frequente em regiões tropicais e sub-tropicais e é causada pela migração de larvas de nemátodos na pele. O diagnóstico é efectuado essencialmente pelas características epidemiológicas da dermatose e pela sua semiologia clínica. Geralmente o tratamento é bem sucedido com albendazol ou ivermectina. Descreve-se o caso clínico de uma mulher de 54 anos que regressou de férias na Jamaica há cerca de 15 dias. A doente iniciou no local, uma pápula eritematosa, bem deli...

  8. The Biology of Decapod Crustacean Larvae

    OpenAIRE

    Anger, Klaus

    2001-01-01

    About 90% of the extant species of the Decapoda live in oceans and adjacent coastal and estuarine regions, and most of them pass through a complex life history comprising a benthic (juvenile-adult) and a planktonic (larval) phase. The larvae show a wide array of adaptations to the pelagic environment, including modifications in functio-nal morphology, anatomy, the molting cycle, nutrition, growth, chemical composi-tion, meta-bo-lism, energy partitioning, ecology, and behavior. Due to these ad...

  9. The early stress responses in fish larvae.

    Science.gov (United States)

    Pederzoli, Aurora; Mola, Lucrezia

    2016-05-01

    During the life cycle of fish the larval stages are the most interesting and variable. Teleost larvae undergo a daily increase in adaptability and many organs differentiate and become active. These processes are concerted and require an early neuro-immune-endocrine integration. In larvae communication among the nervous, endocrine and immune systems utilizes several known signal molecule families which could be different from those of the adult fish. The immune-neuroendocrine system was studied in several fish species, among which in particular the sea bass (Dicentrarchus labrax), that is a species of great commercial interest, very important in aquaculture and thus highly studied. Indeed the immune system of this species is the best known among marine teleosts. In this review the data on main signal molecules of stress carried out on larvae of fish are considered and discussed. For sea bass active roles in the early immunological responses of some well-known molecules involved in the stress, such as ACTH, nitric oxide, CRF, HSP-70 and cortisol have been proposed. These molecules and/or their receptors are biologically active mainly in the gut before complete differentiation of gut-associated lymphoid tissue (GALT), probably acting in an autocrine/paracrine way. An intriguing idea emerges from all results of these researches; the molecules involved in stress responses, expressed in the adult cells of the hypothalamic-pituitary axis, during the larval life of fish are present in several other localizations, where they perform probably the same role. It may be hypothesized that the functions performed by hypothalamic-pituitary system are particularly important for the survival of the larva and therefore they comprises several other localizations of body. Indeed the larval stages of fish are very crucial phases that include many physiological changes and several possible stress both internal and environmental. PMID:26968620

  10. Caffeine Taste Signaling in Drosophila Larvae.

    Science.gov (United States)

    Apostolopoulou, Anthi A; Köhn, Saskia; Stehle, Bernhard; Lutz, Michael; Wüst, Alexander; Mazija, Lorena; Rist, Anna; Galizia, C Giovanni; Lüdke, Alja; Thum, Andreas S

    2016-01-01

    The Drosophila larva has a simple peripheral nervous system with a comparably small number of sensory neurons located externally at the head or internally along the pharynx to assess its chemical environment. It is assumed that larval taste coding occurs mainly via external organs (the dorsal, terminal, and ventral organ). However, the contribution of the internal pharyngeal sensory organs has not been explored. Here we find that larvae require a single pharyngeal gustatory receptor neuron pair called D1, which is located in the dorsal pharyngeal sensilla, in order to avoid caffeine and to associate an odor with caffeine punishment. In contrast, caffeine-driven reduction in feeding in non-choice situations does not require D1. Hence, this work provides data on taste coding via different receptor neurons, depending on the behavioral context. Furthermore, we show that the larval pharyngeal system is involved in bitter tasting. Using ectopic expressions, we show that the caffeine receptor in neuron D1 requires the function of at least four receptor genes: the putative co-receptors Gr33a, Gr66a, the putative caffeine-specific receptor Gr93a, and yet unknown additional molecular component(s). This suggests that larval taste perception is more complex than previously assumed already at the sensory level. Taste information from different sensory organs located outside at the head or inside along the pharynx of the larva is assembled to trigger taste guided behaviors. PMID:27555807

  11. Feeding behavior of giant gourami, Osphronemus gouramy (Lacepede larvae

    Directory of Open Access Journals (Sweden)

    Thumronk Amornsakun

    2014-06-01

    Full Text Available Feeding experiments were carried out in 15-liter glass aquaria with 10 liters of water containing 1000 larvae aged 1.5 days post-hatching (before mouth opening in three replicates. It was found that the feeding scheme of larval giant gourami aged 5-17 days (TL 8.36-13.40 mm consumed Moina. The larvae aged 14-17 days (TL 12.40-13.40 mm consumed both Moina and artificial pellet. Larvae aged more than 18-days (TL 13.60 mm consumed only artificial pellet. Daily food uptake by the larvae and juvenile were determined in a 15-liter aquaria (water volume 10 liters containing 500 larvae. The larvae were fed with Moina at density of 10 ind/ml. Aquaria without larvae were also set for a control of natural fluctuation in food density. The amount of food intake was calculated based on changes of food density in the aquarium with and without fish larvae. It was found the average uptake of Moina in digestive tract per day of larvae aged 5, 8, 11, 14 and 17 days old were 38, 52, 182, 205 and 266 individual/larva, respectively at density of 1.27, 1.73, 6.07, 6.83, and 8.87 individual/ml, respectively.

  12. Interactions among Drosophila larvae before and during collision.

    Science.gov (United States)

    Otto, Nils; Risse, Benjamin; Berh, Dimitri; Bittern, Jonas; Jiang, Xiaoyi; Klämbt, Christian

    2016-01-01

    In populations of Drosophila larvae, both, an aggregation and a dispersal behavior can be observed. However, the mechanisms coordinating larval locomotion in respect to other animals, especially in close proximity and during/after physical contacts are currently only little understood. Here we test whether relevant information is perceived before or during larva-larva contacts, analyze its influence on behavior and ask whether larvae avoid or pursue collisions. Employing frustrated total internal reflection-based imaging (FIM) we first found that larvae visually detect other moving larvae in a narrow perceptive field and respond with characteristic escape reactions. To decipher larval locomotion not only before but also during the collision we utilized a two color FIM approach (FIM(2c)), which allowed to faithfully extract the posture and motion of colliding animals. We show that during collision, larval locomotion freezes and sensory information is sampled during a KISS phase (german: Kollisions Induziertes Stopp Syndrom or english: collision induced stop syndrome). Interestingly, larvae react differently to living, dead or artificial larvae, discriminate other Drosophila species and have an increased bending probability for a short period after the collision terminates. Thus, Drosophila larvae evolved means to specify behaviors in response to other larvae.

  13. The Identification of Congeners and Aliens by Drosophila Larvae.

    Directory of Open Access Journals (Sweden)

    Francisco Del Pino

    Full Text Available We investigated the role of Drosophila larva olfactory system in identification of congeners and aliens. We discuss the importance of these activities in larva navigation across substrates, and the implications for allocation of space and food among species of similar ecologies. Wild type larvae of cosmopolitan D. melanogaster and endemic D. pavani, which cohabit the same breeding sites, used species-specific volatiles to identify conspecifics and aliens moving toward larvae of their species. D. gaucha larvae, a sibling species of D. pavani that is ecologically isolated from D. melanogaster, did not respond to melanogaster odor cues. Similar to D. pavani larvae, the navigation of pavani female x gaucha male hybrids was influenced by conspecific and alien odors, whereas gaucha female x pavani male hybrid larvae exhibited behavior similar to the D. gaucha parent. The two sibling species exhibited substantial evolutionary divergence in processing the odor inputs necessary to identify conspecifics. Orco (Or83b mutant larvae of D. melanogaster, which exhibit a loss of sense of smell, did not distinguish conspecific from alien larvae, instead moving across the substrate. Syn97CS and rut larvae of D. melanogaster, which are unable to learn but can smell, moved across the substrate as well. The Orco (Or83b, Syn97CS and rut loci are necessary to orient navigation by D. melanogaster larvae. Individuals of the Trana strain of D. melanogaster did not respond to conspecific and alien larval volatiles and therefore navigated randomly across the substrate. By contrast, larvae of the Til-Til strain used larval volatiles to orient their movement. Natural populations of D. melanogaster may exhibit differences in identification of conspecific and alien larvae. Larval locomotion was not affected by the volatiles.

  14. The Identification of Congeners and Aliens by Drosophila Larvae

    Science.gov (United States)

    Del Pino, Francisco; Jara, Claudia; Pino, Luis; Medina-Muñoz, María Cristina; Alvarez, Eduardo; Godoy-Herrera, Raúl

    2015-01-01

    We investigated the role of Drosophila larva olfactory system in identification of congeners and aliens. We discuss the importance of these activities in larva navigation across substrates, and the implications for allocation of space and food among species of similar ecologies. Wild type larvae of cosmopolitan D. melanogaster and endemic D. pavani, which cohabit the same breeding sites, used species-specific volatiles to identify conspecifics and aliens moving toward larvae of their species. D. gaucha larvae, a sibling species of D. pavani that is ecologically isolated from D. melanogaster, did not respond to melanogaster odor cues. Similar to D. pavani larvae, the navigation of pavani female x gaucha male hybrids was influenced by conspecific and alien odors, whereas gaucha female x pavani male hybrid larvae exhibited behavior similar to the D. gaucha parent. The two sibling species exhibited substantial evolutionary divergence in processing the odor inputs necessary to identify conspecifics. Orco (Or83b) mutant larvae of D. melanogaster, which exhibit a loss of sense of smell, did not distinguish conspecific from alien larvae, instead moving across the substrate. Syn97CS and rut larvae of D. melanogaster, which are unable to learn but can smell, moved across the substrate as well. The Orco (Or83b), Syn97CS and rut loci are necessary to orient navigation by D. melanogaster larvae. Individuals of the Trana strain of D. melanogaster did not respond to conspecific and alien larval volatiles and therefore navigated randomly across the substrate. By contrast, larvae of the Til-Til strain used larval volatiles to orient their movement. Natural populations of D. melanogaster may exhibit differences in identification of conspecific and alien larvae. Larval locomotion was not affected by the volatiles. PMID:26313007

  15. Immune response studies with Wuchereria bancrofti vespid allergen homologue (WbVAH) in human lymphatic filariasis

    OpenAIRE

    Anand, Setty Balakrishnan; Gnanasekar, Munirathinam; Thangadurai, Mani; Prabhu, Prince R.; Kaliraj, Perumal; RAMASWAMY, KALYANASUNDARAM

    2007-01-01

    A homologue of Brugia malayi venom allergen (BmVAH) was cloned from the infective stages (L3) of Wuchereria bancrofti. Sequence analysis showed 90% sequence identity between WbVAH and BmVAH. Recombinant WbVAH was then expressed and purified. VAH from other nematode parasites is being evaluated as potential vaccine candidates. Because W. bancrofti infections are more prevalent than B. malayi, it will significantly benefit using W. bancrofti antigens for vaccine development. In this study, we h...

  16. Immunization with Wuchereria bancrofti Glutathione-S-transferase Elicits a Mixed Th1/Th2 Type of Protective Immune Response Against Filarial Infection in Mastomys.

    Science.gov (United States)

    Andure, Dhananjay; Pote, Kiran; Khatri, Vishal; Amdare, Nitin; Padalkar, Ramchandra; Reddy, Maryada Venkata Rami

    2016-10-01

    Lymphatic filariasis is a mosquito borne parasitic infection and can severely affect the normal working ability of an individual. Currently there is no vaccine available to prevent this infection and the development of a potential vaccine could effectively support the on-going mass drug administration program by World Health Organization (WHO). Filarial parasites have complex mechanisms to modulate the host immune responses against them. The glutathione-S-transferases (GST) are the important enzymes effectively involved to counteract the oxidative free radicals produced by the host. In the present study, we have shown that the mastomys which are fully permissible rodents for Brugia malayi when immunized with Wuchereria bancrofti recombinant GST (rWbGST) could induce 65.5 % in situ cytotoxicity against B. malayi infective (L3) larvae. There was a balanced Th1/Th2 immune response in the vaccinated animals, characterized by higher levels of WbGST-specific IgG1 and IgG2a antibodies and pronounced IFN-γ, IL-10 and IL-4 cytokines production by the spleen cells. PMID:27605739

  17. Microsporidium Infecting Anopheles supepictus (Diptera: Culicidae Larvae

    Directory of Open Access Journals (Sweden)

    Seyed-Mohammad Omrani

    2016-01-01

    Full Text Available Background: Microsporidia are known to infect a wide variety of animals including mosquitoes (Diptera: Cu­licidae. In a recent study on the mosquito fauna of Chahar Mahal and Bakhtiari Province, at the central western part of Iran, a few larvae of Anopheles superpictus were infected with a microsporidium-resembled microorganism. Cur­rent investigation deals with the identification of the responsible microorganism at the genus level.Methods: Fresh infected larvae were collected from the field. After determining the species identity they were dis­sected to extract their infective contents. Wet preparations were checked for general appearance and the size of the pathogenic microorganism. Fixed preparations were stained with Geimsa and Ryan-Blue modified Trichrome tech­niques to visualize further morphological characters. The obtained light microscopy data were used in the identifica­tion process.Results: The infected larvae were bulged by a whitish material filling the involved segments corresponding to a microsporidium infection. Bottle-shaped semioval spores ranged 4.33±0.19×2.67±0.12 and 4.18±0.43×2.45±0.33 micron in wet and fixed preparations, respectively. They were mostly arranged in globular structures comprised of 8 spores. These data was in favor of a species from the genus Parathelohania in the family Ambliosporidae.Conclusion: This is the first report of a microsporidium infection in An. superpictus. The causative agent is diag­nosed as a member of the genus Parathelohania. Further identification down to the species level needs to determine its ultrastructural characteristics and the comparative analysis of ss rRNA sequence data. It is also necessary to un­derstand the detail of the components of the transmission cycle.

  18. Modeling peripheral olfactory coding in Drosophila larvae.

    Directory of Open Access Journals (Sweden)

    Derek J Hoare

    Full Text Available The Drosophila larva possesses just 21 unique and identifiable pairs of olfactory sensory neurons (OSNs, enabling investigation of the contribution of individual OSN classes to the peripheral olfactory code. We combined electrophysiological and computational modeling to explore the nature of the peripheral olfactory code in situ. We recorded firing responses of 19/21 OSNs to a panel of 19 odors. This was achieved by creating larvae expressing just one functioning class of odorant receptor, and hence OSN. Odor response profiles of each OSN class were highly specific and unique. However many OSN-odor pairs yielded variable responses, some of which were statistically indistinguishable from background activity. We used these electrophysiological data, incorporating both responses and spontaneous firing activity, to develop a bayesian decoding model of olfactory processing. The model was able to accurately predict odor identity from raw OSN responses; prediction accuracy ranged from 12%-77% (mean for all odors 45.2% but was always significantly above chance (5.6%. However, there was no correlation between prediction accuracy for a given odor and the strength of responses of wild-type larvae to the same odor in a behavioral assay. We also used the model to predict the ability of the code to discriminate between pairs of odors. Some of these predictions were supported in a behavioral discrimination (masking assay but others were not. We conclude that our model of the peripheral code represents basic features of odor detection and discrimination, yielding insights into the information available to higher processing structures in the brain.

  19. Nutritional components affecting skeletal development in fish larvae

    OpenAIRE

    Cahu, Chantal; Zambonino, Jose-luis; Takeuchi, Toshio

    2003-01-01

    Marine fish larvae undergo major functional and morphological changes during the developmental stages and several factors can interfere with the normal development of larvae and affect fry quality. Skeletal malformations, such as spinal malformation-scoliosis, lordosis, coiled vertebral column-, missing or additional fin rays, bending opercle or jaw malformations, are frequently observed in hatchery-reared larvae. This paper reviews the effects of some nutritional components on skeletal devel...

  20. Toxicity of phenol on Macrobrachium rosenbergii (de Man) eggs, larvae, and post-larvae

    Energy Technology Data Exchange (ETDEWEB)

    Law, A.T.; Yeo, M.E. [Universiti Kolej Terengganu (UPM), Darul Iman (Malaysia)

    1997-03-01

    Literature on the toxicities of phenol on aquatic organisms is very limited. USEPA reported that the acute and chronic toxicities of phenol to freshwater aquatic life occur at concentrations as low as 10.2 mg/L and 2.56 mg/L, respectively. While for the saltwater aquatic life the acute toxicity occurs at concentrations as low as 5.8 mg/L. No data are available for the chronic toxicity of phenol to saltwater aquatic life. Sublethal concentrations of phenol have significant effects on the physiological and histological processes of the aquatic organisms: such as gill necrosis; destruction of erythrocyte cells; inhibition of sexual activities; suppression on growth and reduction of resistance to diseases. Macrobrachium rosenbergii(de Man) is the sole freshwater prawn cultured in Malaysia. Occasionally, the hatcheries are unable to produce the post-larvae because of undefined pollutants present in the water supplies. It has been observed that the use of cracked fiberglass tanks for larvae rearing is correlated with high mortality. This high mortality is probably due to the toxicity of the phenolic compounds which are leached out from the fiber glass tank into the water. This study was undertaken to evaluate the toxicity of phenol on eggs, larvae and post-larvae of M. rosenbergii and to set the water quality criteria of phenol for the said species. 16 refs., 3 tabs.

  1. Fate of pharmaceuticals and pesticides in fly larvae composting.

    Science.gov (United States)

    Lalander, C; Senecal, J; Gros Calvo, M; Ahrens, L; Josefsson, S; Wiberg, K; Vinnerås, B

    2016-09-15

    A novel and efficient organic waste management strategy currently gaining great attention is fly larvae composting. High resource recovery efficiency can be achieved in this closed-looped system, but pharmaceuticals and pesticides in waste could potentially accumulate in every loop of the treatment system and spread to the environment. This study evaluated the fate of three pharmaceuticals (carbamazepine, roxithromycin, trimethoprim) and two pesticides (azoxystrobin, propiconazole) in a fly larvae composting system and in a control treatment with no larvae. It was found that the half-life of all five substances was shorter in the fly larvae compost (pesticides into the environment. PMID:27177134

  2. A Madurella mycetomatis Grain Model in Galleria mellonella Larvae.

    Directory of Open Access Journals (Sweden)

    Wendy Kloezen

    Full Text Available Eumycetoma is a chronic granulomatous subcutaneous infectious disease, endemic in tropical and subtropical regions and most commonly caused by the fungus Madurella mycetomatis. Interestingly, although grain formation is key in mycetoma, its formation process and its susceptibility towards antifungal agents are not well understood. This is because grain formation cannot be induced in vitro; a mammalian host is necessary to induce its formation. Until now, invertebrate hosts were never used to study grain formation in M. mycetomatis. In this study we determined if larvae of the greater wax moth Galleria mellonella could be used to induce grain formation when infected with M. mycetomatis. Three different M. mycetomatis strains were selected and three different inocula for each strain were used to infect G. mellonella larvae, ranging from 0.04 mg/larvae to 4 mg/larvae. Larvae were monitored for 10 days. It appeared that most larvae survived the lowest inoculum, but at the highest inoculum all larvae died within the 10 day observation period. At all inocula tested, grains were formed within 4 hours after infection. The grains produced in the larvae resembled those formed in human and in mammalian hosts. In conclusion, the M. mycetomatis grain model in G. mellonella larvae described here could serve as a useful model to study the grain formation and therapeutic responses towards antifungal agents in the future.

  3. Biodiversity of Insect Larvae in Streams at Jobolarangan Forest

    OpenAIRE

    MANAN EFENDI; EDWI MAHAJOENO; ARDIANSYAH

    2001-01-01

    Insect larvae are macro-invertebrate that becomes the most perfect indicator of aquatic-environmental health. Natural streams usually determined by its insect-larvae community in a good condition, in which their taxonomic diversity and richness are high. The objective of the research was to know the taxonomic diversity and richness of insect-larvae family in streams at Jobolarangan forest. The larvae were sampled using net-surber (dip-net) in three location of streams, i.e.: Parkiran (1773 m ...

  4. A Model of Drosophila Larva Chemotaxis.

    Directory of Open Access Journals (Sweden)

    Alex Davies

    2015-11-01

    Full Text Available Detailed observations of larval Drosophila chemotaxis have characterised the relationship between the odour gradient and the runs, head casts and turns made by the animal. We use a computational model to test whether hypothesised sensorimotor control mechanisms are sufficient to account for larval behaviour. The model combines three mechanisms based on simple transformations of the recent history of odour intensity at the head location. The first is an increased probability of terminating runs in response to gradually decreasing concentration, the second an increased probability of terminating head casts in response to rapidly increasing concentration, and the third a biasing of run directions up concentration gradients through modulation of small head casts. We show that this model can be tuned to produce behavioural statistics comparable to those reported for the larva, and that this tuning results in similar chemotaxis performance to the larva. We demonstrate that each mechanism can enable odour approach but the combination of mechanisms is most effective, and investigate how these low-level control mechanisms relate to behavioural measures such as the preference indices used to investigate larval learning behaviour in group assays.

  5. Metamorphosis of cinctoblastula larvae (Homoscleromorpha, porifera).

    Science.gov (United States)

    Ereskovsky, Alexander V; Tokina, Daria B; Bézac, Chantal; Boury-Esnault, Nicole

    2007-06-01

    The metamorphosis of the cinctoblastula of Homoscleromorpha is studied in five species belonging to three genera. The different steps of metamorphosis are similar in all species. The metamorphosis occurs by the invagination and involution of either the anterior epithelium or the posterior epithelium of the larva. During metamorphosis, morphogenetic polymorphism was observed, which has an individual character and does not depend on either external or species specific factors. In the rhagon, the development of the aquiferous system occurs only by epithelial morphogenesis and subsequent differentiation of cells. Mesohylar cells derive from flagellated cells after ingression. The formation of pinacoderm and choanoderm occurs by the differentiation of the larval flagellated epithelium. This is possibly due to the conservation of cell junctions in the external surface of the larval flagellated cells and of the basement membrane in their internal surface. The main difference in homoscleromorph metamorphosis compared with Demospongiae is the persistence of the flagellated epithelium throughout this process and even in the adult since exo- and endopinacoderm remain flagellated. The antero-posterior axis of the larva corresponds to the baso-apical axis of the adult in Homoscleromorpha.

  6. Feeding behaviour of snake head fish, Channa striatus larvae

    Directory of Open Access Journals (Sweden)

    Thumronk Amornsakun1*

    2011-12-01

    Full Text Available Feeding scheme experiments were done in a 15-liter glass aquarium (water volume 10 liters containing 500 of two-dayold larvae (stage at first feeding. It was found that larval snake head fish aged 3-11 days (average total length 6.08-10.86 mmconsumed Moina. Larvae aged 12-15 days (average total length 10.79-14.61 mm consumed both Moina and commercialpellet (40 % crude protein. Larvae aged more than 16 days consumed only commercial pellet.Determining the daily food uptake by the larvae and juveniles was done in a 15-liter glass aquarium (water volume 10liters containing 1,000 larvae. The larvae consumed Moina ,provide of a density of Moina 10 individual/ml. The amount offood intake was calculated based on changes of food density in the aquarium with and without fish larvae at 2-hour intervals.It was found that larvae aged 3-15 days consumed Moina. The average uptake of Moina in digestive tract per day of larvaeage 3, 6, 9, 12 and 15 days old was 28.7, 115.70, 162.27, 195.30 and 227.30 individual/larva, respectively at water temperaturesranging between 25 and 28°C.A starvation experiment was carried out using a 15-liter glass aquarium (water volume 10 liters with three replications.Two hundred newly hatched larvae were kept without feeding. Larvae started to die at 216 hr and totally died within 326 hrafter hatching at water temperature ranging between 28.0 and 30.5°C.

  7. BACTERIAL FLORA OF RAINBOW TROUT LARVAE AND FRY (ONCORHYNCHUS MYKISS

    Directory of Open Access Journals (Sweden)

    Damir Kapetanović

    2003-09-01

    Full Text Available There are no information in available literature about the structure of bacterial flora in rainbow trout larvae and fry in the first days of their lives. The objective of our work has been to follow bacteroflora between the third and the eighth week of their lives. During 35 days of experiment bacteroflora of rainbow trout has been examined, along with following physico–chemical characteristics of water quality as well as it’s influence on health. Samples for bacteriological examination were taken from gill, heart and kidney areas and innoculated on the plates. Bacterial colonies were examined macroscopically, slides with Gram staining, and afterwords biochemical tests were performed. For identification, APILAB Plus programme (bio Mérieux, France was used. Bacterial population of rainbow trout larvae and fry changed in dependence with their age. Physico–chemical characteristics of water ranged within optimal values. Most of bacterial colonies originated from gill isolates (64,4 %, than from heart (21,8 % and kidney areas (13,8 %. The bacterial flora of larvae in incubator was composed mostly of Gram–positive bacteria (75,1 %, genera: Renibacterium (25 %, Lactobacillus (16,7 %, Staphilococcus (16,7 % and Corynebacterium (16,7 %. The transfer of larvae from incubator into the pools resulted in reducing bacterial flora (–66,7 % after 45 minute stay in the pool. Gram–negative bacteria, which have been represented in larvae in incubator with low percent (24, 9 %, after the transfer of larvae to the pools became dominant and represented more than 95 % of rainbow trout larvae and fry bacterial flora. Flavobacterium, Acinetobacter and Yersinia were the predominant Gram–negative genera in larvae in incubator, whereas Aeromonas, Pseudomonas, Flavobacterium and Pasteurella were the main isolates from rainbow trout larvae and fry until the end of experiment. Bacterial flora of larvae in incubator mostly consists of Gram–positive bacteria

  8. The effects of dissolved gas supersaturation on white sturgeon larvae

    Science.gov (United States)

    Counihan, T.D.; Miller, A.I.; Mesa, M.G.; Parsley, M.J.

    2000-01-01

    Spill at dams has caused supersaturation of atmospheric gas in waters of the Columbia and Snake rivers and raised concerns about the effects of dissolved gas supersaturation (DGS) on white sturgeons Acipenser transmontanus. The timing and location of white sturgeon spawning and the dispersal of white sturgeon larvae from incubation areas makes the larval stage potentially vulnerable to the effects of DGS. To assess the effects of DGS on white sturgeon larvae, we exposed larvae to mean total dissolved gas (TDG) levels of 118% and 131% saturation in laboratory bioassay tests. Gas bubble trauma (GBT) was manifested as a gas bubble in the buccal cavity, nares, or both and it first occurred at developmental stages characterized by the formation of the mouth and gills. Exposure times of 15 min were sufficient to elicit these signs in larvae in various stages of development. No mortality was observed in larvae exposed to 118% TDG for 10 d, but 50% mortality occurred after a 13-d exposure to 131% TDG. The signs of GBT we observed resulted in positive buoyancy and alterations in behavior that may affect the dispersal and predation vulnerability of white sturgeon larvae. The exact depth distribution of dispersing white sturgeon larvae in the Columbia River currently is unknown. Thus, our results may represent a worst-case scenario if white sturgeon larvae are dispersed at depths with insufficient hydrostatic pressure to compensate for high TDG levels.

  9. Effects of cobalt-60 gamma radiation on gnathostoma spinigerum larvae

    International Nuclear Information System (INIS)

    Gnathostoma spinigerum infective larvae were found to be very resistant to gamma ray. The larvae were still viable, motile and capable to infect white mice with no observable abnormality in both internal and external structures and their sizes after exposure to 0-7.0 KGy of gamma ray. At doses of 0, 0.3, 0.6, 1.0, 1.5, 2.0, 3.0, 5.0 and 7.0 KGy, the infective rates were 72%, 78%, 64%, 54%, 28%, 42%, 26%, 14% and 5% respectively. The infective rates of the irradiated larvae exposed to 8 KGy and 10 KGy of irradiation in mice became zero. The reduction of motility and infectivity was first observed after exposure of larvae to 1.5 KGy of gamma ray. It was also found that motility and infectivity decreased in relationship to the higher doses of gamma ray. At 10.0 KGy of irradiation which was the highest dose used in this experiment could not devitalize the larvae but inhibit infectivity. Irradiation of the larvae mixed in food prepared from fishes at 8 KGy was proved to inhibit the infectivity. On the study, the dose of 8.0 KGy was suggested to be the minimum effective dose that inhibited the infectivity of the infective stage. To confirm the effective dose, the mixture of the infective larvae and Somfuk, a local food, was treated by 8 KGy and these irradiated larvae precisely lost their infectivity in mice

  10. Cadmium and zinc reversibly arrest development of Artemia larvae

    Energy Technology Data Exchange (ETDEWEB)

    Bagshaw, J.C.; Rafiee, P.; Matthews, C.O.; MacRae, T.H.

    1986-08-01

    Despite the widespread distribution of heavy metals such as cadmium and zinc in the environment and their well-known cytotoxicity and embryotoxicity in mammals, comparatively little is known about their effect on aquatic organisms, particularly invertebrates. Post-gastrula and early larval development of the brine shrimp, Artemia, present some useful advantages for studies of developmental aspects of environmental toxicology. Dormant encysted gastrulae, erroneously called brine shrimp eggs, can be obtained commercially and raised in the laboratory under completely defined conditions. Following a period of post-gastrula development within the cyst, pre-nauplius larvae emerge through a crack in the cyst shell. A few hours later, free-swimming nauplius larvae hatch. Cadmium is acutely toxic to both adults and nauplius larvae of Artemia, but the reported LC50s are as high as 10 mM, depending on larval age. In this paper the authors show that pre-nauplius larvae prior to hatching are much more sensitive to cadmium than are hatched nauplius larvae. At 0.1 ..mu..m, cadmium retards development and hatching of larvae; higher concentrations block hatching almost completely and thus are lethal. However, the larvae arrested at the emergence stage survive for 24 hours or more before succumbing to the effects of cadmium, and during this period the potentially lethal effect is reversible if the larvae are placed in cadmium-free medium. The effects of zinc parallel those of cadmium, although zinc is somewhat less toxic than cadmium at equal concentrations.

  11. Cultivation of sponge larvae: settlement, survival, and growth of juveniles

    NARCIS (Netherlands)

    Caralt, de S.; Otjens, H.; Uriz, M.J.; Wijffels, R.H.

    2007-01-01

    The aim of this study was to culture sponge juveniles from larvae. Starting from larvae we expected to enhance the survival and growth, and to decrease the variation in these parameters during the sponge cultures. First, settlement success, morphological changes during metamorphosis, and survival of

  12. Bacteria Present in Comadia redtenbacheri Larvae (Lepidoptera: Cossidae).

    Science.gov (United States)

    Hernández-Flores, L; Llanderal-Cázares, C; Guzmán-Franco, A W; Aranda-Ocampo, S

    2015-09-01

    The external and internal culturable bacterial community present in the larvae of Comadia redtenbacheri Hammerschmidt, an edible insect, was studied. Characterization of the isolates determined the existence of 18 morphotypes and phylogenetic analysis of the 16S rRNA gene revealed the existence of Paenibacillus sp., Bacillus safensis, Pseudomonas sp., Bacillus pseudomycoides, Corynebacterium variabile, Enterococcus sp., Gordonia sp., Acinetobacter calcoaceticus, Arthrobacter sp., Micrococcus sp., and Bacillus cereus. Greater diversity of bacteria was found in those larvae obtained from vendors than in those directly taken from Agave plants in nature. Many of the larvae obtained from vendors presented signs of potential disease, and after the analysis, results showed a greater bacterial community compared with the larvae with a healthy appearance. This indicates that bacterial flora can vary in accordance with how the larvae are handled during extraction, collection, and transport. PMID:26336239

  13. Chemical spying in coral reef fish larvae at recruitment.

    Science.gov (United States)

    Roux, Natacha; Brooker, Rohan M; Lecellier, Gaël; Berthe, Cécile; Frédérich, Bruno; Banaigs, Bernard; Lecchini, David

    2015-10-01

    When fish larvae recruit back to a reef, chemical cues are often used to find suitable habitat or to find juvenile or adult conspecifics. We tested if the chemical information used by larvae was intentionally produced by juvenile and adult conspecifics already on the reef (communication process) or whether the cues used result from normal biochemical processes with no active involvement by conspecifics ("spying" behavior by larvae). Conspecific chemical cues attracted the majority of larvae (four out of the seven species tested); although while some species were equally attracted to cues from adults and juveniles (Chromis viridis, Apogon novemfasciatus), two exhibited greater sensitivity to adult cues (Pomacentrus pavo, Dascyllus aruanus). Our results indicate also that spying cues are those most commonly used by settling fishes (C. viridis, P. pavo, A. novemfasciatus). Only one species (D. aruanus) preferred the odour of conspecifics that had had visual contact with larvae (communication). PMID:26318049

  14. [Tungiasis and cutaneous larva migrans: unpleasant travel souvenirs].

    Science.gov (United States)

    Feldmeier, Hermann

    2009-12-01

    Tungiasis (sand flea disease) and cutaneous larva migrans (creeping eruption) are parasitic skin diseases in which the infectious agents only temporarily invade human skin. The parasites die in situ and eventually are eliminated by tissue repair mechanisms. Both diseases are zoonoses. Humans only accidentally become a host for animal hookworm larvae (resulting in cutaneous larva migrans), but get infected with Tunga penetrans as frequent as domestic animals. In travelers to tropical and subtropical regions tungiasis and cutaneous larva migrans are the most common imported skin diseases. The diagnosis is made clinically. In tungiasis the clinical manifestations depend on the stage of the disease. Intense local inflammation and bacterial superinfection are common. Cutaneous larva migrans is treated orally with ivermectin or albendazole. A repellent based on coconut oil effectively prevents penetration of sand fleas.

  15. Nutritional condition and vertical distribution of Baltic cod larvae

    DEFF Research Database (Denmark)

    Grønkjær, P.; Clemmesen, C.; St. John, Michael

    1997-01-01

    . To lest this hypothesis, Baltic cod larvae were sampled during the spawning seasons of 1994 and 1995 with depth-resolving multiple opening/closing nets. Each larva was aged by otolith readings and its RNA/DNA ratio was determined as a measure of nutritional condition. The RNA/DNA ratios of these larvae...... aged 2-25 days (median 10 days) ranged from 0.4 to 6.2, corresponding to levels exhibited by starving and fast growing larvae in laboratory calibration studies (starvation, protein growth rate, G(pi)=-12.2% day(-1); fast-growing larvae, G(pi)=14.1% day(-1)) respectively. Seventy per cent of the field...

  16. Evaluation of Paracentrotus lividus (Lamarck, 1816) exotrophic larvae as live feed for marine decapod crustacean larvae

    OpenAIRE

    Repolho, Tiago Filipe Baptista da Rosa, 1974-

    2012-01-01

    Tese de doutoramento, Biologia (Biologia Marinha e Aquacultura), Universidade de Lisboa, Faculdade de Ciências, 2012 In the present study, we have evaluated 4‐arm exotrophic larvae of sea urchin Paracentrotus lividus (Echinodermata: Echinoidea) as live feed in marine decapod crustacean larviculture, in comparison to Artemia spp. naupliar stages, a commonly used live prey in marine hatcheries. We therefore investigated several key parameters to assess the potential of P. lividus plutei as l...

  17. Comparative proteomic analysis of surface proteins of Trichinella spiralis muscle larvae and intestinal infective larvae.

    Science.gov (United States)

    Liu, Ruo Dan; Cui, Jing; Liu, Xiao Lin; Jiang, Peng; Sun, Ge Ge; Zhang, Xi; Long, Shao Rong; Wang, Li; Wang, Zhong Quan

    2015-10-01

    The critical step for Trichinella spiralis infection is that muscle larvae (ML) are activated to intestinal infective larvae (IIL) and invade intestinal epithelium to further develop. The IIL is its first invasive stage, surface proteins are directly exposed to host environment and are crucial for larval invasion and development. In this study, shotgun LC-MS/MS was used to analyze surface protein profiles of ML and IIL. Totally, 41 proteins common to both larvae, and 85 ML biased and 113 IIL biased proteins. Some proteins (e.g., putative scavenger receptor cysteine-rich domain protein and putative onchocystatin) were involved in host-parasite interactions. Gene ontology analysis revealed that proteins involved in generation of precursor metabolites and energy; and nucleobase, nucleoside, nucleotide and nucleic acid metabolic process were enriched in IIL at level 4. Some IIL biased proteins might play important role in larval invasion and development. qPCR results confirmed the high expression of some genes in IIL. Our study provides new insights into larval invasion, host-Trichinella interaction and for screening vaccine candidate antigens. PMID:26184560

  18. Larva migrans within scalp sebaceous gland Larva migrans em glândula sebácea do couro cabeludo

    Directory of Open Access Journals (Sweden)

    Lucinda Calheiros Guimarães

    1999-04-01

    Full Text Available A case of larva migrans or serpiginous linear dermatitis on the scalp of a teenager is reported. An ancylostomid larva was found within a sebaceous gland acinus. The unusual skin site for larva migrans as well as the penetration through the sebaceous gland are highlighted. The probable mechanism by which the parasite reached the skin adnexa is discussed.Relata-se caso de larva migrans ou dermatite linear serpiginosa no couro cabeludo de adolescente, no qual o ancilostomídeo foi encontrado no interior de glândula sebácea. Destaca-se a possibilidade do helminto sediar-se em locais pouco usuais, das glândulas sebáceas serem via de penetração de larvas na pele e discute-se o provável mecanismo pelo qual o agente implantou-se no anexo cutâneo.

  19. Biodiversity of Insect Larvae in Streams at Jobolarangan Forest

    Directory of Open Access Journals (Sweden)

    MANAN EFENDI

    2001-07-01

    Full Text Available Insect larvae are macro-invertebrate that becomes the most perfect indicator of aquatic-environmental health. Natural streams usually determined by its insect-larvae community in a good condition, in which their taxonomic diversity and richness are high. The objective of the research was to know the taxonomic diversity and richness of insect-larvae family in streams at Jobolarangan forest. The larvae were sampled using net-surber (dip-net in three location of streams, i.e.: Parkiran (1773 m asl., Mrutu (1875 m asl., and Air Terjun (1600 m asl.. The screened insect-larvae were grouped its family and counted their individual number. The diversity was counted using Shanon-Weiner diversity indices. In this research was found 12 families of insect-larvae consisted of two families of Odonata order, 3 families of Coleopteran order, and a family of Lepidoptera. Nine families identified, while the three insect-larvae i.e. 2 of Coleoptera and 1 of Lepidoptera were not identified yet. The Parkiran station indicated the highest diversity index of 0.1436.

  20. Accelerated larvae development of Ascaris lumbricoides eggs with ultraviolet radiation

    Energy Technology Data Exchange (ETDEWEB)

    Aladawi, M.A. [Syrian Atomic Energy Commission, Radiation Technology Department, P.O. Box 6091, Damascus (Syrian Arab Republic)]. E-mail: Scientific@aec.org.sy; Albarodi, H. [Syrian Atomic Energy Commission, Radiation Technology Department, P.O. Box 6091, Damascus (Syrian Arab Republic); Hammoudeh, A. [Syrian Atomic Energy Commission, Radiation Technology Department, P.O. Box 6091, Damascus (Syrian Arab Republic); Shamma, M. [Syrian Atomic Energy Commission, Radiation Technology Department, P.O. Box 6091, Damascus (Syrian Arab Republic); Sharabi, N. [Syrian Atomic Energy Commission, Radiation Technology Department, P.O. Box 6091, Damascus (Syrian Arab Republic)

    2006-01-15

    In order to investigate the effect of UV radiation on the development of Ascaris lumbricoides larvae, eggs were exposed to increasing UV doses. Filtered wastewater from the secondary effluent taken from the Damascus wastewater treatment plant (DWTP) was used as irradiation and incubation medium. The progressive and accelerated embryonation stages were microscopically observed and the percentages of completely developed larvae were determined weekly. Results indicated that the UV radiation accelerated the development of larvae with increasing UV dose. Preliminary information about the relationship between the UV radiation dose and rate of embryonation is also presented.

  1. Accelerated larvae development of Ascaris lumbricoides eggs with ultraviolet radiation

    Science.gov (United States)

    Aladawi, M. A.; Albarodi, H.; Hammoudeh, A.; Shamma, M.; Sharabi, N.

    2006-01-01

    In order to investigate the effect of UV radiation on the development of Ascaris lumbricoides larvae, eggs were exposed to increasing UV doses. Filtered wastewater from the secondary effluent taken from the Damascus wastewater treatment plant (DWTP) was used as irradiation and incubation medium. The progressive and accelerated embryonation stages were microscopically observed and the percentages of completely developed larvae were determined weekly. Results indicated that the UV radiation accelerated the development of larvae with increasing UV dose. Preliminary information about the relationship between the UV radiation dose and rate of embryonation is also presented.

  2. MID TERM ASSESSMENT OF MASS DRUG ADMINISTRATION IN LYMPHATIC FILARIASIS ENDEMIC AREA OF DAMOH AND SAGAR DISTRICT OF MADHYA PRADESH

    OpenAIRE

    Mohan; Yash; Ankur

    2015-01-01

    BACKGROUND: Lymphatic filariasis caused by Wuchereria bancrofti and Brugia malayi is an important public health problem in India. Filariasis is a major social and the fourth most common cause of disability all over the globe. Filariasis is endemic in 17 States and six Union Territories, with about 553 million people at risk of infection...

  3. Starvation threshold of Balanus amphitrite larvae in relation to temperature

    Digital Repository Service at National Institute of Oceanography (India)

    Anil, A.C.; Desai, D.V.

    Energy content in the non-feeding (lecithotrophic) cyprid larvae of B. amphitrite plays an important role in determining its metamorphic characteristics. In this context it is important to understand the energy transformed to this stage from...

  4. What do barnacle larvae feed on ? Implications in biofouling ecology

    Digital Repository Service at National Institute of Oceanography (India)

    Gaonkar, C.; Anil, A.C.

    deliberated by monitoring the faecal pellets egested by freshly captured larvae from a tropical estuarine environment (Dona Paula bay, Goa, west coast of India) influenced by monsoon and characteristic temporal variations in the phytoplankton abundance...

  5. Microbial interference with hatch and survival of European eel larvae

    DEFF Research Database (Denmark)

    Sørensen, Sune Riis; Lauesen; Tomkiewicz, Jonna;

    Recent research has significantly improved our knowledge and capabilities in the field of in vitro production of yolk sac larvae from European eel (Anguilla anguilla). Female broodstock European eels are matured by weekly administration of pituitary extract and male eels with hCG (human chorionic...... gonadotropin), which afford gametes for in vitro fertilization studies. The maturing process may lead to mass hatchings of up to ½ million larvae of which some survive the entire yolk sac phase. However, the rearing of larvae suffers from high larval mortalities, and water quality might be a crucial factor...... for larval survival in rearing systems. By applying antibiotic treatment as a research tool, it was possible to determine the extent of microbial interference in the production of high numbers of good quality larvae. By controlling microbiota during egg and larval incubation, the egg hatching success...

  6. Microbial modulation of behavior and stress responses in zebrafish larvae.

    Science.gov (United States)

    Davis, Daniel J; Bryda, Elizabeth C; Gillespie, Catherine H; Ericsson, Aaron C

    2016-09-15

    The influence of the microbiota on behavior and stress responses is poorly understood. Zebrafish larvae have unique characteristics that are advantageous for neuroimmune research, however, they are currently underutilized for such studies. Here, we used germ-free zebrafish to determine the effects of the microbiota on behavior and stress testing. The absence of a microbiota dramatically altered locomotor and anxiety-related behavior. Additionally, characteristic responses to an acute stressor were also obliterated in larvae lacking exposure to microbes. Lastly, treatment with the probiotic Lactobacillus plantarum was sufficient to attenuate anxiety-related behavior in conventionally-raised zebrafish larvae. These results underscore the importance of the microbiota in communicating to the CNS via the microbiome-gut-brain axis and set a foundation for using zebrafish larvae for neuroimmune research. PMID:27217102

  7. Visceral larva migrans: migratory pattern of Toxocara canis in pigs

    DEFF Research Database (Denmark)

    Helwigh, Birgitte; Lind, Peter; Nansen, Peter

    1999-01-01

    The migratory pattern of Toxocara canis was investigated following infection of pigs with 60 000 infective eggs. Groups of six pigs were slaughtered at 7, 14 and 28 days after infection (p.i.), and the number of larvae in selected organs and muscles was determined by digestion. A group...... of uninfected pigs was used as negative controls for blood parameters and weight gain. Toxocara canis migrated well in the pig, although the relative numbers of larvae recovered decreased significantly during the experiment. On day 7 p.i., high numbers of larvae were recovered from the lymph nodes around...... towards T. canis L2/L3 ES products was observed from day 14 p.i. until termination of the experiment, and the maximum eosinophil response was observed 14 days p.i. The pig is a useful non-primate model for human visceral larva migrans, since T. canis migrate well and induce a strong immunological response...

  8. Antimicrobial activity of essential oils against Paenibacillus larvae

    OpenAIRE

    Gende, L. B.; Pires, Sância; Fernandez, N.J.; Damiani, M; Churio, M.S.; Fritz, R.; Eguaras, M. J.

    2012-01-01

    American foulbrood is a serious bacterial disease that affects Apis mellifera colonies; the causative agent is Paenibacillus larvae [1 ]. The aim of the study was to evaluate in vitro the antimicrobial activity of 32 essential oils against P. larvae. Oils from 21 botanical species were analyzed by gas chromatography (CG and CG/EM). All essential oils were classified according to the composition of their main components in two groups: benzene ring compounds (BRC) and terpene com...

  9. Maya Index and Larva Density Aedes Aegypti Toward Dengue Infection

    OpenAIRE

    Sang G. Purnama; Tri Baskoro

    2012-01-01

    South Denpasar District was of there as with the highest dengue cases in Bali province. The number of mosquito breeding places and larvae density become risk factor that influenced the spreading of mosquitoes. Maya index was an indicator to measure the amount of waterreservoirs can be breeding places for mosquitoes. Knowing the relationship between maya index and density of larvae and pupae of Ae.aegypti toward dengue infection in South Denpasar District. The study was observational analytic ...

  10. The use of fly larvae for organic waste treatment.

    Science.gov (United States)

    Čičková, Helena; Newton, G Larry; Lacy, R Curt; Kozánek, Milan

    2015-01-01

    The idea of using fly larvae for processing of organic waste was proposed almost 100 years ago. Since then, numerous laboratory studies have shown that several fly species are well suited for biodegradation of organic waste, with the house fly (Musca domestica L.) and the black soldier fly (Hermetia illucens L.) being the most extensively studied insects for this purpose. House fly larvae develop well in manure of animals fed a mixed diet, while black soldier fly larvae accept a greater variety of decaying organic matter. Blow fly and flesh fly maggots are better suited for biodegradation of meat processing waste. The larvae of these insects have been successfully used to reduce mass of animal manure, fecal sludge, municipal waste, food scrapes, restaurant and market waste, as well as plant residues left after oil extraction. Higher yields of larvae are produced on nutrient-rich wastes (meat processing waste, food waste) than on manure or plant residues. Larvae may be used as animal feed or for production of secondary products (biodiesel, biologically active substances). Waste residue becomes valuable fertilizer. During biodegradation the temperature of the substrate rises, pH changes from neutral to alkaline, ammonia release increases, and moisture decreases. Microbial load of some pathogens can be substantially reduced. Both larvae and digested residue may require further treatment to eliminate pathogens. Facilities utilizing natural fly populations, as well as pilot and full-scale plants with laboratory-reared fly populations have been shown to be effective and economically feasible. The major obstacles associated with the production of fly larvae from organic waste on an industrial scale seem to be technological aspects of scaling-up the production capacity, insufficient knowledge of fly biology necessary to produce large amounts of eggs, and current legislation. Technological innovations could greatly improve performance of the biodegradation facilities and

  11. Symbiotic bacteria enable olive fly larvae to overcome host defences

    OpenAIRE

    Ben-Yosef, Michael; Pasternak, Zohar; Jurkevitch, Edouard; Yuval, Boaz

    2015-01-01

    Ripe fruit offer readily available nutrients for many animals, including fruit fly larvae (Diptera: Tephritidae) and their associated rot-inducing bacteria. Yet, during most of their ontogeny, fruit remain chemically defended and effectively suppress herbivores and pathogens by high levels of secondary metabolites. Olive flies (Bactrocera oleae) are uniquely able to develop in unripe olives. Unlike other frugivorous tephritids, the larvae maintain bacteria confined within their midgut caeca. ...

  12. Phylogenetics links monster larva to deep-sea shrimp

    OpenAIRE

    Bracken-Grissom, Heather D; Felder, Darryl L.; Vollmer, Nicole L; Martin, Joel W.; Crandall, Keith A.

    2012-01-01

    Mid-water plankton collections commonly include bizarre and mysterious developmental stages that differ conspicuously from their adult counterparts in morphology and habitat. Unaware of the existence of planktonic larval stages, early zoologists often misidentified these unique morphologies as independent adult lineages. Many such mistakes have since been corrected by collecting larvae, raising them in the lab, and identifying the adult forms. However, challenges arise when the larva is remar...

  13. Long-duration feedings and caste differentiation in Bombus terrestris larvae

    NARCIS (Netherlands)

    Ribeiro, M.F.

    2002-01-01

    The duration of feedings received by Bombus terrestris larvae was studied using video-recordings. In the last days of development all larvae received feedings mainly of long duration. Worker larvae of the third brood received significantly longer feedings than worker larvae reared in the other brood

  14. Quantification of vestibular-induced eye movements in zebrafish larvae

    Directory of Open Access Journals (Sweden)

    Mo Weike

    2010-09-01

    Full Text Available Abstract Background Vestibular reflexes coordinate movements or sensory input with changes in body or head position. Vestibular-evoked responses that involve the extraocular muscles include the vestibulo-ocular reflex (VOR, a compensatory eye movement to stabilize retinal images. Although an angular VOR attributable to semicircular canal stimulation was reported to be absent in free-swimming zebrafish larvae, recent studies reveal that vestibular-induced eye movements can be evoked in zebrafish larvae by both static tilts and dynamic rotations that tilt the head with respect to gravity. Results We have determined herein the basis of sensitivity of the larval eye movements with respect to vestibular stimulus, developmental stage, and sensory receptors of the inner ear. For our experiments, video recordings of larvae rotated sinusoidally at 0.25 Hz were analyzed to quantitate eye movements under infrared illumination. We observed a robust response that appeared as early as 72 hours post fertilization (hpf, which increased in amplitude over time. Unlike rotation about an earth horizontal axis, rotation about an earth vertical axis at 0.25 Hz did not evoke eye movements. Moreover, vestibular-induced responses were absent in mutant cdh23 larvae and larvae lacking anterior otoliths. Conclusions Our results provide evidence for a functional vestibulo-oculomotor circuit in 72 hpf zebrafish larvae that relies upon sensory input from anterior/utricular otolith organs.

  15. Biorheological action of Ascaris lumbricoides larvae on human erythrocytes.

    Science.gov (United States)

    de León, Patricia Ponce; Del Balzo, Gonzalo; Riquelme, Bibiana

    2013-03-01

    Previous studies have shown that A. lumbricoides extracts capture sialic acid (SA) from human red blood cells (RBC). The aim of this work was to study hemorheological alterations in vitro caused by parasite larvae. The biorheological action of three larva concentrates of first and second larval stage on group O erythrocytes was analyzed by incubating the erythrocyte packed together with an equal volume of larvae (treated RBC) and PBS (control RBC). Distribution and parameters of aggregation (digital image analysis), aggregation kinetics (erythroaggregameter), and viscoelasticity (erythrodeformeter) were measured. The digital image analysis showed that all the larvae diminished the isolated cells percentage and increased the size of the formed aggregates. The aggregate formation velocity was lower in the treated than in the control. The deformability index (ID) values of treated RBC did not present variations with respect to those of the control, but a decrease in the erythrocyte elastic modulus (μ(m)) and membrane surface viscosity (η(m)) values was observed, indicating that the larvae not only induced a diminution in the membrane surface viscosity of RBC but also altered the dynamic viscoelasticity of the membrane. Experiments carried out in vitro support the conclusion that the contact between larvae and RBC produces hemorheological alterations.

  16. Appetitive and aversive learning in Spodoptera littoralis larvae.

    Science.gov (United States)

    Salloum, Ali; Colson, Violaine; Marion-Poll, Frédéric

    2011-10-01

    Adult Lepidoptera are capable of associative learning. This helps them to forage flowers or to find suitable oviposition sites. Larval learning has never been seriously considered because they have limited foraging capabilities and usually depend on adults as concerns their food choices. We tested if Spodoptera littoralis larvae can learn to associate an odor with a tastant using a new classical conditioning paradigm. Groups of larvae were exposed to an unconditioned stimulus (US: fructose or quinine mixed with agar) paired with a conditioned stimulus (CS: hexanol, geraniol or pentyl acetate) in a petri dish. Their reaction to CS was subsequently tested in a petri dish at different time intervals after conditioning. Trained larvae showed a significant preference or avoidance to CS when paired with US depending on the reinforcer used. The training was more efficient when larvae were given a choice between an area where CS-US was paired and an area with no CS (or another odor). In these conditions, the memory formed could be recalled at least 24 h after pairing with an aversive stimulus and only 5 min after pairing with an appetitive stimulus. This learning was specific to CS because trained larvae were able to discriminate CS from another odor that was present during the training but unrewarded. These results suggest that Lepidoptera larvae exhibit more behavioral plasticity than previously appreciated. PMID:21653242

  17. Acute toxicity of sodium metabisulphite in larvae and post-larvae of the land crab, Cardisoma guanhumi.

    Science.gov (United States)

    Galli, Orlando B S; Fujimoto, Rodrigo Y; Abrunhosa, Fernando A

    2012-08-01

    Sodium metabisulphite (SMB) is used in marine shrimp aquaculture to prevent the occurrence of black spot. The release SMB into the estuarine environment from shrimp farm pond effluents has been reported. This study evaluated the susceptibility of larvae and post-larvae of land crab, Cardisoma guanhumi to this salt. A decrease in dissolved oxygen and pH occurred with increasing concentration of SMB and exposure time. LC(50) values after 48 h of exposure were 34 ± 1.1 mg/L, 31.1 ± 1.9 mg/L, and 30.6 ± 0.5 mg/L for I zoea larvae, megalopa larvae and stage I juveniles, respectively.

  18. Differential immunological responses induced by infection with female muscle larvae and newborn larvae of Trichinella pseudospiralis.

    Science.gov (United States)

    Wu, Z; Nagano, I; Asano, K; Liu, M Y; Takahashi, Y

    2013-05-20

    Trichinella pseudospiralis infection can modulate the immunological response of autoimmune and allergic diseases leading to the amelioration of these diseases. The present study was undertaken to compare immunity induced by adult worms and muscle larvae. Higher eosinophilia was observed from newborn larva (NBL) infection than from adult females while higher levels of IgE were observed in adult female infections over those induced by NBL. The IgG1 response to ES antigen was more prominent in infections with adult females. The IgG2 responses to larval crude antigen were prominent against NBL. The Th2 cytokine, IL-4 cytokine was elevated in adult female infection following re-stimulation with adult crude antigen and ES. Both infections induced strong IFN-γ responses. The present study demonstrates that adult female worms induced stronger Th2 responses (IgG1, IgE and IL-4 responses) than NBL. Further examination of the mechanisms involved in immune modulation may be helpful for identifying Trichinella-derived molecules responsible for regulating autoimmune and allergic diseases. PMID:23433605

  19. The central nervous system of ascidian larvae.

    Science.gov (United States)

    Hudson, Clare

    2016-09-01

    Ascidians are marine invertebrate chordates. Their tadpole larvae contain a dorsal tubular nervous system, resulting from the rolling up of a neural plate. Along the anterior-posterior (A-P) axis, the central nervous system (CNS) is organized into a sensory vesicle, neck, trunk ganglion, and tail nerve cord and consists of approximately only 330 cells, of which around 100 are thought to be neurons. The organization of distinct neuronal cell types and neurotransmitter gene expression within the CNS has been described. The unique developmental mode of ascidians, with a small number of cells and a fixed cell division pattern, allows individual cells to be traced throughout development. This feature has led to the complete documentation of the cell lineages of certain cell types in the CNS. Thus, a step-by-step understanding of nervous system development from the initial stages of neural induction to the neurogenesis of individual neurons is a feasible goal. The genetic control of neural fate induction and early neural plate patterning are now well understood. The molecular mechanisms specifying the cholinergic neurons of the trunk ganglion as well as the pigment cells of the sensory organs are also well elucidated. In addition, studies have begun on the morphogenetic processes of neurulation. Remaining challenges include building an embryonic atlas integrating gene expression patterns, cell lineage, and neuronal cell types as well as developing the gene regulatory networks of cell fate specification and integrating them with the genetic control of morphogenesis. WIREs Dev Biol 2016, 5:538-561. doi: 10.1002/wdev.239 For further resources related to this article, please visit the WIREs website. PMID:27328318

  20. Amostragem por larva-única na vigilância de Aedes aegypti Single-larva sampling for Aedes aegypti surveillance

    Directory of Open Access Journals (Sweden)

    José Eduardo Bracco

    1995-04-01

    Full Text Available Com a finalidade de testar a metodologia de amostragem por larva-única na vigilância entomológica do Aedes aegypti, foram pesquisados domicílios do Município de Araraquara, SP (Brasil. Nos criadouros que continham larvas de Aedes uma delas foi coletada. Como controle, após a coleta da larva-única, todas as larvas foram coletadas para identificação posterior. Esse processo foi repetido no laboratório. Dos 447 domicílios visitados, apenas 12 foram considerados positivos e 20 criadouros foram identificados; destes, 13 continham larvas de Aedes; 5, larvas de Aedes e Culex e 2, larvas de Culex. Os resultados mostram o reconhecimento correto, no campo, de todos os criadouros, evidenciando que o método poderia ser utilizado na vigilância entomológica de municípios sem infestação domiciliar ou infestados apenas com uma única espécie de Aedes.Buildings in Araraquara city, Southeastern Brazil, were searched during a year for the presence of Aedes larvae using single larva sampling in order to check the single-larva methodology. In those breeding places in wich Aedes larvae were found, one of them was collected. As a control, after the single larva had been collected, all the larvae from the breeding place were collected for later identification. This process was repeated in the laboratory. Of the 447 domiciles searched, 12 were considered positive and 20 breeding places were found. Of the breeding places, 13 contained Aedes larvae, 5 both Aedes and Culex larvae and 2 Culex larvae only. The results show that all the breeding places in the field were properly recognited showing the method may be used for Aedes surveillance in cities infested with one species only or without any domiciliary infestation.

  1. Unexpected high losses of Anopheles gambiae larvae due to rainfall.

    Directory of Open Access Journals (Sweden)

    Krijn P Paaijmans

    Full Text Available BACKGROUND: Immature stages of the malaria mosquito Anopheles gambiae experience high mortality, but its cause is poorly understood. Here we study the impact of rainfall, one of the abiotic factors to which the immatures are frequently exposed, on their mortality. METHODOLOGY/PRINCIPAL FINDINGS: We show that rainfall significantly affected larval mosquitoes by flushing them out of their aquatic habitat and killing them. Outdoor experiments under natural conditions in Kenya revealed that the additional nightly loss of larvae caused by rainfall was on average 17.5% for the youngest (L1 larvae and 4.8% for the oldest (L4 larvae; an additional 10.5% (increase from 0.9 to 11.4% of the L1 larvae and 3.3% (from 0.1 to 3.4% of the L4 larvae were flushed away and larval mortality increased by 6.9% (from 4.6 to 11.5% and 1.5% (from 4.1 to 5.6% for L1 and L4 larvae, respectively, compared to nights without rain. On rainy nights, 1.3% and 0.7% of L1 and L4 larvae, respectively, were lost due to ejection from the breeding site. CONCLUSIONS/SIGNIFICANCE: This study demonstrates that immature populations of malaria mosquitoes suffer high losses during rainfall events. As these populations are likely to experience several rain showers during their lifespan, rainfall will have a profound effect on the productivity of mosquito breeding sites and, as a result, on the transmission of malaria. These findings are discussed in the light of malaria risk and changing rainfall patterns in response to climate change.

  2. Descrição da larva de Diastatops obscura (Fabricius (Odonata, Libellulidae Description of the larva of Diastatops obscura (Fabricius (Odonata, Libellulidae

    Directory of Open Access Journals (Sweden)

    N.D. Santos

    1993-01-01

    Full Text Available The larva of Diastatops obscura (Fabricius, 1775 is described and figured based on exuviae of last instar of reared specimes collected on still waters in São João river, Silva Jardim (22º38' - 42º18', Rio de Janeiro, Brazil. The relationship among the larva of D. obscura and larvae of Celithemis are discussed.

  3. Image enhancement for tracking the translucent larvae of Drosophila melanogaster.

    Directory of Open Access Journals (Sweden)

    Sukant Khurana

    Full Text Available Drosophila melanogaster larvae are model systems for studies of development, synaptic transmission, sensory physiology, locomotion, drug discovery, and learning and memory. A detailed behavioral understanding of larvae can advance all these fields of neuroscience. Automated tracking can expand fine-grained behavioral analysis, yet its full potential remains to be implemented for the larvae. All published methods are unable to track the larvae near high contrast objects, including the petri-dish edges encountered in many behavioral paradigms. To alleviate these issues, we enhanced the larval contrast to obtain complete tracks. Our method employed a dual approach of optical-contrast boosting and post-hoc image processing for contrast enhancement. We reared larvae on black food media to enhance their optical contrast through darkening of their digestive tracts. For image processing we performed Frame Averaging followed by Subtraction then Thresholding (FAST. This algorithm can remove all static objects from the movie, including petri-dish edges prior to processing by the image-tracking module. This dual approach for contrast enhancement also succeeded in overcoming fluctuations in illumination caused by the alternating current power source. Our tracking method yields complete tracks, including at the edges of the behavioral arena and is computationally fast, hence suitable for high-throughput fine-grained behavioral measurements.

  4. Feeding ecology of lake whitefish larvae in eastern Lake Ontario

    Science.gov (United States)

    Johnson, James H.; McKenna, James E.; Chalupnicki, Marc A.; Wallbridge, Tim; Chiavelli, Rich

    2009-01-01

    We examined the feeding ecology of larval lake whitefish (Coregonus clupeaformis) in Chaumont Bay, Lake Ontario, during April and May 2004-2006. Larvae were collected with towed ichthyoplankton nets offshore and with larval seines along the shoreline. Larval feeding periodicity was examined from collections made at 4-h intervals over one 24-h period in 2005. Inter-annual variation in diet composition (% dry weight) was low, as was spatial variation among collection sites within the bay. Copepods (81.4%), primarily cyclopoids (59.1%), were the primary prey of larvae over the 3-year period. Cladocerans (8.1%; mainly daphnids, 6.7%) and chironomids (7.3%) were the other major prey consumed. Larvae did not exhibit a preference for any specific prey taxa. Food consumption of lake whitefish larvae was significantly lower at night (i.e., 2400 and 0400 h). Substantial variation in diet composition occurred over the 24-h diel study. For the 24-h period, copepods were the major prey consumed (50.4%) and their contribution in the diet ranged from 29.3% (0400 h) to 85.9% (1200 h). Chironomids made up 33.4% of the diel diet, ranging from 8.0% (0800 h) to 69.9% (0400 h). Diel variation in the diet composition of lake whitefish larvae may require samples taken at several intervals over a 24-h period to gain adequate representation of their feeding ecology.

  5. Larva migrans in India: veterinary and public health perspectives.

    Science.gov (United States)

    Sharma, Rajnish; Singh, B B; Gill, J P S

    2015-12-01

    Despite an important public health problem in developing world like India, larva migrans remains a neglected zoonosis. Cutaneous larva migrans, Visceral larva migrans, and Ocular larva migrans are the important clinical manifestations seen in humans in India. Although many nematode parasites have the ability to cause the infection, the disease primarily occurs due to Ancylostoma caninum and Toxocara canis. Presence of the infection in dogs is an indirect indication of its incidence in humans in endemic regions. In India, sporadic cases of this neglected but important parasitic zoonosis are the main implications of lack of diagnostic methods and under-reporting of human cases. Tropical climate in addition to overcrowding, poor hygiene and sanitation problems, stray dogs, open defecation by dogs and improper faecal disposal are the important factors for persistence of this disease in the country. Sanitary and hygienic measures, improved diagnostic techniques and surveillance programme in dogs as well as humans should be adopted for its effective control. Comprehensive collaborative efforts by physicians and veterinarians are required to tackle this problem in order to attain optimal health for humans, animals and the environment. Moreover, recognition of larva migrans as an important public health problem is the most important step to combat this neglected disease in developing countries like India. PMID:26688621

  6. Larvicidal activity of Brazilian plant essential oils against Coenagrionidae larvae.

    Science.gov (United States)

    Silva, D T; Silva, L L; Amaral, L P; Pinheiro, C G; Pires, M M; Schindler, B; Garlet, Q I; Benovit, S C; Baldisserotto, B; Longhi, S J; Kotzian, C B; Heinzmann, B M

    2014-08-01

    Odonate larvae can be serious pests that attack fish larvae, postlarvae, and fingerlings in fish culture tanks, causing significant loss in the supply and production of juveniles. This study reports a screen of the essential oils (EOs) of Nectandra megapotamica (Sprengel) Mez, Nectandra grandiflora Nees, Hesperozygis ringens (Bentham) Epling, Ocimum gratissimum L., Aloysia gratissima (Gillies & Hooker) Troncoso, and Lippia sidoides Chamisso against Coenagrionidae larvae. In addition, the most effective EO and its 50% lethal concentration (LC50) and chemical analysis are described. The larvae of Acanthagrion Selys, Homeoura Kennedy, Ischnura Charpentier, and Oxyagrion Selys were used to assess the EO effects. EO obtained from H. ringens, O. gratissimum, and L. sidoides showed the highest larvicidal effects at 19 h of treatment. The major constituents of the EO of H. ringens include pulegone and limonene, while eugenol and Z-beta-ocimene predominate in the EO of O. gratissimum, and carvacrol and rho-cymene were the major compounds of the EO of L. sidoides. Leaf EOs from H. ringens, O. gratissimum, and L. sidoides showed activity against Coenagrionidae larvae at similar concentrations with LC50s of 62.92, 75.05, and 51.65 microl liter(-1), respectively, and these were considered the most promising treatments. PMID:25195467

  7. Inactivation of Chironomid Larvae with Chlorine Dioxide and Chlorine

    Institute of Scientific and Technical Information of China (English)

    SUN Xin-bin; CUI Fu-yi

    2008-01-01

    Chironomid larvae propagate prolifically in eutrophic water body and they cannot be exterminated by conventional disinfection process.The inactivation effects of chlorine and chlorine dioxide on Chironomid larvae were investigated and some boundary values in practice were determined under conditions of various oxidant dosage,organic precursor concentration and pH value.In addition,removal effect of differmt pre-oxidation combined with coagulation process on Chironomid larvae in law water was evaluated.It was found that chlorine dioxide possessed better inactivation effect than chlorine.Complete inactivation of Chironomid larvae in raw water was resulted by 1.5mg/L of chlorine dioxide with 30min of contact time. Additionally,the ocgallic precursor concentration,pH value had little influence on the inactivation effect.The coagulation jar test showed that Chironomid larvae in the raw water could be completely ronxwed by chlorine dioxide pre-oxidation in combination with the omgulation process at chlorine dioxide dosage of 0.8 mg/L.

  8. Lipid and fatty acid analysis of uninfected and granulosis virus-infected Plodia interpunctella larvae

    Science.gov (United States)

    Shastri-Bhalla, K.; Consigli, R. A.; Spooner, B. S. (Principal Investigator)

    1994-01-01

    A comparative study on the lipid and fatty acid composition of the uninfected and GV-infected Plodia interpunctella larvae was performed. Higher levels of free fatty acids were found in GV-infected larvae compared to those of the uninfected larvae, while the latter had more triacylglycerol compared to the former. The known identified phospholipids were fewer in the GV-infected larvae compared to those in the uninfected larvae. However, an unidentified phospholipid was found to be approximately two times higher in GV-infected larvae. The total lipid of both larvae had palmitic, oleic, and linoleic as the major fatty acids. The fatty acid composition of the GV-infected larval phospholipid differed considerably compared to that of the uninfected larvae, in that the ratio of unsaturated fatty acid to saturated fatty acid was 3.5 times less in the GV-infected larvae.

  9. Ecdysteroids in the larvae of Opogona sacchari (Bojer), a invasive alien pest

    Institute of Scientific and Technical Information of China (English)

    WANG FangHai; ZHANG GuRen; WEN RuiZhen; HE GuoFeng

    2007-01-01

    In order to understand the composition and quantitative variation of ecdysteriods in the larvae of Opogona sacchari (Bojer), a invasive alien pest, we analyzed the larval ecdysteroid composition and titers in this pest. The main component of ecdysteriods in the larvae of O. Sacchari is 20-hydroxyecdysone, and also there is a little 26-hydroxyecdysone. The titer of ecdysteriods in the larvae from the 1st instar to the 7th instar was gotten higher gradually compared on ng ecdysteroid/larva, but no regularity could be found about the titer if compared on ng ecdysteroid/g avoirdupois. There was only one peak of ecdysteroids (0.5475 ng/larva) showed at day 2 during the developmental time of the 6th instar larvae. However, there were two peaks appearing during the developmental time of the 7th instar larvae , one peak (0.29415 ng/larva) at day 3, another (0.214 ng/larva) at day 5.

  10. Antioxidant activities of protein hydrolysates obtained from the housefly larvae.

    Science.gov (United States)

    Zhang, Huan; Wang, Pan; Zhang, Ai-Jun; Li, Xuan; Zhang, Ji-Hong; Qin, Qi-Lian; Wu, Yi-Jun

    2016-09-01

    The housefly is an important resource insect and the housefly larvae are ideal source of food additives. The housefly larvae protein hydrolysates were obtained by enzymatic hydrolysis by alcalase and neutral proteinase. Their antioxidant activities were investigated, including the superoxide and hydroxyl radicalscavenging activity, 1,1-diphenyl-2-picrylhydrazyl (DPPH) scavenging activity, reducing power and metal chelating activity. The antioxidant activities of both hydrolysates increased with their increasing concentrations. The alcalase hydrolysate (AH) showed higher scavenging activities against hydroxyl radical and superoxide anion radical at low concentrations and higher metal-chelating activity than the neutral proteinase hydrolysate (NPH). The NPH exhibited higher scavenging activity against DPPH free radical and higher reducing power than the AH. Both hydrolysates showed more than 50% superoxide anion radical-scavenging activity at 10 μg/mL. These results indicate that both housefly larvae protein hydrolysates display high antioxidant activities and they could serve as potential natural antioxidant food additives. PMID:27630047

  11. Microsatellite genotyping of individual abalone larvae: parentage assignment in aquaculture.

    Science.gov (United States)

    Selvamani, M J; Degnan, S M; Degnan, B M

    2001-09-01

    In aquaculture, microsatellite DNA markers are used to genotype parental broodstock, to assess fertilization success, and to maintain pedigree information for selective breeding. In this study we genotyped individual Haliotis asinina larvae by analyzing a suit of polymorphic microsatellite loci. At least 10 loci can be analyzed from a single abalone veliger larva. We assayed 5 polymorphic loci to identify the parents of individual larvae produced in 3 separate crosses. In all cases, the parents of an individual veliger could be determined from as few as 3 loci. The microsatellite analysis revealed that, in each of our crosses, a single male fathered most of the veligers, despite efforts to normalize the amount of sperm contributed by competing males. These observations suggest that highly controlled breeding practices may be required to ensure that the genetic diversity of an abalone population produced for aquaculture is maintained at the level of diversity of the original broodstock.

  12. Paenibacillus larvae-Directed Bacteriophage HB10c2 and Its Application in American Foulbrood-Affected Honey Bee Larvae.

    Science.gov (United States)

    Beims, Hannes; Wittmann, Johannes; Bunk, Boyke; Spröer, Cathrin; Rohde, Christine; Günther, Gabi; Rohde, Manfred; von der Ohe, Werner; Steinert, Michael

    2015-08-15

    Paenibacillus larvae is the causative agent of American foulbrood (AFB), the most serious honey bee brood bacterial disease. We isolated and characterized P. larvae-directed bacteriophages and developed criteria for safe phage therapy. Whole-genome analysis of a highly lytic virus of the family Siphoviridae (HB10c2) provided a detailed safety profile and uncovered its lysogenic nature and a putative beta-lactamase-like protein. To rate its antagonistic activity against the pathogens targeted and to specify potentially harmful effects on the bee population and the environment, P. larvae genotypes ERIC I to IV, representatives of the bee gut microbiota, and a broad panel of members of the order Bacillales were analyzed for phage HB10c2-induced lysis. Breeding assays with infected bee larvae revealed that the in vitro phage activity observed was not predictive of the real-life scenario and therapeutic efficacy. On the basis of the disclosed P. larvae-bacteriophage coevolution, we discuss the future prospects of AFB phage therapy. PMID:26048941

  13. Fish larvae at fronts: Horizontal and vertical distributions of gadoid fish larvae across a frontal zone at the Norwegian Trench

    Science.gov (United States)

    Munk, Peter

    2014-09-01

    The reproduction and early life history of many fish species are linked to the physical and biological characteristics of fronts. In order to ascertain linkages between frontal physics and fish larvae, we investigated distributional differences among gadoid fish larvae comparing these to both horizontal and vertical variability in hydrography and abundances of potential copepod prey The investigation was carried out at a frontal zone along the Norwegian Trench in the northern North Sea, and was based on a series of cross-bathymetric sampling transects. Tows with a large ring net and an opening-closing net were used for describing fish larval horizontal and vertical distributions, while a submersible pump was used for describing vertical distributions of copepods. Hydrographic profiles and current velocity measurements were used to outline variability in temperature, salinity and current structure. Measurements demonstrated a distinct bottom front at the southern slope of the Trench with deepening isopycnals and high chlorphyll a concentrations. Abundances of both gadoid fish larvae and copepods peaked in vicinity of the front around mid-depth, and findings points to an inter-connection between the vertical and horizontal distributions of each species. However, the three-dimensional pattern of distribution differed significantly among species of larvae and species of copepods. The study underlines the complexity of bio-physical interrelationships in the frontal zone, and indicates that the zone encompasses specific ecological niches to which each species of fish larvae is adapted.

  14. Developmental arrest in Caenorhabditis elegans dauer larvae causes high expression of enzymes involved in thymidylate biosynthesis, similar to that found in Trichinella muscle larvae.

    Science.gov (United States)

    Wińska, P; Gołos, B; Cieśla, J; Zieliński, Z; Fraczyk, T; Wałajtys-Rode, E; Rode, W

    2005-08-01

    Crude extract specific activities of thymidylate synthase, dUTPase, thymidine kinase and dihydrofolate reductase were high during the development of Caenorhabditis elegans, the dauer larva activities being similar to those previously determined in Trichinella spiralis and T. pseudospiralis muscle larvae (with the exception of thymidine kinase, not detected in Trichinella). High thymidylate synthase expression in developmentally arrested larvae, demonstrated also at the mRNA and protein levels, is in agreement with a global cell cycle arrest of dauer larvae and indicates this unusual cell cycle regulation pattern can be shared by developmentally arrested larvae of C. elegans and the two Trichnella species. Hence, the phenomenon may be characteristic for developmentally arrested larvae of different nematodes, rather than specific for the parasitic Trichinella muscle larvae. Endogenous C. elegans thymidylate synthase was purified and its molecular properties compared with those of the recombinant protein, expression of the latter in E. coli cells confirming the NCBI database sequence identity. PMID:16145941

  15. CONTROLE DE LARVAS DE Diloboderus abderus COM INSETICIDAS EM TRIGO

    Directory of Open Access Journals (Sweden)

    Silva Mauro Tadeu Braga da

    2002-01-01

    Full Text Available A larva de Diloboderus abderus Sturm (Coleoptera: Melolonthidae é uma praga importante da cultura do trigo (Triticum aestivum L. em plantio direto na região Sul do Brasil. Este estudo teve como objetivo avaliar diferentes inseticidas aplicados nas sementes (fipronil e tiametoxam e via pulverização do solo (clorpirifós e lambdacialotrina para o controle dessa praga. A eficiência dos inseticidas foi determinada através do número de larvas vivas no solo aos 30, 60 e 90 dias após a emergência das plantas (DAE, da massa seca da parte aérea das plantas aos 90 DAE e da produção de grãos. Foram observadas correlações negativas significativas entre a dose dos inseticidas fipronil e tiametoxam e o número de larvas, e correlações positivas significativas entre estes inseticidas e a massa seca da parte aérea e a produtividade de grãos. Infestações de larvas nas testemunhas não tratadas reduziram a produtividade em relação às áreas tratadas com inseticidas. A produtividade incrementou à medida que aumentou a eficiência de controle do inseto pelos inseticidas. Concluiu-se que clorpirifós (960 e 1200g i.a./ha e lambdacialotrina a 25g i.a./ha (formulação CE, aplicados em pulverização do solo, são eficientes para reduzir a população de larvas de D. abderus, garantindo a produtividade de grãos. Sugerem-se novos testes com os inseticidas fipronil, tiametoxam e lambdacialotrina (formulação SC para determinar doses técnica e economicamente adequadas para o controle de larvas de D. abderus em trigo.

  16. Nutrient effects of broodstocks on the larvae in Patinopecten yessoensis

    Science.gov (United States)

    Bai, Yucen; Zhang, Tao; Qiu, Tianlong; Gao, Yan; Zhang, Xiaofang

    2015-07-01

    Patinopecten yessoensis is a commercial valuable species. This study deals with the effect of nutrient effects of the broodstock (mainly ovaries) on the larvae. Concentrations of total carbohydrate, total protein and total lipid in the gonads of P. yessoensis from three Hatcheries (Hatchery 1, Hatchery 2, and Hatchery 3) were determined before and after spawning. The relationship between the nutrient concentration in ovaries before spawning (BC) and that of larvae (LC) was assessed as well as the change in nutrient levels in ovaries after spawning (DC). Results indicate that the BC of total carbohydrate (7.66%) and total lipid (14.48%) in ovaries were significantly higher than in testes (5.20%, 5.20% respectively), whereas the BC of total protein in the ovaries was lower (61.76%) than in the testes (81.67%). The different gonadal composition suggests the different nutrient demands between male and female broodstocks in breeding season. Patinopecten yessoensis gonads contained a higher proportion of lipids, in comparison to other bivalves, which might be a response to the low ambient water temperatures. Further analysis of fatty acids showed that the concentrations of n-3PUFA, EPA and DHA in larvae (LC) were positively correlated with BC and DC, indicating the significant nutrient influence of broodstocks on the larvae. As these fatty acids are important in metabolism, and have been demonstrated to be influential to the viability of the larvae, larval growth and the settlement, spat growth, and juvenile survival in many bivalves, they could possibly be used as indexes to evaluate, and predict condition of broodstocks and larvae.

  17. Studies on anopheline larvae in El Faiyum Governorate, Egypt.

    Science.gov (United States)

    Morsy, T A; el Kadery, A A; Salama, M M; Sabry, A H; Kotb, M M; el Sharkawy, I M

    1995-08-01

    In Egypt, malaria is still reported as sporadic cases or small outbreaks particularly in El Faiyum Governorate. This paper aimed to identify and to study the breeding and seasonal activities of anopheline larvae. Spot light surveys were carried out in five different ecological areas (Karoun Lake, El Fedemean, El Siliyien, Kom-Osheim and Sinouris) from September 1991 to August 1992. Three species of Anopheles larvae were encountered: A. (Cellia) pharoensis (43%), A. (Cellia) sergenti (29.8%) and A. (Cellia) multicolor (27.2%). Several type of breeding places were encountered for the three species. A. pharoensis preferred clear, shallow, stagnant water with thick growth of vegetations an shae especially in rice fields. A. sergenti preferred clean, shallow to deep stagnant or slow-moving water with vegetations especially in small water collections in grassy areas and under palm trees. A. multicolor preferred shallow, stagnant water, sometimes partially exposed to sunlight especially in seepage water. The breeding waters for the three species were alkaline. Seasonal study of the anopheline larvae were conducted in three villages: Abheit El Hagar, El Zawia El Khadra and Tersa, in Sinouris Center during the year 1993. A. pharoensis larvae were abundant in the three villages in June, July, August and September with a peak in June. No breeding was noticed in January and February. A. sergenti larvae were abundant from September to November in the three villages, the lowest density was recorded in January and July in Abheit, in April in El Zawia and in June in Tersa. No breeding in February in the three villages was noticed and also in March in Abheit and Tersa. A multicolor larvae were recorded in Abheit and Tersa. In Abheit, the highest density was recorded in November with no breeding in January, February, March and June while in Tersa, the highest density was recorded in October and November with no breeding in January, February, March, April, July and December. The

  18. A case report of cutaneous larva migrans in Argentina

    Institute of Scientific and Technical Information of China (English)

    Javier; Bava; Lucia; G; Gonzalez; Celeste; M; Seley; Gisela; P; Lopez; Alcides; Troncoso

    2011-01-01

    Cutaneous larva migrans(CLM) represents the most common tropically acquired dermatosis.CLM is caused by infection with hookworm larvae in tropical and sub-tropical areas,and people who have a history of foreign travel and of walking barefoot on sandy soil or beaches are at a high risk of getting infected with it.The diagnosis is usually made on the basis of the typical appearance of the lesion,intense itching and history of foreign travel.CLM is a common parasitic skin disease that can be easily prevented by wearing ’protective’ footwear.A case of CLM is described in this article.

  19. A case report of cutaneous larva migrans in Argentina

    OpenAIRE

    BAVA Javier; Gonzalez, Lucia G; Seley, Celeste M; López, Gisela P; Troncoso, Alcides

    2011-01-01

    Cutaneous larva migrans (CLM) represents the most common tropically acquired dermatosis. CLM is caused by infection with hookworm larvae in tropical and sub-tropical areas, and people who have a history of foreign travel and of walking barefoot on sandy soil or beaches are at a high risk of getting infected with it. The diagnosis is usually made on the basis of the typical appearance of the lesion, intense itching and history of foreign travel. CLM is a common parasitic skin disease that can ...

  20. Culture of Eriocheir sinensis Larvae in Ponds in Greenhouse

    Institute of Scientific and Technical Information of China (English)

    Guoliang RUAN; Liangcheng HU; Hai ZHOU; Dawen MA; Yabin TANG

    2016-01-01

    A total of 15 pools were selected from a greenhouse, and they were randomly and evenly divided into three groups. In each group, one stocking density of Eriocheir sinensis was arranged. The results showed that after 45-d culture, the crab number per kilogram reached about 300 with survival rate of about 20%; the initial stocking density had significantly effect on the body size of E. sinensis on sel , instead on the survival rate of E. sinensis larvae. Therefore, it is feasible to conduct the culture of E. sinensis larvae in a pool in greenhouse.

  1. Aquaculture and feeding ecology: Feeding behaviour in turbot larvae

    DEFF Research Database (Denmark)

    Bruno, Eleonora

    , larvae of flatfishes undergo a particularly evident and dramatic metamorphosis, because flatfishes completely reprogram their body to move from the pelagic habitat, in the water column, to the benthic habitat, on the sea floor. Due to the complex morphological and physiological changes, in aquaculture...... capture success. This thesis is part of a large international project aimed at improving the rearing techniques of high value fish species larvae fed with calanoid copepods, their natural prey, to achieve high levels of survival and quality. In fact, fish aquaculture is becoming increasingly important...

  2. CONTROLE DE LARVAS DE Diloboderus abderus COM INSETICIDAS EM TRIGO

    OpenAIRE

    Silva Mauro Tadeu Braga da; Boss Adriano

    2002-01-01

    A larva de Diloboderus abderus Sturm (Coleoptera: Melolonthidae) é uma praga importante da cultura do trigo (Triticum aestivum L.) em plantio direto na região Sul do Brasil. Este estudo teve como objetivo avaliar diferentes inseticidas aplicados nas sementes (fipronil e tiametoxam) e via pulverização do solo (clorpirifós e lambdacialotrina) para o controle dessa praga. A eficiência dos inseticidas foi determinada através do número de larvas vivas no solo aos 30, 60 e 90 dias após a emergência...

  3. Acanthocephala Larvae parasitizing Ameiva ameiva ameiva (Linnaeus, 1758 (Squamata: Teiidae

    Directory of Open Access Journals (Sweden)

    Lilian Cristina Macedo

    2016-03-01

    Full Text Available Abstract Knowledge concerning the taxonomy and biology of species of Acanthocephala, helminth parasites of the helminth species of the phylum Acanthocephala, parasites of lizards in Brazilian Amazonia, is still insufficient, but reports of Acanthocephala in reptiles are becoming increasingly common in the literature. Cystacanth-stage Acanthocephalan larvae have been found in the visceral peritoneum during necropsy of Ameiva ameiva ameivalizards from the “Osvaldo Rodrigues da Cunha” Herpetology Collection of the Emílio Goeldi Museum, Belém, Pará, Brazil. The aim of this study was to present the morphological study of the Acanthocephala larvae found in A. ameiva ameiva lizard.

  4. A case report of cutaneous larva migrans in Argentina

    Institute of Scientific and Technical Information of China (English)

    Javier Bava; Lucia G Gonzalez; Celeste M Seley; Gisela P Lpez; Alcides Troncoso

    2011-01-01

    Cutaneous larva migrans (CLM) represents the most common tropically acquired dermatosis. CLM is caused by infection with hookworm larvae in tropical and sub-tropical areas, and people who have a history of foreign travel and of walking barefoot on sandy soil or beaches are at a high risk of getting infected with it. The diagnosis is usually made on the basis of the typical appearance of the lesion, intense itching and history of foreign travel. CLM is a common parasitic skin disease that can be easily prevented by wearing 'protective' footwear. A case of CLM is described in this article.

  5. Sun-Compass Orientation in Mediterranean Fish Larvae

    OpenAIRE

    Robin Faillettaz; Agathe Blandin; Claire B. Paris; Philippe Koubbi; Jean-Olivier Irisson

    2015-01-01

    Mortality is very high during the pelagic larval phase of fishes but the factors that determine recruitment success remain unclear and hard to predict. Because of their bipartite life history , larvae of coastal species have to head back to the shore at the end of their pelagic episode , to settle. These settlement-stage larvae are known to display strong sensory and motile abilities, but most work has been focused on tropical, insular environments and on the influence of coast-related cues o...

  6. Large extracellular loop of tetraspanin as a potential vaccine candidate for filariasis.

    Science.gov (United States)

    Dakshinamoorthy, Gajalakshmi; Munirathinam, Gnanasekar; Stoicescu, Kristen; Reddy, Maryada Venkatarami; Kalyanasundaram, Ramaswamy

    2013-01-01

    Lymphatic filariasis affects nearly 120 million people worldwide and mass preventive chemotherapy is currently used as a strategy to control this infection. This has substantially reduced the incidence of the infection in several parts of the world. However, a prophylactic vaccine would be more effective in preventing future infections and will supplement the mass chemotherapy efforts. Unfortunately, there is no licensed vaccine available currently to prevent this infection. Molecules expressed on the surface of the parasite are potential candidates for vaccine development as they are exposed to the host immune system. In this study we show that the large extracellular loop of tetraspanin (TSP LEL), a protein expressed on the cuticle of Brugia malayi and Wuchereria bancrofti is a potential vaccine candidate. Our results showed that BmTSP LEL is expressed on the surface of B. malayi infective third stage larvae (L3) and sera from human subjects who are putatively immune to lymphatic filariasis carry high titer of IgG1 and IgG3 antibodies against BmTSP LEL and WbTSP LEL. We also showed that these antibodies in the sera of human subjects can participate in the killing of B. malayi L3 in an antibody dependent cell-mediated cytotoxicity mechanism. Vaccination trials in mice showed that close to 64% protection were achieved against challenge infections with B. malayi L3. Immunized animals showed high titer of anti-WbTSP LEL IgG1, IgG2a and IgG2b antibodies in the sera and IFN-γ secreting cells in the spleen. Onchocerca volvulus another filarial parasite also expresses TSP LEL. Cross-reactivity studies showed that IgG1 antibody in the sera of endemic normal subjects, recognize OvTSP LEL. Similarly, anti-OvTSP LEL antibodies in the sera of subjects who are immune to O. volvulus were also shown to cross-react with rWbTSP LEL and rBmTSP LEL. These findings thus suggested that rTSP LEL can be developed as a potential vaccine candidate against multiple filarial infections

  7. Large extracellular loop of tetraspanin as a potential vaccine candidate for filariasis.

    Directory of Open Access Journals (Sweden)

    Gajalakshmi Dakshinamoorthy

    Full Text Available Lymphatic filariasis affects nearly 120 million people worldwide and mass preventive chemotherapy is currently used as a strategy to control this infection. This has substantially reduced the incidence of the infection in several parts of the world. However, a prophylactic vaccine would be more effective in preventing future infections and will supplement the mass chemotherapy efforts. Unfortunately, there is no licensed vaccine available currently to prevent this infection. Molecules expressed on the surface of the parasite are potential candidates for vaccine development as they are exposed to the host immune system. In this study we show that the large extracellular loop of tetraspanin (TSP LEL, a protein expressed on the cuticle of Brugia malayi and Wuchereria bancrofti is a potential vaccine candidate. Our results showed that BmTSP LEL is expressed on the surface of B. malayi infective third stage larvae (L3 and sera from human subjects who are putatively immune to lymphatic filariasis carry high titer of IgG1 and IgG3 antibodies against BmTSP LEL and WbTSP LEL. We also showed that these antibodies in the sera of human subjects can participate in the killing of B. malayi L3 in an antibody dependent cell-mediated cytotoxicity mechanism. Vaccination trials in mice showed that close to 64% protection were achieved against challenge infections with B. malayi L3. Immunized animals showed high titer of anti-WbTSP LEL IgG1, IgG2a and IgG2b antibodies in the sera and IFN-γ secreting cells in the spleen. Onchocerca volvulus another filarial parasite also expresses TSP LEL. Cross-reactivity studies showed that IgG1 antibody in the sera of endemic normal subjects, recognize OvTSP LEL. Similarly, anti-OvTSP LEL antibodies in the sera of subjects who are immune to O. volvulus were also shown to cross-react with rWbTSP LEL and rBmTSP LEL. These findings thus suggested that rTSP LEL can be developed as a potential vaccine candidate against multiple

  8. First record of larvae of Chironomidae (Insecta, Diptera as prey of Temnocephala sp. (Platyhelminthes, Temnocephalidae, an ectosymbiont on larvae of Corydalidae (Megaloptera Primeiro registro de larvas de Chironomidae como presas de Temnocephala sp. (Platyhelminthes, Temnocephalidae, um ectosimbionte de larvas de Corydalidae (Maegaloptera

    Directory of Open Access Journals (Sweden)

    Susana Trivinho-Strixino

    2012-09-01

    Full Text Available First record of larvae of Chironomidae (Insecta, Diptera as prey of Temnocephala sp. (Platyhelminthes, Temnocephalidae, an ectosymbiont on larvae of Corydalidae (Megaloptera. This study constitutes the first record of Temnocephala Blanchard, an ectosymbiont on Corydalidae, as a possible predator of chironomid larvae. Twenty-eight Corydalidae larvae (Corydalus and Protochauliodes were examined under stereomicroscopic in search for Temnocephala and Chironomidae larvae, of which five megalopteran larvae had 24 Temnocephala sp. associated. Furthermore, eight of these Temnocephala worms had chironomid larvae in their gut contents, an interaction previously unknown. Gut content analyses revealed Corynoneura as the commonest chironomid, but larvae of Larsia, Rheotanytarsus and Tanytarsus were recorded as well. This study included Corydalus and Protochauliodes as hosts for Temnocephala, which might be important for this worm dispersion and population dynamics.Primeiro registro de larvas de Chironomidae como presas de Temnocephala sp. (Platyhelminthes, Temnocephalidae, um ectosimbionte de larvas de Corydalidae (Maegaloptera. Este estudo constitui o primeiro registro de Temnocephala Blanchard (Platyhelminthes, Temnocephalidae, um ectosimbionte em larvas de Megaloptera, como um possível predador de larvas de Chironomidae. Vinte e oito larvas de Corydalidae (Corydalus e Protochauliodes foram examinadas sobre estereomicroscópio na busca por Temnocephala e larvas de Chironomidae, das quais cinco larvas de Megaloptera continham 24 Temnocephala sp. associadas. Além disso, oito Temnocephala possuíam em seu conteúdo estomacal larvas de Chironomidae, uma interação desconhecida anteriormente. A análise do conteúdo estomacal revelou Corynoneura como o quironomídeo mais abundante, e também algumas larvas de Larsia, Rheotanytarsus e Tanytarsus. Este estudo inclui Corydalus e Protochauliodes como hospedeiros de Temnocephala, os quais podem ser importantes

  9. Intraguild predation and cannibalism among larvae of detritivorous caddisflies in subalpine wetlands

    Science.gov (United States)

    Wissinger, S.A.; Sparks, G.B.; Rouse, G.L.; Brown, W.S.; Steltzer, H.

    1996-01-01

    Comparative data from subalpine wetlands in Colorado indicate that larvae of the limnephilid caddisflies, Asynarchus nigriculus and Limnephilus externus, are reciprocally abundant among habitats - Limnephilus larvae dominate in permanent waters, whereas Asynarchus larvae dominate in temporary basins. The purpose of this paper is to report on field and laboratory experiments that link this pattern of abundance to biotic interactions among larvae. In the first field experiment, growth and survival were compared in single and mixed species treatments in littoral enclosures. Larvae, which eat mainly vascular plant detritus, grew at similar rates among treatments in both temporary and permanent habitats suggesting that exploitative competition is not important under natural food levels and caddisfly densities. However, the survival of Limnephilus larvae was reduced in the presence of Asynarchus larvae. Subsequent behavioral studies in laboratory arenas revealed that Asynarchus larvae are extremely aggressive predators on Limnephilus larvae. In a second field experiment we manipulated the relative sizes of larvae and found that Limnephilus larvae were preyed on only when Asynarchus larvae had the same size advantage observed in natural populations. Our data suggest that the dominance of Asynarchus larvae in temporary habitats is due to asymmetric intraguild predation (IGP) facilitated by a phenological head start in development. These data do not explain the dominance of Limnephilus larvae in permanent basins, which we show elsewhere to be an indirect effect of salamander predation. Behavioral observations also revealed that Asynarchus larvae are cannibalistic. In contrast to the IGP on Limnephilus larvae, Asynarchus cannibalism occurs among same-sized larvae and often involves the mobbing of one victim by several conspecifics. In a third field experiment, we found that Asynarchus cannibalism was not density-dependent and occurred even at low larval densities. We

  10. Angiostrongylus cantonensis (Nematode: Metastrongiloidea: in vitro cultivation of infective third-stage larvae to fourth-stage larvae.

    Directory of Open Access Journals (Sweden)

    Rong-Jyh Lin

    Full Text Available The present study to attempt to cultivate Angiostrongylus cantonensis from third-stage larvae (AcL3 to fourth-stage larvae (AcL4 in vitro in defined complete culture medium that contained with Minimum Essential Medium Eagle (MEM, supplemented amino acid (AA, amine (AM, fatty acid (FA, carbohydrate (CA and 20% fetal calf serum (FCS was successful. When AcL3 were cultured in the defined complete culture medium at 37°C in a 5% CO2 atmosphere, the larvae began to develop to AcL4 after 30 days of cultivation, and were enclosed within the sheaths of the third molts of the life cycle. Under these conditions, the larvae developed uniformly and reached to the fourth-stage 36 days. The morphology of AcL3 develop to AcL4 were recording and analyzing. Then comparison of A. cantonensis larval morphology and development between in vitro cultivation in defined complete culture medium and in vivo cultivation in infective BALB/c mice. The larvae that had been cultivated in vitro were smaller than AcL4 of infective BALB/c mice. However the AcL3 that were cultured using defined incomplete culture medium (MEM plus 20% FCS with AA+AM, FA, CA, AA+AM+FA, FA+CA, CA+AA+AM or not did not adequately survive and develop. Accordingly, the inference is made that only the defined complete medium enable AcL3 develop to AcL4 in vitro. Some nematodes have been successfully cultured into mature worms but only a few researches have been made to cultivate A. cantonensis in vitro. The present study is the first to have succeeded in developing AcL3 to AcL4 by in vitro cultivation. Finally, the results of in vitro cultivation studies herein contribute to improving media for the effective development and growth of A. cantonensis. The gap in the A. cantonensis life cycle when the larvae are cultivated in vitro from third-stage larvae to fourth-stage larvae can thus be solved.

  11. Development of Metarhizium anisopliae and Beauveria bassiana formulations for control of malaria mosquito larvae

    NARCIS (Netherlands)

    Bukhari, S.T.; Takken, W.; Koenraadt, C.J.M.

    2011-01-01

    Background The entomopathogenic fungi Metarhizium anisopliae and Beauveria bassiana have demonstrated effectiveness against anopheline larvae in the laboratory. However, utilising these fungi for the control of anopheline larvae under field conditions, relies on development of effective means of app

  12. The Blue Neck Syndrome : Nematode Larvae in Skin Scrapings

    Directory of Open Access Journals (Sweden)

    Sugathan P

    2000-01-01

    Full Text Available A novel non-inflammatory type of pigmentation of the neck associated with nematode larvae on affected skin is described. The name ′Blue neck syndrome′ is suggested for this condition because of the characteristic clinical appearance. Antinematode agents such as albendazole and neem oil have been found to be effective in the treatment.

  13. Cryopreservation of Greenshell™ mussel (Perna canaliculus) trochophore larvae.

    Science.gov (United States)

    Paredes, E; Adams, S L; Tervit, H R; Smith, J F; McGowan, L T; Gale, S L; Morrish, J R; Watts, E

    2012-12-01

    The Greenshell™ mussel (Perna canaliculus) is the main shellfish species farmed in New Zealand. The aim of this study was to evaluate the effects of cryoprotectant concentration, loading and unloading strategy as well as freezing and thawing method in order to develop a protocol for cryopreservation of trochophore larvae (16-20 h old). Toxicity tests showed that levels of 10-15% ethylene glycol (EG) were not toxic to larvae and could be loaded and unloaded in a single step. Through cryopreservation experiments, we designed a cryopreservation protocol that enabled 40-60% of trochophores to develop to D-larvae when normalized to controls. The protocol involved: holding at 0 °C for 5 min, then cooling at 1 °C min⁻¹ to -10 °C, holding for a further 5 min, then cooling at 0.5 °C min⁻¹ to -35 °C followed by a 5 min hold and then plunging into liquid nitrogen. A final larval rearing experiment of 18 days was conducted to assess the ability of these frozen larvae to develop further. Results showed that only 2.8% of the frozen trochophores were able to develop to competent pediveligers.

  14. Coral larvae under ocean acidification: survival, metabolism, and metamorphosis.

    Directory of Open Access Journals (Sweden)

    Masako Nakamura

    Full Text Available Ocean acidification may negatively impact the early life stages of some marine invertebrates including corals. Although reduced growth of juvenile corals in acidified seawater has been reported, coral larvae have been reported to demonstrate some level of tolerance to reduced pH. We hypothesize that the observed tolerance of coral larvae to low pH may be partly explained by reduced metabolic rates in acidified seawater because both calcifying and non-calcifying marine invertebrates could show metabolic depression under reduced pH in order to enhance their survival. In this study, after 3-d and 7-d exposure to three different pH levels (8.0, 7.6, and 7.3, we found that the oxygen consumption of Acropora digitifera larvae tended to be suppressed with reduced pH, although a statistically significant difference was not observed between pH conditions. Larval metamorphosis was also observed, confirming that successful recruitment is impaired when metamorphosis is disrupted, despite larval survival. Results also showed that the metamorphosis rate significantly decreased under acidified seawater conditions after both short (2 h and long (7 d term exposure. These results imply that acidified seawater impacts larval physiology, suggesting that suppressed metabolism and metamorphosis may alter the dispersal potential of larvae and subsequently reduce the resilience of coral communities in the near future as the ocean pH decreases.

  15. The Colonization Dynamics of the Gut Microbiota in Tilapia Larvae

    NARCIS (Netherlands)

    Giatsis, C.; Sipkema, D.; Smidt, H.; Verreth, J.A.J.; Verdegem, M.C.J.

    2014-01-01

    The gut microbiota of fish larvae evolves fast towards a complex community. Both host and environment affect the development of the gut microbiota; however, the relative importance of both is poorly understood. Determining specific changes in gut microbial populations in response to a change in an e

  16. Lead levels of Culex mosquito larvae inhabiting lead utilizing factory

    Institute of Scientific and Technical Information of China (English)

    Kitvatanachai; S; Apiwathnasorn; C; Leemingsawat; S; Wongwit; W; Overgaard; HJ

    2011-01-01

    Objective:To determine lead level primarily in Culex quinquefasciatus(Cx.quinquefasciatus), and Culex gelidus(Cx.gelidus) larvae inhabiting lead consuming factories,and to putatively estimate eco-toxicological impact of effluents from the firms.Methods:Third instars larvae were sampled by standard dipping method and lead concentrations in the larvae and their respective surrounding factory aquatic environments were determined through standard atomic absorption spectrophotometry(AAS).Results:Cx.quinquefasciatus was the most abundant species followed by Cx.gelidus.The levels of lead were higher in the Cx.quinquefasciatus(1.08-47.47μg/g),than in the wastewaters surface(0.01-0.78 μg/mL) from the factories or closer areas around factories. Other species were not reaching the.criteria for lead determination.Conclusions:The Cx. quinquefasciatus larvae can bio-accumulate the metal and can potentially serve as a biomarker of lead contamination,to complemente conventional techniques.

  17. CHIRONOMUS PLUMOSUS LARVAE - A SUITABLE NUTRIENT FOR FRESHWATER FARMED FISH

    Directory of Open Access Journals (Sweden)

    I. Bogut

    2007-06-01

    Full Text Available Crude protein, fat, water, ash, dry matter and essential amino and fatty acids were analyzed from freshly collected Chironomus plumosus larvae in order to evaluate their suitability as a component for farmed fish diet. The analyses were performed in intact living organisms and in the dry matter. Essential amino acids were determined by LKB 4101 automatic analyzer, while fatty acids were determined by Chronopack CP 9000 chromatograph with flame ionization detector. Crude protein content was 7.6% and 55.7% in fresh larvae and dry matter, respectively, being a value adequate for growth needs of all freshwater fish sorts and categories. Most essential amino acids in fresh larvae and dry matter are present in quantities adequate for feeding majority of omnivorous and carnivorous freshwater fish species. Crude fat content was 1.3% and 9.7% in fresh larvae and dry matter, respectively, being energetically sufficient for all warm-water living fish. The crude fat contains 26.12% saturated, 30.42% monounsaturated and 34.03% polyunsaturated fatty acids (PUFA. Among the highly unsaturated fatty acids (HUFA, the most abundant is linolenic (7.21%, followed by eicosapentanoic (4.36%, docosahexaenoic (2.49% and docosapentaenoic (1.16% acid. The measured quantity of ω-3 and ω-6 fatty acids (essential for omnivorous fish, as well as ω-6 to ω-3 fatty acid ratio (0.81, completely meets nutritional requirements of carp and tench.

  18. Behavioral Analysis of Bitter Taste Perception in Drosophila Larvae.

    Science.gov (United States)

    Kim, Haein; Choi, Min Sung; Kang, KyeongJin; Kwon, Jae Young

    2016-01-01

    Insect larvae, which recognize food sources through chemosensory cues, are a major source of global agricultural loss. Gustation is an important factor that determines feeding behavior, and the gustatory receptors (Grs) act as molecular receptors that recognize diverse chemicals in gustatory receptor neurons (GRNs). The behavior of Drosophila larvae is relatively simpler than the adult fly, and a gustatory receptor-to-neuron map was established in a previous study of the major external larval head sensory organs. Here, we extensively study the bitter taste responses of larvae using 2-choice behavioral assays. First, we tested a panel of 23 candidate bitter compounds to compare the behavioral responses of larvae and adults. We define 9 bitter compounds which elicit aversive behavior in a dose-dependent manner. A functional map of the larval GRNs was constructed with the use of Gr-GAL4 lines that drive expression of UAS-tetanus toxin and UAS-VR1 in specific gustatory neurons to identify bitter tastants-GRN combinations by suppressing and activating discrete subsets of taste neurons, respectively. Our results suggest that many gustatory neurons act cooperatively in larval bitter sensing, and that these neurons have different degrees of responsiveness to different bitter compounds.

  19. Symbiotic Bacteria Enable Olive Fly Larvae to Overcome Host Defenses

    International Nuclear Information System (INIS)

    Ripe fruit offer readily available nutrients for many animals, including fruit fly larvae (Diptera: Tephritidae) and their associated rot-inducing bacteria. Yet, during most of their ontogeny, fruit remain chemically defended and effectively suppress herbivores and pathogens by high levels of secondary metabolites. Olive flies (Bactrocera oleae) are uniquely able to develop in unripe olives. Unlike other frugivorous tephritids, the larvae maintain bacteria confined within their midgut caeca. We examined the interaction between larvae, their associated bacteria, and fruit chemical defence, hypothesizing that bacterial contribution to larval development is contingent on the phenology of fruit defensive chemistry. We demonstrate that larvae require their natural complement of bacteria (Candidatus Erwinia dacicola: Enterobacteriaceae) in order to develop in unripe olives. Conversely, when feeding on ripe fruit, larval development proceeds independently of these bacteria. Our experiments suggest that bacteria counteract the inhibitory effect of oleuropein—the principal phenolic glycoside in unripe olives. In light of these results, we suggest that the unique symbiosis in olive flies, compared with other frugivorous tephritids, is understood by considering the relationship between the fly, bacteria and fruit chemistry. When applied in an evolutionary context, this approach may also point out the forces which shaped symbioses across the Tephritidae. (author)

  20. Two alternating motor programs drive navigation in Drosophila larva.

    Directory of Open Access Journals (Sweden)

    Subhaneil Lahiri

    Full Text Available When placed on a temperature gradient, a Drosophila larva navigates away from excessive cold or heat by regulating the size, frequency, and direction of reorientation maneuvers between successive periods of forward movement. Forward movement is driven by peristalsis waves that travel from tail to head. During each reorientation maneuver, the larva pauses and sweeps its head from side to side until it picks a new direction for forward movement. Here, we characterized the motor programs that underlie the initiation, execution, and completion of reorientation maneuvers by measuring body segment dynamics of freely moving larvae with fluorescent muscle fibers as they were exposed to temporal changes in temperature. We find that reorientation maneuvers are characterized by highly stereotyped spatiotemporal patterns of segment dynamics. Reorientation maneuvers are initiated with head sweeping movement driven by asymmetric contraction of a portion of anterior body segments. The larva attains a new direction for forward movement after head sweeping movement by using peristalsis waves that gradually push posterior body segments out of alignment with the tail (i.e., the previous direction of forward movement into alignment with the head. Thus, reorientation maneuvers during thermotaxis are carried out by two alternating motor programs: (1 peristalsis for driving forward movement and (2 asymmetric contraction of anterior body segments for driving head sweeping movement.

  1. Molecular expression and characterization of a homologue of host cytokine macrophage migration inhibitory factor from Trichinella spp.

    Science.gov (United States)

    Wu, Z; Boonmars, T; Nagano, I; Nakada, T; Takahashi, Y

    2003-06-01

    A homologue of cytokine macrophage migration inhibitory factor (MIF) from complementary DNA (cDNA) of Trichinella spiralis and Trichinella pseudospiralis was expressed in Escherichia coli and characterized. The sequence analysis indicated that the predicted amino acid sequence has an identity of 57 and 44% with the MIF of nematodes Trichuris trichiura and Brugia malayi respectively, and 41 and 40% with that of a human and a mouse, respectively. The identity in sequences of cDNA and amino acids between T. spiralis and T. pseudospiralis was 91 and 86%, respectively. Western blot analysis showed that anti-MIF antibodies positively stained proteins from the extracts of adult worms or muscle larvae migrating at about 12.5 kDa (3 isoforms with isoelectric point 5.23, 5.72, and 6.29). Semiquantitative reverse transcriptase-polymerase chain reaction revealed that the gene was expressed in various developmental stages, including in adult worms, newborn larvae, precyst muscle larvae, and postcyst muscle larvae, although there was difference in the expression level among these stages. The immunohistochemical analysis showed the MIF exists in the muscle cells of the body wall and some stichocytes of larvae. Histopathology of T. spiralis-infected muscles revealed an accumulation of mononuclear cells around the worms, and immunocytochemical staining showed these cells were not macrophages. Mononuclear cells, including macrophages, were, however, observed in cardiac muscles where the parasite did not encyst. Macrophages accumulated around the Sephadex beads transplanted in mice subcutaneously, but this accumulation was profoundly inhibited when the beads were pretreated with MIF recombinant protein. PMID:12880250

  2. Interrelationships among egg, larvae and maternal characteristics in Persian sturgeon Acipenser persicus

    OpenAIRE

    Rajab Mohammad Nazari; Mohammad Reza Ghomi; Laura Aquiloni

    2010-01-01

    This study was aimed to observe the correlations among egg, larvae and maternal characteristics of Persian sturgeon. A total of 41 females were used and the variables including fertilization rate, incubation survival rate, larvae survival rate during yolk sac absorption (before feeding), and larvae survival rate after first feeding were determined. As a result, fertilization rate was positively correlated with three variables: incubation survival, larvae survival during yolk sac absorption, a...

  3. Predation on anchovy larvae by a pelagic chaetognatha, Sagitta nagae in the Sagami Bay, central Japan

    OpenAIRE

    Terazaki, Makoto

    2005-01-01

    Anchovy larvae were detected in the gut of Sagitta nagae collected near Oshima Island in Sagami Bay during the night on 23 May 1996. S. nagae attacked the anchovy larvae actively when they encountered the aggregation of larvae. Generally, large animals consumed larger prey and there is a good correlation between body length of S. nagae and their prey size. Many S. nagae caught anchovy larvae from tail.

  4. The potential for ontogenetic vertical migration by larvae of bathyal echinoderms

    OpenAIRE

    Young, Cm; Devin, Mg; Jaeckle, Wb; Ekaratne, Suk; George, Sb

    1996-01-01

    Planktotrophy is a relatively common developmental mode among bathyal and abyssal echinoderms, but the sources of food used by deep-sea planktotrophic larvae remain generally unknown. Very few deep-sea echinoderm larvae have been collected in plankton samples, so we do not know whether larvae migrate to the euphotic zone to feed or if they rely on bacteria or detritus at greater depths. We approached this question indirectly by investigating whether larvae of bathyal echinoids can tolerate th...

  5. S1 guideline diagnosis and therapy of cutaneous larva migrans (creeping disease)

    OpenAIRE

    Sunderkötter, C.; von Stebut, E.; Schöfer, H.; Mempel, M; Reinel, D; Wolf, G.; Meyer, V.; Nast, A; Burchard, GD

    2014-01-01

    Cutaneous larva migrans is a skin infection with a typical clinical appearance caused by active penetration of nematode larvae and their subsequent epidermal migration. The typical clinical appearance is caused by hookworm larvae, usually Ancylostoma braziliense but sometimes other canine or feline types of hookworm.This guideline aims to enhance patient care by optimizing the diagnosis and treatment of infections due to creeping disease (cutaneous larva migrans) and to raise awareness among ...

  6. Ocean Acidification Has Multiple Modes of Action on Bivalve Larvae.

    Science.gov (United States)

    Waldbusser, George G; Hales, Burke; Langdon, Chris J; Haley, Brian A; Schrader, Paul; Brunner, Elizabeth L; Gray, Matthew W; Miller, Cale A; Gimenez, Iria; Hutchinson, Greg

    2015-01-01

    Ocean acidification (OA) is altering the chemistry of the world's oceans at rates unparalleled in the past roughly 1 million years. Understanding the impacts of this rapid change in baseline carbonate chemistry on marine organisms needs a precise, mechanistic understanding of physiological responses to carbonate chemistry. Recent experimental work has shown shell development and growth in some bivalve larvae, have direct sensitivities to calcium carbonate saturation state that is not modulated through organismal acid-base chemistry. To understand different modes of action of OA on bivalve larvae, we experimentally tested how pH, PCO2, and saturation state independently affect shell growth and development, respiration rate, and initiation of feeding in Mytilus californianus embryos and larvae. We found, as documented in other bivalve larvae, that shell development and growth were affected by aragonite saturation state, and not by pH or PCO2. Respiration rate was elevated under very low pH (~7.4) with no change between pH of ~ 8.3 to ~7.8. Initiation of feeding appeared to be most sensitive to PCO2, and possibly minor response to pH under elevated PCO2. Although different components of physiology responded to different carbonate system variables, the inability to normally develop a shell due to lower saturation state precludes pH or PCO2 effects later in the life history. However, saturation state effects during early shell development will carry-over to later stages, where pH or PCO2 effects can compound OA effects on bivalve larvae. Our findings suggest OA may be a multi-stressor unto itself. Shell development and growth of the native mussel, M. californianus, was indistinguishable from the Mediterranean mussel, Mytilus galloprovincialis, collected from the southern U.S. Pacific coast, an area not subjected to seasonal upwelling. The concordance in responses suggests a fundamental OA bottleneck during development of the first shell material affected only by

  7. Ocean Acidification Has Multiple Modes of Action on Bivalve Larvae.

    Directory of Open Access Journals (Sweden)

    George G Waldbusser

    Full Text Available Ocean acidification (OA is altering the chemistry of the world's oceans at rates unparalleled in the past roughly 1 million years. Understanding the impacts of this rapid change in baseline carbonate chemistry on marine organisms needs a precise, mechanistic understanding of physiological responses to carbonate chemistry. Recent experimental work has shown shell development and growth in some bivalve larvae, have direct sensitivities to calcium carbonate saturation state that is not modulated through organismal acid-base chemistry. To understand different modes of action of OA on bivalve larvae, we experimentally tested how pH, PCO2, and saturation state independently affect shell growth and development, respiration rate, and initiation of feeding in Mytilus californianus embryos and larvae. We found, as documented in other bivalve larvae, that shell development and growth were affected by aragonite saturation state, and not by pH or PCO2. Respiration rate was elevated under very low pH (~7.4 with no change between pH of ~ 8.3 to ~7.8. Initiation of feeding appeared to be most sensitive to PCO2, and possibly minor response to pH under elevated PCO2. Although different components of physiology responded to different carbonate system variables, the inability to normally develop a shell due to lower saturation state precludes pH or PCO2 effects later in the life history. However, saturation state effects during early shell development will carry-over to later stages, where pH or PCO2 effects can compound OA effects on bivalve larvae. Our findings suggest OA may be a multi-stressor unto itself. Shell development and growth of the native mussel, M. californianus, was indistinguishable from the Mediterranean mussel, Mytilus galloprovincialis, collected from the southern U.S. Pacific coast, an area not subjected to seasonal upwelling. The concordance in responses suggests a fundamental OA bottleneck during development of the first shell material

  8. Gut fluorescence analysis of barnacle larvae: An approach to quantify the ingested food

    Digital Repository Service at National Institute of Oceanography (India)

    Gaonkar, C.A.; Anil, A.C.

    pellets it was 224(plus or minus 63) ng chlorophyll a larva sup(−1). A phaeopigment concentration in larval gut was found to be 311(plus or minus 13) ng larva sup(−1) and in faecal pellets it was 172(plus or minus 61) ng larva sup(−1). The study also...

  9. Infection of North Sea cod, Gadus morhua L., larvae with the parasitic nematode Hysterothylacium aduncum Rudolphi

    DEFF Research Database (Denmark)

    Skovgaard, Alf; Bahlool, Qusay Z. M.; Munk, Peter;

    2011-01-01

    Investigation of 2197 cod larvae and post-larvae collected in the North Sea revealed high prevalence of infection with a parasitic anisakid nematode identified morphologically and genetically as Hysterothylacium aduncum. Nematodes were third stage larvae and were almost exclusively found...

  10. Infestation of a bird and two cats by larvae of Plodia interpunctella (Lepidoptera: Pyralidae).

    Science.gov (United States)

    Pinckney, R D; Kanton, K; Foster, C N; Steinberg, H; Pellitteri, P

    2001-09-01

    The larvae of Plodia interpunctella (Hübner), commonly known as the Indian meal moth, often cause enormous losses in stored food supplies. We present three clinical case reports of accidental infestation by P. interpunctella larvae in two domestic cats and one parakeet. A larva gained entry into the avian host and subsequently migrated to the brain. It was alive, covered with "silk-like" fibers and confirmed to be a fourth instar. Plodia interpunctella larvae were excised with forceps from the subcutaneous tissues of the ear and neck of two cats in a different household. Previous reports of infestation by P. interpunctella larvae in vertebrates are unknown.

  11. MOLECULAR IDENTIFICATION OF Pseudoterranova azarasi LARVAE IN COD (Gadus sp.) SOLD FOR HUMAN CONSUMPTION IN BRAZIL.

    Science.gov (United States)

    Marigo, Juliana; Taniwaki, Sueli Akemi; Pinto, Pedro Luiz Silva; Soares, Rodrigo Martins; Catão-Dias, José Luiz

    2015-12-01

    Anisakiasis and Pseudoterranovosis are human diseases caused by the ingestion of live Anisakidae larvae in raw, undercooked or lightly marinated fish. Larvae were collected from one salted cod sold for human consumption in a Sao Paulo market in 2013. One section of one brownish larva was used for molecular analyses. The partial COX2 gene sequence from the larva had a nucleotide identity of 99.8 % with Pseudoterranova azarasi, which belongs to the Pseudoterranova decipiens species complex. The risk of allergy when consuming dead larvae in salted fish is not well known and should be considered.

  12. Description of the larva of Gynacantha millardi Selys, 1891 (Odonata: Aeshnidae) from Chhattisgarh, India.

    Science.gov (United States)

    Dawn, Prosenjit; Chandra, Kailash

    2016-01-01

    The larva of Gynacantha millardi Selys is described here from female larvae and male and female exuviae collected from Chhattisgarh, India. Unlike other Gynacantha larvae known so far, G. millardi has 7 palpal setae almost equal in length; in other species, the palpal setae are of different lengths. The larvae lack a tooth on each side of the median cleft and have a distinct blunt tooth on the inner margin corner of each labial palp. The larvae were found in a semi-stagnant forest pool with enormous growth of aquatic vegetation. PMID:27395672

  13. Age of Atlantic halibut larvae (Hippoglossus hippoglossus L.) at first feeding

    OpenAIRE

    Harboe, Torstein; Næss, Tore Håkon; Naas, Kjell Emil; Rabben, Håvard; Skjolddal, Lillian

    1990-01-01

    Halibut larvae at different age (150 to 315 day-degrees) were transferred to outdoor startfeeding tanks each with two internal plastic bags (100 litre). The larvae were fed wild zooplankton. One bag was sampled after 24 hours, and the other after nine days. Numbers of larvae with food in the gut, without food in gut and dead larvae, were counted for each larval age tested. The results showed that some larvae captured prey at an age of 150 day-degrees. However, at this age few ...

  14. [Ingestion and digestion of seven species of microalgae by larvae of Strombus gigas (Mesogastropoda: Strombidae)].

    Science.gov (United States)

    Patiño Súarez, V; Aldana Aranda, D

    2000-12-01

    The potential nutritional value of seven microalgal diets as measured by their ingestibility and digestibility to queen conch Strombus gigas larvae was tested with 30 day old larvae reared at 28 degrees C and fed at 1000 cells x ml(-1). The algae were Tetraselmis suecica, Tetraselmis chuii Isochrysis aff. galbana, Dunaliella tertiolecta, Chlamydomonas coccoides, Chaetoceros sp. and Thalassiosira fluviatilis. Ingestion and digestion were measured by the four nutritional stages studied with epifluorescence microscopy with live larvae. Temporal and absolute indices showed that larvae fed Chaetoceros sp. and T. fluviatilis had lower ingestion and digestion levels. The other algae are recommend to feed S. gigas larvae. PMID:15266796

  15. Feeding habits of Pacific cod larvae and juveniles in Mutsu Bay, Japan

    OpenAIRE

    Takatsu, Tetsuya; NAKATANI, Toshikuni; MUTOH, Takashi; Takahashi, Toyomi

    1995-01-01

    The diets and prey widths of Pacific cod (Gadus macrocephalus) larvae and juveniles were examined in Mutsu Bay. In early March, 11 yolk-sac larvae were caught in midwater of the bay mouth. Five of 11 larvae captured had not opened their mouths, and the remaining six had not fed. Post-larvae ≤ 7mm in total length (TL) fed on copepod nauplii, particularly Pseudocalanus nauplii. Prey items of post-larvae >7mm TL were chiefly crustacean eggs, and Pseudocalanus spp. copepodites and adults. From Ap...

  16. Reduction of muscle larvae burden in rats experimentally infected with Trichinella spiralis

    Directory of Open Access Journals (Sweden)

    Machnicka-Rowinska B.

    2001-06-01

    Full Text Available In Wistar rats infected with 500 to 2,500 Trichinella spiralis larvae the muscle larvae intensity (larvae per gram-l.p.g. was measured from 20 to 180 day post infection (d.p.i. The l.p.g. increased to day 40-50 p.i. and decreased thereafter. The highest reduction took place between 6 0 and 120 d.p.i. with intermediate inoculum of T. spiralis larvae. The mechanism of the reduction of T. spiralis larvae in muscles is suggested to depend on pericapsular-intercapsular host cells infiltrations attracted by parasite antigens.

  17. Starving honey bee (Apis mellifera) larvae signal pheromonally to worker bees

    Science.gov (United States)

    He, Xu Jiang; Zhang, Xue Chuan; Jiang, Wu Jun; Barron, Andrew B.; Zhang, Jian Hui; Zeng, Zhi Jiang

    2016-01-01

    Cooperative brood care is diagnostic of animal societies. This is particularly true for the advanced social insects, and the honey bee is the best understood of the insect societies. A brood pheromone signaling the presence of larvae in a bee colony has been characterised and well studied, but here we explored whether honey bee larvae actively signal their food needs pheromonally to workers. We show that starving honey bee larvae signal to workers via increased production of the volatile pheromone E-β-ocimene. Analysis of volatile pheromones produced by food-deprived and fed larvae with gas chromatography-mass spectrometry showed that starving larvae produced more E-β-ocimene. Behavioural analyses showed that adding E-β-ocimene to empty cells increased the number of worker visits to those cells, and similarly adding E-β-ocimene to larvae increased worker visitation rate to the larvae. RNA-seq and qRT-PCR analysis identified 3 genes in the E-β-ocimene biosynthetic pathway that were upregulated in larvae following 30 minutes of starvation, and these genes also upregulated in 2-day old larvae compared to 4-day old larvae (2-day old larvae produce the most E-β-ocimene). This identifies a pheromonal mechanism by which brood can beg for food from workers to influence the allocation of resources within the colony. PMID:26924295

  18. Enhanced ammonia content in compost leachate processed by black soldier fly larvae.

    Science.gov (United States)

    Green, Terrence R; Popa, Radu

    2012-03-01

    Black soldier fly (BSF) larvae (Hermetia illucens), feeding on leachate from decaying vegetable and food scrap waste, increase ammonia (NH (4) (+) ) concentration five- to sixfold relative to leachate unprocessed by larvae. NH (4) (+) in larva-processed leachate reached levels as high as ∼100 mM. Most of this NH (4) (+) appears to have come from organic nitrogen within the frass produced by the larvae as they fed on leachate. In nitrate-enriched solutions, BSF larvae also facilitate dissimilatory nitrate reduction to ammonia. The markedly higher concentration of NH (4) (+) recovered in leachates processed with BSF larvae and concomitant diversion of nutrients into insect biomass (itself a valuable feedstock) indicate that the use of BSF larvae in processing leachate of decaying organic waste could be advantageous in offsetting capital and environmental costs incurred in composting. PMID:22238016

  19. VISCERAL LARVA MIGRANS AND TROPICAL PYOMYOSITIS: A CASE REPORT

    Directory of Open Access Journals (Sweden)

    Roberto LAMBERTUCCI

    1998-11-01

    Full Text Available We report a case of tropical pyomyositis in a boy who presented with a severe febrile illness associated with diffuse erythema, and swelling in many areas of the body which revealed on operation extensive necrotic areas of various muscles that required repeated débridement. The patient gave a history of contact with dogs, and an ELISA test for Toxocara canis was positive. He also presented eosinophilia and high serum IgE levels. Staphylococcus aureus was the sole bacteria isolated from the muscles affected. We suggest that tropical pyomyositis may be caused by the presence of migrating larvae of this or other parasites in the muscles. The immunologic and structural alterations caused by the larvae, in the presence of concomitant bacteremia, would favour seeding of the bacteria and the development of pyomyositis.

  20. EFFICACY OF THAI NEEM OIL AGAINST AEDES AEGYPTI (L.) LARVAE.

    Science.gov (United States)

    Silapanuntakul, Suthep; Keanjoom, Romnalin; Pandii, Wongdyan; Boonchuen, Supawadee; Sombatsiri, Kwanchai

    2016-05-01

    Trees with larvicidal activity may be found in Thailand. We conducted this study to evaluate the efficacy and length of efficacy of Thai neem (Azadirachta siamensis) oil emulsion and an alginate bead of Thai neem oil formulation against early fourth stage Aedes aegypti larvae using a dipping test. The Thai neem oil emulsion had significantly greater larvicidal activity than the alginate bead formulation at 12 to 60 hours post-exposure (p neem oil formulation resulted in 100% mortality among the early fourth stage Aedes aegypti larvae at 48 hours, while the alginate bead formulation resulted in 98% larval mortality at 84 hours and 100% mortality at 96 hours. The mean larval mortality using the Thai neem oil emulsion dropped to < 25% by 12 days and with the alginate beads dropped to < 25% by 15 days of exposure.

  1. Microvascular system forming in skeletal muscle near trichinella larvae

    International Nuclear Information System (INIS)

    The fine structure and dynamics of formation of the microcirculatory system about the larvae of the two Trichinella species, providing for the rapid entry of nutrient substances to the larvae, were investigated in the muscles of white mice. Hitological, hitochemical, autoradiographic, and electron-microscopic methods were used in the investigation. At a certain period of the experiment, the greatest quantity of RNA was found in the endotheliocyte cytoplasm, tritium-thymidine label was incorporated into the nuclei, and mitoses were visible. The transition to tissue parasitism was accompanied by a complication of the relationships with the host and the formation of a more complex independent microcirculatory system, which ensures a more intensive influx of blood

  2. Identification of common excitatory motoneurons in Drosophila melanogaster larvae.

    Science.gov (United States)

    Takizawa, Eiji; Komatsu, Akira; Tsujimura, Hidenobu

    2007-05-01

    In insects, four types of motoneurons have long been known, including fast motoneurons, slow motoneurons, common inhibitory motoneurons, and DUM neurons. They innervate the same muscle and control its contraction together. Recent studies in Drosophila have suggested the existence of another type of motoneuron, the common excitatory motoneuron. Here, we found that shakB-GAL4 produced by labels this type of motoneuron in Drosophila larvae. We found that Drosophila larvae have two common excitatory motoneurons in each abdominal segment, RP2 for dorsal muscles and MNSNb/d-Is for ventral muscles. They innervate most of the internal longitudinal or oblique muscles on the dorsal or ventral body wall with type-Is terminals and use glutamate as a transmitter. Electrophysiological recording indicated that stimulation of the RP2 axon evoked excitatory junctional potential in a dorsal muscle. PMID:17867850

  3. EFFICACY OF THAI NEEM OIL AGAINST AEDES AEGYPTI (L.) LARVAE.

    Science.gov (United States)

    Silapanuntakul, Suthep; Keanjoom, Romnalin; Pandii, Wongdyan; Boonchuen, Supawadee; Sombatsiri, Kwanchai

    2016-05-01

    Trees with larvicidal activity may be found in Thailand. We conducted this study to evaluate the efficacy and length of efficacy of Thai neem (Azadirachta siamensis) oil emulsion and an alginate bead of Thai neem oil formulation against early fourth stage Aedes aegypti larvae using a dipping test. The Thai neem oil emulsion had significantly greater larvicidal activity than the alginate bead formulation at 12 to 60 hours post-exposure (p Aedes aegypti larvae at 48 hours, while the alginate bead formulation resulted in 98% larval mortality at 84 hours and 100% mortality at 96 hours. The mean larval mortality using the Thai neem oil emulsion dropped to < 25% by 12 days and with the alginate beads dropped to < 25% by 15 days of exposure. PMID:27405123

  4. Dual RNA-seq of parasite and host reveals gene expression dynamics during filarial worm-mosquito interactions.

    Directory of Open Access Journals (Sweden)

    Young-Jun Choi

    2014-05-01

    Full Text Available BACKGROUND: Parasite biology, by its very nature, cannot be understood without integrating it with that of the host, nor can the host response be adequately explained without considering the activity of the parasite. However, due to experimental limitations, molecular studies of parasite-host systems have been predominantly one-sided investigations focusing on either of the partners involved. Here, we conducted a dual RNA-seq time course analysis of filarial worm parasite and host mosquito to better understand the parasite processes underlying development in and interaction with the host tissue, from the establishment of infection to the development of infective-stage larva. METHODOLOGY/PRINCIPAL FINDINGS: Using the Brugia malayi-Aedes aegypti system, we report parasite gene transcription dynamics, which exhibited a highly ordered developmental program consisting of a series of cyclical and state-transitioning temporal patterns. In addition, we contextualized these parasite data in relation to the concurrent dynamics of the host transcriptome. Comparative analyses using uninfected tissues and different host strains revealed the influence of parasite development on host gene transcription as well as the influence of the host environment on parasite gene transcription. We also critically evaluated the life-cycle transcriptome of B. malayi by comparing developmental stages in the mosquito relative to those in the mammalian host, providing insight into gene expression changes underpinning the mosquito-borne parasitic lifestyle of this heteroxenous parasite. CONCLUSIONS/SIGNIFICANCE: The data presented herein provide the research community with information to design wet lab experiments and select candidates for future study to more fully dissect the whole set of molecular interactions of both organisms in this mosquito-filarial worm symbiotic relationship. Furthermore, characterization of the transcriptional program over the complete life cycle of

  5. Utilization of computer processed high definition video imaging for measuring motility of microscopic nematode stages on a quantitative scale: “The Worminator”

    Directory of Open Access Journals (Sweden)

    Bob Storey

    2014-12-01

    Full Text Available A major hindrance to evaluating nematode populations for anthelmintic resistance, as well as for screening existing drugs, new compounds, or bioactive plant extracts for anthelmintic properties, is the lack of an efficient, objective, and reproducible in vitro assay that is adaptable to multiple life stages and parasite genera. To address this need we have developed the “Worminator” system, which objectively and quantitatively measures the motility of microscopic stages of parasitic nematodes. The system is built around the computer application “WormAssay”, developed at the Center for Discovery and Innovation in Parasitic Diseases at the University of California, San Francisco. WormAssay was designed to assess motility of macroscopic parasites for the purpose of high throughput screening of potential anthelmintic compounds, utilizing high definition video as an input to assess motion of adult stage (macroscopic parasites (e.g. Brugia malayi. We adapted this assay for use with microscopic parasites by modifying the software to support a full frame analysis mode that applies the motion algorithm to the entire video frame. Thus, the motility of all parasites in a given well are recorded and measured simultaneously. Assays performed on third-stage larvae (L3 of the bovine intestinal nematode Cooperia spp., as well as microfilariae (mf of the filarioid nematodes B. malayi and Dirofilaria immitis, yielded reproducible dose responses using the macrocyclic lactones ivermectin, doramectin, and moxidectin, as well as the nicotinic agonists, pyrantel, oxantel, morantel, and tribendimidine. This new computer based-assay is simple to use, requires minimal new investment in equipment, is robust across nematode genera and developmental stage, and does not require subjective scoring of motility by an observer. Thus, the “Worminator” provides a relatively low-cost platform for developing genera- and stage-specific assays with high efficiency and

  6. Effects of dietary vitamin C on fish and crustacean larvae

    OpenAIRE

    Merchie, G.; Lavens, P.; Sorgeloos, P.

    1995-01-01

    In order to assess the dietary needs for ascorbic acid (AA) at startfeeding, the AA content in the various live diets currently applied in aquaculture (algae, rotifers, Artemia ) was studied. Application of boosting techniques using ascorbyl palmitate (AP) as the vitamin C source enabled the transfer of elevated levels of bioactive vitamin C (up to 2500µg AA.g DW-1) via the live food chain into larvae of fish (Clarias gariepinus, Dicentrarchus labrax, Scophthalmus maximus), shrimp (Pennaeus v...

  7. Monarch larvae sensitivity to Bacillus thuringiensis- purified proteins and pollen

    OpenAIRE

    Hellmich, Richard L; Blair D Siegfried; Sears, Mark K.; Stanley-Horn, Diane E.; Daniels, Michael J.; Mattila, Heather R.; Spencer, Terrence; Bidne, Keith G.; Lewis, Leslie C.

    2001-01-01

    Laboratory tests were conducted to establish the relative toxicity of Bacillus thuringiensis (Bt) toxins and pollen from Bt corn to monarch larvae. Toxins tested included Cry1Ab, Cry1Ac, Cry9C, and Cry1F. Three methods were used: (i) purified toxins incorporated into artificial diet, (ii) pollen collected from Bt corn hybrids applied directly to milkweed leaf discs, and (iii) Bt pollen contaminated with corn tassel material applied directly to milkweed leaf discs. Bioassays of purified Bt tox...

  8. CHIRONOMUS PLUMOSUS LARVAE - A SUITABLE NUTRIENT FOR FRESHWATER FARMED FISH

    OpenAIRE

    Valentina Rajković; Zdeněk Adámek; Elizabeta Has-Schön; Ivan Bogut; Dalida Galović

    2007-01-01

    Crude protein, fat, water, ash, dry matter and essential amino and fatty acids were analyzed from freshly collected Chironomus plumosus larvae in order to evaluate their suitability as a component for farmed fish diet. The analyses were performed in intact living organisms and in the dry matter. Essential amino acidswere determined by LKB 4101 automatic analyzer, while fatty acids were determined by Chronopack CP 9000 chromatograph with flame ionization detector. Crude protein content was...

  9. Acanthocephala Larvae parasitizing Ameiva ameiva ameiva (Linnaeus, 1758) (Squamata: Teiidae)

    OpenAIRE

    Lilian Cristina Macedo; Francisco Tiago de Vasconcelos Melo; Teresa Cristina Sauer Ávila-Pires; Elane Guerreiro Giese; Jeannie Nascimento dos Santos

    2016-01-01

    Abstract Knowledge concerning the taxonomy and biology of species of Acanthocephala, helminth parasites of the helminth species of the phylum Acanthocephala, parasites of lizards in Brazilian Amazonia, is still insufficient, but reports of Acanthocephala in reptiles are becoming increasingly common in the literature. Cystacanth-stage Acanthocephalan larvae have been found in the visceral peritoneum during necropsy of Ameiva ameiva ameivalizards from the “Osvaldo Rodrigues da Cunha” Herpetolog...

  10. Odour avoidance learning in the larva of Drosophila melanogaster

    Indian Academy of Sciences (India)

    Sukant Khurana; Mohammed Bin AbuBaker; Obaid Siddiqi

    2009-10-01

    Drosophila larvae can be trained to avoid odours associated with electric shock. We describe here, an improved method of aversive conditioning and a procedure for decomposing learning retention curve that enables us to do a quantitative analysis of memory phases, short term (STM), middle term (MTM) and long term (LTM) as a function of training cycles. The same method of analysis when applied to learning mutants dunce, amnesiac, rutabaga and radish reveals memory deficits characteristic of the mutant strains.

  11. Larva currens in a case of Organophosphorous poisoning

    Directory of Open Access Journals (Sweden)

    Rao D

    2006-01-01

    Full Text Available A 20-year-old healthy farmer consumed organophosphorous poison. On third day he developed diarrhoea and on fourth day linear serpiginous ulcers appeared on both buttocks. Clinically lesions were considered as decubitus ulcers. By stool examination and other laboratory investigations it was diagnosed as cutaneous larva currens due to S trongyloides stercoralis in a case of organophosphorus poisoning. Patient responded very well to a course of albendazole.

  12. Maya Index and Larva Density Aedes Aegypti Toward Dengue Infection

    Directory of Open Access Journals (Sweden)

    Sang G. Purnama

    2012-12-01

    Full Text Available South Denpasar District was of there as with the highest dengue cases in Bali province. The number of mosquito breeding places and larvae density become risk factor that influenced the spreading of mosquitoes. Maya index was an indicator to measure the amount of waterreservoirs can be breeding places for mosquitoes. Knowing the relationship between maya index and density of larvae and pupae of Ae.aegypti toward dengue infection in South Denpasar District. The study was observational analytic with case-control design. Data was collected through interviews and field observations to 150 respondents. The survey entomologist with indicators maya index, house index (HI, container index (CI, breteau index (BI and pupa index (PI to see the density of larvae and pupae in survey area. Dengue transmission risk was categorized mild, moderate and severe based on density figure. Water storage containers inspected in 1215 containers that as many as 675 containers in the case and 540 containers in control. Water reservoirs (TPA that the most larvae was tub (29.27%, dispenser (18.29%, container tirta (10.98%, wells (10.98%. Maya index status was lower in the case (24% smaller thancontrols (37.33%. Value of HI = 23.33; CI=10.69; BI=55; PI=15.33. Based on HI and CI indicator South Denpasar District means have moderate the risk of transmission spread of dengue disease. Based on the BI, have a high risk of transmission to the spread of dengue disease. Based on the maya index showed house cases have highest risk as breeding place compare than control house. House index, Breteau index, container index, pupa index and maya index have correlation with dengue infection. Kind of breeding place have the high risk is bath tub

  13. DINAMIKA LARVA IKAN SEBAGAI DASAR OPSI PENGELOLAAN SUMBER DAYA IKAN DI LAGUNA PULAU PARI KEPULAUAN SERIBU

    Directory of Open Access Journals (Sweden)

    Reny Puspasari

    2013-05-01

    Full Text Available Proses rekruitmen populasi ikan sangat ditentukan oleh kelangsungan hidup larva ikan yang ada di daerah pemijahan/asuhan. Laguna Pulau Pari merupakan daerah pemjahan bagi banyak jenis larva ikan karang. Tujuan dari penelitian ini adalah untuk mengkaji dinamika kelimpahan dan komposisi dari larva ikan di laguna Pulau Pari. Hasil penelitian menunjukkan bahwa kelimpahan larva ikan yang ditemukan berkisar antara 1,0 x103 – 14,7 x 103 individu/m3. Puncak kelimpahan tertinggi terjadi pada bulan Juli dan Oktober. Larva ikan ditemukan tersebar di semua lokasi pengamatan. Larva pada fase perkembangan pre flexion ditemukan dalam presentase yang paling tinggi. Selama masa pengamatan ditemukan 79 famili larva ikan yang didominasi oleh Pomacentridae, Aulostomidae, Blenniidae, Engraulidae dan Pinguipedidae. Dinamika yang terjadi pada larva ikan dapat dijadikan dasar bagi pengelolaan perikanan di wilayah Laguna Pulau Pari dengan cara memperluas daerah perlindungan laut dan rehabilitasi ekosistem Laguna Pulau Pari, sehingga peran dan fungsinya sebagai pemasok rekrut bagi stok ikan di perairan sekitarnya terjaga.   Fish Recruitment is, in turn, thought to be directly related to the survival of the early life stages in the spawning/nursery ground. Pulau Pari Laguna is considered as a spawning ground for many reef fishes. The aims of the research were to investigate the dynamic of abundance and composition of fish larvae in Pulau Pari lagune. The Results show, fish larvae abundance range between 1,0 x 103 – 14,7 x 103 ind/m3. Highest larval abundance occurred on July and October, which predicted as the month of fish larvae production seasons. Fish larvae were distributed in all part of the lagune. Larvae in the pre flexion stage found in the highest precentation compare to other. Totally 79 families of reef fish larvae were found during June – November 2010 dominated by Pomacentridae, Aulostomidae, Blenniidae, Engraulidae and Pinguipedidae.

  14. The larva of Drusus vinconi Sipahiler, 1992 (Trichoptera, Limnephilidae, Drusinae

    Directory of Open Access Journals (Sweden)

    Johann Waringer

    2013-07-01

    Full Text Available This paper describes the previously unknown larva of Drusus vinconi Sipahiler, 1992. Information on the morphology of the 5th larval instar is given, and the most important diagnostic features are illustrated. In the context of existing identification keys the larva of D. vinconi keys together with D. annulatus (Stephens, 1837, D. biguttatus (Pictet, 1834, D. ingridae Sipahiler, 1993, Hadimina torosensis Sipahiler, 2002 and Leptodrusus budtzi (Ulmer, 1913. These species differ in the contours of the pronotum in lateral view, the presence/absence of the pronotal transverse groove, the shape of the median notch of the pronotum (in anterior view, pronotal sculpturing, presence/absence of the lateral carina of the head capsule, the number of proximo-dorsal setae on the mid-and hind femora, where the lateral fringe starts on the abdomen, and in geographic distribution. With respect to zoogeography, Drusus vinconi is a (micro-endemic of the Western Pyrenees. The species prefers stony substratum in springs and springbrooks of the montane and subalpine region (Graf et al. 2008; Sipahiler 1992, 1993. As a grazer, the larvae of D. vinconi feed on biofilm and epilithic algae.

  15. Using black soldier fly larvae for processing organic leachates.

    Science.gov (United States)

    Popa, Radu; Green, Terrence R

    2012-04-01

    A large number of biodegradable byproducts including alcohols, soluble saccharides, volatile organic acids, and amines accumulate in the liquid fraction (leachate) produced as vegetal and food scrap waste decomposes. Untreated leachate, because it is rich in nutrients and organic byproducts, has a high chemical oxygen demand and is normally cleared of soluble organic byproducts by mineralization before its discharge into waterways. Mineralizing leachates using chemical and microbial biotechnologies is, however, a lengthy and costly process. We report here that the larvae of the black soldier fly Hermetia illucens (L.) (Diptera: Stratiomyidae), an insect rich in protein and lipids, and having significant commercial value, while feeding and growing off of compost leachate, lowers its chemical oxygen demand relative to that of leachate unexposed to larvae, neutralizes its acidity, and clears it of volatile organic acids, amines, and alcohols. These observations demonstrate that black soldier fly larvae could be used to help offset the cost and clean up of organic solutes in leachate waste streams while recycling carbon, nitrogen, and phosphate into usable and commercially valuable biomass. PMID:22606806

  16. Toxic dinoflagellates and Vibrio spp. act independently in bivalve larvae.

    Science.gov (United States)

    De Rijcke, M; Van Acker, E; Nevejan, N; De Schamphelaere, K A C; Janssen, C R

    2016-10-01

    Harmful algal blooms (HABs) and marine pathogens - like Vibrio spp. - are increasingly common due to climate change. These stressors affect the growth, viability and development of bivalve larvae. Little is known, however, about the potential for interactions between these two concurrent stressors. While some mixed exposures have been performed with adult bivalves, no such work has been done with larvae which are generally more sensitive. This study examines whether dinoflagellates and bacteria may interactively affect the viability and immunological resilience of blue mussel Mytilus edulis larvae. Embryos were exposed to environmentally relevant concentrations (100, 500, 2500 & 12,500 cells ml(-1)) of a dinoflagellate (Alexandrium minutum, Alexandrium ostenfeldii, Karenia mikimotoi, Protoceratium reticulatum, Prorocentrum cordatum, P. lima or P. micans), a known pathogen (Vibrio coralliilyticus/neptunius-like isolate or Vibrio splendidus; 10(5) CFU ml(-1)), or both. After five days of exposure, significant (p < 0.05) adverse effects on larval viability and larval development were found for all dinoflagellates (except P. cordatum) and V. splendidus. Yet, despite the individual effect of each stressor, no significant interactions were found between the pathogens and harmful algae. The larval viability and the phenoloxidase innate immune system responded independently to each stressor. This independence may be related to a differential timing of the effects of HABs and pathogens. PMID:27554394

  17. Toxic dinoflagellates and Vibrio spp. act independently in bivalve larvae.

    Science.gov (United States)

    De Rijcke, M; Van Acker, E; Nevejan, N; De Schamphelaere, K A C; Janssen, C R

    2016-10-01

    Harmful algal blooms (HABs) and marine pathogens - like Vibrio spp. - are increasingly common due to climate change. These stressors affect the growth, viability and development of bivalve larvae. Little is known, however, about the potential for interactions between these two concurrent stressors. While some mixed exposures have been performed with adult bivalves, no such work has been done with larvae which are generally more sensitive. This study examines whether dinoflagellates and bacteria may interactively affect the viability and immunological resilience of blue mussel Mytilus edulis larvae. Embryos were exposed to environmentally relevant concentrations (100, 500, 2500 & 12,500 cells ml(-1)) of a dinoflagellate (Alexandrium minutum, Alexandrium ostenfeldii, Karenia mikimotoi, Protoceratium reticulatum, Prorocentrum cordatum, P. lima or P. micans), a known pathogen (Vibrio coralliilyticus/neptunius-like isolate or Vibrio splendidus; 10(5) CFU ml(-1)), or both. After five days of exposure, significant (p larval viability and larval development were found for all dinoflagellates (except P. cordatum) and V. splendidus. Yet, despite the individual effect of each stressor, no significant interactions were found between the pathogens and harmful algae. The larval viability and the phenoloxidase innate immune system responded independently to each stressor. This independence may be related to a differential timing of the effects of HABs and pathogens.

  18. Monarch larvae sensitivity to Bacillus thuringiensis- purified proteins and pollen.

    Science.gov (United States)

    Hellmich, R L; Siegfried, B D; Sears, M K; Stanley-Horn, D E; Daniels, M J; Mattila, H R; Spencer, T; Bidne, K G; Lewis, L C

    2001-10-01

    Laboratory tests were conducted to establish the relative toxicity of Bacillus thuringiensis (Bt) toxins and pollen from Bt corn to monarch larvae. Toxins tested included Cry1Ab, Cry1Ac, Cry9C, and Cry1F. Three methods were used: (i) purified toxins incorporated into artificial diet, (ii) pollen collected from Bt corn hybrids applied directly to milkweed leaf discs, and (iii) Bt pollen contaminated with corn tassel material applied directly to milkweed leaf discs. Bioassays of purified Bt toxins indicate that Cry9C and Cry1F proteins are relatively nontoxic to monarch first instars, whereas first instars are sensitive to Cry1Ab and Cry1Ac proteins. Older instars were 12 to 23 times less susceptible to Cry1Ab toxin compared with first instars. Pollen bioassays suggest that pollen contaminants, an artifact of pollen processing, can dramatically influence larval survival and weight gains and produce spurious results. The only transgenic corn pollen that consistently affected monarch larvae was from Cry1Ab event 176 hybrids, currently corn planted and for which re-registration has not been applied. Results from the other types of Bt corn suggest that pollen from the Cry1Ab (events Bt11 and Mon810) and Cry1F, and experimental Cry9C hybrids, will have no acute effects on monarch butterfly larvae in field settings. PMID:11559841

  19. Observations of cocooned Hydrobaenus (Diptera: Chironomidae) larvae in Lake Michigan

    Science.gov (United States)

    Tucker, Taaja R.; Hudson, Patrick L.; Riley, Stephen

    2016-01-01

    Larvae of the family Chironomidae have developed a variety of ways to tolerate environmental stress, including the formation of cocoons, which allows larvae to avoid unfavorable temperature conditions, drought, or competition with other chironomids. Summer cocoon formation by younger instars of the genus Hydrobaenus Fries allows persistence through increased temperatures and/or intermittent dry periods in arid regions or temporary habitats, but this behavior was not observed in the Great Lakes until the current study. Cocoon-aestivating Hydrobaenus sp. larvae were found in benthic grab samples collected in 2010–2013 near Sleeping Bear Dunes National Lakeshore in northern Lake Michigan with densities up to 7329/m2. The aestivating species was identified as Hydrobaenus johannseni (Sublette, 1967), and the associated chironomid community was typical for an oligotrophic nearshore system. Hydrobaenus cocoon formation in the Great Lakes was likely previously unnoticed due to the discrepancies between the genus' life history and typical benthos sampling procedures which has consequences for describing chironomid communities where Hydrobaenus is present.

  20. Chlorpyrifos-induced toxicity in Duttaphrynus melanostictus (Schneider 1799) larvae.

    Science.gov (United States)

    Wijesinghe, M R; Bandara, M G D K; Ratnasooriya, W D; Lakraj, G P

    2011-05-01

    This study investigates the effects of continuous exposure to a widely used organophosphate pesticide, chlorpyrifos, on survival, growth, development, and activity of larvae of the Asian common toad, Duttaphrynus melanostictus Schneider 1799. Larvae were continuously exposed to six different concentrations (1-1,500 μg l(-1)) of commercial-grade chlorpyrifos for 14 days and monitored for 1 additional week. Chlorpyrifos at ≥1,000 μg l(-1) caused significantly high and dose-dependent mortality, and the weekly LC50(7 day-21 day) values ranged from 3,003 to 462 μg l(-1). Larvae surviving exposure to ≥500 μg l(-1) chlorpyrifos showed significant growth impairment, delays in metamorphosis, and decreased swimming activity. Tail abnormalities were the most common morphologic deformity at concentrations of 1,000 and 1,500 μg l(-1) chlorpyrifos. The findings of the present study highlight the need to recognize the potential risk that agrochemicals pose to amphibians inhabiting agricultural landscapes in Sri Lanka and other Asian countries. PMID:20669016

  1. Ingestion of Nanoplastics and Microplastics by Pacific Oyster Larvae.

    Science.gov (United States)

    Cole, Matthew; Galloway, Tamara S

    2015-12-15

    Plastic debris is a prolific contaminant effecting freshwater and marine ecosystems across the globe. Of growing environmental concern are "microplastics"and "nanoplastics" encompassing tiny particles of plastic derived from manufacturing and macroplastic fragmentation. Pelagic zooplankton are susceptible to consuming microplastics, however the threat posed to larvae of commercially important bivalves is currently unknown. We exposed Pacific oyster (Crassostrea gigas) larvae (3-24 d.p.f.) to polystyrene particles spanning 70 nm-20 μm in size, including plastics with differing surface properties, and tested the impact of microplastics on larval feeding and growth. The frequency and magnitude of plastic ingestion over 24 h varied by larval age and size of polystyrene particle (ANOVA, P plastic, with aminated particles ingested and retained more frequently (ANOVA, P plastic consumption and plastic load per organism was identified (Spearmans, r = 0.95, P plastic concentrations exceeding those observed in the marine environment resulted in no measurable effects on the development or feeding capacity of the larvae over the duration of the study. PMID:26580574

  2. Probiotic legacy effects on gut microbial assembly in tilapia larvae

    Science.gov (United States)

    Giatsis, Christos; Sipkema, Detmer; Ramiro-Garcia, Javier; Bacanu, Gianina M.; Abernathy, Jason; Verreth, Johan; Smidt, Hauke; Verdegem, Marc

    2016-01-01

    The exposure of fish to environmental free-living microbes and its effect on early colonization in the gut have been studied in recent years. However, little is known regarding how the host and environment interact to shape gut communities during early life. Here, we tested whether the early microbial exposure of tilapia larvae affects the gut microbiota at later life stages. The experimental period was divided into three stages: axenic, probiotic and active suspension. Axenic tilapia larvae were reared either under conventional conditions (active suspension systems) or exposed to a single strain probiotic (Bacillus subtilis) added to the water. Microbial characterization by Illumina HiSeq sequencing of 16S rRNA gene amplicons showed the presence of B. subtilis in the gut during the seven days of probiotic application. Although B. subtilis was no longer detected in the guts of fish exposed to the probiotic after day 7, gut microbiota of the exposed tilapia larvae remained significantly different from that of the control treatment. Compared with the control, fish gut microbiota under probiotic treatment was less affected by spatial differences resulting from tank replication, suggesting that the early probiotic contact contributed to the subsequent observation of low inter-individual variation. PMID:27670882

  3. Olfactory coding in Drosophila larvae investigated by cross-adaptation.

    Science.gov (United States)

    Boyle, Jennefer; Cobb, Matthew

    2005-09-01

    In order to reveal aspects of olfactory coding, the effects of sensory adaptation on the olfactory responses of first-instar Drosophila melanogaster larvae were tested. Larvae were pre-stimulated with a homologous series of acetic esters (C3-C9), and their responses to each of these odours were then measured. The overall patterns suggested that methyl acetate has no specific pathway but was detected by all the sensory pathways studied here, that butyl and pentyl acetate tended to have similar effects to each other and that hexyl acetate was processed separately from the other odours. In a number of cases, cross-adaptation transformed a control attractive response into a repulsive response; in no case was an increase in attractiveness observed. This was investigated by studying changes in dose-response curves following pre-stimulation. These findings are discussed in light of the possible intra- and intercellular mechanisms of adaptation and the advantage of altered sensitivity for the larva. PMID:16155221

  4. Morphological and behavioral development of the piracanjuba larvae Desenvolvimento morfológico e comportamental de larvas de piracanjuba

    Directory of Open Access Journals (Sweden)

    Cláudia Maria Reis Raposo Maciel

    2010-05-01

    Full Text Available The objective of this work was to study the morphologic development and the swimming and feeding behaviors of piracanjuba larvae, Brycon orbignyanus Valenciennes (1849 (Characiformes, Characidae, Bryconinae, during the period from zero to 172 hours after hatching (standard length = 3.62 - 11.94 mm. The morphological analyses were accomplished by using a trinocular stereo microscope, while the behavioral analyses were performed through periodic observations. In 28 hours after hatching, the larvae (standard length = 6.25 ± 0.13 mm showed the following structural and behavioral characteristics that made them become active predators able to overcome a larval critical phase, the beginning of exogenous feeding: presence of pigmented eyes, terminal and wide mouth, developed oral dentition, developing digestive tube, yolk sac reduction, fins and swim bladder formation, horizontal swimming, cannibalism, and predation. Intense cannibalism among larvae was verified from 26 to 72 hours. At the end of the metamorphosis - 172 hours after hatching - the larvae measuring 11.94 + 0.80 mm in standard length presented a flexed notochord, caudal fin bifurcation, dorsal and anal fin formation, synchronized movements, and formation of shoals, characteristics that together allow enhanced perception and locomotio in exploration of the environment, determining the best moment for transfering to the fishponds. New studies can contribute to commercial fish farming by improving feeding management, performance, survival, and productivity of this species.Objetivou-se estudar o desenvolvimento morfológico e os comportamentos natatório e alimentar de larvas de piracanjuba, Brycon orbignyanus Valenciennes (1849 (Characiformes, Characidae, Bryconinae no período de 0 a 172 horas após a eclosão (comprimento-padrão = 3,62 - 11,94 mm. As análises morfológicas foram realizadas com auxílio de um microscópio estereoscópico trinocular e as comportamentais, por meio de

  5. Mananoligossacarídeo em dietas para larvas de tilápia Mannanoligosaccharides in diets for tilapia larvae

    Directory of Open Access Journals (Sweden)

    Kátia Kalko Schwarz

    2011-12-01

    Full Text Available Este experimento foi realizado para avaliar níveis crescentes de mananoligossacarídeo (MOS na dieta de larvas de tilápias-do-nilo (linhagem Supreme® na fase de reversão sexual durante 30 dias. Larvas de tilápia-do-nilo (n=1500, P=0,01 g ± 0,001 g foram distribuídas aleatoriamente em 30 tanques de 100 litros. Os peixes foram distribuídos em delineamento inteiramente casualizado, composto por seis tratamentos e cinco repetições. A dieta controle (isenta de MOS foi elaborada para conter aproximadamente 35% de proteína bruta e 3.100 kcal de ED/kg. As demais foram suplementadas com 0; 0,15; 0,30; 0,45; 0,60 e 0,75% de MOS em substituição ao milho da dieta controle. Com o aumento nos níveis de MOS nas dietas, foi observado aumento linear sobre o comprimento do intestino, a altura das vilosidades intestinais e a densidade dos vilos. Não houve diferença na composição corporal, no ganho em peso, no peso final, no comprimento final, no fator de condição, na taxa de sobrevivência e no número de células caliciformes do intestino das larvas. Os níveis de MOS tiveram efeito quadrático sobre a conversão alimentar, cujos melhores resultados foram obtidos com 0,34% de MOS. A utilização de MOS no nível de 0,34% em dietas para larvas de tilápia-do-nilo melhora a conversão alimentar e promove aumento do comprimento do intestino, da altura das vilosidades e da densidade de vilos intestinal.This experiment was conducted to evaluate increasing levels of mannanoligosaccharides (MOS in the diet of Nile tilapia larvae (Supreme® at the sex reversal stage for 30 days. Nile tilapia larvae (n = 1500, p = 0.01 ± 0.001 g, were randomly distributed in 30 tanks of 100 liters each, for 30 days. The fish were distributed in a randomized design with six treatments and five replicates. The control diet (no MOS was elaborated to contain approximately 35% of crude protein and 3,100 kcal DE/kg. Mannanoligosaccharides were included in the other diets

  6. Transcriptional responses in Honey Bee larvae infected with chalkbrood fungus

    Directory of Open Access Journals (Sweden)

    Murray Keith D

    2010-06-01

    Full Text Available Abstract Background Diseases and other stress factors working synergistically weaken honey bee health and may play a major role in the losses of bee populations in recent years. Among a large number of bee diseases, chalkbrood has been on the rise. We present here the experimental identification of honey bee genes that are differentially expressed in response to infection of honey bee larvae with the chalkbrood fungus, Ascosphaera apis. Results We used cDNA-AFLP ®Technology to profile transcripts in infected and uninfected bee larvae. From 64 primer combinations, over 7,400 transcriptionally-derived fragments were obtained A total of 98 reproducible polymorphic cDNA-AFLP fragments were excised and sequenced, followed by quantitative real-time RT-PCR (qRT-PCR analysis of these and additional samples. We have identified a number of differentially-regulated transcripts that are implicated in general mechanisms of stress adaptation, including energy metabolism and protein transport. One of the most interesting differentially-regulated transcripts is for a chitinase-like enzyme that may be linked to anti-fungal activities in the honey bee larvae, similarly to gut and fat-body specific chitinases found in mosquitoes and the red flour beetle. Surprisingly, we did not find many components of the well-characterized NF-κB intracellular signaling pathways to be differentially-regulated using the cDNA-AFLP approach. Therefore, utilizing qRT-PCR, we probed some of the immune related genes to determine whether the lack of up-regulation of their transcripts in our analysis can be attributed to lack of immune activation or to limitations of the cDNA-AFLP approach. Conclusions Using a combination of cDNA-AFLP and qRT-PCR analyses, we were able to determine several key transcriptional events that constitute the overall effort in the honey bee larvae to fight natural fungal infection. Honey bee transcripts identified in this study are involved in critical

  7. Annual and spatial variability in endo- and ectoparasite infections of North Sea cod (Gadus morhua Linnaeus, 1758) larvae, post-larvae and juveniles

    DEFF Research Database (Denmark)

    Mehrdana, Foojan; Bahlool, Qusay Z. M.; Skovgaard, Alf;

    2014-01-01

    A parasitological investigation was performed on a total of 5380 Atlantic cod larvae, post-larvae and small juveniles sampled from the North Sea during a period of five years. The copepod Caligus elongatus (Von Nordmann, 1832) and the nematode Hysterothylacium aduncum (Rudolphi, 1802) were found...

  8. Exposure to lead induces hypoxia-like responses in bullfrog larvae (Rana catesbeiana)

    Energy Technology Data Exchange (ETDEWEB)

    Rice, T.M.; Blackstone, B.J.; Nixdorf, W.L.; Taylor, D.H.

    1999-10-01

    Amphibians collected around mining sites, areas with extensive automobile traffic, and shooting ranges have been documented to contain high levels of lead. Lead-exposed amphibians might respond as if in hypoxic conditions because exposure is known to decrease hemoglobin levels, damage erythrocytes, and alter respiratory surfaces. Therefore, the authors exposed bullfrog larvae to either 0 or 780 {micro}g/L Pb and either 3.50 or 7.85 mg/L oxygen for 7 d and monitored activity, trips to the surface, and buccal ventilation rates. Activity was significantly decreased in larvae exposed to low oxygen, Pb, or both compared to activity of larvae in high oxygen with no Pb. Larvae exposed to both Pb and low oxygen displayed higher buccal ventilation rates than larvae exposed to either treatment separately. Lead-exposed larvae surfaced significantly more often than unexposed larvae even under high-oxygen conditions. Lead-exposed larvae decreased in mass during the exposure period, whereas unexposed larvae increased in mass. Lead exposure could decrease survival of larvae in the field not only because of physiological problems due to decreased oxygen uptake but also because of greater predation pressure due to increased presence at the surface and reduced growth rates.

  9. Laboratory investigation of daily food intake and gut evacuation in larvae of African catfish Clarias gariepinus under different feeding conditions

    OpenAIRE

    García-Ortega, A.; Verreth, J.A.J.; Vermis, K.; Nelis, H J; Sorgeloos, P.; Verstegen, M.W.A.

    2010-01-01

    Abstract Temporary accumulation of ascorbic acid 2-sulfate (AAS) was measured to estimate food intake and gut evacuation in larvae of African catfish. Fish larvae were fed decapsulated cysts of Artemia containing AAS. In a first experiment it was found that no biosynthesis of AAS occurs in the larvae of this species. In a second experiment, the gut contents of the fish larvae fed were calculated as they changed during development. In a third experiment, the gut evacuation rate of fish larvae ...

  10. "Filarial dance sign" real-time ultrasound diagnosis of filarial oophoritis.

    Science.gov (United States)

    Panditi, Surekha; Shelke, Ashwini G; Thummalakunta, Laxmi Narasimha Praveen

    2016-10-01

    Filariasis is a parasitic disease caused by Filarial nematodes (Wuchereria bancrofti, Brugia malayi, and Brugia timori) that commonly causes lymphatic obstruction resulting in edema and increase in the size of the affected organ. Filariasis is diagnosed by identifying microfilariae on Giemsa stain. The immunochromatographic card test is diagnostic. Ultrasound is the imaging modality of choice for detecting adult filarial worms/microfilaria in the lymphatic system, which are responsible for the classic "filarial dance sign" caused by twirling movements of the microfilariae. © 2016 Wiley Periodicals, Inc. J Clin Ultrasound 44:500-501, 2016. PMID:27130361

  11. Natural hosts of the larvae of Nuttalliella sp. (N. namaqua? (Acari: Nuttalliellidae

    Directory of Open Access Journals (Sweden)

    Ivan G. Horak

    2012-02-01

    Full Text Available The first collection of unengorged and fully engorged larvae of Nuttalliella sp. (N. namaqua? from the murid rodents Micaelamys namaquensis, Aethomys chrysophilus and Acomys spinosissimus in Limpopo Province and from M. namaquensis in the Northern Cape Province, South Africa, is documented. A total of nine larvae were collected from two M. namaquensis in the Soutpansberg mountain range in the Limpopo Province during April 2009. During the last week of September 2011, 221 larvae were collected from rodents at the same locality and 10 of 48 M. namaquensis, 6 of 12 Ae. chrysophilus and 3 of 14 Ac. spinosissimus were infested. One of the M. namaquensis harboured 53 larvae. Five larvae were collected from two M. namaquensis in the Northern Cape Province. Total genomic DNA was extracted from two larvae and a region of the 18S rRNA gene was sequenced for these. BLASTn searches revealed similarity between these specimens and the Nuttalliella sequences published on GenBank.

  12. Cumulative mortality of Aedes aegypti larvae treated with compounds.

    Science.gov (United States)

    Torres, Sandra Maria; Cruz, Nadine Louise Nicolau da; Rolim, Vitor Pereira de Matos; Cavalcanti, Maria Inês de Assis; Alves, Leucio Câmara; Silva Júnior, Valdemiro Amaro da

    2014-06-01

    OBJECTIVE To evaluate the larvicidal activity of Azadirachta indica, Melaleuca alternifolia, carapa guianensis essential oils and fermented extract of Carica papaya against Aedes aegypti (Linnaeus, 1762) (Diptera: Culicidae). METHODS The larvicide test was performed in triplicate with 300 larvae for each experimental group using the third larval stage, which were exposed for 24h. The groups were: positive control with industrial larvicide (BTI) in concentrations of 0.37 ppm (PC1) and 0.06 ppm (PC2); treated with compounds of essential oils and fermented extract, 50.0% concentration (G1); treated with compounds of essential oils and fermented extract, 25.0% concentration (G2); treated with compounds of essential oils and fermented extract, 12.5% concentration (G3); and negative control group using water (NC1) and using dimethyl (NC2). The larvae were monitored every 60 min using direct visualization. RESULTS No mortality occurred in experimental groups NC1 and NC2 in the 24h exposure period, whereas there was 100% mortality in the PC1 and PC2 groups compared to NC1 and NC2. Mortality rates of 65.0%, 50.0% and 78.0% were observed in the groups G1, G2 and G3 respectively, compared with NC1 and NC2. CONCLUSIONS The association between three essential oils from Azadirachta indica, Melaleuca alternifolia, Carapa guianensis and fermented extract of Carica papaya was efficient at all concentrations. Therefore, it can be used in Aedes aegypti Liverpool third larvae stage control programs.

  13. Cumulative mortality of Aedes aegypti larvae treated with compounds

    Directory of Open Access Journals (Sweden)

    Sandra Maria Torres

    2014-06-01

    Full Text Available OBJECTIVE To evaluate the larvicidal activity of Azadirachta indica, Melaleuca alternifolia, carapa guianensis essential oils and fermented extract of Carica papaya against Aedes aegypti (Linnaeus, 1762 (Diptera: Culicidae. METHODS The larvicide test was performed in triplicate with 300 larvae for each experimental group using the third larval stage, which were exposed for 24h. The groups were: positive control with industrial larvicide (BTI in concentrations of 0.37 ppm (PC1 and 0.06 ppm (PC2; treated with compounds of essential oils and fermented extract, 50.0% concentration (G1; treated with compounds of essential oils and fermented extract, 25.0% concentration (G2; treated with compounds of essential oils and fermented extract, 12.5% concentration (G3; and negative control group using water (NC1 and using dimethyl (NC2. The larvae were monitored every 60 min using direct visualization. RESULTS No mortality occurred in experimental groups NC1 and NC2 in the 24h exposure period, whereas there was 100% mortality in the PC1 and PC2 groups compared to NC1 and NC2. Mortality rates of 65.0%, 50.0% and 78.0% were observed in the groups G1, G2 and G3 respectively, compared with NC1 and NC2. CONCLUSIONS The association between three essential oils from Azadirachta indica, Melaleuca alternifolia, Carapa guianensis and fermented extract of Carica papaya was efficient at all concentrations. Therefore, it can be used in Aedes aegypti Liverpool third larvae stage control programs.

  14. Cumulative mortality of Aedes aegypti larvae treated with compounds

    Science.gov (United States)

    Torres, Sandra Maria; da Cruz, Nadine Louise Nicolau; Rolim, Vitor Pereira de Matos; Cavalcanti, Maria Inês de Assis; Alves, Leucio Câmara; da Silva, Valdemiro Amaro

    2014-01-01

    OBJECTIVE To evaluate the larvicidal activity of Azadirachta indica, Melaleuca alternifolia, carapa guianensis essential oils and fermented extract of Carica papaya against Aedes aegypti (Linnaeus, 1762) (Diptera: Culicidae). METHODS The larvicide test was performed in triplicate with 300 larvae for each experimental group using the third larval stage, which were exposed for 24h. The groups were: positive control with industrial larvicide (BTI) in concentrations of 0.37 ppm (PC1) and 0.06 ppm (PC2); treated with compounds of essential oils and fermented extract, 50.0% concentration (G1); treated with compounds of essential oils and fermented extract, 25.0% concentration (G2); treated with compounds of essential oils and fermented extract, 12.5% concentration (G3); and negative control group using water (NC1) and using dimethyl (NC2). The larvae were monitored every 60 min using direct visualization. RESULTS No mortality occurred in experimental groups NC1 and NC2 in the 24h exposure period, whereas there was 100% mortality in the PC1 and PC2 groups compared to NC1 and NC2. Mortality rates of 65.0%, 50.0% and 78.0% were observed in the groups G1, G2 and G3 respectively, compared with NC1 and NC2. CONCLUSIONS The association between three essential oils from Azadirachta indica, Melaleuca alternifolia, Carapa guianensis and fermented extract of Carica papaya was efficient at all concentrations. Therefore, it can be used in Aedes aegypti Liverpool third larvae stage control programs. PMID:25119939

  15. Immunization with irradiated larvae against Dictyocaulus filaria in young lambs

    Energy Technology Data Exchange (ETDEWEB)

    Dhar, D.N.; Sharma, R.L.

    1981-12-01

    In the lungworm-endemic areas of Kashmir, 6-10 week old lambs of Karnah and Kashmir Merino breeds were vaccinated with two doses of 50 kR gamma-irradiated larvae of Dictyocaulus filaria, given a month apart. Assessed on the basis of reduced prevalence and significantly lower faecal larval output over an eight-month observation period, vaccinated lambs showed a high degree of resistance to naturally acquired D. filaria infection. The results also show that vaccination against D. filaria provided some degree of protection against infection with other lungworm species.

  16. Lobesia botrana larvae develop faster in the presence of parasitoids.

    Directory of Open Access Journals (Sweden)

    Fanny Vogelweith

    Full Text Available To combat parasitism hosts often rely on their immune system, which is the last line of defense. However, the immune system may not always be effective, and other non-immunological defenses might be favored to reduce the cost of parasite infection. Here we report that larvae of the moth Lobesia botrana can rapidly accelerate their development and reach maturity earlier in response to cues perceived at a distance from parasitoids. Such a phenotypically plastic life history shift, induced by the perception of deadly enemies in the environment, is likely to be an adaptive defensive strategy to prevent parasitoid attack, and has important implications in host-parasite dynamics.

  17. A linear model for the dynamics of fish larvae

    Directory of Open Access Journals (Sweden)

    Noureddine Ghouali

    2004-11-01

    Full Text Available We consider a linear model for the growth and the dispersion of fish larvae of certain species. Dispersion is modeled as entailed by the combination of transport and vertical diffusion. We generalize the work of Boushaba, Arino and Boussouar [5,6] in the sense that horizontal velocities are uniform throughout the water column; but we deal with vertical component velocity and vertical diffusion depending on the space variables and on time, which was not the case in [5,6]. This new vision leads us to non-autonomous problems, the aim of this work is to show the existence, uniqueness, and positivity of solutions.

  18. Drosophila melanogaster larvae make nutritional choices that minimize developmental time.

    Science.gov (United States)

    Rodrigues, Marisa A; Martins, Nelson E; Balancé, Lara F; Broom, Lara N; Dias, António J S; Fernandes, Ana Sofia D; Rodrigues, Fábio; Sucena, Élio; Mirth, Christen K

    2015-10-01

    Organisms from slime moulds to humans carefully regulate their macronutrient intake to optimize a wide range of life history characters including survival, stress resistance, and reproductive success. However, life history characters often differ in their response to nutrition, forcing organisms to make foraging decisions while balancing the trade-offs between these effects. To date, we have a limited understanding of how the nutritional environment shapes the relationship between life history characters and foraging decisions. To gain insight into the problem, we used a geometric framework for nutrition to assess how the protein and carbohydrate content of the larval diet affected key life history traits in the fruit fly, Drosophila melanogaster. In no-choice assays, survival from egg to pupae, female and male body size, and ovariole number - a proxy for female fecundity - were maximized at the highest protein to carbohydrate (P:C) ratio (1.5:1). In contrast, development time was minimized at intermediate P:C ratios, around 1:2. Next, we subjected larvae to two-choice tests to determine how they regulated their protein and carbohydrate intake in relation to these life history traits. Our results show that larvae targeted their consumption to P:C ratios that minimized development time. Finally, we examined whether adult females also chose to lay their eggs in the P:C ratios that minimized developmental time. Using a three-choice assay, we found that adult females preferentially laid their eggs in food P:C ratios that were suboptimal for all larval life history traits. Our results demonstrate that D. melanogaster larvae make foraging decisions that trade-off developmental time with body size, ovariole number, and survival. In addition, adult females make oviposition decisions that do not appear to benefit the larvae. We propose that these decisions may reflect the living nature of the larval nutritional environment in rotting fruit. These studies illustrate the

  19. Prospects, drawbacks and future needs of xenomonitoring for the endpoint evaluation of lymphatic filariasis elimination programs in Africa.

    Science.gov (United States)

    Okorie, Patricia N; de Souza, Dziedzom K

    2016-02-01

    Lymphatic filariasis (LF) is a debilitating disease caused by Wuchereria bancrofti, Brugia malayi and B. timori parasitic worms and transmitted by Culex, Anopheles, Aedes and Mansonia mosquitoes. Mass drug administration (MDA) to reduce the infection levels in the human population is the key component of LF elimination programs. However, the potential of the use of vector control is gaining recognition as a tool that can complement MDA. The method of monitoring the parasites in mosquito vectors is known as xenomonitoring. Monitoring of vectors for filarial larvae is an important assessment tool for LF elimination programs. Xenomonitoring has the advantage of giving a real-time estimate of disease, because the pre-patent period may take months after infection in humans. It is a non-invasive sensitive tool for assessing the presence of LF in endemic areas. The aim of this review is to discuss the prospects, challenges and needs of xenomonitoring as a public health tool, in the post-MDA evaluation activities of national LF elimination programs. PMID:26822601

  20. Tandem antioxidant enzymes confer synergistic protective responses in experimental filariasis.

    Science.gov (United States)

    Prince, P R; Madhumathi, J; Anugraha, G; Jeyaprita, P J; Reddy, M V R; Kaliraj, P

    2014-12-01

    Helminth parasites use antioxidant defence strategies for survival during oxidative stress due to free radicals in the host. Accordingly, tissue-dwelling filarial parasites counteract host responses by releasing a number of antioxidants. Targeting these redox regulation proteins together, would facilitate effective parasite clearance. Here, we report the combined effect of protective immune responses trigged by recombinant Wuchereria bancrofti thioredoxin (WbTRX) and thioredoxin peroxidase (WbTPX) in an experimental filarial model. The expression of WbTRX and WbTPX in different stages of the parasite and their cross-reactivity were analysed by enzyme-linked immunosorbent assay (ELISA). The immunogenicity of recombinant proteins and their protective efficacy were studied in animal models when immunized in single or cocktail mode. The antigens showed cross-reactive epitopes and induced high humoral and cellular immune responses in mice. Further, parasite challenge against Brugia malayi L3 larvae in Mastomys coucha conferred significant protection of 57% and 62% against WbTRX and WbTPX respectively. The efficacy of L3 clearance was significantly higher (71%) (P filariasis.

  1. Chimeric Epitope Vaccine from Multistage Antigens for Lymphatic Filariasis.

    Science.gov (United States)

    Anugraha, G; Madhumathi, J; Prince, P R; Prita, P J Jeya; Khatri, V K; Amdare, N P; Reddy, M V R; Kaliraj, P

    2015-10-01

    Lymphatic filariasis, a mosquito-borne parasitic disease, affects more than 120 million people worldwide. Vaccination for filariasis by targeting different stages of the parasite will be a boon to the existing MDA efforts of WHO which required repeated administration of the drug to reduce the infection level and sustained transmission. Onset of a filaria-specific immune response achieved through antigen vaccines can act synergistically with these drugs to enhance the parasite killing. Multi-epitope vaccine approach has been proved to be successful against several parasitic diseases as it overcomes the limitations associated with the whole antigen vaccines. Earlier results from our group suggested the protective efficacy of multi-epitope vaccine comprising two immunodominant epitopes from Brugia malayi antioxidant thioredoxin (TRX), several epitopes from transglutaminase (TGA) and abundant larval transcript-2 (ALT-2). In this study, the prophylactic efficacy of the filarial epitope protein (FEP), a chimera of selective epitopes identified from our earlier study, was tested in a murine model (jird) of filariasis with L3 larvae. FEP conferred a significantly (P < 0.0001) high protection (69.5%) over the control in jirds. We also observed that the multi-epitope recombinant construct (FEP) induces multiple types of protective immune responses, thus ensuring the successful elimination of the parasite; this poses FEP as a potential vaccine candidate.

  2. [Scanning microscopical observations on the foregut structures o mosquitoes and their role for the ingestion of microfilariae (author's transl)].

    Science.gov (United States)

    Buse, E; Kuhlow, F

    1979-12-01

    Experiments on the transmission of Brugia malayi by various mosquitoes had shown that microfilariae ingested by some species were badly damaged when they reached the stomach, but were much less hurt in others. The structures of the foregut likely to cause these injuries, were investigated and documented by scanning microscope techniques. In Anopheles albimanus, A. arabiensis, A. stephensi and A. pharoensis which have well developed armatures the microfilariae showed a high rate of destruction. In A. stroparvus as well as in Aedes aegypti, Ae. togoi and Culex fatigans in which these structures are missing or poorly developed the larvae were much less affected. From the size, shape and position of the different papillae, spines, rods and cones observed it can be concluded and confirmed that the pharyngeal armature (buccopharyngeal bar) will be by far the most important structure responsible for the injuries of the microfilariae. However, it appears that the characteristics of different filaria species can play an important role in preventing such damages.

  3. Evaluation of immune response elicited by inulin as an adjuvant with filarial antigens in mice model.

    Science.gov (United States)

    Mahalakshmi, N; Aparnaa, R; Kaliraj, P

    2014-10-01

    Filariasis caused by infectious parasitic nematodes has been identified as the second leading source of permanent and long-term disability in Sub-Saharan Africa, Asia and Latin America. Several vaccine candidates were identified from infective third-stage larvae (L3) which involves in the critical transition from arthropod to human. Hitherto studies of these antigens in combination with alum adjuvant have shown to elicit its characteristic Th2 responses. Inulin is a safe, non-toxic adjuvant that principally stimulates the innate immune response through the alternative complement pathway. In the present study, the immune response elicited by inulin and alum as adjuvants were compared with filarial antigens from different aetiological agents: secreted larval acidic protein 1 (SLAP1) from Onchocerca volvulus and venom allergen homologue (VAH) from Brugia malayi as single or as cocktail vaccines in mice model. The study revealed that inulin can induce better humoral response against these antigens than alum adjuvant. Antibody isotyping disclosed inulin's ability to elevate the levels of IgG2a and IgG3 antibodies which mediates in complement-dependent cytotoxicity and antibody-dependent cell-mediated cytotoxicity (ADCC), respectively, in mice. Splenocyte analysis showed that T cells prestimulated with inulin have higher stimulation index (P inulin formulation had induced higher cytotoxicity with filarial antigens (as single P inulin to deplete the levels of Treg and brought a balance in Th1/Th2 arms against filarial antigens in mice.

  4. Chimeric Epitope Vaccine from Multistage Antigens for Lymphatic Filariasis.

    Science.gov (United States)

    Anugraha, G; Madhumathi, J; Prince, P R; Prita, P J Jeya; Khatri, V K; Amdare, N P; Reddy, M V R; Kaliraj, P

    2015-10-01

    Lymphatic filariasis, a mosquito-borne parasitic disease, affects more than 120 million people worldwide. Vaccination for filariasis by targeting different stages of the parasite will be a boon to the existing MDA efforts of WHO which required repeated administration of the drug to reduce the infection level and sustained transmission. Onset of a filaria-specific immune response achieved through antigen vaccines can act synergistically with these drugs to enhance the parasite killing. Multi-epitope vaccine approach has been proved to be successful against several parasitic diseases as it overcomes the limitations associated with the whole antigen vaccines. Earlier results from our group suggested the protective efficacy of multi-epitope vaccine comprising two immunodominant epitopes from Brugia malayi antioxidant thioredoxin (TRX), several epitopes from transglutaminase (TGA) and abundant larval transcript-2 (ALT-2). In this study, the prophylactic efficacy of the filarial epitope protein (FEP), a chimera of selective epitopes identified from our earlier study, was tested in a murine model (jird) of filariasis with L3 larvae. FEP conferred a significantly (P < 0.0001) high protection (69.5%) over the control in jirds. We also observed that the multi-epitope recombinant construct (FEP) induces multiple types of protective immune responses, thus ensuring the successful elimination of the parasite; this poses FEP as a potential vaccine candidate. PMID:26179420

  5. Gastrointestinal symptoms resembling ulcerative proctitis caused by larvae of the drone fly Eristalis tenax.

    Science.gov (United States)

    Desoubeaux, Guillaume; Gaillard, Julien; Borée-Moreau, Diane; Bailly, Éric; Andres, Christian R; Chandenier, Jacques

    2014-04-01

    We report a case of facultative intestinal myiasis due to larvae of the drone fly Eristalis tenax, also named the rat-tailed maggots. The development of larvae in the lower bowel was responsible for non-specific gastrointestinal symptoms that resembled ulcerative proctitis. The diagnosis was established upon the observation of four spontaneously excreted mobile larvae. The definite identification of the E. tenax species was made possible by scanning electron microscopy. The clinical outcome was satisfactory. PMID:24766340

  6. Screening alternative antibiotics against oxytetracycline-susceptible and -resistant Paenibacillus larvae

    OpenAIRE

    Kochansky, Jan; Knox, David; Feldlaufer, Mark; Pettis, Jeffery

    2001-01-01

    International audience Since resistance of the causative organism of American foulbrood, Paenibacillus larvae subsp. larvae, to oxytetracycline (OTC) is becoming widespread in the United States, we began a search for effective alternative antibiotics. We investigated the sensitivity of P. l. larvae to 27 antibiotics, which were primarily ones already registered with the US Food and Drug Administration for agricultural uses. Bacterial resistance to OTC also conferred resistance to other tet...

  7. KERENTANAN LARVA AEDES AEGYPTI TERHADAP TEMEFOS DI TIGA KELURAHAN ENDEMIS DEMAM BERDARAH DENGUE KOTA SUKABUMI

    OpenAIRE

    Hubullah Fuadzy; Dewi Nur Hodijah; Asep Jajang; Mutiara Widawati

    2015-01-01

    AbstractResistance of Aedes aegypti larvae against temephos influeneed the efforts of Dengue Fever vector control . The purpose of this study was to determine the status of susceptibility of Ae. aegypti larvae against temephos in three Dengue Fever endemic areas in Sukabumi. Design laboratory experiment with random design. approach group. Sample of Ae. aegypti larvae instar 3 and 4 had been taken from Subdistrict Baros, Sriwedari, Nangeleng. Susceptibility test, in performed according to Worl...

  8. Rearing of catfish (Clarias batrachus Lin.) larvae with live and prepared feeds

    OpenAIRE

    Yasmin, A.; Mollah, M.F.A; Haylor, G.S.

    1998-01-01

    Provision or live feed (Tubificid worms) attributed significantly better weight gain in the five days old Clarias batrachus larvae when reared for another 28 days compared to those fed mixed feed (live and artificial) and artificial feed only. Larvae fed mixed feed showed significantly better weight gain compared to those fed only artificial feed and the survival rate was similar to those fed only live feed. Both the weight gain and survival rate were the lowest for the larvae reared only on ...

  9. Effect og bioactive products on innate immunity and development of Atlantic halibut (Hippoglossus hippoglossus L.) larvae

    OpenAIRE

    Rut Hermannsdóttir

    2008-01-01

    Halibut larvae were treated with various bioactive products and the effects on selected components of the innate immune system investigated. Effects on growth, survival and normal development of larvae were also studied. The bioactive products which were tested were chitosan and protein hydrolysates from cod, blue whiting and pollock. The larvae where treated with bioactive products from the onset of feeding or from 4-5 weeks after the onset of feeding and throughout the first feeding period....

  10. Ultrastructural characteristics of nurse cell-larva complex of four species of Trichinella in several hosts

    OpenAIRE

    Sacchi L.; Corona S.; Gajadhar A.A.; Pozio E.

    2001-01-01

    The nurse cell-larva complex of nematodes of the genus Trichinella plays an Important role in the survival of the larva in decaying muscles, frequently favouring the transmission of the parasite in extreme environmental conditions. The ultrastructure of the nurse cell-larva complex in muscles from different hosts infected with T. nativa (a walrus and a polar bear), T. spiralis (horses and humans), T. pseudospiralis (a laboratory mouse) and T. papuae (a laboratory mouse) were examined. Analysi...

  11. Drosophila melanogaster larvae control amylase secretion according to the hardness of food

    OpenAIRE

    Sakaguchi, Honami; Suzuki, Masataka G.

    2013-01-01

    Drosophila melanogaster larvae excrete amylase and perform external digestion of their food. In this study, to investigate whether their external digestion ability varies in response to changes in the external environment, we measured the relative amount of amylase excreted by larvae using a new method: the iodine starch agar method (ISAM). Analysis using this method revealed that the amount of amylase excreted by larvae increased in accordance with the increase in the agar concentration. In ...

  12. Descrição da larva de Erythemis mithroides (Brauer e notas sobre outras larvas conhecidas do gênero (Odonata, Libellulidae Description of the larva of Erythemis mithroides (Brauer and notes on other known larvae of the genus (Odonata, Libellulidae

    Directory of Open Access Journals (Sweden)

    J.M. Costa

    1993-01-01

    Full Text Available The last instar larva of Erythemis mithroides (Brauer, 1900 is described and figured based on exuviae of reared specimens. A comparative analysis of this immature stage and the known larvae of the genus are furnished according to the data available in the literature and of specimens of E credula (Hagen, 1861 and E. vesiculosa (Fab., 1775 permiting a diagnose for the larvae of the genus Erylhemis Hagen, 1861.

  13. Kaolin as a possible treatment against lepidopteran larvae and mites in organic fruit production

    OpenAIRE

    Jaastad, G.; Røen, D.; Hovland, B.; Opedal, O.

    2006-01-01

    Few control methods are available in Norwegian organic fruit production that can prevent damage by early and late larvae. Also phytophagous mites are difficult to control without harming the beneficial mites. Proc-essed kaolin function by coating trees and thus creating a physical barrier to infestation, impeding move-ment, feeding and egg-laying. Kaolin may reduce feeding and movement of over-wintering tortricide larvae and other larvae that hatch early in spring and have a repellent effect ...

  14. Humidity Detection and Hygropreference Behavior in Larvae of the Tobacco hornworm, Manduca sexta

    OpenAIRE

    Rowley, Marc; Hanson, Frank

    2007-01-01

    Water is a critical resource for any terrestrial animal, especially for a soft-bodied insect such as larvae of the tobacco hornworm, Manduca sexta L. (Lepidoptera: Sphingidae). Strategies for coping with a dry environment might include seeking out regions of high relative humidity that reduce desiccative stress, or to find and imbibe liquid water. Desiccated larvae placed in a linear arena with a humidity gradient preferred the humid end, whereas un-desiccated larvae did not. This behavior wa...

  15. Volatiles induced by the larvae of the Asian corn borer (Ostrinia furnacalis) in maize plants affect behavior of conspecific larvae and female adults

    Institute of Scientific and Technical Information of China (English)

    Cui-Hong Huang; Feng-Ming Yan; John A.Byers; Rong-Jiang Wang; Chong-Ren Xu

    2009-01-01

    Effects of maize (Zea mays L.) volatiles induced by larvae of the Asian corn borer, Ostrinia furnacalis (Guenee), on the orientation behaviors of Asian corn borer larvae and oviposition of the females were investigated. Nineteen volatile chemicals, with terpenes being the major components, were identified from maize plants attacked by third instar Asian corn borer larvae. Coupled gas chromatographic-electroantennographic detection (GC-EAD) analyses revealed some electroantennographic differences between female and male Asian corn borer antennae in response to larvae-induced maize volatiles; female responded to (E)-2-hexenal, nonanal, (Z)-3-hexen-1-ol and three unknown compounds while the male only responded to (E)-2-hexenal, nonanal and one unknown compound. In laboratory orientation bioassays, Asian corn borer neonate larvae were attracted to extracts collected from Asian corn borer-damaged plants as well as to synthetic famesene, but were repelled by (Z)-3-hexen- 1-ol. In laboratory oviposition bioassays, gravid females laid fewer eggs on plants damaged by larvae than on mechanically damaged plants or undamaged plants. Adult Asian corn borer females deposited fewer eggs on wax paper treated with (E)-2-hexenal or (Z)-3-hexen-l-ol than on wax paper treated with hexane (control). The results suggest that Asian corn borer can affect the behaviors of conspecific larvae and adults by changing host plant volatiles.

  16. Fly larvae as sustainable bioconverters of waste for feed in the future

    DEFF Research Database (Denmark)

    Nordentoft, Steen; Aabo, Søren

    2014-01-01

    , or nutrients may be refined fromprocessed insects, however there is a huge need for technological development in order to automateculture and harvest of the insects.In nature insects and insect larvae are important feed sources for poultry and the larva of the commonhouse fly (Musca domestica) have been shown...... to be especially rich in essential amino and fatty acids. Atthe Food institute we have investigated in feed safety of using these fly larvae as feed for egg laying hens.The larvae were reared on poultry manure which implies the risk of transmission of pathogenicmicroorganism between animals and to humans, as well...

  17. The use of morphological and histological features as nutritional condition indices of Pagrus pagrus larvae

    Directory of Open Access Journals (Sweden)

    Marina Vera Diaz

    2013-09-01

    Full Text Available Morphometrical and histological techniques were employed to characterize Pagrus pagrus larvae nutritional condition. Larvae were reared in laboratory under controlled conditions with the main objective of testing whether these methodologies allowed finding differences between larvae from different feeding treatments. Once yolk was consumed (three days after hatching larvae were assigned to a feeding treatment: starved during the whole experiment; delayed feeding, starved during three days; fed during the entire experiment. Algae (Nannochloropsis oculata and rotifers (Brachionus plicatilis were provided to larvae for feed treatments. Larvae were fixed daily; for morphometrical purposes in 5% formaldehyde solution, and in Bouin for histological sections. Results herein obtained showed that both methodologies are sensitive enough to distinguish larvae characterized by different nutritional condition states obtained from the feeding treatments. Consequently, these methodologies could be employed in wild red porgy larvae in order to asses their nutritional condition. These techniques could also be employed to check larval quality obtained with aquaculture purposes to estimate the effects of changes in rearing protocols or kind of food supply and thus, to guaranty a higher survival of early developmental stages of reared larvae.

  18. The Effects of Shrimp Gut Probiotic Bacteria on the Shrimp Larvae (Penaeus Chinensis)

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    The survival rates of shrimp larvae in different stage are higher than those of control groups when probiotic bacteria strains X4B-1 and X1B-1 which are isolated from gut of adult shrimp are added into the little volume rearing sea water of shrimp larvae. The effects of probiotic bacteria are evaluated by challenge test (pathogenic bacteria Z3G2 isolated from disease shrimp larvae in the hatchery of Jimo town) and low salinity stress resistance tests on shrimp larvae, the survival rate and lengths of the shrimp larvae in the experiment are determined. Results indicate that 1. The survival rate, ability of resistant to low salinity, lengths of the delivered shrimp larvae are improved after the strains of probiotic bacteria, X4B-1 or X1B-1, are added into the rearing sea water of hatchery. 2. The addition of the probiotic bacteria could not influence the change of the bacteria number, NH3-N and COD value in the rearing sea water. 3. The probiotic bacteria used in the experiment have many enzymes such as Lipase, Amylase, Gelatinase and Lecithinase. These enzymes may help the probiotic bacteria to digest the food components fed to shrimp larvae and increase the digestive efficiency of post larvae. This may be one of the reasons why these probiotic bacteria are beneficial to the shrimp larvae.

  19. House fly oviposition inhibition by larvae ofHermetia illucens, the black soldier fly.

    Science.gov (United States)

    Bradley, S W; Sheppard, D C

    1984-06-01

    Wild populations of house flies were inhibited from ovipositing into poultry manure containing larvae of the black soldier fly,Hermetia illucens (L.). A laboratory strain of house fly responded differently, readily ovipositing into manure with lower densities of soldier fly larvae, but avoiding the higher densities tested. The amount of timeH. illucens larvae occupy the manure prior to an oviposition test influences ovipositional responses of house flies. Manure conditioned byH. illucens larvae for 4-5 days did not significantly inhibit house fly oviposition. We suggest that some type of interspecific chemical communication (allomone) is present. PMID:24318779

  20. Unusual pseudomyiasis with Musca domestica (housefly) larvae in a child with chronic otitis media

    OpenAIRE

    Zafar Iqbal; Satish Chandra Sharma; Hiba Sami; Amit Kumar

    2016-01-01

    Myiasis is a disease caused by fly larvae and aural myiasis is a rare clinic condition often occurring in children or mentally retarded people. We report the case of an unusual presentation of a unilateral aural myiasis in a 3-year-old female child patient belonging to a slum with unilateral chronic otitis media caused by Musca domestica (housefly) larvae. Eight larvae were removed from the external auditory canal while five more larvae were located in the middle ear cavity and were removed t...

  1. Secreted and immunogenic proteins produced by the honeybee bacterial pathogen, Paenibacillus larvae.

    Science.gov (United States)

    Antúnez, Karina; Anido, Matilde; Evans, Jay D; Zunino, Pablo

    2010-03-24

    American Foulbrood is a severe disease affecting larvae of honeybee Apis mellifera, causing significant decrease in the honeybee population, beekeeping industries and agricultural production. In spite of its importance, little is known about the virulence factors secreted by Paenibacillus larvae during larval infection. The aim of the present work was to perform a first approach to the identification and characterization of P. larvae secretome. P. larvae secreted proteins were analyzed by SDS-PAGE and identified by MALDI-TOF. Protein toxicity was evaluated using an experimental model based on feeding of A. mellifera larvae and immunogenicity was evaluated by Western blot, using an antiserum raised against cells and spores of P. larvae. Ten different proteins were identified among P. larvae secreted proteins, including proteins involved in transcription, metabolism, translation, cell envelope, transport, protein folding, degradation of polysaccharides and motility. Although most of these proteins are cytosolic, many of them have been previously detected in the extracellular medium of different Bacillus spp. cultures and have been related to virulence. The secreted proteins resulted highly toxic and immunogenic when larvae were exposed using an experimental model. This is the first description of proteins secreted by the honeybee pathogen P. larvae. This information may be relevant for the elucidation of bacterial pathogenesis mechanisms. PMID:19781868

  2. Cutaneous larva migrans in northern climates. A souvenir of your dream vacation

    Energy Technology Data Exchange (ETDEWEB)

    Edelglass, J.W.; Douglass, M.C.; Stiefler, R.; Tessler, M.

    1982-09-01

    Three young women recently returned to the metropolitan Detroit area with cutaneous larva migrans. All three had vacationed at a popular club resort on the Caribbean island of Martinique. Cutaneous larva migrans is frequently seen in the southern United States, Central and South America, and other subtropical areas but rarely in northern climates. Several organisms can cause cutaneous larva migrans, or creeping eruption. The larvae of the nematode Ancylostoma braziliense are most often the causative organisms. Travel habits of Americans make it necessary for practitioners in northern climates to be familiar with diseases contracted primarily in warmer locations. The life cycle of causative organisms and current therapy are reviewed.

  3. BIOLOGICAL AND MORPHOLOGICAL EFFECTS OF CHITINSYNTHESIS INHIBITOR (TRIFLUMURON) ON ANOPHELINE LARVAE

    OpenAIRE

    E. Farashiani; H. Ladonni

    1999-01-01

    Triflumuron (Bay sir 8514) is one of many benzoylated ureas, which inhibit chitin synthesis during insect molting and are commonly referred to as insect growth regulators or I. G. Rs. The post emergence efficacy of triflumuron (SC 48%) was evaluated against larvae of Anopheles stephensi. The first instar larvae were exposed to tirflumuron at LC50 level (0.0001 mg/l) in a continues exposure time. Among 1000 larvae listed 570 were passed to pupal stage (43% morality at the larvae of stage). The...

  4. Larva migrans cutânea: ocorrência de casos humanos e identificação de larvas de Ancylostoma spp em parque público do município de Taciba, São Paulo Cutaneous larva migrans: reports of pediatric cases and contamination by Ancylostoma spp larvae in public parks in Taciba, São Paulo State

    OpenAIRE

    Vamilton Alvares Santarém; Rogério Giuffrida; Gabriel Arantes Zanin

    2004-01-01

    Descreve-se a ocorrência de larva migrans cutânea em crianças de Taciba, São Paulo, Brasil, pelo contato com areia de parques públicos, onde observou-se larvas de Ancylostoma spp. A enfermidade foi controlada após adotar-se medidas educacionais sanitárias, desativação e isolamento dos locais para reduzir acesso de animais e troca de areia.Cutaneous larva migrans in children from Taciba, São Paulo, Brazil, was related to contact with sand in public squares, where Ancylostoma spp larvae were de...

  5. The culture of sand goby, Oxyeleotris marmoratus II: Gastric emptying times and feed requirements of larvae

    Directory of Open Access Journals (Sweden)

    Uraiwan Chamnanwech

    2003-05-01

    Full Text Available Time of digestion experiments were carried out in a 15-liter rearing glass aquaria (water volume 10 liters containing 1,500 larvae. The larvae were fed with sufficient rotifer, Artemia or Moina and then transferred to another rearing glass aquarium without food. Samples of 20 larvae were checked at 10-minute intervals until no food remained in the larval digestive tract. It was found that the time required to empty the larval digestive tract with rotifer, Artemia or Moina was as follows. Larvae 3-18 days old fed with rotifertook 130-180 minutes to empty the digestive tract while larvae 21-27 days old fed with rotifer and Artemia took 110-120 minutes and larvae 30-45 days old fed with Moina took 80-100 minutes at water temperature of 25-29ºC. Time consumed to empty the gut content tended to decrease as larval age increased. Experiments to determined the time and amount of prey required to get satiation were carried out in a 15-liter rearing glass aquaria (water volume 10 liters containing 1,500 larvae. The larvae were fed with rotifer, Artemia or Moina after starvation of 24 hr. Samples of 20 larvae were checked at 10- inutes intervals after the start of feeding until 3 hr. It was found the time required to fill the larval digestive tract with rotifer, Artemia or Moina for 3-18 days old larvae was 80-110 minutes and amount of rotifer to get satiation was 4.8- 26 ind/larvae. For 21-27 day-old larvae the corresponding time was 60-80 minutes and was 28.5-31.6 ind/ larvae. For 30-45 day-old larvae the time was 40-60 minutes and amount of Moina to get satiation was 34.6- 52.4 ind/larvae at water temperature of 25-29ºC. The time required to fill the larval gut, tends to decrease with larval age but the amount of prey required to fill the larval gut, tends to increase with larval age. Experiments to determined the amount of food uptake in a day were done in a 15-liter rearing glass aquaria (water volume 10 liters containing 500 larvae, and 10 ind

  6. Histomorphogenesis of cranial nerves in Huso huso larvae.

    Science.gov (United States)

    Tavighi, Sherma; Saadatfar, Zohreh; Shojaei, Bahador; Behnam Rassouli, Morteza

    2016-01-01

    In this study the cranial nerves development of H. huso are explained from 1 to 54-days-old (1, 3, 6, 15, 21 and 54 days). Despite all the researches on fish brain, there are no study on nerves evolution on H. huso during their larvae life. For this research 40 samples of larvae H. huso were obtained (from each age, about six samples were selected). The specimens were maintained in fiberglass tank, then histological samples were taken from tissues and stained with hematoxylin and eosin for general histological studies using light microscope. According to the results, on 1 and 3-days-old, no nerve was observed. The terminal nerve and their dendrites were observed around the nasal cavity and the axons projected to different areas in forebrain especially around olfactory bulb diffusely, on 6-day-old fish. Also, olfactory, optic, oculomotor, trochlear, trigeminal, lateral line and vagus nerves were detected on 6-day-old fish, however two parts of lateral line nerve were separated on 54-day-old. Three nerves, profundus, facial and octaval were observed on 54-day-old, however, up to this age, epiphysial nerve was not observed. PMID:27482355

  7. The hemolymph proteome of fed and starved Drosophila larvae.

    Directory of Open Access Journals (Sweden)

    Björn Handke

    Full Text Available The co-operation of specialized organ systems in complex multicellular organisms depends on effective chemical communication. Thus, body fluids (like blood, lymph or intraspinal fluid contain myriads of signaling mediators apart from metabolites. Moreover, these fluids are also of crucial importance for immune and wound responses. Compositional analyses of human body fluids are therefore of paramount diagnostic importance. Further improving their comprehensiveness should increase our understanding of inter-organ communication. In arthropods, which have trachea for gas exchange and an open circulatory system, the single dominating interstitial fluid is the hemolymph. Accordingly, a detailed analysis of hemolymph composition should provide an especially comprehensive picture of chemical communication and defense in animals. Therefore we used an extensive protein fractionation workflow in combination with a discovery-driven proteomic approach to map out the detectable protein composition of hemolymph isolated from Drosophila larvae. Combined mass spectrometric analysis revealed more than 700 proteins extending far beyond the previously known Drosophila hemolymph proteome. Moreover, by comparing hemolymph isolated from either fed or starved larvae, we provide initial provisional insights concerning compositional changes in response to nutritional state. Storage proteins in particular were observed to be strongly reduced by starvation. Our hemolymph proteome catalog provides a rich basis for data mining, as exemplified by our identification of potential novel cytokines, as well as for future quantitative analyses by targeted proteomics.

  8. Seasonal variation in toxicity of citral against Fasciola larva

    Institute of Scientific and Technical Information of China (English)

    Kumari Sunita; Pradeep Kumar; Dinesh Kumar Singh

    2014-01-01

    Objective:To test whether the larvicidal activity of citral against Fasciola varies by season. Methods:Mortality of Fasciola larva in different month of year (2011-2012) in in vitro and in vivo condition were observed at 2 h, 4 h, 6 h and 8 h exposure of citral. Results:In vitro toxicity of citral against redia was highest in between the June to August (8 h LC50: 2.58-2.62 mg/L), whereas against cercaria 8 h LC50 was in between 3.44-2.62 mg/L. Highest in vivo toxicity against redia was noted in between June to August (8h LC50: 4.20-5.09 mg/L). The lowest toxicity was observed from November to April. The highest temperature, free carbon dioxide, and lowest pH, dissolved oxygen were observed from June to August. Conclusions:The present study conclusively shows that varying a biotic factor can significantly alter the in vitro and in vivo toxicity of citral against sporocyst redia and cercaria larva.

  9. Pyrethroid resistance in Aedes aegypti larvae (Diptera: Culicidae) from Singapore.

    Science.gov (United States)

    Koou, Sin-Ying; Chong, Chee-Seng; Vythilingam, Indra; Ng, Lee-Ching; Lee, Chow-Yang

    2014-01-01

    We report the first comprehensive insecticide susceptibility status ofAedes aegypti (L.) larvae from Singapore. The study indicated that Ae. aegypti is susceptible to temephos, although resistance (RR50 = 1.29-4.43-fold) couldbe developing. Of high concern is the detection of moderate to high resistance to permethrin (RR50 = 29-47-fold) and etofenprox (RR50 = 14-34-fold). Biolarvicide Bacillus thuringiensis israelensis (Bti) remains effective. The insecticide susceptibility profile of Ae. aegypti larvae was found to be homogenous among the different sites studied across the island city. The addition of synergists piperonyl butoxide, S,S,S,-tributyl phosphorotrithioate, and triphenyl phosphate generally failed to enhance the toxicity of the insecticides investigated, suggesting an insignificant role of metabolic-based resistance, and a possible involvement of target site resistance. Further biochemical investigation of specific metabolic enzyme activities suggested that detoxifying enzymes, mono-oxygenases, esterases, glutathione S-transferases, and altered acetylcholinesterases, generally did not contribute to the resistance observed. This study clearly demonstrated that pyrethroid resistance is widespread among Ae. aegypti population and lowered susceptibility to organophosphates is developing. PMID:24605467

  10. The colonization dynamics of the gut microbiota in tilapia larvae.

    Directory of Open Access Journals (Sweden)

    Christos Giatsis

    Full Text Available The gut microbiota of fish larvae evolves fast towards a complex community. Both host and environment affect the development of the gut microbiota; however, the relative importance of both is poorly understood. Determining specific changes in gut microbial populations in response to a change in an environmental factor is very complicated. Interactions between factors are difficult to separate and any response could be masked due to high inter-individual variation even for individuals that share a common environment. In this study we characterized and quantified the spatio-temporal variation in the gut microbiota of tilapia larvae, reared in recirculating aquaculture systems (RAS or active suspension tanks (AS. Our results showed that variation in gut microbiota between replicate tanks was not significantly higher than within tank variation, suggesting that there is no tank effect on water and gut microbiota. However, when individuals were reared in replicate RAS, gut microbiota differed significantly. The highest variation was observed between individuals reared in different types of system (RAS vs. AS. Our data suggest that under experimental conditions in which the roles of deterministic and stochastic factors have not been precisely determined, compositional replication of the microbial communities of an ecosystem is not predictable.

  11. The colonization dynamics of the gut microbiota in tilapia larvae.

    Science.gov (United States)

    Giatsis, Christos; Sipkema, Detmer; Smidt, Hauke; Verreth, Johan; Verdegem, Marc

    2014-01-01

    The gut microbiota of fish larvae evolves fast towards a complex community. Both host and environment affect the development of the gut microbiota; however, the relative importance of both is poorly understood. Determining specific changes in gut microbial populations in response to a change in an environmental factor is very complicated. Interactions between factors are difficult to separate and any response could be masked due to high inter-individual variation even for individuals that share a common environment. In this study we characterized and quantified the spatio-temporal variation in the gut microbiota of tilapia larvae, reared in recirculating aquaculture systems (RAS) or active suspension tanks (AS). Our results showed that variation in gut microbiota between replicate tanks was not significantly higher than within tank variation, suggesting that there is no tank effect on water and gut microbiota. However, when individuals were reared in replicate RAS, gut microbiota differed significantly. The highest variation was observed between individuals reared in different types of system (RAS vs. AS). Our data suggest that under experimental conditions in which the roles of deterministic and stochastic factors have not been precisely determined, compositional replication of the microbial communities of an ecosystem is not predictable. PMID:25072852

  12. Otolith geochemistry does not reflect dispersal history of clownfish larvae

    KAUST Repository

    Berumen, Michael L.

    2010-07-01

    Natural geochemical signatures in calcified structures are commonly employed to retrospectively estimate dispersal pathways of larval fish and invertebrates. However, the accuracy of the approach is generally untested due to the absence of individuals with known dispersal histories. We used genetic parentage analysis (genotyping) to divide 110 new recruits of the orange clownfish, Amphiprion percula, from Kimbe Island, Papua New Guinea, into two groups: "self-recruiters" spawned by parents on Kimbe Island and "immigrants" that had dispersed from distant reefs (>10 km away). Analysis of daily increments in sagittal otoliths found no significant difference in PLDs or otolith growth rates between self-recruiting and immigrant larvae. We also quantified otolith Sr/Ca and Ba/Ca ratios during the larval phase using laser ablation inductively coupled plasma mass spectrometry. Again, we found no significant differences in larval profiles of either element between self-recruits and immigrants. Our results highlight the need for caution when interpreting otolith dispersal histories based on natural geochemical tags in the absence of water chemistry data or known-origin larvae with which to test the discriminatory ability of natural tags. © 2010 Springer-Verlag.

  13. Otolith geochemistry does not reflect dispersal history of clownfish larvae

    Science.gov (United States)

    Berumen, M. L.; Walsh, H. J.; Raventos, N.; Planes, S.; Jones, G. P.; Starczak, V.; Thorrold, S. R.

    2010-12-01

    Natural geochemical signatures in calcified structures are commonly employed to retrospectively estimate dispersal pathways of larval fish and invertebrates. However, the accuracy of the approach is generally untested due to the absence of individuals with known dispersal histories. We used genetic parentage analysis (genotyping) to divide 110 new recruits of the orange clownfish, Amphiprion percula, from Kimbe Island, Papua New Guinea, into two groups: “self-recruiters” spawned by parents on Kimbe Island and “immigrants” that had dispersed from distant reefs (>10 km away). Analysis of daily increments in sagittal otoliths found no significant difference in PLDs or otolith growth rates between self-recruiting and immigrant larvae. We also quantified otolith Sr/Ca and Ba/Ca ratios during the larval phase using laser ablation inductively coupled plasma mass spectrometry. Again, we found no significant differences in larval profiles of either element between self-recruits and immigrants. Our results highlight the need for caution when interpreting otolith dispersal histories based on natural geochemical tags in the absence of water chemistry data or known-origin larvae with which to test the discriminatory ability of natural tags.

  14. Decapod larvae dynamics on Berlengas Biosphere Reserve (UNESCO - Portugal

    Directory of Open Access Journals (Sweden)

    Lénia Da Fonseca Alexandre Rato

    2014-05-01

    Total decapoda abundance ranged from 0,06 ind.m-3 in May 2011 to 64,28ind.m-3 in August 2012, and significantly different between summer/winter and winter/spring months (P(perm≤0,05. The data obtained on this study revealed that Infraorders Brachyura, Anomura and Caridea are the most common. All three are significantly different between months (P(perm≤0,05 but not between sampling stations (P(perm>0,05. Brachyuran abundance was significantly affected by the Oceanograhic Conditions (P(perm≤0,05. Abundances were higher in spring and summer months, when Chlorophyl a values (mg.m-3, Temperature (ºC and Salinity (ppt were also higher. Decapoda community is directly affected by the surrounding environmental conditions in Berlengas Biosphere Reserve and abundance might also be related with specific larvae release throughout the year. Each sampling station was considered a replica from the study area. The ecological importance of Berlengas was also verified by the presence of non-frequent larvae of Achelata and Stomatopoda.

  15. How did indirect development with planktotrophic larvae evolve?

    Science.gov (United States)

    Nielsen, Claus

    2009-06-01

    The two main types of theories for the evolution of the biphasic life cycles in marine invertebrates are discussed. The "intercalation" theories propose that the larval stages (planktotrophic or lecithotrophic) have evolved as specializations from the ancestral, direct life cycle. The opposing "terminal addition" theories propose that the ancestor was holopelagic and that the adult stage was added to the life cycle with the pelagic stage retained as a planktotrophic larva. It is emphasized that theories based on hypothetical ancestors that were unable to feed must be rejected. This applies to planula theories based on a compact planula. Various arguments against the theories that consider the feeding larvae as ancestral in the major eumetazoan lineages and in particular against the trochaea theory are discussed and found untenable. It is suggested that the "Cambrian explosion" was actually a rapid Ediacaran radiation of the eubilaterians that was made possible by the evolution of a tubular gut with all the resulting possibilities for new body plans. PMID:19556589

  16. ASPEK ZOONOTIK PARASIT NEMATODA PADA KERA DAN BINATANG MENGERAT DI BENGKULU, SUMATERA. INDONESIA

    Directory of Open Access Journals (Sweden)

    Untung S.

    2012-09-01

    Full Text Available Twentyfive monkeys and 481 rats were examined for parasitic nematodes in Bengkulu, nine species of nematode were found infecting these animals. Five of filarían nematodes, i.e. Brugia malayi, Brugia pahangi, Dirofilaria magnilarvatum and Edesonfilaria malayensis were infecting monkeys and one speciesTBreinlia booliati, was found infecting rats. Three species of gastrointestinal helminths, i.e. Trichuris trichiura, Enterobius vermicularis and Oestophagomomum spp were found in monkeys; a lung worm, Angiostrongylus cantonensis, was found in rats. The most important nematode species is B. malayi, which was found in Presbytis cristatus (36.8 % and in Macaca fascicularis (20.0 %. T. trichiura was found in R. cristatus (47.9 % and A. cantonensis in Rattus argentiventer (4.0 % and Rattus tiomanicus (2.9%.

  17. Temporal and spatial distribution patterns of echinoderm larvae in La Parguera, Puerto Rico.

    Science.gov (United States)

    Williams, Stacey M; Jorge, García-Sais

    2010-10-01

    This study describes temporal and spatial abundance patterns of echinoderm larvae in La Parguera, Puerto Rico. For the temporal study, larvae were sampled by a series of monthly tows taken with a 64 microm mesh net between the new and full moon from April 2005 to July 2006, September 2006 and August 2007. In order to measure spatial variation of echinoderm larval abundances, oblique tows were taken with 64 and 202 microm mesh nets at seven different sites within the shelf, at the shelf-edge, and at a nearby oceanic stations during August 2007. Overall, Echinoidea (sea urchin) exhibited the highest abundance with a total of 11 921 larvae, representing 52.5% of the total collection. Ophiuroidea (brittle star) ranked second in abundance with 45.6% of the total larvae. Holothuroidea (sea cucumber) and Asteroidea larvae (sea star) accounted for less than 2% of the total echinoderm larval collection. Early larval stages (2-8 day old) of Diadema antillarum represented 20% of the total Echinoidea larvae. There was no marked seasonal trend of echinoderm larval abundance; Echinoidea and Ophiuroidea larvae were present in all monthly samples indicating that reproduction occurs year-round. Peak abundances of later-stage Echinoidea larvae were observed during January, July and October and of later-stage Ophiuroidea larvae during June, August and October. The observed peaks of later-stage larval abundances may be indicative of higher recruitment activity during these months. There was a significant difference of echinoderm larval abundance between spatial stations, with higher abundances collected at the shelf-edge. Later-stage (approximately 24 day old) D. antillarum larvae were mostly collected at shelf-edge and oceanic locations. In addition, the 64 microm mesh net was more efficient for collection of echinoderm larvae than the 202 microm mesh net. PMID:21302410

  18. Effects of salinity on striped bass eggs and larvae from the Savannah River, Georgia

    Science.gov (United States)

    Winger, P.V.; Lasier, P.J.

    1994-01-01

    Operation of a tide gate installed in the Savannah River by the U.S. Army Corps of Engineers to reduce dredging activities increased salinities upstream in important spawning habitat for striped bass Morone saxatilis. To assess the effects of salinity on survival and growth of striped bass at early life stages, newly fertilized eggs and 48-h-posthatch were exposed to serial dilutions of seawater, with salinities ranging from 0 to 33 permill (g/L) in increments of 3 permill in addition, older larvae (5-d posthatch) were exposed to salinities of 0, 6, 12, 18, and 24 permill. Eggs were exposed until 24 h posthatch, 48-h-posthatch larvae were exposed for 10 d, and 5-d-posthatch larvae were exposed for 6 d. Eggs died within 24 h in salinities greater than 18 permill. Both survival and total length of larvae hatched from eggs exposed to salinities of 15 permill or higher were reduced. Percent mortality and mean total lengths of newly hatched larvae followed the same pattern for each of three sets of salinity regimes (i.e., changes in salinities over time) that striped bass eggs might encounter during passage downstream in the Savannah River. Hardening eggs in freshwater did not increase survival or length of hatched larvae over that shown by eggs hardened in saline water. The 5-d-posthatch larvae were less sensitive to salinity than the 48-h-posthatch larvae. Survival of larvae was negatively con-elated with both salinity and exposure time. For 48-h-posthatch larvae, the 10-d LC50 (the salinity lethal to 50% of the test fish within 10 d) was 10 permill. Probabilities of survival for larval striped bass exposed to different salinities for different amounts of time can be estimated from curves generated from models of survival analysis. Salinities judged to be critical to Savannah River striped bass eggs and larvae are those greater than 9 permill.

  19. Schinus terebinthifolius Leaf Extract Causes Midgut Damage, Interfering with Survival and Development of Aedes aegypti Larvae

    Science.gov (United States)

    Procópio, Thamara Figueiredo; Fernandes, Kenner Morais; Pontual, Emmanuel Viana; Ximenes, Rafael Matos; de Oliveira, Aline Rafaella Cardoso; Souza, Carolina de Santana; Melo, Ana Maria Mendonça de Albuquerque; Navarro, Daniela Maria do Amaral Ferraz; Paiva, Patrícia Maria Guedes; Martins, Gustavo Ferreira; Napoleão, Thiago Henrique

    2015-01-01

    In this study, a leaf extract from Schinus terebinthifolius was evaluated for effects on survival, development, and midgut of A. aegypti fourth instar larvae (L4), as well as for toxic effect on Artemia salina. Leaf extract was obtained using 0.15 M NaCl and evaluated for phytochemical composition and lectin activity. Early L4 larvae were incubated with the extract (0.3–1.35%, w/v) for 8 days, in presence or absence of food. Polymeric proanthocyanidins, hydrolysable tannins, heterosid and aglycone flavonoids, cinnamic acid derivatives, traces of steroids, and lectin activity were detected in the extract, which killed the larvae at an LC50 of 0.62% (unfed larvae) and 1.03% (fed larvae). Further, the larvae incubated with the extract reacted by eliminating the gut content. No larvae reached the pupal stage in treatments at concentrations between 0.5% and 1.35%, while in the control (fed larvae), 61.7% of individuals emerged as adults. The extract (1.0%) promoted intense disorganization of larval midgut epithelium, including deformation and hypertrophy of cells, disruption of microvilli, and vacuolization of cytoplasms, affecting digestive, enteroendocrine, regenerative, and proliferating cells. In addition, cells with fragmented DNA were observed. Separation of extract components by solid phase extraction revealed that cinnamic acid derivatives and flavonoids are involved in larvicidal effect of the extract, being the first most efficient in a short time after larvae treatment. The lectin present in the extract was isolated, but did not show deleterious effects on larvae. The extract and cinnamic acid derivatives were toxic to A. salina nauplii, while the flavonoids showed low toxicity. S. terebinthifolius leaf extract caused damage to the midgut of A. aegypti larvae, interfering with survival and development. The larvicidal effect of the extract can be attributed to cinnamic acid derivatives and flavonoids. The data obtained using A. salina indicates that caution

  20. Evaluation of a Multivalent Vaccine against Lymphatic Filariasis in Rhesus macaque Model

    Science.gov (United States)

    Dakshinamoorthy, Gajalakshmi; von Gegerfelt, Agneta; Andersen, Hanne; Lewis, Mark; Kalyanasundaram, Ramaswamy

    2014-01-01

    Lymphatic filariasis affects 120 million people worldwide and another 1.2 billion people are at risk of acquiring the infection. Chemotherapy with mass drug administration is substantially reducing the incidence of the infection. Nevertheless, an effective vaccine is needed to prevent the infection and eradicate the disease. Previously we reported that a multivalent fusion protein vaccine (rBmHAT) composed of small heat shock proteins 12.6 (HSP12.6), abundant larval transcript-2 (ALT-2) and large extracellular domain of tetraspanin (TSP LEL) could confer >95% protection against the challenge infection with Brugia malayi infective larvae (L3) in mouse and gerbil models. In this study we evaluated the immunogenicity and efficacy of rBmHAT fusion protein vaccine in a rhesus macaque model. Our results show that rBmHAT is highly immunogenic in rhesus macaques. All the vaccinated monkeys developed significant titers of antigen-specific IgG antibodies against each of the component antigens (16,000 for rBmHSP12.6), (24,000 for rBmALT-2) and (16,000 for rBmTSP-LEL). An in vitro antibody dependent cellular cytotoxicity (ADCC) assay performed using the sera samples from vaccinated monkeys showed that the anti-rBmHAT antibodies are functional with 35% killing of B. malayi L3s. Vaccinated monkeys also had antigen responding cells in the peripheral blood. Vaccine-induced protection was determined after challenging the monkeys with 500 B. malayi L3. Following challenge infection, 3 out of 5 vaccinated macaques failed to develop the infection. These three protected macaques had high titers of IgG1 antibodies and their PBMC secreted significantly high levels of IFN-γ in response to the vaccine antigens. The two vaccinated macaques that picked the infection had slightly low titers of antibodies and their PBMC secreted high levels of IL-10. Based on these findings we conclude that the rBmHAT vaccine is highly immunogenic and safe and can confer significant protection against

  1. Hyaluronidase from infective Ancylostoma hookworm larvae and its possible function as a virulence factor in tissue invasion and in cutaneous larva migrans.

    OpenAIRE

    Hotez, P. J.; Narasimhan, S; HAGGERTY, J; Milstone, L; Bhopale, V; Schad, G A; Richards, F F

    1992-01-01

    During skin penetration, infective hookworm larvae encounter hyaluronic acid as they migrate between epidermal keratinocytes and through the ground substance of the dermis. A hyaluronidase would facilitate passage through the epidermis and dermis during larval invasion. Zoonotic hookworm larvae of the genus Ancylostoma were shown to contain a hyaluronidase activity that migrated on modified sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE) hyaluronic acid gels with an appar...

  2. Stable isotopic analysis of Barnacle larvae and their faecal pellets to evaluate the ingested food

    Digital Repository Service at National Institute of Oceanography (India)

    Gaonkar, C.A.; Anil, A.C.

    larvae fed with C. calcitrans diet pointed out an enrichment in sup(13)C by 0.95 ppt and sup(15)N by 1.42 ppt. The enrichment level in the faecal pellets was comparatively higher than that obtained from the larvae either fed or starved indicating the role...

  3. INDEKS ENTOMOLOGI DAN KERENTANAN LARVA Aedes aegypti TERHADAP TEMEFOS DI KELURAHAN KARSAMENAK KECAMATAN KAWALU KOTA TASIKMALAYA

    OpenAIRE

    Hubullah Fuadzy; Joni Hendri

    2015-01-01

    AbstrakSalah satu upaya pengendalian vektor nyamuk Aedes aegypti adalah menggunakan larvasida sintetis seperti temefos. Pemanfaatan temefos secara terus menerus dan berulang merupakan faktor risiko terjadinya resistensi. Tujuan penelitian ini adalah untuk menentukan indeks entomologi dan status kerentanan larva Ae. aegypti terhadap temefos di Kelurahan Karsamenak Kecamatan Kawalu Kota Tasikmalaya. Jenis penelitian adalah eksperimen dengan rancangan acak lengkap. Populasi adalah larva nyamuk A...

  4. Black soldier fly (Diptera: Stratiomyidae) larvae reduce Escherichia coli in dairy manure.

    Science.gov (United States)

    Liu, Qiaolin; Tomberlin, Jeffery K; Brady, Jeff A; Sanford, Michelle R; Yu, Ziniu

    2008-12-01

    Escherichia coli labeled with a green fluorescent protein was inoculated into sterile dairy manure at 7.0 log cfu/g. Approximately 125 black soldier fly larvae were placed in manure inoculated and homogenized with E. coli. Manure inoculated with E. coli but without black soldier fly larvae served as the control. For the first experiment, larvae were introduced into 50, 75, 100, or 125 g sterilized dairy manure inoculated and homogenized with E. coli and stored 72 h at 27 degrees C. Black soldier fly larvae significantly reduced E. coli counts in all treatments. However, varying the amount of manure provided the black soldier fly larvae significantly affected their weight gain and their ability to reduce E. coli populations present. For the second experiment, larvae were introduced into 50 g manure inoculated with E. coli and stored for 72 h at 23, 27, 31, or 35 degrees C. Minimal bacterial growth was recorded in the control held at 35 degrees C and was excluded from the analysis. Black soldier fly larvae significantly reduced E. coli counts in manure held at remaining temperatures. Accordingly, temperature significantly influenced the ability of black soldier fly larvae to develop and reduce E. coli counts with greatest suppression occurring at 27 degrees C. PMID:19161696

  5. The intestinal bacterial community in the food waste-reducing larvae of Hermetia illucens.

    Science.gov (United States)

    Jeon, Hyunbum; Park, Soyoung; Choi, Jiyoung; Jeong, Gilsang; Lee, Sang-Beom; Choi, Youngcheol; Lee, Sung-Jae

    2011-05-01

    As it is known that food waste can be reduced by the larvae of Hermetia illucens (Black soldier fly, BSF), the scientific and commercial value of BSF larvae has increased recently. We hypothesised that the ability of catabolic degradation by BSF larvae might be due to intestinal microorganisms. Herein, we analysed the bacterial communities in the gut of BSF larvae by pyrosequencing of extracting intestinal metagenomic DNA from larvae that had been fed three different diets. The 16S rRNA sequencing results produced 9737, 9723 and 5985 PCR products from larval samples fed food waste, cooked rice and calf forage, respectively. A BLAST search using the EzTaxon program showed that the bacterial community in the gut of larvae fed three different diets was mainly composed of the four phyla with dissimilar proportions. Although the composition of the bacterial communities depended on the different nutrient sources, the identified bacterial strains in the gut of BSF larvae represented unique bacterial species that were unlike the intestinal microflora of other insects. Thus, our study analysed the structure of the bacterial communities in the gut of BSF larvae after three different feedings and assessed the application of particular bacteria for the efficient degradation of organic compounds. PMID:21267722

  6. Chemically mediated group formation in soil-dwelling larvae and pupae of the beetle Trypoxylus dichotomus

    Science.gov (United States)

    Kojima, Wataru; Ishikawa, Yukio; Takanashi, Takuma

    2014-09-01

    Many insects form groups through interactions among individuals, and these are often mediated by chemical, acoustic, or visual cues and signals. In spite of the diversity of soil-dwelling insects, their aggregation behaviour has not been examined as extensively as that of aboveground species. We investigated the aggregation mechanisms of larvae of the Japanese rhinoceros beetle Trypoxylus dichotomus, which live in groups in humus soil. In two-choice laboratory tests, 2nd- and 3rd-instar larvae gathered at conspecific larvae irrespective of the kinship. The ablation of maxillae, which bear chemosensilla, abolished aggregation behaviour. Intact larvae also exhibited aggregation behaviour towards a larval homogenate. These results suggest that larval aggregation is mediated by chemical cues. We also demonstrated that the mature larvae of T. dichotomus built their pupal cells close to a mesh bag containing a conspecific pupal cell, which indicated that larvae utilize chemical cues emanating from these cells to select the pupation site. Thus, the larvae of T. dichotomus may use chemical cues from the conspecifics in two different contexts, i.e. larval aggregation and pupation site selection. Using conspecific cues, larvae may be able to choose suitable locations for foraging or building pupal cells. The results of the present study highlight the importance of chemical information in belowground ecology.

  7. Virulence of metalloproteases produced by Vibrio species on Pacific oyster Crassostrea gigas larvae.

    Science.gov (United States)

    Hasegawa, Hiroaki; Gharaibeh, Dima N; Lind, Erin J; Häse, Claudia C

    2009-06-10

    Vibrio tubiashii, a pathogen of shellfish larvae and juveniles, produces several extracellular products. Here, we document that culture supernatants of several marine Vibrio species showed toxicity to oyster larvae. Treatment of these supernatants with EDTA not only severely diminished proteolytic activities, but also dramatically reduced toxicity to the larvae. Culture supernatants of metalloprotease-deficient mutants of V. tubiashii, V. cholerae, and V. splendidus were impaired in their ability to cause larval death compared to the wild type strains. Culture supernatants of Pseudomonas aeruginosa, known to contain several secreted proteases, showed virtually no toxicity to oyster larvae. Purified V. tubiashii protease A (VtpA), but not the prototype metalloprotease, thermolysin from Bacillus thermoproteolyticus, was highly toxic to the larvae. In addition, toxicity of purified VtpA was much greater for 6-d-old oyster larvae than for 16-d-old larvae. Together, these results indicated that culture supernatants of a variety of Vibrio species are highly toxic to oyster larvae and that the production of a metalloprotease is required for this effect. We propose that there are, as yet uncharacterized, specific substrates contained in larval tissue that are degraded by VtpA as well as certain homologous metalloproteases produced by other marine Vibrio species which, in turn, may contribute to vibriosis.

  8. Estimating reproductive success of Aethina tumida (Coleoptera: Nitidulidae) in honey bee colonies by trapping emigrating larvae.

    Science.gov (United States)

    Arbogast, Richard T; Torto, Baldwyn; Willms, Steve; Fombong, Ayuka T; Duehl, Adrian; Teal, Peter E A

    2012-02-01

    The small hive beetle (Aethina tumida Murray) is a scavenger and facultative predator in honey bee colonies, where it feeds on pollen, honey, and bee brood. Although a minor problem in its native Africa, it is an invasive pest of honey bees in the United States and Australia. Adult beetles enter bee hives to oviposit and feed. Larval development occurs within the hive, but mature larvae leave the hive to pupate in soil. The numbers leaving, which can be estimated by trapping, measure the reproductive success of adult beetles in the hive over any given period of time. We describe a trap designed to intercept mature larvae as they reach the end of the bottom board on their way to the ground. Trap efficiency was estimated by releasing groups of 100 larvae into empty brood boxes and counting the numbers trapped. Some larvae escaped, but mean efficiency ranged from 87.2 to 94.2%. We envision the trap as a research tool for study of beetle population dynamics, and we used it to track numbers of larvae leaving active hives for pupation in the soil. The traps detected large increases and then decreases in numbers of larvae leaving colonies that weakened and died. They also detected small numbers of larvae leaving strong European and African colonies, even when no larvae were observed in the hives. PMID:22525070

  9. Description of the larvae of Hydroporus ferrugineus Stephens and H-polaris fall (Coleoptera: Adephaga: Dytiscidae)

    NARCIS (Netherlands)

    Alarie, Y.; Wood, P.J.; Bruyn, de A.M.H.; Cuppen, J.G.M.

    2001-01-01

    Description of structures of the larvae of Hydroporus ferrugineus Stephens and H. polaris Fall is provided including detailed chaetotaxal and porotaxal analyses. Larvae of H. ferrugineus are distinguished from all other species of Hydroporus Clairville by the presence of 1–2 secondary setae on urogo

  10. Alterations in the fat body and midgut of Culex quinquefasciatus larvae following exposure to different insecticides.

    Science.gov (United States)

    Alves, Stênio Nunes; Serrão, José Eduardo; Melo, Alan Lane

    2010-08-01

    This study describes morphological alterations in the fat body and midgut of Culex quinquefasciatus larvae following exposure to different insecticides. To this end, both third and fourth instars of C. quinquefasciatus larvae were exposed for 30 and 60 min to organophosphate (50 ppb), pyrethroids (20 and 30 ppb), and avermectin derivates (1.5 and 54 ppb). Following incubation, pH measurements of the larvae gut were recorded. The fat body and midgut were also analyzed by light and transmission electron microscopy. These studies demonstrate a decrease in the pH of the larvae anterior midgut following exposure to all of the tested insecticides. Histochemical tests revealed a strong reaction for neutral lipids in the control group and a marked decrease in the group exposed to cypermethrin. Furthermore, a weak reaction with acidic lipids in larvae exposed to deltamethrin, temephos, ivermectin and abamectin was also observed. Insecticide-exposed larvae also exhibited cytoplasm granule differences, relative to control larvae. Finally, we noted a small reduction in microvilli size in the apex of digestive cells, although vesicles were found to be present. The destructive changes in the larvae were very similar regardless of the type of insecticide analyzed. These data suggest that alterations in the fat body and midgut are a common response to cellular intoxication.

  11. Chemical Composition and Food Potential of Pachymerus nucleorum Larvae Parasitizing Acrocomia aculeata Kernels.

    Science.gov (United States)

    Alves, Ariana Vieira; Sanjinez Argandoña, Eliana Janet; Linzmeier, Adelita Maria; Cardoso, Claudia Andrea Lima; Macedo, Maria Lígia Rodrigues

    2016-01-01

    Insect consumption as food is culturally practiced in various regions of the world. In Brazil, there are more than 130 species of edible insects registered, from nine orders, among which stands out the Coleoptera. The larva of the beetle Pachymerus nucleorum Fabricius, 1792, grows into the bocaiuva fruit (Acrocomia aculeata (Jacq.) Lodd. Ex Mart., 1845), which has proven nutritional quality. The aim of this work was to evaluate the nutritional potential of P. nucleorum larvae compared to bocaiuva kernels for human consumption. Proteins were the second largest portion of the larvae nutritional composition (33.13%), with percentage higher than the bocaiuva kernels (14.21%). The larval lipid content (37.87%) was also high, very close to the kernels (44.96%). The fraction corresponding to fatty acids in the oil extracted from the larvae was 40.17% for the saturated and 46.52% for the unsaturated. The antioxidant activity value was 24.3 uM trolox/g of oil extracted from larvae. The larvae tryptic activity was 0.032±0.006 nmol BAPNA/min. Both the larvae and the bocaiuva kernel presented absence of anti-nutritional factors. These results favor the use of P. nucleorum larvae as food, which are a great protein and lipid sources with considerable concentrations of unsaturated fatty acids compared to the bocaiuva kernel. PMID:27031500

  12. Genes Expressed Differentially in Hessian Fly Larvae Feeding in Resistant and Susceptible Plants

    Science.gov (United States)

    Chen, Ming-Shun; Liu, Sanzhen; Wang, Haiyan; Cheng, Xiaoyan; El Bouhssini, Mustapha; Whitworth, R. Jeff

    2016-01-01

    The Hessian fly, Mayetiola destructor, is a destructive pest of wheat worldwide and mainly controlled by deploying resistant cultivars. In this study, we investigated the genes that were expressed differentially between larvae in resistant plants and those in susceptible plants through RNA sequencing on the Illumina platform. Informative genes were 11,832, 14,861, 15,708, and 15,071 for the comparisons between larvae in resistant versus susceptible plants for 0.5, 1, 3, and 5 days, respectively, after larvae had reached the feeding site. The transcript abundance corresponding to 5401, 6902, 8457, and 5202 of the informative genes exhibited significant differences (p ≤ 0.05) in the respective paired comparisons. Overall, genes involved in nutrient metabolism, RNA and protein synthesis exhibited lower transcript abundance in larvae from resistant plants, indicating that resistant plants inhibited nutrient metabolism and protein production in larvae. Interestingly, the numbers of cytochrome P450 genes with higher transcript abundance in larvae from resistant plants were comparable to, or higher than those with lower transcript abundance, indicating that toxic chemicals from resistant plants may have played important roles in Hessian fly larval death. Our study also identified several families of genes encoding secreted salivary gland proteins (SSGPs) that were expressed at early stage of 1st instar larvae and with more genes with higher transcript abundance in larvae from resistant plants. Those SSGPs are candidate effectors with important roles in plant manipulation. PMID:27529231

  13. Entomopathogenic fungi disturbed the larval growth and feeding performance of Ocinara varians (Lepidoptera: Bombycidae) larvae

    Institute of Scientific and Technical Information of China (English)

    Abid Hussain; Ming-Yi Tian; Yu-Rong He; Sohail Ahmed

    2009-01-01

    Feeding experiments using three strains of entomopathogenic fungi, Beauveria bassiana, Metarhizium anisopliae and Isaria fumosorosea were conducted with newly moulted 3rd-5th instar Ocinara varians Walker larvae in the laboratory. The mortality of larvae immersed individually in spore suspension (1×10~7 spores/mL) of all the strains was > 80% except 5th instar larvae treated with M. anisopliae which transformed into pupae, but did not result in adult emergence. The growth (total body mass), consumption, relative consumption rate and relative growth rate, were reduced at all three larval stages, while developmental time was extended in infected larvae with concurrent significant increase in approximate digestibility in infected larvae. Conversion of digested food (ECD) and ingested food (ECI) values declined in infected larvae as compared to the healthy larvae (control). The 5th instar larvae treated with M. anisopliae showed higher ECD and ECI values than control. Based on mortality and growth inhibition it can be suggested that all the studied fungal strains have a high potential for biocontrol and could be developed into biocontrol agents against O. varians.

  14. The potential for cryopreserving larvae of the sea urchin, Evechinus chloroticus.

    Science.gov (United States)

    Adams, Serean L; Hessian, Paul A; Mladenov, Philip V

    2006-02-01

    Larvae of the sea urchin, Evechinus chloroticus, at varying stages of development, were assessed for their potential to survive cryopreservation. Ethylene glycol (EG) and dimethyl sulphoxide (Me2SO), at concentrations of 1-2 M, were evaluated as cryoprotectants (CPAs) in freezing regimes initially based on methods established for freezing larvae of other sea urchin species. Subsequent work varied cooling rate, holding temperature, holding time, and plunge temperature. Ethylene glycol was less toxic to larvae than Me2SO. However, no larvae survived freezing and thawing in EG. Larvae frozen in Me2SO at the gastrula stage and 4-armed pluteus stage regained motility post-thawing. The most successful freezing regime cooled straws containing larvae in 1.5 M Me2SO from 0 to -35 degrees C at 2.5 degrees C min(-1), held at -35 degrees C for 5 min, then plunged straws into liquid nitrogen. Motility was high 2-4 h post-thawing using this regime but decreased markedly within 24 h. Some 4-armed pluteus larvae that survived beyond this time developed through to metamorphosis and settled. Different Me2SO concentrations and supplementary trehalose did not improve long-term survival. Large variation in post-thaw survival was observed among batches of larvae produced from different females. PMID:16321369

  15. Xenodiagnóstico na Habronemose dos Equídeos: estudo das larvas do Helminto

    Directory of Open Access Journals (Sweden)

    Jônio F. de Sales

    1945-02-01

    Full Text Available Xenodiagnosis for habronemosis was 96,6% positive in 87 stud horses at Instituto Oswaldo Cuz, Rio de Janeiro, Brazil, from July-November, 1944. The A A. were unable to identify the Habronema larvae obtained from parasitider fly maggots. Measurements and drawings of the larvae are presented.

  16. Chemical Composition and Food Potential of Pachymerus nucleorum Larvae Parasitizing Acrocomia aculeata Kernels.

    Directory of Open Access Journals (Sweden)

    Ariana Vieira Alves

    Full Text Available Insect consumption as food is culturally practiced in various regions of the world. In Brazil, there are more than 130 species of edible insects registered, from nine orders, among which stands out the Coleoptera. The larva of the beetle Pachymerus nucleorum Fabricius, 1792, grows into the bocaiuva fruit (Acrocomia aculeata (Jacq. Lodd. Ex Mart., 1845, which has proven nutritional quality. The aim of this work was to evaluate the nutritional potential of P. nucleorum larvae compared to bocaiuva kernels for human consumption. Proteins were the second largest portion of the larvae nutritional composition (33.13%, with percentage higher than the bocaiuva kernels (14.21%. The larval lipid content (37.87% was also high, very close to the kernels (44.96%. The fraction corresponding to fatty acids in the oil extracted from the larvae was 40.17% for the saturated and 46.52% for the unsaturated. The antioxidant activity value was 24.3 uM trolox/g of oil extracted from larvae. The larvae tryptic activity was 0.032±0.006 nmol BAPNA/min. Both the larvae and the bocaiuva kernel presented absence of anti-nutritional factors. These results favor the use of P. nucleorum larvae as food, which are a great protein and lipid sources with considerable concentrations of unsaturated fatty acids compared to the bocaiuva kernel.

  17. A complex of genes involved in adaptation of Leptinotarsa decemlineata larvae to induced potato defence

    NARCIS (Netherlands)

    Petek, M.; Turnšek, N.; Gašparic, M.B.; Novak, M.P.; Gruden, K.; Slapar, N.; Popovic, T.; Štrukelj, B.; Jongsma, M.A.

    2012-01-01

    The Colorado potato beetle (Leptinotarsa decemlineata) is the most important pest of potato in many areas of the world. One of the main reasons for its success lies in the ability of its larvae to counteract plant defense compounds. Larvae adapt to protease inhibitors (PIs) produced in potato leaves

  18. Radiolabeling and autoradiographic tracing of Toxocara canis larvae in male mice

    Energy Technology Data Exchange (ETDEWEB)

    Wade, S.E.; Georgi, J.R.

    1987-02-01

    Artificially hatched infective larvae of Toxocara canis were labeled with /sup 75/Se in Medium 199 (Gibco) containing /sup 75/Se-methionine. Male CD-1 mice were infected with radiolabeled larvae by intragastric intubation or by intraperitoneal injection. At intervals of 3-56 days mice were killed and the organs prepared for compressed organ autoradiography. Radioactivity of parasitic larvae showed an exponential decrease with time, reflecting catabolism of label with a biological half life of 26 days (effective half life of 21 days) making possible experiments lasting several months. Total body larva counts, estimated by total body autoradiography, displayed an overall downward trend, but the rate of reduction was probably not constant because no significant positive or negative trends were noted from day 14 onward in the numbers of larvae. The carcass accumulated the greatest number of larvae followed by the central nervous system, liver, and lung in that order. When the numbers of larvae were considered in relationship to the mass of tissue, there were 4 groupings: central nervous system, liver, lung, carcass, and kidney, and genito-urinary organ, pelt, and intestine. No significant difference between intragastric and intraperitoneal administration was observed in the larval distribution after the larvae had left the initial site of deposition.

  19. Molecular endocrine changes of Gh/Igf1 axis in gilthead sea bream (Sparus aurata L.) exposed to different environmental salinities during larvae to post-larvae stages.

    Science.gov (United States)

    Mohammed-Geba, Khaled; Yúfera, Manuel; Martínez-Rodríguez, Gonzalo; Mancera, Juan Miguel

    2016-08-01

    The influence of acclimation of the euryhaline gilthead sea bream (Sparus aurata) larvae/post-larvae to brackish water on growth, energetic contents, and mRNA levels of selected hormones and growth-regulating hypothalamic neurohormones was assessed. Specimens from 49 days post-hatching were acclimated during 28 days to two different environmental salinities: 38 and 20 psu (as brackish water). Both groups were then transferred to 38 psu and acclimated for an additional week. Early juveniles were sampled after 28 days of acclimation to both salinities and one week after transfer to 38 psu. Pituitary adenylate cyclase-activating peptide (adcyap1; pacap), somatostatin-I (sst1), growth hormone (gh1), insulin-like growth factor-I (igf1), and prolactin (prl) mRNA expression were all studied by QPCR. Post-larvae acclimated to 20 psu showed better growth performance and body energetic content than post-larvae maintained at 38 psu. prl, adcyap1, and igf1 mRNA expression levels increased in 20-psu-acclimated post-larvae but decreased upon transfer to 38 psu. GH1 expression did not show significant changes under both experimental conditions. Our results suggested an enhanced general performance for post-larvae in brackish water, supported by the actions of adcyap1, igf1, and prl. PMID:26947706

  20. ROLE OF FINE NEEDLE ASPIRATION CYTOLOGY (FNAC) IN DIAGNOSIS OF ASYMPTOMATIC MICROFILARIASIS

    OpenAIRE

    Reena; Rajesh; Nitin

    2015-01-01

    Filariasis is a tropical and subtropical disease caused by Wuchereria Bancrofti and Brugia Malayi and transmitted by Culex mosquito. Lymphatic Filariasis is a major health problem in countries like India, China, Indonesia, and Africa. Diagnosis of Filari a is done by conventional methods like peripheral blood smear examination, Fluorescent capillary method and filarial antigen detection by Rapid card method. Here we present four unusual cases with swellings presented in surg...

  1. A review of the complexity of biology of lymphatic filarial parasites

    OpenAIRE

    K. P. Paily; Hoti, S. L.; Das, P K

    2009-01-01

    There are about five more common, including Wuchereria bancrofti and Brugia malayi, and four less common filarial parasites infecting human. Genetic analysis of W. bancrofti populations in India showed that two strains of the species are prevalent in the country. The adult filarial parasites are tissue specific in the human host and their embryonic stage, called microfilariae (mf), are found in the blood or skin of the host, depending upon the species of the parasite. Three genetically determ...

  2. Multiplex Bead Assay for Serum Samples from Children in Haiti Enrolled in a Drug Study for the Treatment of Lymphatic Filariasis

    OpenAIRE

    Moss, Delynn M.; Priest, Jeffrey W.; Boyd, Alexis; Weinkopff, Tiffany; Kucerova, Zuzana; Beach, Michael J.; Lammie, Patrick J

    2011-01-01

    A multiplex bead assay (MBA) was used to analyze serum samples collected longitudinally from children enrolled in a drug trial for treatment of filariasis in Leogane, Haiti. Recombinant antigens Bm14 and Bm33 from Brugia malayi, third polar tube protein (PTP3) from Encephalitozoon cuniculi, and merozoite surface protein-119 (MSP-119) from Plasmodium falciparum were coupled to carboxylated polystyrene microspheres. IgG responses to PTP3 and MSP-119 were not affected by albendazole (ALB), dieth...

  3. Random Amplified Polymorphic DNA (RAPD) for differentiation between Thai and Myanmar strains of Wuchereria bancrofti

    OpenAIRE

    Nuchprayoon, Surang; Junpee, Alisa; Poovorawan, Yong

    2007-01-01

    Background Lymphatic filariasis (LF) is a mosquito-borne disease caused by mosquito-transmitted filarial nematodes, including Wuchereria bancrofti and Brugia malayi. The Lymphatic Filariasis Elimination Program in Thailand has reduced the prevalence of nocturnally subperiodic W. bancrofti (Thai strain), mainly transmitted by the Ochlerotatus (Aedes) niveus group in Thailand to 0.57/100,000 population. However, it is estimated that more than one million Myanmar migrants with high prevalence of...

  4. The complete mitochondrial genome sequence of the filarial nematode Wuchereria bancrofti from three geographic isolates provides evidence of complex demographic history

    OpenAIRE

    Ramesh, Akshaya; Small, Scott T; Kloos, Zachary A.; Kazura, James W; Nutman, Thomas B.; Serre, David; Zimmerman, Peter A

    2012-01-01

    Mitochondrial (mt) genome sequences have enabled comparison of population genetics and evolution for numerous free-living and parasitic nematodes. Here we define the complete mt genome of Wuchereria bancrofti through analysis of isolates from Papua New Guinea, India and West Africa. Sequences were assembled for each isolate and annotated with reference to the mt genome sequence for Brugia malayi. The length of the W. bancrofti mt genome is approximately 13,637 nucleotides, contains 2 ribosoma...

  5. Presence of Wolbachia endosymbionts in microfilariae of Wuchereria bancrofti (Spirurida: Onchocercidae) from different geographical regions in India

    OpenAIRE

    Hoti SL; Sridhar A.; PK Das

    2003-01-01

    In view of the recent discovery of rickettsial endosymbionts, Wolbachia in lymphatic filarial parasites, Wuchereria bancrofti and Brugia malayi and subsequently of their vital role in the survival and development of the latter, antibiotics such as tetracycline are being suggested for the treatment of lymphatic filariasis, by way of eliminating the endosymbiont. But, it is essential to assess their presence in parasites from areas endemic for lymphatic filariasis before such a new control tool...

  6. Plasmodium knowlesi and Wuchereria bancrofti: Their Vectors and Challenges for the Future

    OpenAIRE

    Vythilingam, Indra

    2012-01-01

    Malaria and filariasis still continue to pose public health problems in developing countries of the tropics. Although plans are in progress for the elimination of both these parasitic vector borne diseases, we are now faced with a daunting challenge as we have a fifth species, Plasmodium knowlesi a simian malaria parasite affecting humans. Similarly in peninsular Malaysia, filariasis was mainly due to Brugia malayi. However, we now see cases of Wuchereria bancrofti in immigrant workers coming...

  7. Host protective immunity and vaccine development studies in lymphatic filariasis

    OpenAIRE

    Reddy, M. V. R.; Alli, R.; Harinath, B. C.

    2000-01-01

    Lymphatic filariasis caused mainly by infection fromWuchereria bancrofti andBrugia malayi remains as the major cause of clinical morbidity in tropical and subtropical countries. Development of vaccine against filarial infection can act as additional measure to the existing therapeutic and vector control methods in the control of this disease. The main hurdles in the development of anti-filarial vaccine are the strict primate specificity ofWuchereria bancrofti, the paucity of parasite material...

  8. Repurposing Auranofin as a Lead Candidate for Treatment of Lymphatic Filariasis and Onchocerciasis

    OpenAIRE

    Bulman, Christina A.; Bidlow, Chelsea M.; Sara Lustigman; Fidelis Cho-Ngwa; David Williams; Rascón, Alberto A; Nancy Tricoche; Moses Samje; Aaron Bell; Brian Suzuki; K C Lim; Nonglak Supakorndej; Prasit Supakorndej; Wolfe, Alan R.; Knudsen, Giselle M.

    2015-01-01

    Two major human diseases caused by filariid nematodes are onchocerciasis, or river blindness, and lymphatic filariasis, which can lead to elephantiasis. The drugs ivermectin, diethylcarbamazine (DEC), and albendazole are used in control programs for these diseases, but are mainly effective against the microfilarial stage and have minimal or no effect on adult worms. Adult Onchocerca volvulus and Brugia malayi worms (macrofilariae) can live for up to 15 years, reproducing and allowing the infe...

  9. Single multivalent vaccination boosted by trickle larval infection confers protection against experimental lymphatic filariasis

    OpenAIRE

    Joseph, SK; Ramaswamy, K.

    2013-01-01

    The multivalent vaccine BmHAT, consisting of the Brugia malayi infective larval (L3) antigens heat shock protein12.6 (HSP12.6), abundant larval transcript-2 (ALT-2) and tetraspanin large extra cellular loop (TSP-LEL), was shown to be protective in rodent models from our laboratory. We hypothesize that since these antigens were identified using protective antibodies from immune endemic normal individuals, the multivalent vaccine can be augmented by natural L3 infections providing protection to...

  10. Genomics of Loa loa, a Wolbachia-free filarial parasite of humans

    OpenAIRE

    Desjardins, Christopher A.; Cerqueira, Gustavo C.; Goldberg, Jonathan M.; Hotopp, Julie C Dunning; Haas, Brian J.; Zucker, Jeremy; Ribeiro, Jose’ M.C.; Saif, Sakina; Levin, Joshua Z.; Fan, Lin; Zeng, Qiandong; Russ, Carsten; Wortman, Jennifer R.; Fink, Doran L.; Birren, Bruce W.

    2014-01-01

    Loa loa, the African eyeworm, is a major filarial pathogen of humans. Unlike most filariae, Loa loa does not contain the obligate intracellular Wolbachia endosymbiont. We describe the 91.4 Mb genome of Loa loa, and the genome of the related filarial parasite Wuchereria bancrofti, and predict 14,907 Loa loa genes based on microfilarial RNA sequencing. By comparing these genomes to that of another filarial parasite, Brugia malayi, and to several other nematode genomes, we demonstrate synteny am...

  11. Role of fine needle aspiration cytology in diagnosing filarial arm cysts

    OpenAIRE

    Tandon, Nishi; Bansal, Cherry; Sharma, Richa; Irfan, Sumaiya

    2013-01-01

    Filariasis is prevalent in tropical and subtropical areas and is endemic in regions of India. Lymphatic filariasis in India is caused mainly by two species of nematodes: Wuchereria bancrofti and Brugia malayi, which invade the human lymphatic system. We report two cases of superficial cystic lesions of the upper limb revealed on fine needle aspiration (FNA) to be clinically unsuspected filariasis. Despite similar aetiologies, both cases revealed variations in aspirate nature, smear morphology...

  12. Characterizing Ancylostoma caninum transcriptome and exploring nematode parasitic adaptation

    OpenAIRE

    Hawdon John; Wilson Richard K; Martin John; Abubucker Sahar; Wang Zhengyuan; Mitreva Makedonka

    2010-01-01

    Abstract Background Hookworm infection is one of the most important neglected diseases in developing countries, with approximately 1 billion people infected worldwide. To better understand hookworm biology and nematode parasitism, the present study generated a near complete transcriptome of the canine hookworm Ancylostoma caninum to a very high coverage using high throughput technology, and compared it to those of the free-living nematode Caenorhabditis elegans and the parasite Brugia malayi....

  13. Nematodes parasitic in fishes of cenotes (= sinkholes) of the Peninsula of Yucatan, Mexico. Part 2. Larvae.

    Science.gov (United States)

    Moravec, F; Vivas-Rodríguez, C; Scholz, T; Vargas-Vázquez, J; Mendoza-Franco, E; Schmitter-Soto, J J; González-Solís, D

    1995-01-01

    This paper comprises a systematic survey of larval nematodes collected from fishes from cenotes (= sinkholes) of the Peninsula of Yucatan, southern Mexico, in 1993-1994. Larvae of the following nine species were recorded: Physocephalus sexalatus, Acuariidae gen. sp., Spiroxys sp., Falcaustra sp., Hysterothylacium cenotae, Contracaecum sp. Type 1, Contracaecum sp. Type 2, Goezia sp., and Eustrongylides sp. Larvae of P. sexalatus are recorded from fishes (Rhamdia guatemalensis) for the first time. The larvae are briefly described and illustrated and problems concerning their morphology, taxonomy, hosts and geographical distribution are discussed. Adults of these larvae are parasitic in piscivorous fishes, reptiles, birds and mammals (definitive hosts). Fishes harbouring the larvae of these parasites serve as paratenic hosts, being mostly an important source of infection for the definitive hosts. PMID:8774773

  14. Effects of pesticides on DNA and protein of shrimp larvae Litopenaeus stylirostris of the California Gulf.

    Science.gov (United States)

    Galindo Reyes, J Guillermo; Leyva, Nancy R; Millan, Olivia A; Lazcano, Guadalupe A

    2002-10-01

    Recently, diverse pathologies and massive mortalities have been presented in shrimp hatcheries located along the California Gulf; therefore, toxic responses of shrimp larvae were used as biomarkers of pesticide pollution, because in this region intensive agriculture is practiced. Shrimp larvae were exposed to DDT, azinphosmethyl, permethrine, parathion, chlorpyrifos, malathion, endosulfan, and carbaryl, in order to determine LC50, DNA adducts and/or breaks, and total protein in larvae. The results indicate reductions in protein and DNA in larvae exposed to these pesticides, and in those exposed to DDT, breaks and/or adducts were registered. It is possible that pesticide pollution is a cause of these problems, because reduction in protein indicates a decrease in larvae growth rate and DNA breaks or adducts have been related to pathologies and carcinogenesis in many aquatic organisms. PMID:12568452

  15. Scanning electron microscope observations of brine shrimp larvae from space shuttle experiments

    Science.gov (United States)

    DeBell, L.; Paulsen, A.; Spooner, B.

    1992-01-01

    Brine shrimp are encysted as gastrula stage embryos, and may remain dehydrated and encysted for years without compromising their viability. This aspect of brine shrimp biology is desirable for studying development of animals during space shuttle flight, as cysts placed aboard a spacecraft may be rehydrated at the convenience of an astronaut, guaranteeing that subsequent brine shrimp development occurs only on orbit and not on the pad during launch delays. Brine shrimp cysts placed in 5 ml syringes were rehydrated with salt water and hatched during a 9 day space shuttle mission. Subsequent larvae developed to the 8th larval stage in the sealed syringes. We studied the morphogenesis of the brine shrimp larvae and found the larvae from the space shuttle experiments similar in rate of growth and extent of development, to larvae grown in sealed syringes on the ground. Extensive differentiation and development of embryos and larvae can occur in a microgravity environment.

  16. Ultrastructural characteristics of nurse cell-larva complex of four species of Trichinella in several hosts

    Directory of Open Access Journals (Sweden)

    Sacchi L.

    2001-06-01

    Full Text Available The nurse cell-larva complex of nematodes of the genus Trichinella plays an Important role in the survival of the larva in decaying muscles, frequently favouring the transmission of the parasite in extreme environmental conditions. The ultrastructure of the nurse cell-larva complex in muscles from different hosts infected with T. nativa (a walrus and a polar bear, T. spiralis (horses and humans, T. pseudospiralis (a laboratory mouse and T. papuae (a laboratory mouse were examined. Analysis with transmission electron microscope showed that the typical nurse cell structure was present in all examined samples, irrespective of the species of larva, of the presence of a collagen capsule, of the age of infection and of the host species, suggesting that there exists a molecular mechanism that in the first stage of larva invasion is similar for encapsulated and non-encapsulated species.

  17. Excision of furuncular myiasis larvae using a punch: a simple, practical and aesthetic method*

    Science.gov (United States)

    Pascoal, Gianne; de Oliveira, Fernanda Queiroz; Siqueira, Rosana Rocon; Lopes, Maria Gabriela Araújo; Martins Neto, Marcelino Pereira; Gamonal, Aloísio Carlos Couri

    2016-01-01

    Myiasis refers to Diptera larvae infesting vertebrate animals. There are two forms of the disease: primary and secondary. In primary myiasis, fly larvae invade and develop in healthy tissue; in secondary myiasis, flies lay their eggs in skin ulcerations, and the larvae develop in tissue necrosis products. Furuncular myiasis is a type of primary myiasis. Treatment for it consists of techniques such as the production of localized hypoxia to force the emergence of the larvae, and mechanical or surgical removal of the maggots. These techniques, however, are painful and often unsuccessful. We propose a new technique for extraction of myiasis larvae, which might facilitate the surgical procedure and constitute a virtually painless and aesthetic option for the patient. PMID:27438206

  18. Comparative study of cultivation of feces in vermiculite or charcoal to obtain larvae of Strongyloides venezuelensis

    Directory of Open Access Journals (Sweden)

    Steveen Rios Ribeiro

    2014-10-01

    Full Text Available Introduction We compared feces culturing in charcoal or vermiculite to obtain Strongyloides venezuelensis larvae. Methods Feces (5g from infected rats was mixed with vermiculite (10g or coal (10g in plastic cups and incubated at 28°C for 48h. Larvae were recovered using Baermann-Moraes method. Results Significantly higher number of positive larval cultures were recovered from vermiculite than from charcoal (15/17 and 4/17, respectively; p < 0.001; 990.6 ± 307.5 and 215 ± 78.1 larvae, p = 0.027. Conclusions Vermiculite yields more larvae and provides cleaner pellets, improving larvae identification and facilitating their use for other purposes.

  19. X-ray inactivation of Caenorhabditis elegans embryos or larvae

    Energy Technology Data Exchange (ETDEWEB)

    Ishi, N.; Suzuki, K. (Tokai Univ., Isehara, Kanagawa (Japan). School of Medicine)

    1990-11-01

    The lethal effects of X-irradiation were examined in staged populations of Caenorhabditis elegans embryos or larvae. Radiation resistance decreased slightly throughout the first, proliferative phase of embryogenesis. This might be due to the increase in target size, since most cells in C. elegans are autonomously determined. Animals irradiated in the second half of embryogenesis were about 40-fold more resistant to the lethal effects of X-rays. This is probably due to the absence of cell divisions during this time. The radiation resistance increased still more with advancing larval stages. A radiation hypersensitive mutant, rad-1, irradiated in the first half of embryogenesis, is about 30-fold more sensitive than wild-type, but in the second half it is the same as wild-type. (author).

  20. Integrative neuromechanics of crawling in D. melanogaster larvae

    Science.gov (United States)

    Pehlevan, Cengiz; Paoletti, Paolo; Mahadevan, L

    2016-01-01

    Locomotion in an organism is a consequence of the coupled interaction between brain, body and environment. Motivated by qualitative observations and quantitative perturbations of crawling in Drosophila melanogaster larvae, we construct a minimal integrative mathematical model for its locomotion. Our model couples the excitation-inhibition circuits in the nervous system to force production in the muscles and body movement in a frictional environment, thence linking neural dynamics to body mechanics via sensory feedback in a heterogeneous environment. Our results explain the basic observed phenomenology of crawling with and without proprioception, and elucidate the stabilizing role that proprioception plays in producing a robust crawling phenotype in the presence of biological perturbations. More generally, our approach allows us to make testable predictions on the effect of changing body-environment interactions on crawling, and serves as a step in the development of hierarchical models linking cellular processes to behavior. DOI: http://dx.doi.org/10.7554/eLife.11031.001

  1. Eggs containing larvae of Enterobius vermicularis in vaginal smear

    Directory of Open Access Journals (Sweden)

    Jyothi B Shetty

    2012-01-01

    Full Text Available Enterobius vermicularis also known commonly as pinworm is the most common intestinal parasite. It is a nematode that inhabits the human terminal ileum, colon and appendix. The fertilized female migrates to the perianal area where eggs are deposited but occasionally introduces itself into adjacent orifices, most commonly the female genitourinary tract. Thus the eggs can be seen in the vaginal smear as a result of contamination. We report a case wherein the patient presented with signs and symptoms of vulvovaginitis. In her vaginal smear there were eggs of Enterobius vermicularis which showed a coiled larva within it. In the background there were plenty of acute inflammatory cells. This patient responded favorably to antihelminthics. We report this case to highlight the morphology of the parasite and also to emphasize that such findings should not be neglected. Timely reporting and appropriate treatment of such cases will prevent further complications of this parasite including endometritis, salphingitis and peritonitis.

  2. Biochemistry and molecular biology of the Caenorhabditis elegans dauer larva

    Energy Technology Data Exchange (ETDEWEB)

    Wadsworth, W.G.

    1989-01-01

    Biochemical and molecular techniques have been used to study the formation and recovery of the developmentally arrested, non-feeding dauer stage of the nematode Caenorhabditis elegans. While investigating developmental transitions in energy metabolism, a major metabolite isolated from perchloric acid extracts has been identified as a modified uridine nucleotide. The compound was isolated by gel filtration and ion-exchange chromatography and its structure was determined by {sup 1}H NMR and {sup 13}C NMR spectroscopy. This compound is the most abundant metabolite detected in {sup 31}PMR spectra of perchloric acid extracts from growing larvae. In the absence of phosphoarginine or phosphocreatine, this modified nucleotide may have an important function in the nematode's energy metabolism, and it may also be found in several other invertebrates. During recovery from the dauer stage, metabolic activation is accompanied by a decrease in intracellular pH (pH{sub i}). Although metabolic activation has been associated with an alkaline pH{sub i} shift in other organisms, in vivo {sup 31}P NMR analysis of recovering dauer larvae shows a pH{sub i} decrease from {approximately}7.3 to {approximately}6.3 within 3 hr after the animals encounter food. This shift occurs before feeding begins, and coincides with, or soon follows, the development commitment to recover from the dauer stage, suggesting that control of pH{sub i} may be important in the regulation of larval development in nematodes. A library enriched for sequences expressed specifically during the L2d (predauer) stage was made by selecting plaques from a genomic lambda library that hybridized to subtracted L2d cDNA probes. Ultimately, three clones that were shown to hybridize only to L2d RNA were selected.

  3. Cellular and genetic analysis of wound healing in Drosophila larvae.

    Directory of Open Access Journals (Sweden)

    Michael J Galko

    2004-08-01

    Full Text Available To establish a genetic system to study postembryonic wound healing, we characterized epidermal wound healing in Drosophila larvae. Following puncture wounding, larvae begin to bleed but within an hour a plug forms in the wound gap. Over the next couple of hours the outer part of the plug melanizes to form a scab, and epidermal cells surrounding the plug orient toward it and then fuse to form a syncytium. Subsequently, more-peripheral cells orient toward and fuse with the central syncytium. During this time, the Jun N-terminal kinase (JNK pathway is activated in a gradient emanating out from the wound, and the epidermal cells spread along or through the wound plug to reestablish a continuous epithelium and its basal lamina and apical cuticle lining. Inactivation of the JNK pathway inhibits epidermal spreading and reepithelialization but does not affect scab formation or other wound healing responses. Conversely, mutations that block scab formation, and a scabless wounding procedure, provide evidence that the scab stabilizes the wound site but is not required to initiate other wound responses. However, in the absence of a scab, the JNK pathway is hyperinduced, reepithelialization initiates but is not always completed, and a chronic wound ensues. The results demonstrate that the cellular responses of wound healing are under separate genetic control, and that the responses are coordinated by multiple signals emanating from the wound site, including a negative feedback signal between scab formation and the JNK pathway. Cell biological and molecular parallels to vertebrate wound healing lead us to speculate that wound healing is an ancient response that has diversified during evolution.

  4. Effective de novo assembly of fish genome using haploid larvae.

    Science.gov (United States)

    Iwasaki, Yuki; Nishiki, Issei; Nakamura, Yoji; Yasuike, Motoshige; Kai, Wataru; Nomura, Kazuharu; Yoshida, Kazunori; Nomura, Yousuke; Fujiwara, Atushi; Kobayashi, Takanori; Ototake, Mitsuru

    2016-02-01

    Recent improvements in next-generation sequencing technology have made it possible to do whole genome sequencing, on even non-model eukaryote species with no available reference genomes. However, de novo assembly of diploid genomes is still a big challenge because of allelic variation. The aim of this study was to determine the feasibility of utilizing the genome of haploid fish larvae for de novo assembly of whole-genome sequences. We compared the efficiency of assembly using the haploid genome of yellowtail (Seriola quinqueradiata) with that using the diploid genome obtained from the dam. De novo assembly from the haploid and the diploid sequence reads (100 million reads per each datasets) generated by the Ion Proton sequencer (200 bp) was done under two different assembly algorithms, namely overlap-layout-consensus (OLC) and de Bruijn graph (DBG). This revealed that the assembly of the haploid genome significantly reduced (approximately 22% for OLC, 9% for DBG) the total number of contigs (with longer average and N50 contig lengths) when compared to the diploid genome assembly. The haploid assembly also improved the quality of the scaffolds by reducing the number of regions with unassigned nucleotides (Ns) (total length of Ns; 45,331,916 bp for haploids and 67,724,360 bp for diploids) in OLC-based assemblies. It appears clear that the haploid genome assembly is better because the allelic variation in the diploid genome disrupts the extension of contigs during the assembly process. Our results indicate that utilizing the genome of haploid larvae leads to a significant improvement in the de novo assembly process, thus providing a novel strategy for the construction of reference genomes from non-model diploid organisms such as fish. PMID:26478467

  5. Composition of agarose substrate affects behavioral output of Drosophila larvae

    Directory of Open Access Journals (Sweden)

    Anthi Aristomenis Apostolopoulou

    2014-01-01

    Full Text Available In the last decade the Drosophila larva has evolved into a simple model organism offering the opportunity to integrate molecular genetics with systems neuroscience. This led to a detailed understanding of the functional neuronal networks for a number of sensory functions and behaviors including olfaction, vision, gustation and learning and memory. Typically, behavioral assays in use exploit simple Petri dish setups with either agarose or agar as a substrate. However, neither the quality nor the concentration of the substrate is generally standardized across these experiments and there is no data available on how larval behavior is affected by such different substrates. Here, we have investigated the effects of different agarose concentrations on several larval behaviors. We demonstrate that agarose concentration is an important parameter, which affects all behaviors tested: preference, feeding, learning and locomotion. Larvae can discriminate between different agarose concentrations, they feed differently on them, they can learn to associate an agarose concentration with an odor stimulus and crawl faster on a substrate of higher agarose concentration. Additionally, we have investigated the effect of agarose concentration on three quinine based behaviors: preference, feeding and learning. We show that in all cases examined the behavioral output changes in an agarose concentration-dependent manner. Our results suggest that comparisons between experiments performed on substrates differing in agarose concentration should be done with caution. It should be taken into consideration that the agarose concentration can affect the behavioral output and thereby the experimental outcomes per se potentially due to an increased escape response on more rigid substrates.

  6. Effective de novo assembly of fish genome using haploid larvae.

    Science.gov (United States)

    Iwasaki, Yuki; Nishiki, Issei; Nakamura, Yoji; Yasuike, Motoshige; Kai, Wataru; Nomura, Kazuharu; Yoshida, Kazunori; Nomura, Yousuke; Fujiwara, Atushi; Kobayashi, Takanori; Ototake, Mitsuru

    2016-02-01

    Recent improvements in next-generation sequencing technology have made it possible to do whole genome sequencing, on even non-model eukaryote species with no available reference genomes. However, de novo assembly of diploid genomes is still a big challenge because of allelic variation. The aim of this study was to determine the feasibility of utilizing the genome of haploid fish larvae for de novo assembly of whole-genome sequences. We compared the efficiency of assembly using the haploid genome of yellowtail (Seriola quinqueradiata) with that using the diploid genome obtained from the dam. De novo assembly from the haploid and the diploid sequence reads (100 million reads per each datasets) generated by the Ion Proton sequencer (200 bp) was done under two different assembly algorithms, namely overlap-layout-consensus (OLC) and de Bruijn graph (DBG). This revealed that the assembly of the haploid genome significantly reduced (approximately 22% for OLC, 9% for DBG) the total number of contigs (with longer average and N50 contig lengths) when compared to the diploid genome assembly. The haploid assembly also improved the quality of the scaffolds by reducing the number of regions with unassigned nucleotides (Ns) (total length of Ns; 45,331,916 bp for haploids and 67,724,360 bp for diploids) in OLC-based assemblies. It appears clear that the haploid genome assembly is better because the allelic variation in the diploid genome disrupts the extension of contigs during the assembly process. Our results indicate that utilizing the genome of haploid larvae leads to a significant improvement in the de novo assembly process, thus providing a novel strategy for the construction of reference genomes from non-model diploid organisms such as fish.

  7. Impact of ultraviolet-B radiation on planktonic fish larvae: Alteration of the osmoregulatory function

    Energy Technology Data Exchange (ETDEWEB)

    Sucre, Elliott, E-mail: elliott.sucre@univ-montp2.fr [AEO Team (Adaptation Ecophysiologique et Ontogenese), UMR 5119 Ecosym UM2, CNRS, IRD, Ifremer, UM1, Universite Montpellier 2, cc092, Pl. Eugene Bataillon, 34095 Montpellier, Cx 05 (France); Vidussi, Francesca [RESEAUX Team (Reseaux Planctoniques et Changement Environnemental), UMR 5119 Ecosym UM2, CNRS, IRD, Ifremer, UM1, Universite Montpellier 2, cc093, Pl. Eugene Bataillon, 34095 Montpellier, Cx 05 (France); Mostajir, Behzad [RESEAUX Team (Reseaux Planctoniques et Changement Environnemental), UMR 5119 Ecosym UM2, CNRS, IRD, Ifremer, UM1, Universite Montpellier 2, cc093, Pl. Eugene Bataillon, 34095 Montpellier, Cx 05 (France); Centre d' ecologie marine experimentale MEDIMEER (Mediterranean centre for Marine Ecosystem Experimental Research), Universite Montpellier 2-CNRS (UMS 3301), Station Mediterraneenne de l' Environnement Littoral, MEDIMEER, 2 Rue des Chantiers, 34200 Sete (France); Charmantier, Guy; Lorin-Nebel, Catherine [AEO Team (Adaptation Ecophysiologique et Ontogenese), UMR 5119 Ecosym UM2, CNRS, IRD, Ifremer, UM1, Universite Montpellier 2, cc092, Pl. Eugene Bataillon, 34095 Montpellier, Cx 05 (France)

    2012-03-15

    Coastal marine ecosystems are submitted to variations of several abiotic and biotic parameters, some of them related to global change. Among them the ultraviolet-B (UV-B) radiation (UVBR: 280-320 nm) may strongly impact planktonic fish larvae. The consequences of an increase of UVBR on the osmoregulatory function of Dicentrarchus labrax larvae have been investigated in this study. In young larvae of D. labrax, as in other teleosts, osmoregulation depends on tegumentary ion transporting cells, or ionocytes, mainly located on the skin of the trunk and of the yolk sac. As early D. labrax larvae passively drift in the top water column, ionocytes are exposed to solar radiation. The effect of UVBR on larval osmoregulation in seawater was evaluated through nanoosmometric measurements of the blood osmolality after exposure to different UV-B treatments. A loss of osmoregulatory capability occured in larvae after 2 days of low (50 {mu}W cm{sup -2}: 4 h L/20 h D) and medium (80 {mu}W cm{sup -2}: 4 h L/20 h D) UVBR exposure. Compared to control larvae kept in the darkness, a significant increase in blood osmolality, abnormal behavior and high mortalities were detected in larvae exposed to UVBR from 2 days on. At the cellular level, an important decrease in abundance of tegumentary ionocytes and mucous cells was observed after 2 days of exposure to UVBR. In the ionocytes, two major osmoeffectors were immunolocalized, the Na{sup +}/K{sup +}-ATPase and the Na{sup +}/K{sup +}/2Cl{sup -} cotransporter. Compared to controls, the fluorescent immunostaining was lower in UVBR-exposed larvae. We hypothesize that the impaired osmoregulation in UVBR-exposed larvae originates from the lower number of tegumentary ionocytes and mucous cells. This alteration of the osmoregulatory function could negatively impact the survival of young larvae at the surface water exposed to UVBR.

  8. Impact of ultraviolet-B radiation on planktonic fish larvae: Alteration of the osmoregulatory function

    International Nuclear Information System (INIS)

    Coastal marine ecosystems are submitted to variations of several abiotic and biotic parameters, some of them related to global change. Among them the ultraviolet-B (UV-B) radiation (UVBR: 280–320 nm) may strongly impact planktonic fish larvae. The consequences of an increase of UVBR on the osmoregulatory function of Dicentrarchus labrax larvae have been investigated in this study. In young larvae of D. labrax, as in other teleosts, osmoregulation depends on tegumentary ion transporting cells, or ionocytes, mainly located on the skin of the trunk and of the yolk sac. As early D. labrax larvae passively drift in the top water column, ionocytes are exposed to solar radiation. The effect of UVBR on larval osmoregulation in seawater was evaluated through nanoosmometric measurements of the blood osmolality after exposure to different UV-B treatments. A loss of osmoregulatory capability occured in larvae after 2 days of low (50 μW cm−2: 4 h L/20 h D) and medium (80 μW cm−2: 4 h L/20 h D) UVBR exposure. Compared to control larvae kept in the darkness, a significant increase in blood osmolality, abnormal behavior and high mortalities were detected in larvae exposed to UVBR from 2 days on. At the cellular level, an important decrease in abundance of tegumentary ionocytes and mucous cells was observed after 2 days of exposure to UVBR. In the ionocytes, two major osmoeffectors were immunolocalized, the Na+/K+-ATPase and the Na+/K+/2Cl− cotransporter. Compared to controls, the fluorescent immunostaining was lower in UVBR-exposed larvae. We hypothesize that the impaired osmoregulation in UVBR-exposed larvae originates from the lower number of tegumentary ionocytes and mucous cells. This alteration of the osmoregulatory function could negatively impact the survival of young larvae at the surface water exposed to UVBR.

  9. Description of the final instar larva of Orthetrum borneense Kimmins, 1936 (Odonata, Libellulidae), using rearing and molecular methods.

    Science.gov (United States)

    Steinhoff, Philip O M; Butler, Stephen G; Dow, Rory A

    2016-01-01

    The final instar larva of Orthetrum borneense Kimmins, 1936, is described and figured for the first time based on exuviae from three male and six female larvae collected in Sarawak, Borneo (East Malaysia). It is compared with an early instar larva, which was matched to the adult O. borneense by DNA barcoding, and the known larvae of other species of this genus that occur in the region. PMID:27394221

  10. Effect of stocking density on growth and survival of spotted sand bass Paralabrax maculatofasciatus larvae in a closed recirculating system

    OpenAIRE

    Álvarez González, Carlos; Ortiz Galindo, José Luis; Dumas, Silvie; Martínez Díaz, Sergio Francisco; Hernández Ceballos, Dora Esther; Grayeb del Alamo, Tanos; Moreno Lagorreta, Manuel; Peña Martínez, Renato; Civera Cerecedo, Roberto

    2001-01-01

    The effect on growth and survival of the initial stocking density (50, 100, 150, and 200 larvae/ L) in larval rearing of spotted sand bass was evaluated over 30 d in a closed recirculating system. Larvae were fed with rotifers, copepods, nauplii and adult Artemia, and spotted sand bass yolk-sac larvae. Water quality was monitored daily. The notochordal or standard length of sampled larvae was measured by image analysis. Specific growth rates at each density were compared by covariance analysi...

  11. Biological Role of Paenilarvins, Iturin-Like Lipopeptide Secondary Metabolites Produced by the Honey Bee Pathogen Paenibacillus larvae

    Science.gov (United States)

    Gensel, Sebastian; Garcia-Gonzalez, Eva; Ebeling, Julia; Skobalj, Ranko; Kuthning, Anja; Süssmuth, Roderich D.

    2016-01-01

    The Gram-positive bacterium Paenibacillus larvae (P. larvae) is the causative agent of a deadly honey bee brood disease called American Foulbrood (AFB). AFB is a notifiable epizootic in most countries and, hence, P. larvae is of considerable relevance for veterinarians and apiculturists alike. Over the last decade, much progress has been made in the understanding of the (patho)biology of P. larvae. Recently, several non-ribosomally produced peptides (NRP) and peptide/polyketide (NRP/PK) hybrids produced by P. larvae were identified. Among these NRPs were iturin-like lipopeptides, the paenilarvins A-C. Iturins are known to exhibit strong anti-fungal activity; for some iturins, cytotoxic activity towards mammalian erythrocytes and human cancer cell lines are described. We here present our results on the analysis of the natural function of the paenilarvins during pathogenesis of P. larvae infections. We demonstrated production of paenilarvins in infected larvae. However, we could neither demonstrate cytotoxicity of paenilarvins towards cultured insect cells nor towards larvae in feeding assays. Accordingly, exposure bioassays performed with larvae infected by wild-type P. larvae and a knockout mutant of P. larvae lacking production of paenilarvins did not substantiate a role for the paenilarvins as virulence factor. Further experiments are necessary to analyze the relevance of the paenilarvins’ anti-fungal activity for P. larvae infections in the presence of fungal competitors in the larval midgut or cadaver. PMID:27760211

  12. Seasonal fluctuation in the distribution of eggs and larvae of flat fishes (Pleuronectiformes - Pisces) in the Cochin Backwater

    Digital Repository Service at National Institute of Oceanography (India)

    Devi, C

    existance of very low salinity appears to restrict the distribution of flat fish larvae. In the post-monsoon period also the eggs and larvae were not found in regions of very low salinity. Larvae of Cynoglossus puncticeps (Richardson). C. brevis Gunther, C...

  13. Some aspects in early life stage of climbing perch, Anabas testudineus larvae

    Directory of Open Access Journals (Sweden)

    Ponpanom Promkaew

    2005-02-01

    Full Text Available The sexual maturity of female climbing perch, Anabas testudineus was studied by determining fecundity and gonadosomatic index (GSI. It was found that the size at sexual maturity of female climbing perch was 15.20±1.24 cm (mean±SD in total length and 61.10±17.32 g in body weight. The eggs were floating and rounded. The fertilized eggs had a diameter of 830±39 μm. The fecundity was 24,120.5±3,328.24 ova/ fish and gonadosomatic index (GSI was 10.4±2.5%. Newly hatched larvae of climbing perch were produced by induced spawning using chemical injection (Suprefact and Motilium. The sexually mature fishes were cultured in fiber-glass tank (water volume 300 liters with the ratio of male and female brooders 2:1. The fertilization rate, hatching out and hatching rate experiments were carried out using a 15-liter glass aquarium (water volume 10 liters containing 7,000-9,000 eggs. It was found that the eggs were floating and rounded. The fertilized eggs had a diameter of 830±39 μm. The average fertilization rate was 92.67%, hatching out was 20 hr 30 min and average hatching rate was 87.44% at a water temperature of 27.0-30.5ºC. Sampling of the newly-hatched larvae was done at 2-hour intervals, when 20 of them were randomly taken and preserved in 10% buffered formalin for later deter-mination of yolk absorption time. Observation using a microscope revealed that newly hatched larvae were 2.02±0.20 mm in total length and had yolk sacs of 111.33±46.19 mm3 in volume. The yolk sacs were completely absorbed within 92 hr after hatching at a water temperature of 27.0-30.5ºC. Up until full mouth development (start of feeding, 2-hourly samplings of twenty newly hatched larvae were taken from an aquarium for observation of the size of mouth opening. All the larvae had open mouths about 28 hr after hatching (2.95±0.59 mm TL, with the mouths measuring 328.42±32.23 mm in height. The feeding experiments were carried out using a 15-liter glass aquarium (water

  14. Dietary fatty acid composition affects food intake and gut-brain satiety signaling in Senegalese sole (Solea senegalensis, Kaup 1858) larvae and post-larvae.

    Science.gov (United States)

    Bonacic, Kruno; Campoverde, Cindy; Gómez-Arbonés, Javier; Gisbert, Enric; Estevez, Alicia; Morais, Sofia

    2016-03-01

    Little is known how dietary lipids affect food intake during larval development of fish, especially with regard to fatty acid (FA) composition. In fact, very little work has been done on appetite regulation and food intake in fish larvae in general, due to biological and technical difficulties associated with this type of studies. A new method using fluorescent microspheres as markers was developed in this study to evaluate food intake and prey selectivity of Senegalese sole larvae and post-larvae. Food intake was quantified in fish fed Artemia metanauplii enriched with oils differing in FA profile: cod liver oil (CLO), linseed oil (LSO), soybean oil (SBO) or olive oil (OO). The fish did not preferentially ingest a specific diet when presented with a choice. However, pre-metamorphic larvae from the CLO treatment ingested more metanauplii per g body weight, while differences in post-larvae were not significant. These findings were developed further by analyzing mRNA levels of a range of putative anorexigenic (pyya, pyyb, glp1, cckl, cart1a, cart1b, cart2a, cart4, pomca, pomcb, crf) and orexigenic (gal, npy, agrp2) genes, to identify those which are significantly affected by feeding and/or dietary FA composition. The variety of expression patterns observed highlighted the complexity of appetite regulatory mechanisms. In general, fish fed the CLO diet tended to show gene expression patterns most dissimilar to the remaining treatments. Expression in pre-metamorphic larvae was generally less in accordance with the putative function of the genes than in post-larvae, which could suggest a yet underdeveloped regulatory system. PMID:26851305

  15. Tracking living decapod larvae: mass staining of eggs with neutral red prior to hatching.

    Science.gov (United States)

    Øresland, V; Horobin, R W

    2012-04-01

    Mass staining of decapod females carrying eggs, with subsequent identification of hatched larvae in the environment, is a research tool with great potential for field ecologists wishing to track the movements of larvae. For this to be achieved, however, numerous requirements must be met. These include adequate dye solubility, short staining time, dye penetration through different tissues, dye retention within the organism, absence of toxic and behavioral effects, low visibility to predators of stained larvae, no loss of staining owing to preservatives and low cost. The dye, neutral red, appears to meet most of these requirements. This dye was used in aliquots of 0.7 g/770 ml seawater applied to the females of Norway lobster (Nephrops norvegicus) and European lobster (Homarus gammarus) for 10 min. This procedure stained lobster eggs and embryos so that hatched larvae could be distinguished easily by fluorescence microscopy from larvae that hatched from unstained eggs. Stained larvae that were preserved in 4% formaldehyde in seawater were still stained after 1 year. Larvae should not come in contact with ethanol, because it extracts the dye rapidly.

  16. Distribution of Lepidopteran Larvae on Norway Spruce: Effects of Slope and Crown Aspect.

    Science.gov (United States)

    Kulfan, Ján; Dvořáčková, Katarína; Zach, Peter; Parák, Michal; Svitok, Marek

    2016-04-01

    Lepidoptera associated with Norway spruce, Picea abies (L.) Karsten, play important roles in ecosystem processes, acting as plant pests, prey for predators, and hosts for parasites and parasitoids. Their distribution patterns in spruce crowns and forests are only poorly understood. We examined how slope and crown aspect affect the occurrence and abundance of moth larvae on solitary spruce trees in a montane region in Central Europe. Moth larvae were collected from southern and northern crowns of trees growing on south- and north-facing slopes (four treatments) using emergence boxes at the end of winter and by the beating method during the growing season. Species responses to slope and crown aspect were not uniform. Treatment effects on moth larvae were stronger in the winter than during the growing season. In winter, the abundance of bud-boring larvae was significantly higher in northern than in southern crowns regardless of the slope aspect, while both slope and aspect had marginally significant effects on abundance of miners. During the growing season, the occurrence of free-living larvae was similar among treatments. Emergence boxes and beating spruce branches are complementary techniques providing valuable insights into the assemblage structure of moth larvae on Norway spruce. Due to the uneven distribution of larvae detected in this study, we recommend adoption of a protocol that explicitly includes sampling of trees from contrasting slopes and branches from contrasting crown aspect in all seasons. PMID:26795212

  17. Direct Effects of Microalgae and Protists on Herring (Clupea harengus Yolk Sac Larvae.

    Directory of Open Access Journals (Sweden)

    Björn Illing

    Full Text Available This study investigated effects of microalgae (Rhodomonas baltica and heterotrophic protists (Oxyrrhis marina on the daily growth, activity, condition and feeding success of Atlantic herring (Clupea harengus larvae from hatch, through the end of the endogenous (yolk sac period. Yolk sac larvae were reared in the presence and absence of microplankton and, each day, groups of larvae were provided access to copepods. Larvae reared with microalgae and protists exhibited precocious (2 days earlier and ≥ 60% increased feeding incidence on copepods compared to larvae reared in only seawater (SW. In the absence and presence of microalgae and protists, life span and growth trajectories of yolk sac larvae were similar and digestive enzyme activity (trypsin and nutritional condition (RNA-DNA ratio markedly declined in all larvae directly after yolk sac depletion. Thus, microplankton promoted early feeding but was not sufficient to alter life span and growth during the yolk sac phase. Given the importance of early feeding, field programs should place greater emphasis on the protozooplankton-ichthyoplankton link to better understand match-mismatch dynamics and bottom-up drivers of year class success in marine fish.

  18. Fish larvae retention linked to abrupt bathymetry at Mejillones Bay (northern Chile during coastal upwelling events

    Directory of Open Access Journals (Sweden)

    Pablo M Rojas

    2014-11-01

    Full Text Available The influence of oceanic circulation and bathymetry on the fish larvae retention inside Mejillones Bay, northern Chile, was examined. Fish larvae were collected during two coastal upwelling events in November 1999 and January 2000. An elevated fish larvae accumulation was found near an oceanic front and a zone of low-speed currents. Three groups of fish larvae were identified: the coastal species (Engraulis ringens and Sardinops sagax, associated with high chlorophyll-a levels; larvae from the families Phosichthyidae (Vinciguerria lucetia and Myctophidae (Diogenichthys laternatus and Triphoturus oculeus, associated with the thermocline (12°C, and finally, larvae of the families Myctophidae (Diogenichthys atlanticus and Bathylagidae (Bathylagus nigrigenys, associated with high values of temperature and salinity. The presence of a seamount and submarine canyon inside Mejillones Bay appears to play an important role in the circulation during seasonal upwelling events. We propose a conceptual model of circulation and particles retention into Mejillones Bay. The assumption is that during strong upwelling conditions the flows that move along the canyon emerge in the centre of Mejillones Bay, producing a fish larvae retention zone. Understanding the biophysical interactions responsible to trap and/or concentrate particles is essential to protect these fragile upwelling ecosystems.

  19. Characterization of secreted proteases of Paenibacillus larvae, potential virulence factors involved in honeybee larval infection.

    Science.gov (United States)

    Antúnez, Karina; Anido, Matilde; Schlapp, Geraldine; Evans, Jay D; Zunino, Pablo

    2009-10-01

    Paenibacillus larvae is the causative agent of American Foulbrood (AFB), the most severe bacterial disease that affects honeybee larvae. AFB causes a significant decrease in the honeybee population affecting the beekeeping industry and agricultural production. After infection of larvae, P. larvae secretes proteases that could be involved in the pathogenicity. In the present article, we present the secretion of different proteases by P. larvae. Inhibition assays confirmed the presence of metalloproteases. Two different proteases patterns (PP1 and PP2) were identified in a collection of P. larvae isolates from different geographic origin. Forty nine percent of P. larvae isolates showed pattern PP1 while 51% exhibited pattern PP2. Most isolates belonging to genotype ERIC I - BOX A presented PP2, most isolates belonging to ERIC I - BOX C presented PP1 although relations were not significant. Isolates belonging to genotypes ERIC II and ERIC III presented PP2. No correlation was observed between the secreted proteases patterns and geographic distribution, since both patterns are widely distributed in Uruguay. According to exposure bioassays, isolates showing PP2 are more virulent than those showing PP1, suggesting that difference in pathogenicity could be related to the secretion of proteases. PMID:19638278

  20. Predation of Fruit Fly Larvae Anastrepha (Diptera: Tephritidae by Ants in Grove

    Directory of Open Access Journals (Sweden)

    W. D. Fernandes

    2012-01-01

    Full Text Available Based on evidence that ants are population regulatory agents, we examined their efficiency in predation of fruit fly larvae Anastrepha Schiner, 1868 (Diptera: Tephritidae. Hence, we considered the differences among species of fruit trees, the degree of soil compaction, and the content of soil moisture as variables that would explain predation by ants because these variables affect burying time of larvae. We carried out the experiment in an orchard containing various fruit bearing trees, of which the guava (Psidium guajava Linn., jaboticaba (Myrciaria jaboticaba (Vell. Berg., and mango trees (Mangifera indica Linn. were chosen for observations of Anastrepha. We offered live Anastrepha larvae on soil beneath the tree crowns. We observed for 10 min whether ants removed the larvae or the larvae buried themselves. Eight ant species were responsible for removing 1/4 of the larvae offered. The Pheidole Westwood, 1839 ants were the most efficient genus, removing 93% of the larvae. In compacted and dry soils, the rate of predation by ants was greater. Therefore, this study showed that ants, along with specific soil characteristics, may be important regulators of fruit fly populations and contribute to natural pest control in orchards.

  1. Behaviour of damselfly larvae (Enallagma cyathigerum) (Insecta, Odonata) after long-term exposure to PFOS

    Energy Technology Data Exchange (ETDEWEB)

    Gossum, Hans van [Evolutionary Ecology Group, University of Antwerp, Groenenborgerlaan 171, B-2020 Antwerp (Belgium)], E-mail: hans.vangossum@ua.ac.be; Bots, Jessica [Evolutionary Ecology Group, University of Antwerp, Groenenborgerlaan 171, B-2020 Antwerp (Belgium)], E-mail: jessica.bots@ua.ac.be; Snijkers, Tom [Evolutionary Ecology Group, University of Antwerp, Groenenborgerlaan 171, B-2020 Antwerp (Belgium)], E-mail: tom.snijkers@gmail.com; Meyer, Johan [Research group of Ecophysiology, Biochemistry and Toxicology, University of Antwerp, Groenenborgerlaan 171, B-2020 Antwerp (Belgium)], E-mail: izak.meyer@ua.ac.be; Van Wassenbergh, Sam [Laboratory for Functional Morphology, University of Antwerp, Universiteitsplein 1, B-2610 Antwerp (Belgium)], E-mail: sam.vanwassenbergh@ua.ac.be; De Coen, Wim [Research group of Ecophysiology, Biochemistry and Toxicology, University of Antwerp, Groenenborgerlaan 171, B-2020 Antwerp (Belgium)], E-mail: wim.decoen@ua.ac.be; De Bruyn, Luc [Evolutionary Ecology Group, University of Antwerp, Groenenborgerlaan 171, B-2020 Antwerp (Belgium); Research Institute for Nature and Forest, Kliniekstraat 25, 1070 Brussels (Belgium)], E-mail: luc.debruyn@ua.ac.be

    2009-04-15

    Perfluorooctane sulfonic acid (PFOS) is a persistent and ubiquitous environmental contaminant that has been detected in organisms worldwide. Here, we evaluate whether long-term (1 and 4 months) exposure to PFOS contamination affects the behavioural performance of freshwater larvae of the damselfly Enallagma cyathigerum (Insecta: Odonata). Our results show reduced behavioural performance with increasing PFOS concentration. In 1 month exposed larvae, no observed effect concentrations (NOECs) were 100 {mu}g/L for general activity. In 4 months exposed larvae, NOECs were 10 {mu}g/L, for each behavioural trait, except swimming acceleration of male larvae where the NOEC was 100 {mu}g/L. When faced with PFOS concentrations above the NOEC, E. cyathigerum larvae were less active, less capable to escape a simulated predator attack and less efficient in foraging. Together, our results show that damselfly larvae suffer reduced survival-related behavioural performance. - Long-term laboratory exposure to perfluorooctane sulfonic acid decreases behavioural performance of damselfly larvae (Insecta: Odonata)

  2. Inclusion of copepod Acartia tonsa nauplii in the feeding of Centropomus undecimalis larvae increases stress resistance

    Directory of Open Access Journals (Sweden)

    Wanessa de Melo-Costa

    2015-09-01

    Full Text Available This research represents the first result of studies of the common snook Centropomus undecimalis larvae from broodstock matured in captivity in Brazil. The aim of this study was to evaluate if the inclusion of Acartia tonsa nauplii improves stress resistance of common snook larvae. The larvae were fed with: rotifers Brachionus plicatilis (10 to 15 mL-1; A. tonsa nauplii (0.25 to 0.5 mL-1 and rotifers (5 to 7.5 mL-1, and A. tonsa nauplii (0.12 to 0.25 mL-1. The average percentage of survival of the treatments was 11.9%. At 20 days of age, larvae were subjected to thermal stress. Subsequently, the stress resistance was evaluated. Common snook larvae fed B. plicatilis+A. tonsa reached a higher weight and length (7.5 ± 0.00 mg and 9.1 ± 0.23 mm, respectively and resisted more heat stress (87.4% than larvae fed other foods, indicating that the feed mixture is satisfactory as a starter diet for larvae of common snook. However, more research is needed to confirm these results.

  3. Tracking living decapod larvae: mass staining of eggs with neutral red prior to hatching.

    Science.gov (United States)

    Øresland, V; Horobin, R W

    2012-04-01

    Mass staining of decapod females carrying eggs, with subsequent identification of hatched larvae in the environment, is a research tool with great potential for field ecologists wishing to track the movements of larvae. For this to be achieved, however, numerous requirements must be met. These include adequate dye solubility, short staining time, dye penetration through different tissues, dye retention within the organism, absence of toxic and behavioral effects, low visibility to predators of stained larvae, no loss of staining owing to preservatives and low cost. The dye, neutral red, appears to meet most of these requirements. This dye was used in aliquots of 0.7 g/770 ml seawater applied to the females of Norway lobster (Nephrops norvegicus) and European lobster (Homarus gammarus) for 10 min. This procedure stained lobster eggs and embryos so that hatched larvae could be distinguished easily by fluorescence microscopy from larvae that hatched from unstained eggs. Stained larvae that were preserved in 4% formaldehyde in seawater were still stained after 1 year. Larvae should not come in contact with ethanol, because it extracts the dye rapidly. PMID:22149046

  4. Initial characterization of receptors for molecules that induce the settlement and metamorphosis of Haliotis rufescens larvae

    International Nuclear Information System (INIS)

    Larvae of the marine gastropod mollusc Haliotis refescens are induced to undergo metamorphosis by γ-aminobutyric acid (GABA) and stereochemically related compounds. The most potent of these inducers is (-)-β-(parachlorophenyl)-GABA (baclofen). The inductive response exhibits positive cooperatively, and is subject to both facilitation (up-regulation) and habituation (down-regulation). Facilitation is brought about by diamino acids such as L-diaminopropionic acid (L-DAPA), and is characterized by decreased Hill coefficients (n/sub H/) and concentration requirements (EC50) for inducers. Facilitation does not require the simultaneous presence of facilitating and inducing compounds, and the facilitated state is persistent. Larvae are capable of being up-regulated 2 days before they are capable of undergoing settlement and metamorphosis. Habituation can be brought about by exposure of pre-competent larvae to GABA 4 days prior to the attainment of competence; it is then slowly reversible. Larvae specifically bind tritiated (-)-baclofen in a manner that is saturable with both increasing time of exposure of larvae to, and with increasing concentration of, this compound. Specific binding can be competed for by unlabeled GABA-mimetic inducing molecules; the order of effectiveness of these molecules as competitors for specific binding correlates well with their effectiveness as inducers of metamorphosis. Facilitation of larvae by exposure to diamino acids does not alter their specific binding of tritiated (-)-baclofen. It is concluded from these findings that Haliotis larvae possess receptors for GABA-mimetic compounds

  5. Initial characterization of receptors for molecules that induce the settlement and metamorphosis of Haliotis rufescens larvae

    Energy Technology Data Exchange (ETDEWEB)

    Trapido-Rosenthal, H.G.

    1985-01-01

    Larvae of the marine gastropod mollusc Haliotis refescens are induced to undergo metamorphosis by ..gamma..-aminobutyric acid (GABA) and stereochemically related compounds. The most potent of these inducers is (-)-..beta..-(parachlorophenyl)-GABA (baclofen). The inductive response exhibits positive cooperatively, and is subject to both facilitation (up-regulation) and habituation (down-regulation). Facilitation is brought about by diamino acids such as L-diaminopropionic acid (L-DAPA), and is characterized by decreased Hill coefficients (n/sub H/) and concentration requirements (EC/sub 50/) for inducers. Facilitation does not require the simultaneous presence of facilitating and inducing compounds, and the facilitated state is persistent. Larvae are capable of being up-regulated 2 days before they are capable of undergoing settlement and metamorphosis. Habituation can be brought about by exposure of pre-competent larvae to GABA 4 days prior to the attainment of competence; it is then slowly reversible. Larvae specifically bind tritiated (-)-baclofen in a manner that is saturable with both increasing time of exposure of larvae to, and with increasing concentration of, this compound. Specific binding can be competed for by unlabeled GABA-mimetic inducing molecules; the order of effectiveness of these molecules as competitors for specific binding correlates well with their effectiveness as inducers of metamorphosis. Facilitation of larvae by exposure to diamino acids does not alter their specific binding of tritiated (-)-baclofen. It is concluded from these findings that Haliotis larvae possess receptors for GABA-mimetic compounds.

  6. GC-MS investigation of the chemical composition of honeybee drone and queen larvae homogenate

    Directory of Open Access Journals (Sweden)

    Isidorov Valery A.

    2016-06-01

    Full Text Available Honeybee larva homogenate appears to be underrated and insufficiently explored but this homogenate is an exceptionally valuable honeybee product. Drone larva homogenate is very nutritional due to its high content of proteins, free amino acids, lipids, and carbohydrates. Moreover, the biological characteristics of honeybee larvae indicate the presence of chemical substances that may be pharmacologically active. In spite of the above, the chemical composition of honeybee larva has not gained as much attention as that of other bee products. In this study, the chemical composition of honeybee brood homogenate has been investigated using gas chromatography/mass spectrometry. As a result, it was possible to isolate as many as 115 extractive organic compounds from 6 samples of crude queen and 9 samples of drone homogenate. The main groups of substances extracted from either type of homogenate were composed of free amino acids and carbohydrates. The relative content of amino acids in queen homogenate as well as the share of essential amino acids were found to be higher than in the drone homogenate. Disaccharide trehalose was the dominant sugar in the queen larvae, whilst glucose prevailed in the drone larvae. Comparative chemical analyses of honeybee queen and drone larva homogenates have allowed us to make a preliminary inference about a higher overall value of the former.

  7. Effects of Toxocara larvae on brain cell survival by in vitro model assessment.

    Science.gov (United States)

    Heuer, Lea; Haendel, Sabine; Beineke, Andreas; Strube, Christina

    2015-09-01

    Neuroinvasive larvae of the common dog and cat roundworms, Toxocara canis and Toxocara cati, may cause severe neurological and neuropsychological disturbances in humans. Despite their pathogenic potential and high prevalence worldwide, little is known about their cell-specific influences and cerebral host-pathogen interactions in neurotoxocarosis. To address this discrepancy, a co-culture system of viable larvae with murine neuronal (CAD), oligodendrocytal (BO-1) and microglial (BV-2) cell lines has been established. Additionally, murine adult brain slices have been co-cultured with Toxocara larvae to consider complex organotypic cell-cell interplay. Cytotoxicity of larval presence was measured enzymatically and microscopically. Microscopic evaluation using trypan blue exclusion assay revealed to be less reliable and sensitive than the lactate dehydrogenase activity assay. Ultimately, even low numbers of both T. canis and T. cati larvae have impaired survival of differentiated CAD cells, which morphologically resemble primary neurons. In contrast, viability of oligodendrocytal and microglial cells as well as brain slices was not impaired by larval presence. Therefore, immune-mediated mechanisms or trauma by migrating larvae presumably induce the in vivo pathology rather than acute cytotoxic effects. Conclusively, the helminthic larvae co-culture system presented here is a valuable in vitro tool to study cell-specific effects of parasitic larvae and their products. PMID:26080924

  8. Effects of irradiation on the biology of the infective larvae of Toxocara canis in the mouse

    Energy Technology Data Exchange (ETDEWEB)

    Barriga, O.O.; Myser, W.C.

    1987-02-01

    Mice were infected with either 2000 normal or irradiated embryonated eggs of Toxocara canis and the number of larvae in their livers, lungs, brains, and carcasses investigated at 5, 20, and 33 days of infection. Mortality of mice infected with normal eggs was 33% between day 4 and 8 postinfection but there was no mortality among mice infected with irradiated eggs. Irradiation with 60, 90, or 150 kr of X-rays inhibited the migration of larvae from the livers and lungs and their accumulation in brain and carcass in proportion to the irradiation dose. By day 33 of infection, the ratio of larvae in liver and lungs to larvae in brain and carcass was 0.16 in normal mice, 0.42 in 60-kr mice, 0.98 in 90-kr mice, and 23.3 in 150-kr mice. Irradiated larvae, particularly those migrating through the peritoneal cavity, died faster than normal larvae until day 20. Irradiation favored survival after day 20. By days 20 and 33 postinfection the total parasite load was 29% and 8%, respectively, of the administered dose in control mice, 18% and 12% in 60-kr mice, 8% and 4% in 90-kr mice, and 0.9% and 0.3% in 150-kr mice. Irradiation of infective T. canis larvae, then, reduces their pathogenicity, inhibits their migration from liver and lungs, kills some of the parasites during the first 3 weeks of infection, but favors their late survival in the host.

  9. A new procedure for marinating fresh anchovies and ensuring the rapid destruction of Anisakis larvae.

    Science.gov (United States)

    Sánchez-Monsalvez, I; de Armas-Serra, C; Martínez, J; Dorado, M; Sánchez, A; Rodríguez-Caabeiro, F

    2005-05-01

    The consumption of marinated anchovies is the main route of transmission of anisakiasis in Spain. Because this country is one of the world's major tourist destinations, this traditional food also poses a potential health risk to millions of foreign visitors. Anisakis larvae are not destroyed by the traditional marinating procedure, and alternative methods, such as long-term storage in brine, freezing, or hydrostatic pressure treatment, all present major difficulties. In this study, we used high food-grade acetic acid concentrations (10, 20, 30, and 40% [vol/vol] in line with the quantum satis rule) to destroy these larvae rapidly, and we report data on the survival of Anisakis larvae exposed directly to different marinades and when the larvae are placed under the fish musculature. The percentage of salt and acetic acid in the fish tissue water phase was also determined. A marinating procedure is proposed that ensures the rapid death of Anisakis through the use of strong acetic acid concentrations. Posttreatment washes with water reduce these to levels acceptable to consumers. The sensory characteristics of the product were shown to be satisfactory. The actual selection of an acetic acid concentration for marinating depends on costs and the processing time available. The physiological stress of the larvae exposed to the different marinades was determined by measuring the levels of their stress proteins. The latter are good indicators of injury and might reflect the infectivity of larvae. In addition, we also used a rat model to determine the infectivity of larvae considered microscopically dead.

  10. Resistance Detection of Aedes aegypti Larvae to Cypermethrin from Endemic Area in Cimahi City West Java

    Directory of Open Access Journals (Sweden)

    Endang Puji Astuti

    2014-06-01

    Full Text Available Vector control programs using chemical insecticide e.g organochlorin, organophosphate, carbamate, and pyrethroid (cypermethrin. When those insecticides were applied continuously, it may lead to vector resistance. The aim of this research was to detect any resistance of Ae. aegypti to cypermethrin in endemic areas of Cimahi. This research is a laboratory study that used biochemical test which referred to Lee’s method. Larva samples were collected from 8 villages, which are endemic area. Samples of larvae were collected from 15 villages belonged to dengue endemic areas in town of Cimahi, however, villages that meet the availability of larvae were only 8 villages. To detect the activity of monooxygenase enzyme, a biochemical assay was used in this research by created a reaction between larvae homogenate and sodium acetate substrate. The results of reaction were read using ELISA reader with spectrophotometer wave length of 595 nm. Overall, the results showed that most of the larvae in eight villages of Cimahi is still susceptible to cypermethrin. However, larvae from Cibabat village were 4% resistant, 2% tolerant, and 94% susceptible. On the other hand, Cigugur village showed that 12.7% larvae were tolerant and 87.3% still susceptible. Other villages like Cimahi, Cibeureum, Melong, Baros, Cipageran, and Pasirkaliki still remains susceptible. Resistance detection using biochemical assay of cypermethrin insecticide for Ae.aegypti resulting data stated that in 6 villages were still susceptible but in 3 other villages were already tolerant and 1 village was already resistance.

  11. Antioxidative responses and bioaccumulation in Japanese flounder larvae and juveniles under chronic mercury exposure.

    Science.gov (United States)

    Huang, Wei; Cao, Liang; Ye, Zhenjiang; Yin, Xuebo; Dou, Shuozeng

    2010-06-01

    This study investigated the sub-lethal effects of waterborne mercury on growth, bioaccumulation and antioxidative responses of larvae and juveniles of Japanese flounder (Paralichthys olivaceus). Fish were exposed to 0-10 microg Hg(2)(+)L(-1) solutions from embryonic to the juvenile stages for 80 days. Antioxidative responses to mercury exposure were studied in metamorphosing larvae (18 days post hatching, dph), settling larvae (33 dph) and juveniles (78 dph). Results showed that increasing mercury concentration led to increased mercury bioaccumulation and reduced flounder growth. Of the antioxidants investigated, superoxide dismutase (SOD) and catalase (CAT) activities at the three developmental stages were sensitive to mercury exposure and increased with increasing mercury concentration. Glutathione (GSH) content was elevated in metamorphosing larvae, but decreased in juveniles as mercury concentration increased. Glutathione-S-transferase (GST) activity did not significantly vary with mercury concentration in either larvae or juveniles. Mercury exposure did not affect malondialdehyde (MDA) content of larvae, but significantly increased MDA content of juveniles. Results suggest that flounder larvae and juveniles have the potential to manipulate the levels of antioxidants such as SOD, CAT and GSH, which protect flounder from oxidative stress induced by mercury exposure. These antioxidants could serve as biomarkers of mercury contamination in the aquatic environment.

  12. Feasibility study of biodiesel production using lipids of Hermetia illucens larva fed with organic waste.

    Science.gov (United States)

    Leong, Siew Yoong; Kutty, Shamsul Rahman Mohamed; Malakahmad, Amirhossein; Tan, Chew Khun

    2016-01-01

    Hermetia illucens larvae by nature are a decomposer which fed on organic wastes. This study explores the potential of producing biodiesel using lipids from H. illucens larvae. Three types of organic wastes (sewage sludge, fruit waste and palm decanter cake from oil palm mill) were selected based on considerable generation and disposal concern in the area of study as well as lack of investigations as feed for Hermetia illucens larvae in current literatures. Growth rate of the larvae was determined with studying the changes in the biomass per day. H. illucens larvae fed with fruit waste and palm decanter cake have shown growth rates of 0.52±0.02 and 0.23±0.09 g d(-1), respectively. No positive sign of growth were observed in the larvae fed with treated sewage sludge (-0.04±0.01 g d(-1)). Biodiesel as fatty acid methyl ester (FAME) was synthesized by transesterification of the larvae lipid using sulphuric acid as catalyst in methanol. FAME produced was ascertained using ATR-FTIR spectroscopy and GC-MS. The main compositions of fatty acid were found to be C12:0, C16:0 and C18:1n9c. Fatty acid composition of C12:0 fed with fruit waste, sewage sludge and palm decanter was found to be most abundant in the larvae lipid. The amount of C12:0 obtained was 76.13%, 58.31% and 48.06%, respectively. In addition, fatty acid of C16:0 was attained at 16.48% and 25.48% fed with sewage sludge and palm decanter, respectively. Based on the findings, FAME derived from larvae lipids is feasible to be used for biodiesel production.

  13. Feasibility study of biodiesel production using lipids of Hermetia illucens larva fed with organic waste.

    Science.gov (United States)

    Leong, Siew Yoong; Kutty, Shamsul Rahman Mohamed; Malakahmad, Amirhossein; Tan, Chew Khun

    2016-01-01

    Hermetia illucens larvae by nature are a decomposer which fed on organic wastes. This study explores the potential of producing biodiesel using lipids from H. illucens larvae. Three types of organic wastes (sewage sludge, fruit waste and palm decanter cake from oil palm mill) were selected based on considerable generation and disposal concern in the area of study as well as lack of investigations as feed for Hermetia illucens larvae in current literatures. Growth rate of the larvae was determined with studying the changes in the biomass per day. H. illucens larvae fed with fruit waste and palm decanter cake have shown growth rates of 0.52±0.02 and 0.23±0.09 g d(-1), respectively. No positive sign of growth were observed in the larvae fed with treated sewage sludge (-0.04±0.01 g d(-1)). Biodiesel as fatty acid methyl ester (FAME) was synthesized by transesterification of the larvae lipid using sulphuric acid as catalyst in methanol. FAME produced was ascertained using ATR-FTIR spectroscopy and GC-MS. The main compositions of fatty acid were found to be C12:0, C16:0 and C18:1n9c. Fatty acid composition of C12:0 fed with fruit waste, sewage sludge and palm decanter was found to be most abundant in the larvae lipid. The amount of C12:0 obtained was 76.13%, 58.31% and 48.06%, respectively. In addition, fatty acid of C16:0 was attained at 16.48% and 25.48% fed with sewage sludge and palm decanter, respectively. Based on the findings, FAME derived from larvae lipids is feasible to be used for biodiesel production. PMID:25872864

  14. Trombiculidae larvae (Neotrombicula autumnalis) infestation in a Little Bittern (Ixobrychus minutus) in Turkey.

    Science.gov (United States)

    Cakiroglu, Duygu; Pekmezci, Didem; Meral, Yücel; Gokalp, Güvenç; Acici, Mustafa

    2008-04-01

    With this case report, we describe Trombiculidae larvae (Neotrombicula autumnalis) infestation in a Little Bittern (Ixobrychus minutus) which was brought to our clinics by the Directorship of Environmental and Forestry authorities of Samsun, Turkey in April, 2007. The male Little Bittern (I. minutus), with a black back and crown, and black wings with a large white patch on each wing, had thick Trombiculidae larvae infestation both on its legs. There were neither dermatological nor general conditional changes observed, except its superficial larval attachments to the skin. To our knowledge, this is the first report of Trombiculidae larvae (N. autumnalis) infestation in a Little Bittern (I. minutus) in Turkey. PMID:18266010

  15. Metamorfosis del aparato digestivo de larvas carnívoras de Ceratophrys cranwelli (Anura: Leptodactylidae)

    OpenAIRE

    Ulloa Kreisel, Zandra E.

    2000-01-01

    Las larvas carnívoras de Ceratophrys cranwelli presentan un tubo digestivo más corto que la mayoría de las larvas de anuros, tiene 6 veces la longitud del cuerpo del renacuajo y se caracteriza también por tener un estómago larval. El presente trabajo tiene como objetivo el determinar el grado de transformaciones en la cavidad bucofaríngea y tubo digestivo en larvas de esta especie durante la metamorfosis y comparar las estructuras digestivas estudiadas en otras especies de Leptodactylidae de ...

  16. Validation of otolith increment formation and the growth rate of fat greenling larvae

    OpenAIRE

    JOH, Mikimasa; Joh, Takashi; Matsu-ura, Teppei; Takatsu, Tetsuya

    2008-01-01

    We validated the daily formation 0f otolith increments of reared fat greenling Hexagrammos otakii larvae and examined the growth patterns of wild lavae. The mean notochord Length and otolith radius of newly hatched larvae were 8.31 mm and 273μm, respectively. Newly hatched larvae had some increments on their lapilli and a check was formed at hatching (hatch check). The relattonship between age and the number of increments formed outside the hatch chcck (NI)was linear regression (Nl=0.99Age-0....

  17. Jenis-jenis dan Kepadatan Larva Nyamuk di Kelurahan Gedung Johor, Kecamatan Medan Johor, Medan

    OpenAIRE

    Masy’ab, Nadiah

    2016-01-01

    Mosquitoes are living organisms in all around the world which is a disease vector for human . To know the area of mosquito’s spreading in one place, we need to do a larvae survey which measures the density of mosquito larvae in an area by observing directly into water reservoirs. This study aims to determine the type of species and the level of larvae density in Kelurahan Gedung Johor, Kecamatan Medan Johor, Medan. This is a descriptive study and collection of samples is don...

  18. INDEKS ENTOMOLOGI DAN KERENTANAN LARVA Aedes aegypti TERHADAP TEMEFOS DI KELURAHAN KARSAMENAK KECAMATAN KAWALU KOTA TASIKMALAYA

    Directory of Open Access Journals (Sweden)

    Hubullah Fuadzy

    2015-10-01

    Full Text Available AbstrakSalah satu upaya pengendalian vektor nyamuk Aedes aegypti adalah menggunakan larvasida sintetis seperti temefos. Pemanfaatan temefos secara terus menerus dan berulang merupakan faktor risiko terjadinya resistensi. Tujuan penelitian ini adalah untuk menentukan indeks entomologi dan status kerentanan larva Ae. aegypti terhadap temefos di Kelurahan Karsamenak Kecamatan Kawalu Kota Tasikmalaya. Jenis penelitian adalah eksperimen dengan rancangan acak lengkap. Populasi adalah larva nyamuk Ae. aegypti yang diperoleh dari 289 rumah penduduk di Kelurahan Karsamenak, dan sampel adalah 700 larva Ae. aegypti strain Karsamenak. Bioassay menggunakan metode Elliot dan Polson dengan konsentrasi diagnostik WHO sebesar 0,02 ppm. Hasil penelitian menunjukkan bahwa House Index (HI 24,9; Container Index (CI 9,05; Breteau Index (BI 29,07; dan Density Figure (DF 4. Larva Ae. aegypti umumnya ditemukan di Bak Mandi penduduk. Kemudian untuk membunuh 95% larva Ae. aegypti dibutuhkan konsentrasi temefos sebesar (LC95 0,02416 ppm (0,01917 ­ 0,03330 ppm dan RR95 3,02. Kelurahan Karsamenak termasuk wilayah yang potensial untuk penularan penyakit Demam Berdarah Dengue, dan larva Ae. aegypti terindikasi telah resisten terhadap temefos.Kata Kunci : Resisten, Aedes aegypti, temefos, kerentananAbstractOne effort for controlling Aedes aegypti as dengue vector is using synthetic larvacide such as temephos. Utilization of temephos continuously and repeatedly a risk factor for resistance. The objective of this study were to determine the entomology index and susceptibility of Ae. aegypti larvae against temephos in endemic areas of dengue fever in the Karsamenak District Kawalu of Tasikmalaya. The research was a true experimental study with a complete randomized design. The population were the larvae of Ae. aegypti were derived from 289 houses of resident in the Village Karsamenak and the sample was 700 larvae of Ae. aegypti strains Karsamenak. The Bioassay used Elliot and

  19. Jenis-Jenis Larva Nyamuk di Kelurahan Tanjung Rejo, Kecamatan Medan Sunggal, Medan

    OpenAIRE

    Woo, Xin Zhe

    2016-01-01

    Mosquitoe is a kind of animal that plays a role in transmitting various types of diseases. There are 4 stages of mosquito life cycle (egg-larva-pupa-adult) and the most effective prevention methode is from the larvae stage from mosquito because they have not been able to move freely and require water to survive. The present descriptive study was aimed to determine the types of mosquito larvae and what could promote the development of mosquito, thus mosquito control in Tanjung Rejo village, su...

  20. Habitat stability and occurrences of malaria vector larvae in western Kenya highlands

    Directory of Open Access Journals (Sweden)

    Atieli Harrysone

    2009-10-01

    Full Text Available Abstract Background Although the occurrence of malaria vector larvae in the valleys of western Kenya highlands is well documented, knowledge of larval habitats in the uphill sites is lacking. Given that most inhabitants of the highlands actually dwell in the uphill regions, it is important to develop understanding of mosquito breeding habitat stability in these sites in order to determine their potential for larval control. Methods A total of 128 potential larval habitats were identified in hilltops and along the seasonal streams in the Sigalagala area of Kakamega district, western Kenya. Water availability in the habitats was followed up daily from August 3, 2006 to February 23, 2007. A habitat is defined as stable when it remains aquatic continuously for at least 12 d. Mosquito larvae were observed weekly. Frequencies of aquatic, stable and larvae positive habitats were compared between the hilltop and seasonal stream area using χ2-test. Factors affecting the presence/absence of Anopheles gambiae larvae in the highlands were determined using multiple logistic regression analysis. Results Topography significantly affected habitat availability and stability. The occurrence of aquatic habitats in the hilltop was more sporadic than in the stream area. The percentage of habitat occurrences that were classified as stable during the rainy season is 48.76% and 80.79% respectively for the hilltop and stream area. Corresponding frequencies of larvae positive habitats were 0% in the hilltop and 5.91% in the stream area. After the rainy season, only 23.42% of habitat occurrences were stable and 0.01% larvae positive habitats were found in the hilltops, whereas 89.75% of occurrences remained stable in the stream area resulting in a frequency of 12.21% larvae positive habitats. The logistic regression analysis confirmed the association between habitat stability and larval occurrence and indicated that habitat surface area was negatively affecting the

  1. Identification of entomopathogenic Bacillus isolated from Simulium (Diptera, Simuliidae larvae and adults

    Directory of Open Access Journals (Sweden)

    Cavados CFG

    2001-01-01

    Full Text Available Entomopathogenic bacteria isolated from Simulium larvae and adults from breeding sites in the states of São Paulo and Rio de Janeiro, Brazil, were identified as 18 strains of Bacillus thuringiensis and one of B. sphaericus. Most of these strains were serotyped according to their flagellar antigens. However, nine of the B. thuringiensis samples, could not be serotyped and were designated as "autoagglutinating"; they were also shown to be toxic in preliminary tests against Aedes aegypti larvae. Additionally, B. sphaericus was also shown to be toxic towards Culex quinquefasciatus larvae.

  2. A case report of cutaneous larva migrans in a Mexican population of high marginalization

    Institute of Scientific and Technical Information of China (English)

    Isaac Aguirre Maldonadoa; Silvia Cruz Duartea; Felipe Gonzlez Velzqueza; Alfonso Alexander Aguilerab

    2014-01-01

    The creeping verminous dermatitis or cutaneous larva migrans is a parasitosis caused by percutaneous penetration and migration of larval nematode parasites characterized by producing one or more serpiginous erythematous, indurated, raised and pruritic lesion. The most common cause of cutaneous larva migrans is the Ancylostoma braziliense located in warm climate zones. In the present study, authors reported a case of cutaneous larva migrans with a characteristic clinical picture: erythematous-papular and vesicular lesion and serpiginous path, with progressive, and pruritic growth and it shown that a living area with immigration, tropical weather conditions and poverty may lead to this common infection.

  3. A case report of cutaneous larva migrans in a Mexican population of high marginalization

    Institute of Scientific and Technical Information of China (English)

    Isaac; Aguirre; Maldonadoa; Silvia; Cruz; Duartea; Felipe; Gonzlez; Velzqueza; Alfonso; Alexander; Aguilerab

    2014-01-01

    The creeping verminous dermatitis or cutaneous larva migrans is a parasitosis caused by percutaneous penetration and migration of larval nematode parasites characterized by producing one or more serpiginous erythematous,indurated,raised and pruritic lesion.The most common cause of cutaneous larva migrans is the Ancytostoma braziliensc located in warm climate zones.In the present study,authors reported a case of cutaneous larva migrans with a characteristic clinical picture:erythematous-papnlar and vesicular lesion and serpiginous path,with progressive,and pruritic growth and it shown that a living area with immigration,tropical weather conditions and poverty may lead to this common infection.

  4. Contrasting feeding patterns among species of fish larvae from the tropical Andaman Sea

    DEFF Research Database (Denmark)

    Østergaard, P.; Munk, Peter; Janekarn, V.

    2005-01-01

    Feeding habits of tropical fish larvae were analysed in a comparative study of four species (Scorpaenodes sp., Carangoides sp., Acanthocepola sp. and Cynoglossus sp.) from the Andaman Sea. We investigated morphological characteristics and their potential influence on larval feeding, and looked...... for common patterns in larval prey preference. Gut contents of a total of 300 larvae were examined and compared with local zooplankton composition. The feeding habits of the investigated larvae shared a number of characteristics. During ontogeny both the preferred prey size and the number of prey in the gut...

  5. Descrição da larva de último estádio de Micrathyria pseudeximia Westfall (Odonata, Libellulidae

    Directory of Open Access Journals (Sweden)

    Marina Schmidt Dalzochio

    2009-08-01

    Full Text Available A larva de último estádio de Micrathyria pseudeximia Westfall, 1992 é descrita e ilustrada a partir de material procedente de Cascavel, Paraná, Brasil. A caracterização do gênero com base nas larvas é ampliada.Description of the Ultimate Stadium Larva of Micrathyria pseudeximia Westfall(Odonata, Libellulidae.Abstract. The larva of ultimate stadium of Micrathyria pseudeximia Westfall, 1992 is described and illustrated based on material collected in Cascavel Municipality, Paraná State, Brazil. The generic concept based on the larvae is amplified.

  6. Diagnosis of brugian filariasis by loop-mediated isothermal amplification.

    Directory of Open Access Journals (Sweden)

    Catherine B Poole

    Full Text Available In this study we developed and evaluated a Brugia Hha I repeat loop-mediated isothermal amplification (LAMP assay for the rapid detection of Brugia genomic DNA. Amplification was detected using turbidity or fluorescence as readouts. Reactions generated a turbidity threshold value or a clear visual positive within 30 minutes using purified genomic DNA equivalent to one microfilaria. Similar results were obtained using DNA isolated from blood samples containing B. malayi microfilariae. Amplification was specific to B. malayi and B. timori, as no turbidity was observed using DNA from the related filarial parasites Wuchereria bancrofti, Onchocerca volvulus or Dirofilaria immitis, or from human or mosquito. Furthermore, the assay was most robust using a new strand-displacing DNA polymerase termed Bst 2.0 compared to wild-type Bst DNA polymerase, large fragment. The results indicate that the Brugia Hha I repeat LAMP assay is rapid, sensitive and Brugia-specific with the potential to be developed further as a field tool for diagnosis and mapping of brugian filariasis.

  7. Diagnosis of brugian filariasis by loop-mediated isothermal amplification.

    Science.gov (United States)

    Poole, Catherine B; Tanner, Nathan A; Zhang, Yinhua; Evans, Thomas C; Carlow, Clotilde K S

    2012-01-01

    In this study we developed and evaluated a Brugia Hha I repeat loop-mediated isothermal amplification (LAMP) assay for the rapid detection of Brugia genomic DNA. Amplification was detected using turbidity or fluorescence as readouts. Reactions generated a turbidity threshold value or a clear visual positive within 30 minutes using purified genomic DNA equivalent to one microfilaria. Similar results were obtained using DNA isolated from blood samples containing B. malayi microfilariae. Amplification was specific to B. malayi and B. timori, as no turbidity was observed using DNA from the related filarial parasites Wuchereria bancrofti, Onchocerca volvulus or Dirofilaria immitis, or from human or mosquito. Furthermore, the assay was most robust using a new strand-displacing DNA polymerase termed Bst 2.0 compared to wild-type Bst DNA polymerase, large fragment. The results indicate that the Brugia Hha I repeat LAMP assay is rapid, sensitive and Brugia-specific with the potential to be developed further as a field tool for diagnosis and mapping of brugian filariasis.

  8. Diagnosis of brugian filariasis by loop-mediated isothermal amplification.

    Science.gov (United States)

    Poole, Catherine B; Tanner, Nathan A; Zhang, Yinhua; Evans, Thomas C; Carlow, Clotilde K S

    2012-01-01

    In this study we developed and evaluated a Brugia Hha I repeat loop-mediated isothermal amplification (LAMP) assay for the rapid detection of Brugia genomic DNA. Amplification was detected using turbidity or fluorescence as readouts. Reactions generated a turbidity threshold value or a clear visual positive within 30 minutes using purified genomic DNA equivalent to one microfilaria. Similar results were obtained using DNA isolated from blood samples containing B. malayi microfilariae. Amplification was specific to B. malayi and B. timori, as no turbidity was observed using DNA from the related filarial parasites Wuchereria bancrofti, Onchocerca volvulus or Dirofilaria immitis, or from human or mosquito. Furthermore, the assay was most robust using a new strand-displacing DNA polymerase termed Bst 2.0 compared to wild-type Bst DNA polymerase, large fragment. The results indicate that the Brugia Hha I repeat LAMP assay is rapid, sensitive and Brugia-specific with the potential to be developed further as a field tool for diagnosis and mapping of brugian filariasis. PMID:23272258

  9. Effectiveness of probiotic Phaeobacter bacteria grown in biofilters against Vibrio anguillarum infections in the rearing of Turbot (Psetta maxima) larvae.

    Science.gov (United States)

    Prol-García, María J; Pintado, José

    2013-12-01

    The rearing environment of first-feeding turbot larvae, usually with high larvae densities and organic matter concentrations, may promote the growth of opportunistic pathogenic Vibrionaceae bacteria, compromising the survival of the larvae. The aim of this study was to assess the effectiveness of the biofilm-forming probiotic Phaeobacter 27-4 strain grown on a ceramic biofilter (probiofilter) in preventing Vibrio anguillarum infections in turbot larvae. In seawater with added microalgae and maintained under turbot larvae rearing conditions, the probiofilter reduced the total Vibrionaceae count and the concentration of V. anguillarum, which was undetectable after 144 h by real-time PCR. The probiofilter also improved the survival of larvae challenged with V. anguillarum, showing an accumulated mortality similar to that of uninfected larvae (35-40 %) and significantly (p biofilters can constantly inoculate probiotics into rearing tanks and are therefore potentially useful for bacterial control in both open and recirculating industrial units.

  10. MRI findings of spinal visceral larva migrans of Toxocara canis

    International Nuclear Information System (INIS)

    Purpose: The purpose of this study is to investigate the MRI findings of visceral larva migrans (VLS) of Toxocara canis in spinal cord. Materials and methods: We retrospectively reviewed spinal MRI findings in eight patients with serologically proven Toxocara canis between 2005 and 2008. We evaluated the location, length, extent and migration of the lesion, MR signal intensity (SI), enhancement pattern, and swelling of the spinal cord. We evaluated clinical features including presenting symptoms and signs and treatment response. Results: Total 8 patients (M = 8; age range 36-79 years) were included. The lesions were located in the cervical or thoracic spinal cord in all patients. All lesions showed high SI and minimal or mild swelling of involved spinal cord on T2WI and focal nodular enhancement on posterior or posterolateral segment of spinal cord. The length of involved lesion was relatively short in most patients. There was a migration of lesion in one patient. In spite of albendazole or steroid treatment, neurological symptoms or signs were not significantly improved in all patients. Conclusion: Although all lesions show non-specific imaging findings like non-tumorous myelopathy mimicking transverse myelitis, single lesion, focal nodular enhancement on posterior or posterolateral segment of spinal cord, relatively short segmental involvement and migration of lesion may be characteristic findings of spinal VLM of Toxocara canis. In addition, the reluctant response to the treatment may be characteristic of spinal VLM of Toxocara canis.

  11. Enzymatic properties of phenoloxidase from Pieris rapae (Lepidoptera) larvae

    Institute of Scientific and Technical Information of China (English)

    CHAO-BIN XUE; WAN-CHUN LUO; QING-XI CHEN; QIN WANG; LI-NA KE

    2006-01-01

    The kinetic parameters of partially purified phenoloxidase (PO, EC. 1.14.18.1) from the 5th instar larvae of Pieris rapae (Lepidoptera) were determined, using L-3, 4-dihydroxyphenylalanine (L-DOPA) as substrate. The optimal pH and temperature of the enzyme for the oxidation of L-DOPA were determined to be at pH 7.0 and at 42℃,respectively. The enzyme was stable between pH 6.5 and 7.4 and at temperatures lower than 37℃. At pH 6.8 and 37℃, the Michaelis constant (Km) and maximal velocity (Vm) of the enzyme for the oxidation of L-DOPA were determined to be 0.80 mmol/L and 1.84 μmol/ L/min, respectively. Tetra-hexylresorcinol and 4-dodecylresorcinol effectively inhibited activity of phenoloxidase and this inhibition was reversible and competitive, with the IC50 of 1.50 and 1.12μmol/L, respectively. The inhibition constants were estimated to be 0.50 and 0.47μmol/L, respectively.

  12. Parasitic infection protects wasp larvae against a bacterial challenge.

    Science.gov (United States)

    Manfredini, Fabio; Beani, Laura; Taormina, Mauro; Vannini, Laura

    2010-09-01

    Host antibacterial defense after Strepsiptera parasitization is a complex and rather unexplored topic. The way how these parasites interact with bacteria invading into the host insect during an infection is completely unknown. In the present study we demonstrate that larvae of the paper wasp Polistes dominulus are more efficient at eliminating bacteria when they are parasitized by the strepsipteran insect Xenos vesparum. We looked at the expression levels of the antimicrobial peptide defensin and we screened for the activity of other hemolymph components by using a zone of inhibition assay. Transcription of defensin is triggered by parasitization, but also by mechanical injury (aseptic injection). Inhibitory activity in vitro against the Gram positive bacterium Staphylococcus aureus is not influenced by the presence of the parasite in the wasp or by a previous immune challenge, suggesting a constitutive power of killing this bacterium by wasp hemolymph. Our results suggest either direct involvement of the parasite or that defensin and further immune components not investigated in this paper, for example other antimicrobial peptides, could play a role in fighting off bacterial infections in Polistes. PMID:20546915

  13. Xenobiotics Produce Distinct Metabolomic Responses in Zebrafish Larvae (Danio rerio).

    Science.gov (United States)

    Huang, Susie S Y; Benskin, Jonathan P; Chandramouli, Bharat; Butler, Heather; Helbing, Caren C; Cosgrove, John R

    2016-06-21

    Sensitive and quantitative protocols for characterizing low-dose effects are needed to meet the demands of 21st century chemical hazard assessment. To test the hypothesis that xenobiotic exposure at environmentally relevant concentrations produces specific biochemical fingerprints in organisms, metabolomic perturbations in zebrafish (Danio rerio) embryo/larvae were measured following 24 h exposures to 13 individual chemicals covering a wide range of contaminant classes. Measured metabolites (208 in total) included amino acids, biogenic amines, fatty acids, bile acids, sugars, and lipids. The 96-120 h post-fertilization developmental stage was the most appropriate model for detecting xenobiotic-induced metabolomic perturbations. Metabolomic fingerprints were largely chemical- and dose-specific and were reproducible in multiple exposures over a 16-month period. Furthermore, chemical-specific responses were detected in the presence of an effluent matrix; importantly, in the absence of morphological response. In addition to improving sensitivity for detecting biological responses to low-level xenobiotic exposures, these data can aid the classification of novel contaminants based on the similarity of metabolomic responses to well-characterized "model" compounds. This approach is clearly of use for rapid, sensitive, and specific analyses of chemical effect on organisms, and can supplement existing methods, such as the Zebrafish Embryo Toxicity assay (OECD TG236), with molecular-level information. PMID:27232715

  14. Solexa sequencing based transcriptome analysis of Helicoverpa armigera larvae.

    Science.gov (United States)

    Li, Jigang; Li, Xiumin; Chen, Yongli; Yang, Zhongxiang; Guo, Sandui

    2012-12-01

    Helicoverpa armigera (Hübner) is a polyphagous Lepidoptera pest which causes great economic losses in crop production worldwide. In contrast to its agricultural importance, advances in the molecular aspects of this insect are quite limited. In the present study, Illumina's SOLEXA sequencing was adopted to determine the transcriptome of young H. armigera larvae. About 7 gigabases of raw sequence data was generated and assembled into 116,601 contigs with an average length of 389 base pairs after data preprocess. 37,352 of these contigs were annotated by searching against Uniref 100 of UniProt database. The annotated sequences were functionally classified into three groups including biological process (15,632 sequences), cellular component (9,562 sequences) and molecular function (19,258 sequences). KEGG (Kyoto Encyclopedia of Genes and Genomes) analysis showed that 1,409 contigs predicted to encode enzymes with enzyme commission numbers were mapped into 220 KEGG pathways in total. Finally, contigs with simple sequence repeats were derived from this dataset. PMID:23065207

  15. Effect of Irradiation on Anisakis Larvae in Salted Herring

    International Nuclear Information System (INIS)

    The authors describe experiments to test the practicability of using irradiation to kill Anisakis marina larvae in lightly salted herring (Clupea harengus), The lower salt concentration used since the second world war for the preservation of gibbed herring is insufficient to kill the parasites that may be harmful to the consumer. The nematodes were subjected to irradiation, either in water or saline suspension, or pressed between salted herring fillets or in situ in salted gibbed herring. The results were disappointing. In aqueous suspensions, a salt concentration of 6% and a dose of 1.0 Mrad resulted in 100% kill, but appreciable numbers survived (although many of these were inactive) at lower irradiation dosages and at lower salt concentrations. It was noted that for doses of either 0 or 0.3 Mrad the highest proportion of survivals occurred in 3% salt solutions. In testing the effect of irradiation on parasites in the fish or placed between fillets the dosages were limited, because of flavour and colour changes, to 0.3 Mrad for salted ripened herring, and 0.6 Mrad for 5-day-old lightly salted herring. Substantial numbers of nematodes survived these doses. (author)

  16. Chronic Wounds, Biofilms and Use of Medicinal Larvae

    Directory of Open Access Journals (Sweden)

    Linda J. Cowan

    2013-01-01

    Full Text Available Chronic wounds are a significant health problem in the United States, with annual associated costs exceeding $20 billion annually. Traditional wound care consists of surgical debridement, manual irrigation, moisture retentive dressings, and topical and/or systemic antimicrobial therapy. However, despite progress in the science of wound healing, the prevalence and incidence of chronic wounds and their complications are escalating. The presence & complexity of bacterial biofilms in chronic wounds has recently been recognized as a key aspect of non-healing wounds. Bacterial biofilms are sessile colonies of polymicrobial organisms (bacteria, fungus, etc. enclosed within a self-produced exopolymeric matrix that provides high levels of tolerance to host defenses, antibiotics and antiseptics. Thus, there is a need for alternative therapies to reduce biofilms in chronic wounds. In this report, we present initial findings from in vitro experiments which show that larval debridement therapy with disinfected blow fly larvae (Phaenicia sericata reduced total CFUs (6-logs of planktonic and mature biofilms of Pseudomonas aeruginosa or Staphylococcus aureus grown on dermal pig skin explants by 5-logs after 24 hours of exposure, and eliminated biofilms (no measurable CFUs after 48 hours of exposure.

  17. MRI findings of spinal visceral larva migrans of Toxocara canis

    Energy Technology Data Exchange (ETDEWEB)

    Lee, In Ho, E-mail: leeinho1974@hanmail.ne [Department of Radiology and Center for Imaging Science, Samsung Medical Center, Sungkyunkwan University School of Medicine, 50 Ilwon-dong, Gangnam-Gu, Seoul 135-710 (Korea, Republic of); Department of Radiology, Chungnam National University Hospital, 33 Munhwa-ro, Jung-gu, Daejeon 301-721 (Korea, Republic of); Kim, Sung Tae, E-mail: st7.kim@hotmail.co [Department of Radiology and Center for Imaging Science, Samsung Medical Center, Sungkyunkwan University School of Medicine, 50 Ilwon-dong, Gangnam-Gu, Seoul 135-710 (Korea, Republic of); Oh, Dae Kun, E-mail: odk6464@nate.co [Department of Radiology and Center for Imaging Science, Samsung Medical Center, Sungkyunkwan University School of Medicine, 50 Ilwon-dong, Gangnam-Gu, Seoul 135-710 (Korea, Republic of); Kim, Hyung-Jin, E-mail: hyungkim@skku.ed [Department of Radiology and Center for Imaging Science, Samsung Medical Center, Sungkyunkwan University School of Medicine, 50 Ilwon-dong, Gangnam-Gu, Seoul 135-710 (Korea, Republic of); Kim, Keon Ha, E-mail: somatom@skku.ed [Department of Radiology and Center for Imaging Science, Samsung Medical Center, Sungkyunkwan University School of Medicine, 50 Ilwon-dong, Gangnam-Gu, Seoul 135-710 (Korea, Republic of); Jeon, Pyoung, E-mail: drpjeon@gmail.co [Department of Radiology and Center for Imaging Science, Samsung Medical Center, Sungkyunkwan University School of Medicine, 50 Ilwon-dong, Gangnam-Gu, Seoul 135-710 (Korea, Republic of); Byun, Hong Sik, E-mail: byun5474@skku.ed [Department of Radiology and Center for Imaging Science, Samsung Medical Center, Sungkyunkwan University School of Medicine, 50 Ilwon-dong, Gangnam-Gu, Seoul 135-710 (Korea, Republic of)

    2010-08-15

    Purpose: The purpose of this study is to investigate the MRI findings of visceral larva migrans (VLS) of Toxocara canis in spinal cord. Materials and methods: We retrospectively reviewed spinal MRI findings in eight patients with serologically proven Toxocara canis between 2005 and 2008. We evaluated the location, length, extent and migration of the lesion, MR signal intensity (SI), enhancement pattern, and swelling of the spinal cord. We evaluated clinical features including presenting symptoms and signs and treatment response. Results: Total 8 patients (M = 8; age range 36-79 years) were included. The lesions were located in the cervical or thoracic spinal cord in all patients. All lesions showed high SI and minimal or mild swelling of involved spinal cord on T2WI and focal nodular enhancement on posterior or posterolateral segment of spinal cord. The length of involved lesion was relatively short in most patients. There was a migration of lesion in one patient. In spite of albendazole or steroid treatment, neurological symptoms or signs were not significantly improved in all patients. Conclusion: Although all lesions show non-specific imaging findings like non-tumorous myelopathy mimicking transverse myelitis, single lesion, focal nodular enhancement on posterior or posterolateral segment of spinal cord, relatively short segmental involvement and migration of lesion may be characteristic findings of spinal VLM of Toxocara canis. In addition, the reluctant response to the treatment may be characteristic of spinal VLM of Toxocara canis.

  18. Toxic effects of silica nanoparticles on zebrafish embryos and larvae.

    Directory of Open Access Journals (Sweden)

    Junchao Duan

    Full Text Available Silica nanoparticles (SiNPs have been widely used in biomedical and biotechnological applications. Environmental exposure to nanomaterials is inevitable as they become part of our daily life. Therefore, it is necessary to investigate the possible toxic effects of SiNPs exposure. In this study, zebrafish embryos were treated with SiNPs (25, 50, 100, 200 µg/mL during 4-96 hours post fertilization (hpf. Mortality, hatching rate, malformation and whole-embryo cellular death were detected. We also measured the larval behavior to analyze whether SiNPs had adverse effects on larvae locomotor activity. The results showed that as the exposure dosages increasing, the hatching rate of zebrafish embryos was decreased while the mortality and cell death were increased. Exposure to SiNPs caused embryonic malformations, including pericardial edema, yolk sac edema, tail and head malformation. The larval behavior testing showed that the total swimming distance was decreased in a dose-dependent manner. The lower dose (25 and 50 µg/mL SiNPs produced substantial hyperactivity while the higher doses (100 and 200 µg/mL SiNPs elicited remarkably hypoactivity in dark periods. In summary, our data indicated that SiNPs caused embryonic developmental toxicity, resulted in persistent effects on larval behavior.

  19. Transcriptional response of Musca domestica larvae to bacterial infection.

    Directory of Open Access Journals (Sweden)

    Ting Tang

    Full Text Available The house fly Musca domestica, a cosmopolitan dipteran insect, is a significant vector for human and animal bacterial pathogens, but little is known about its immune response to these pathogens. To address this issue, we inoculated the larvae with a mixture of Escherichia coli and Staphylococcus aureus and profiled the transcriptome 6, 24, and 48 h thereafter. Many genes known to controlling innate immunity in insects were induced following infection, including genes encoding pattern recognition proteins (PGRPs, various components of the Toll and IMD signaling pathways and of the proPO-activating and redox systems, and multiple antimicrobial peptides. Interestingly, we also uncovered a large set of novel immune response genes including two broad-spectrum antimicrobial peptides (muscin and domesticin, which might have evolved to adapt to house-fly's unique ecological environments. Finally, genes mediating oxidative phosphorylation were repressed at 48 h post-infection, suggesting disruption of energy homeostasis and mitochondrial function at the late stages of infection. Collectively, our data reveal dynamic changes in gene expression following bacterial infection in the house fly, paving the way for future in-depth analysis of M. domestica's immune system.

  20. Crown-of-Thorns Starfish Larvae Can Feed on Organic Matter Released from Corals

    Directory of Open Access Journals (Sweden)

    Ryota Nakajima

    2016-10-01

    Full Text Available Previous studies have suggested that Crown-of-Thorns starfish (COTS larvae may be able to survive in the absence of abundant phytoplankton resources suggesting that they may be able to utilize alternative food sources. Here, we tested the hypothesis that COTS larvae are able to feed on coral-derived organic matter using labeled stable isotope tracers (13C and 15N. Our results show that coral-derived organic matter (coral mucus and associated microorganisms can be assimilated by COTS larvae and may be an important alternative or additional food resource for COTS larvae through periods of low phytoplankton biomass. This additional food resource could potentially facilitate COTS outbreaks by reducing resource limitation.

  1. The culture of sand goby, Oxyeleotris marmoratus I: Feed and feeding scheme of larvae and juveniles

    Directory of Open Access Journals (Sweden)

    Uraiwan Chamnanwech

    2003-05-01

    Full Text Available Natural spawning of sand goby was carried out in earthen ponds and eggs were then collected. Fertilized eggs were incubated in a glass aquaria for hatching. The feed and feeding scheme experiments were done in the 500 liters (water volume 300 liters rearing tanks containing 1,000-1,500 of two-day old larvae (stage at first feeding. It was found that the larvae 3-18 days old (average total length 0.31-0.41 cm preferably fed only on rotifer while the 21-27 day-old larvae (average total length 0.44-0.65 cm fed on rotifer and Artemia, and the 30-45 day- old larvae (average total length 0.69-2.15 cm fed only on Moina.

  2. Organochlorine chemical hazards for sturgeon larvae in the Middle Mississippi River National Wildlife Refuge

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — We conducted an ecological risk assessment to characterize organochlorine chemical hazards for sturgeon larvae in the Middle Mississippi River National Wildlife...

  3. Capture of white sturgeon larvae downstream of The Dalles Dam, Columbia River, Oregon and Washington, 2012

    Science.gov (United States)

    Parsley, Michael J.; Kofoot, Eric

    2013-01-01

    Wild-spawned white sturgeon (Acipenser transmontanus) larvae captured and reared in aquaculture facilities and subsequently released, are increasingly being used in sturgeon restoration programs in the Columbia River Basin. A reconnaissance study was conducted to determine where to deploy nets to capture white sturgeon larvae downstream of a known white sturgeon spawning area. As a result of the study, 103 white sturgeon larvae and 5 newly hatched free-swimming embryos were captured at 3 of 5 reconnaissance netting sites. The netting, conducted downstream of The Dalles Dam on the Columbia River during June 25–29, 2012, provided information for potentially implementing full-scale collection efforts of large numbers of larvae for rearing in aquaculture facilities and for subsequent release at a larger size in white sturgeon restoration programs.

  4. Identification of Balanus amphitrite larvae from field zooplankton using species-specific primers

    Digital Repository Service at National Institute of Oceanography (India)

    Gaonkar, C.C.; Khandeparker, L.; Desai, D.V.; Anil, A.C.

    robotic molecular method for in situ detection of marine invertebrate larvae. Molecular Ecology Resources 8, 540-550. Karande A.A. (1967) On cirripede crustaceans (barnacles), an important fouling group in Bombay waters. Proceedings Symposium...

  5. Toxicological studies for some agricultural waste extracts on mosquito larvae and experimental animals

    Directory of Open Access Journals (Sweden)

    Somia El-Maghraby

    2012-07-01

    Conclusions: Black liquor can be used efficiently to control Cx. pipiens larvae under laboratory condition. Environmental problem caused by rice straw can be solved by converting the waste material to beneficial natural selective insecticide.

  6. Effect of Exogenous MJA Treatment of Tea Plants on the Growth of Geometrid Larvae

    Institute of Scientific and Technical Information of China (English)

    GUI Lian-you; CHEN Zong-mao; LIU Shu-sheng

    2005-01-01

    The effect of tea plant Camellia sinensis induced by exogenous methyl jasmonate (MJA) on lipoxygenase (LOX), polyphenol oxidase (PPO) and proteinase inhibitor (PI) activity in the leaves of tea plants, as well as the growth and midgut proteinase activity of the geometrid Ectropis obliqua larvae were studied. MJA significantly induced LOX, PPO and PI activity in leaves of tea plants. When geometrid larvae have fed on leaves of tea plants treated with MJA, the activities of the high alkaline trypsin-like enzyme and chymotrypsin-like enzyme in their midgut were significantly inhibited, but the activities of the low alkaline trypsin-like enzyme in their midgut were unaffected, leading to imbalance between different types of proteinase activity in the midgut of the larvae and in turn, the growth were inhibited. These chains of response may be an important mechanism of the direct resistance induced by MJA-treatment of tea plant on geometrid larvae.

  7. A Laboratory Practical on the House Building Behaviour of Caddis Larvae

    Science.gov (United States)

    Hansell, M. H.

    1973-01-01

    Describes a laboratory practical on animal behavior suitable for senior secondary school or university biology classes. Several separate exercises relating to the house building behavior of caddis fly larvae are detailed, together with the time required for preparation. (JR)

  8. Unusual pseudomyiasis with Musca domestica (housefly larvae in a child with chronic otitis media

    Directory of Open Access Journals (Sweden)

    Zafar Iqbal

    2016-01-01

    Full Text Available Myiasis is a disease caused by fly larvae and aural myiasis is a rare clinic condition often occurring in children or mentally retarded people. We report the case of an unusual presentation of a unilateral aural myiasis in a 3-year-old female child patient belonging to a slum with unilateral chronic otitis media caused by Musca domestica (housefly larvae. Eight larvae were removed from the external auditory canal while five more larvae were located in the middle ear cavity and were removed through perforation of the tympanic membrane. Management of ear myiasis is based on removal of the maggots and cleansing of the ear with ethanol, chloroform, or physiological saline. Physiological saline is preferred in patients who have tympanic membrane perforation. Myiasis is related to personal hygiene. Therefore, to decrease the incidence of these infestations, care, and hygiene standards should be carried out for those at risk through information, education, and communication.

  9. Identification of Nanopillars on the Cuticle of the Aquatic Larvae of the Drone Fly (Diptera: Syrphidae).

    Science.gov (United States)

    Hayes, Matthew J; Levine, Timothy P; Wilson, Roger H

    2016-01-01

    Here, we describe a nano-scale surface structure on the rat-tailed maggot, the aquatic larva of the Drone fly Eristalis tenax(L.). Larvae of this syrphid hover fly live in stagnant, anaerobic water-courses that are rich in organic matter. The larvae burrow into fetid slurry and feed on microorganisms which they filter out from the organic material. This environment is rich in bacteria, fungi and algae with the capacity to form biofilms that might develop on the larval surface and harm them. Using transmission and scanning electron microscopy we have identified an array of slender (typically < 100 nm in diameter) nanopillars that cover the surface of the larvae. The high density and dimensions of these spine-like projections appear to make it difficult for bacteria to colonize the surface of the animal. This may interfere with the formation of biofilms and potentially act as a defence against bacterial infection. PMID:27030395

  10. Tolerance to low temperatures of Toxocara cati larvae in chicken muscle tissue

    DEFF Research Database (Denmark)

    Taira, Kensuke; Saitoh, Yasuhide; Okada, Natsuki;

    2012-01-01

    Infectivity of Toxocara cati larvae in muscle tissue of chickens after storage at 4 degrees C and -25 degrees C was assessed in a mouse bioassay to provide information on the risk of meat-borne toxocarosis. Muscle tissue samples of 30-day old T. cati infections were stored at 4 degrees C for 14...... of the infected chicken meat), 47.9% of the inoculated larvae established in mice, whereas storage of meat at 4 degrees C for 14 days or 28 days reduced the recovery to 24.1% or 3.3 respectively. Muscle larvae exposed to -25 degrees C for 12,24 or 48 h did not establish in the mice. The observation that larvae...... retain infective after refrigeration at exposure in 4 degrees C for 28 days, emphasize the zoonotic potential of poultry meat as a causative agent of human toxocarosis....

  11. Effects of prey density on the growth and survival of hybrid snakehead larvae

    Institute of Scientific and Technical Information of China (English)

    Wenkui LIU; Qixue FAN; Bangke ZHU; Haiming DU; Xigang FENG

    2008-01-01

    The effects of prey density (0.1, 0.3, 1, 3 and snakehead (Channa argus × C. maculate) larvae were investigated. The larvae were divided into three groups with different body lengths of 0.68 cm, 1.50 cm and 3.20 cm, respectively. The growth of the hybrid snake-head larvae in all three groups increased with prey growth rate (SGR) was the highest when the prey density early development stage) decreased, while no significant change was observed in those of Group Ⅱ and Group Ⅲ. The survival rates of hybrid snakehead larvae in all three groups were high (91.11%-100%) and not significantly affected by the prey densities except in Group Ⅰ with the significantly lower than the others. Body size was not sensitive to prey density. The optimum prey density was confirmed at 1 prey·mL-1 in all the treatments.

  12. Description of two final stadium Onychogomphus larvae from Thailand (Odonata: Gomphidae).

    Science.gov (United States)

    Chainthong, Damrong; Boonsoong, Boonsatien

    2016-01-01

    The final stadium larvae of Onychogomphus castor Lieftinck and O. duaricus Fraser are described and illustrated for the first time based on reared specimens from Thailand. The taxonomic characteristics of the larvae of the genus Onychogomphus are discussed and summarized. The larva of O. castor differs from other Southeast Asian species in having distinct mid-dorsal spines on S2-9, divergent wing pads reaching S5, and lateral spines on S6-9. The larva of O. duaricus has a weakly swollen third antennal segment, with short blunt mid-dorsal spines on S2-9, divergent wing sheaths reaching the middle of S4, and lateral spines present on S7-9. PMID:27395854

  13. Probiotic effects on cobia Rachycentron canadum larvae reared in a recirculating aquaculture system

    Directory of Open Access Journals (Sweden)

    M. Angélica Garrido-Pereira

    2014-11-01

    Full Text Available Cobia (Rachycentron canadum is a marine finfish with good potential for mariculture. This study analyzes the effects of probiotic Bacillus spp. on the performance of cobia larvae reared in a recirculating aquaculture system (RAS. Larvae were stocked into two independent RAS for 26 days after hatching. One of the systems (Probiotic treatment received the addition of a commercial probiotic consisting of B. subtilis, B. licheniformis and B. pumilus directly into the water and by live feed. Survival, final weight and water quality were not affected by probiotics. Results showed larvae of the probiotic treatment demonstrated a greater resistance to salinity stress. Immunohistochemical analysis showed a higher expression of CD4 in probiotic treatment. These results suggest that Bacillus spp. probiotics used in RAS have a potential stimulating impact on immune system differentiation and increases salinity stress resistance of cobia larvae.

  14. 16S rRNA amplicon sequencing dataset for conventionalized and conventionally raised zebrafish larvae.

    Science.gov (United States)

    Davis, Daniel J; Bryda, Elizabeth C; Gillespie, Catherine H; Ericsson, Aaron C

    2016-09-01

    Data presented here contains metagenomic analysis regarding the sequential conventionalization of germ-free zebrafish embryos. Zebrafish embryos that underwent a germ-free sterilization process immediately after fertilization were promptly exposed to and raised to larval stage in conventional fish water. At 6 days postfertilization (dpf), these "conventionalized" larvae were compared to zebrafish larvae that were raised in conventional fish water never undergoing the initial sterilization process. Bacterial 16S rRNA amplicon sequencing was performed on DNA isolated from homogenates of the larvae revealing distinct microbiota variations between the two groups. The dataset described here is also related to the research article entitled "Microbial modulation of behavior and stress responses in zebrafish larvae" (Davis et al., 2016) [1]. PMID:27508247

  15. Toxocara cati larvae in the eye of a child: a case report

    Directory of Open Access Journals (Sweden)

    Mohammad Zibaei

    2014-05-01

    Full Text Available Toxocariasis is a consequence of human infection by Toxocara larvae. There are symptomatic (visceral, ocular and asymptomatic course of toxocariasis. The ocular form is very rare. We present a 6-year-old patient who developed an ocular form of toxocariasis caused by Toxocara cati. He demonstrated lesions in the peripheral retina of the right eye. White granuloma was present in the superior peripheral retina. A positive immunological assay for toxocariasis essentially completed the outcomes. On the basis of clinical manifestations and conducted examinations, a diagnosis of ocular form of toxocariasis was established. Albendazole and corticosteroids were applied in treatment. Current results clearly highlight the usefulness of excretory-secretory antigens derived from larvae of Toxocara cati for the fine diagnosis ocular larva migrans caused by Toxocara larvae.

  16. Consequences of physical disturbance by tadpoles and snails on chironomid larvae.

    Science.gov (United States)

    Pal, Gargi; Aditya, Gautam; Hazra, Niladri

    2014-01-01

    Indirect interactions among community members impact on organisms. The effects of two snails, banded pond snail, Bellamya bengalensis (Lamarck), and Red-rimmed melania, Melanoides tuberculata (Müller), and tadpoles of Asian common toad, Duttaphrynus melanostictus (Schneider), on nonbiting midge larvae, Chironomus striatipennis Kieffer, were observed in experimental microcosm. Decrease in tube number and tube length of midge larvae was observed compared to control condition due to introduction of selected above mentioned organisms. The direct effects of non-predator organisms on the midge larvae are due to physical disturbance that destroys their tubes. This may result in vulnerability of midge larvae to predators in the wild. So the community structure may be altered by indirect effects, where one or more species, through their direct disturbance, indirectly change the abundance of other species. PMID:24672384

  17. Consequences of Physical Disturbance by Tadpoles and Snails on Chironomid Larvae

    Directory of Open Access Journals (Sweden)

    Gargi Pal

    2014-01-01

    Full Text Available Indirect interactions among community members impact on organisms. The effects of two snails, banded pond snail, Bellamya bengalensis (Lamarck, and Red-rimmed melania, Melanoides tuberculata (Müller, and tadpoles of Asian common toad, Duttaphrynus melanostictus (Schneider, on nonbiting midge larvae, Chironomus striatipennis Kieffer, were observed in experimental microcosm. Decrease in tube number and tube length of midge larvae was observed compared to control condition due to introduction of selected above mentioned organisms. The direct effects of non-predator organisms on the midge larvae are due to physical disturbance that destroys their tubes. This may result in vulnerability of midge larvae to predators in the wild. So the community structure may be altered by indirect effects, where one or more species, through their direct disturbance, indirectly change the abundance of other species.

  18. Larvae of fouling organisms and macrofouling at New Mangalore Port, west coast of India

    Digital Repository Service at National Institute of Oceanography (India)

    Khandeparker, D.C.; Anil, A.C.; Venkat, K.

    Polychaetes, bryozoans, barnacles and ascidians were the dominant groups in the fouling community at New Mangalore Port. Polychaete and cirripede larvae were encountered throughout the year. Even though bivalve were present in the planktonic hauls...

  19. Description of the larva of Argia chelata Calvert, 1902 (Odonata: Coenagrionidae).

    Science.gov (United States)

    Novelo-Gutiérrez, Rodolfo

    2013-01-01

    The larva of Argia chelata is described and figured. It falls into the group of Argia larvae with a moderately prominent ligula and two palpal seta, but it differs from its closest relatives by having labial palp with 2 setae plus one basal setella; the length of the ligula is 30% of its maximum width; basal tergites (1-5) lacking long, fine setae, mainly on midline; S8-10 mostly dark brown; paraprocts with spiniform setae on basal 0.25 and 0.55 of dorsal and ventral borders, respectively. Larvae were found in 2nd to 4th order shallow streams in cloud forest, crawling among debris, fine sand and mud where the water flow is slow or still, close to the shoreline. The larva is compared with A. lacrimans (Hagen), A. pima Garrison, and A. tonto Calvert, species apparently closely related.  PMID:25113363

  20. Vulnerability of the mosquito larvae to the guppies (Poecilia reticulata in the presence of alternative preys

    Directory of Open Access Journals (Sweden)

    Barnali Manna

    2008-08-01

    Full Text Available Background & objectives: The predatory potential of the larvivorous fishes can be affected by the presence of alternative preys. In the present study the predation pattern of the sewage dwelling Poecilia reticulata (Peters 1872 on the larvae of Culex quinquefasciatus Say 1823 (Diptera: Culicidae was evaluated in the presence of alternative preys. Methods: The predation of Cx. quinquefasciatus larvae by different size groups of P. reticulata fishes was evaluated. In addition to this, the niche breadth (N and diet breadth (B were measured following Manly’s selectivity index (Si as an indicator of variation of such predation pattern in the presence of alternative prey types, like chironomid larvae and tubificid worms.Results: The consumption of IV instar Cx. quinquefasciatus larvae by individual P. reticulata ranged between 65 and 84 in a 3 h feeding period and varied with the size of fish (F2, 33 = 34.91; p<0.001. The selectivity coefficient revealed a significantly low preference for the Cx. quinquefasciatus larvae (0.16, CL: 0.05 – 0.27; p< 0.05 compared to the chironomid larvae and tubificid worms, when all the three prey types were present. The niche breadth (N and diet breadth (B ranged from 0.77 to 0.92 and 0.69 to 0.93, respectively. The total consumption of all the prey types varied with the predator density, but the selectivity index for the mosquito larvae was significantly low in all the instances.Interpretation & conclusion: P. reticulata can consume a good number of mosquito larvae, with the consumption rate varying with the body size. P. reticulata fishes exhibit low preference for mosquito larvae as prey in the presence of alternative controphic preys like chironomid larvae and tubificid worms. Though establishment and sustenance of P. reticulata in new habitats will be favoured by the presence of alternative preys, but vulnerability of mosquito larvae may be reduced with availability of multiple preys in natural conditions.

  1. Dietary ascorbic acid requirements during the hatchery production of turbot larvae

    OpenAIRE

    Merchie, G.; Lavens, P.; Dhert, Ph.; Garcia Ulloa Gómez, M.; Nelis, H.; De leenheer, A P; Sorgeloos, P.

    1996-01-01

    The effect of the high ascorbic acid (AA) levels transferred through enriched live food was evaluated for turbot Scophthalmus maximus larvae in two consecutive feeding experiments. The same feeding strategy was applied to all treatments, except for the AA content in the live food which was manipulated through bioencapsulation with ascorbyl palmitate. This resulted finally in a low, medium and high-AA treatment. The AA incorporation levels in the turbot larvae (up to 1400 µg AA g DW-1) were co...

  2. Chemical Composition and Food Potential of Pachymerus nucleorum Larvae Parasitizing Acrocomia aculeata Kernels

    OpenAIRE

    Ariana Vieira Alves; Eliana Janet Sanjinez Argandoña; Adelita Maria Linzmeier; Claudia Andrea Lima Cardoso; Maria Lígia Rodrigues Macedo

    2016-01-01

    Insect consumption as food is culturally practiced in various regions of the world. In Brazil, there are more than 130 species of edible insects registered, from nine orders, among which stands out the Coleoptera. The larva of the beetle Pachymerus nucleorum Fabricius, 1792, grows into the bocaiuva fruit (Acrocomia aculeata (Jacq.) Lodd. Ex Mart., 1845), which has proven nutritional quality. The aim of this work was to evaluate the nutritional potential of P. nucleorum larvae compared to boca...

  3. Lethality and developmental delay in Drosophila melanogaster larvae after ingestion of selected Pseudomonas fluorescens strains.

    Directory of Open Access Journals (Sweden)

    Marika H Olcott

    Full Text Available BACKGROUND: The fruit fly, Drosophila melanogaster, is a well-established model organism for probing the molecular and cellular basis of physiological and immune system responses of adults or late stage larvae to bacterial challenge. However, very little is known about the consequences of bacterial infections that occur in earlier stages of development. We have infected mid-second instar larvae with strains of Pseudomonas fluorescens to determine how infection alters the ability of larvae to survive and complete development. METHODOLOGY/PRINCIPAL FINDINGS: We mimicked natural routes of infection using a non-invasive feeding procedure to study the toxicity of the three sequenced P. fluorescens strains (Pf0-1, SBW25, and Pf-5 to Drosophila melanogaster. Larvae fed with the three strains of P. fluorescens showed distinct differences in developmental trajectory and survival. Treatment with SBW25 caused a subset of insects to die concomitant with a systemic melanization reaction at larval, pupal or adult stages. Larvae fed with Pf-5 died in a dose-dependent manner with adult survivors showing eye and wing morphological defects. In addition, larvae in the Pf-5 treatment groups showed a dose-dependent delay in the onset of metamorphosis relative to control-, Pf0-1-, and SBW25-treated larvae. A functional gacA gene is required for the toxic properties of wild-type Pf-5 bacteria. CONCLUSIONS/SIGNIFICANCE: These experiments are the first to demonstrate that ingestion of P. fluorescens bacteria by D. melanogaster larvae causes both lethal and non-lethal phenotypes, including delay in the onset of metamorphosis and morphological defects in surviving adult flies, which can be decoupled.

  4. Costs of Three Wolbachia Infections on the Survival of Aedes aegypti Larvae under Starvation Conditions.

    Directory of Open Access Journals (Sweden)

    Perran A Ross

    2016-01-01

    Full Text Available The mosquito Aedes aegypti, the principal vector of dengue virus, has recently been infected experimentally with Wolbachia: intracellular bacteria that possess potential as dengue biological control agents. Wolbachia depend on their hosts for nutrients they are unable to synthesize themselves. Consequently, competition between Wolbachia and their host for resources could reduce host fitness under the competitive conditions commonly experienced by larvae of Ae. aegypti in the field, hampering the invasion of Wolbachia into natural mosquito populations. We assess the survival and development of Ae. aegypti larvae under starvation conditions when infected with each of three experimentally-generated Wolbachia strains: wMel, wMelPop and wAlbB, and compare their fitness to wild-type uninfected larvae. We find that all three Wolbachia infections reduce the survival of larvae relative to those that are uninfected, and the severity of the effect is concordant with previously characterized fitness costs to other life stages. We also investigate the ability of larvae to recover from extended food deprivation and find no effect of Wolbachia on this trait. Aedes aegypti larvae of all infection types were able to resume their development after one month of no food, pupate rapidly, emerge at a large size, and exhibit complete cytoplasmic incompatibility and maternal transmission. A lowered ability of Wolbachia-infected larvae to survive under starvation conditions will increase the threshold infection frequency required for Wolbachia to establish in highly competitive natural Ae. aegypti populations and will also reduce the speed of invasion. This study also provides insights into survival strategies of larvae when developing in stressful environments.

  5. ANTHELMINTIC ACTIVITY OF LAPACHOL, β-LAPACHONE AND ITS DERIVATIVES AGAINST Toxocara canis LARVAE

    OpenAIRE

    MATA-SANTOS, Taís; PINTO, Nitza França; Hilton Antônio MATA-SANTOS; DE MOURA, Kelly Gallan; Carneiro, Paula Fernandes; CARVALHO, Tatiane dos Santos; DEL RIO, Karina Pena; PINTO, Maria do Carmo Freire Ribeiro; MARTINS, Lourdes Rodrigues; Juliana Montelli FENALTI; da Silva, Pedro Eduardo Almeida; Scaini, Carlos James

    2015-01-01

    Anthelmintics used for intestinal helminthiasis treatment are generally effective; however, their effectiveness in tissue parasitosis (i.e. visceral toxocariasis) is moderate. The aim of this study was to evaluate the in vitro activity of lapachol, β-lapachone and phenazines in relation to the viability of Toxocara canis larvae. A concentration of 2 mg/mL (in duplicate) of the compounds was tested using microculture plates containing Toxocara canis larvae in an RPMI-1640 environment, incubate...

  6. Isolation and characterization of a novel phage lysin active against Paenibacillus larvae, a honeybee pathogen

    OpenAIRE

    LeBlanc, Lucy; Nezami, Sara; Yost, Diane; Tsourkas, Philippos; Amy, Penny S.

    2015-01-01

    Paenibacillus larvae is the causative agent of American foulbrood (AFB) disease which affects early larval stages during honeybee development. Due to its virulence, transmissibility, capacity to develop antibiotic resistance, and the inherent resilience of its endospores, Paenibacillus larvae is extremely difficult to eradicate from infected hives which often must be burned. AFB contributes to the worldwide decline of honeybee populations, which are crucial for pollination and the food supply...

  7. Oceanographic and behavioural assumptions in models of the fate of coral and coral reef fish larvae.

    Science.gov (United States)

    Wolanski, Eric; Kingsford, Michael J

    2014-09-01

    A predictive model of the fate of coral reef fish larvae in a reef system is proposed that combines the oceanographic processes of advection and turbulent diffusion with the biological process of horizontal swimming controlled by olfactory and auditory cues within the timescales of larval development. In the model, auditory cues resulted in swimming towards the reefs when within hearing distance of the reef, whereas olfactory cues resulted in the larvae swimming towards the natal reef in open waters by swimming against the concentration gradients in the smell plume emanating from the natal reef. The model suggested that the self-seeding rate may be quite large, at least 20% for the larvae of rapidly developing reef fish species, which contrasted with a self-seeding rate less than 2% for non-swimming coral larvae. The predicted self-recruitment rate of reefs was sensitive to a number of parameters, such as the time at which the fish larvae reach post-flexion, the pelagic larval duration of the larvae, the horizontal turbulent diffusion coefficient in reefal waters and the horizontal swimming behaviour of the fish larvae in response to auditory and olfactory cues, for which better field data are needed. Thus, the model suggested that high self-seeding rates for reef fish are possible, even in areas where the 'sticky water' effect is minimal and in the absence of long-term trapping in oceanic fronts and/or large-scale oceanic eddies or filaments that are often argued to facilitate the return of the larvae after long periods of drifting at sea. PMID:24966233

  8. Composting poultry manure by fly larvae (Musca domestica) eliminates Campylobacter jejuni from the manure

    OpenAIRE

    Nordentoft, Steen; Hald, Birthe

    2013-01-01

    Introduction The common house fly, Musca domestica (Md) is an important carrier of zoonotic agents, and Campylobacter jejuni is one that may be transmitted between animals and humans by flies. Colonized animals shed the bacteria in feces where larval stages of Md flies develops. Aim of the present study To monitor fly larvae composting of poultry manure artificially contaminated with C. jejuni, and to investigate a possible transmission route of C. jejuni from the manure through the fly larva...

  9. Feeding chickens fly larvae (Musca domestica) protein improves gut health and performances

    OpenAIRE

    Nordentoft, Steen; Engberg, Ricarda M

    2014-01-01

    In a feeding trial 450 layer chickens were fed either of 3 isoenergetic diets supplemented with different fish meal, grounded fly meal (Musca domestica) or fly meal and fresh fly larvae. The purpose of this study was to investigate the possibility of feeding grounded fly larva to layer chickens as an alternative protein source for fish meal in organic poultry. Parameters investigated were weight gain, food consumption, animal behavior and study whether it would have effect on intestinal health.

  10. Susceptibility of Aedes aegypti larvae to the insecticide temephos in the Federal District, Brazil

    OpenAIRE

    de Carvalho, M.D.S.; Caldas, E.D.; Dégallier, Nicolas; Vilarinhos, P.D.T.; de Souza, L.; Amelia, M.; Yoshizawa, C.; M. B. KNOX; Oliveira, C

    2004-01-01

    Objective: To study the susceptibility status of Aedes aegypti to the organophosphate insecticide temephos. Methods: Samples of Ae. aegypti larvae were obtained, using ovitraps, from eight cities of the Federal District, central Brazil, in 2000 and 2001. Larvae were submitted to the diagnostic dose of 0.012 mg/l temephos, as recommended by standard World Health Organization methodology. Field populations were tested in parallel with reference strains Rockefeller and DIVAL, from the Environmen...

  11. Feeding strategy of Downs herring larvae (Clupea harengus L.) in the English Channel and North Sea

    Science.gov (United States)

    Denis, Jeremy; Vallet, Carole; Courcot, Lucie; Lefebvre, Valérie; Caboche, Josselin; Antajan, Elvire; Marchal, Paul; Loots, Christophe

    2016-09-01

    This study aims to characterize the larval feeding strategy of the Downs sub-population of North Sea herring (Clupea harengus L.). Diet composition, vacuity rate and prey selectivity of larvae from 8 to 15 mm collected during the International Bottom Trawl Survey (IBTS) - MIK sampling from 2008 to 2013 were assessed by direct observation of their gut contents using Scanning Electron Microscopy (SEM). The high contribution of protists and small zooplanktonic prey observed in the gut contents proved the relevance of SEM to study the diet of first feeding larvae. The relatively low vacuity rate of 45% suggests that food may not be a limiting factor for Downs herring larvae in winter. These larvae appeared to be omnivorous and there was a clear shift in term of prey composition at a size of 13 mm. Smaller larvae (8-12 mm) fed on a higher diversity of small prey, mainly small copepods (Oncaea spp. and Euterpina acutifrons), invertebrate eggs, diatoms (Psammodicthyon panduriforme and Coscinodiscus spp.) and dinoflagellates (Dinophysis acuminate and Prorocentrum micans) whereas bigger larvae (13-15 mm) fed on a lower diversity of larger prey, mainly copepods (Temora longicornis and Paracalanus parvus) and dinoflagellates (Gonyaulax spp.). Downs herring larvae had clear prey preferences as some dinoflagellates (Pyrophacus spp., Gonyaulax spp., P. micans and Porocentrum lima), invertebrate eggs, copepods (Oncaea spp. and nauplii) and diatoms (Thalassiosira curviseriata) were positively selected and other diatoms (Nitzschia spp., Thalassiosira tenera, Thalassiosira spp. and Chaetoceros spp.) and copepods (Pseudocalanus elongatus, T. longicornis and Unidentified calanoid) were negatively selected. We argue that this shift in term of prey preferences occurring at a size of 13 mm constitutes the critical period for Downs herring larvae.

  12. Probiotic effects on cobia Rachycentron canadum larvae reared in a recirculating aquaculture system

    OpenAIRE

    M. Angélica Garrido-Pereira; Michael Schwarz; Brendan Delbos; Ricardo V. Rodrigues; Luis Romano; Luís Sampaio

    2014-01-01

    Cobia (Rachycentron canadum) is a marine finfish with good potential for mariculture. This study analyzes the effects of probiotic Bacillus spp. on the performance of cobia larvae reared in a recirculating aquaculture system (RAS). Larvae were stocked into two independent RAS for 26 days after hatching. One of the systems (Probiotic treatment) received the addition of a commercial probiotic consisting of B. subtilis, B. licheniformis and B. pumilus directly into the water and by live feed. Su...

  13. Nosema ceranae Can Infect Honey Bee Larvae and Reduces Subsequent Adult Longevity.

    Directory of Open Access Journals (Sweden)

    Daren M Eiri

    Full Text Available Nosema ceranae causes a widespread disease that reduces honey bee health but is only thought to infect adult honey bees, not larvae, a critical life stage. We reared honey bee (Apis mellifera larvae in vitro and provide the first demonstration that N. ceranae can infect larvae and decrease subsequent adult longevity. We exposed three-day-old larvae to a single dose of 40,000 (40K, 10,000 (10K, zero (control, or 40K autoclaved (control N. ceranae spores in larval food. Spores developed intracellularly in midgut cells at the pre-pupal stage (8 days after egg hatching of 41% of bees exposed as larvae. We counted the number of N. ceranae spores in dissected bee midguts of pre-pupae and, in a separate group, upon adult death. Pre-pupae exposed to the 10K or 40K spore treatments as larvae had significantly elevated spore counts as compared to controls. Adults exposed as larvae had significantly elevated spore counts as compared to controls. Larval spore exposure decreased longevity: a 40K treatment decreased the age by which 75% of adult bees died by 28%. Unexpectedly, the low dose (10K led to significantly greater infection (1.3 fold more spores and 1.5 fold more infected bees than the high dose (40K upon adult death. Differential immune activation may be involved if the higher dose triggered a stronger larval immune response that resulted in fewer adult spores but imposed a cost, reducing lifespan. The impact of N. ceranae on honey bee larval development and the larvae of naturally infected colonies therefore deserve further study.

  14. Detection of Sindbis and Inkoo Virus RNA in Genetically Typed Mosquito Larvae Sampled in Northern Sweden

    Science.gov (United States)

    Tingström, Olov; Wesula Lwande, Olivia; Näslund, Jonas; Spyckerelle, Iris; Engdahl, Cecilia; Von Schoenberg, Pontus; Ahlm, Clas; Evander, Magnus

    2016-01-01

    Abstract Introduction: Mosquito-borne viruses have a widespread distribution across the globe and are known to pose serious threats to human and animal health. The maintenance and dissemination of these viruses in nature are driven through horizontal and vertical transmission. In the temperate climate of northern Sweden, there is a dearth of knowledge on whether mosquito-borne viruses that occur are transmitted transovarially. To gain a better understanding of mosquito-borne virus circulation and maintenance, mosquito larvae were sampled in northern Sweden during the first and second year after a large outbreak of Ockelbo disease in 2013 caused by Sindbis virus (SINV). Materials and Methods: A total of 3123 larvae were sampled during the summers of 2014 and 2015 at multiple sites in northern Sweden. The larvae were homogenized and screened for viruses using RT-PCR and sequencing. Species identification of selected larvae was performed by genetic barcoding targeting the cytochrome C oxidase subunit I gene. Results and Discussion: SINV RNA was detected in mosquito larvae of three different species, Ochlerotatus (Oc.) communis, Oc. punctor, and Oc. diantaeus. Inkoo virus (INKV) RNA was detected in Oc. communis larvae. This finding suggested that these mosquitoes could support transovarial transmission of SINV and INKV. Detection of virus in mosquito larva may serve as an early warning for emerging arboviral diseases and add information to epidemiological investigations before, during, and after outbreaks. Furthermore, our results demonstrated the relevance of genetic barcoding as an attractive and effective method for mosquito larva typing. However, further mosquito transmission studies are needed to ascertain the possible role of different mosquito species and developmental stages in the transmission cycle of arboviruses. PMID:27159120

  15. Metalloproteases of infective Ancylostoma hookworm larvae and their possible functions in tissue invasion and ecdysis.

    OpenAIRE

    Hotez, P; HAGGERTY, J; Hawdon, J.; Milstone, L; Gamble, H R; Schad, G.; Richards, F

    1990-01-01

    To infect their hosts, hookworm larvae must exsheath and migrate through connective tissue. A modified in vitro skin chamber was used to show that the human hookworm Ancylostoma duodenale and the zoonotic canine hookworm Ancylostoma caninum penetrate epidermis, basement membrane, and dermis in similar ways. These similarities in tissue invasion properties reflect the observed biochemical similarities in parasite protease composition. The larvae of both species contain protease activity that i...

  16. Analysis of metallotionein expression and antioxidant enzyme activities in Meretrix meretrix larvae under sublethal cadmium exposure

    International Nuclear Information System (INIS)

    To investigate the possible role of metallothioneins (MTs) and antioxidant enzymes in cadmium (Cd) tolerance in Meretrix meretrix larvae, a new MT (designated MmMT) gene was identified and cloned from M. meretrix. The full-length cDNA of MmMT consisted of an open reading frame (ORF) of 231 bp encoding a protein of 76 amino acids, with 21 cysteine residues and a conserved structural pattern Cys-x-Cys-x(3)-Cys-Tyr-Gly-x(3)-Cys-x-Cys-x(3)-Cys-x-Cys-Lys at the C-terminus. The deduced amino acid sequence of MmMT showed about 57-84% identity with previously published MT sequences of mussels and oysters. Real-time PCR was used to analyze the expression level of MmMT mRNA at different M. meretrix larval stages under Cd exposure (25 μg L-1). Results showed that Cd could induce the expression of MmMT mRNA in the larvae, and the expression level increased 5.04-fold and 3.99-fold in D-shaped larvae and pediveligers, respectively. Immunolocalization of MmMT in the stressed larvae revealed that MmMT was synthesized in almost all of the soft parts at the trochophore and postlarva stages, whereas it was only synthesized in the velum and epidermis at the D-shaped larva and pediveliger stages. The activities of three antioxidant enzymes, superoxide dismutase (SOD), catalase (CAT), and glutathione peroxidase (GPx), also were measured in larvae at different developmental stages. Increased enzymatic activities were detected mainly in D-shaped larvae and pediveligers under Cd stress, suggesting that these enzymes respond synchronously with MT. Our results indicate that MmMT and antioxidant enzymes played important roles in counteracting Cd stress in M. meretrix larvae.

  17. Seasonal and Topographical Factors Affecting Breeding Sites of Culex Larvae in Nakhon Si Thammarat, Thailand

    OpenAIRE

    Warabhorn PREECHAPORN; Mullica JAROENSUTASINEE; Krisanadej JAROENSUTASINEE; Jirawat SAETON

    2007-01-01

    This study investigated how the seasons affect the key breeding sites of Culex larvae in three topographical areas: mangrove, rice paddy and mountainous areas. We examined how the number of Culex larvae varied in different types of water containers. Water containers were categorised into the following groups: indoor/outdoor containers, artificial/natural containers, earthen/plastic containers, containers with/without lids and dark/light coloured containers. Samples were collected from 300 hou...

  18. Consequences of Physical Disturbance by Tadpoles and Snails on Chironomid Larvae

    OpenAIRE

    Gargi Pal; Gautam Aditya; Niladri Hazra

    2014-01-01

    Indirect interactions among community members impact on organisms. The effects of two snails, banded pond snail, Bellamya bengalensis (Lamarck), and Red-rimmed melania, Melanoides tuberculata (Müller), and tadpoles of Asian common toad, Duttaphrynus melanostictus (Schneider), on nonbiting midge larvae, Chironomus striatipennis Kieffer, were observed in experimental microcosm. Decrease in tube number and tube length of midge larvae was observed compared to control condition due to introduction...

  19. Appearance of a reservoir of hookworm-related cutaneous larva migrans in Brittany?

    Science.gov (United States)

    Veraldi, S; Persico, M C; Francia, C; La Vela, V

    2012-12-01

    We describe two cases of hookworm-related cutaneous larva migrans acquired in Brittany (North-Western France). The patients were a 23-year-old woman and a 28-year-old man. In both patients the feet were involved. In the second patient, a superinfection due to Staphylococcus aureus was recorded. The appearance in Brittany of a reservoir of nematodes capable of causing hookworm-related cutaneous larva migrans is hypothesized.

  20. Ingestion by Japanese Eel Anguilla japonica Larvae on Various Minute Zooplanktons

    OpenAIRE

    Wullur, Stenly; Yoshimatsu, Takao; Tanaka, Hideki; Ohtani, Masataka; Sakakura, Yoshitaka; Kim, Hee-Jin; Hagiwara, Atsushi

    2013-01-01

    We observed the feeding incidence of Japanese eel Anguilla japonica larvae of 6, 7, 8 and 14 days after hatching (DAH) using various minute zooplanktons such as rotifer (Proales similis, Synchaeta sp., Keratella sp., Brachionus rotundiformis, B. angularis) and nauplii of copepod Paracyclopina nana, and compared those results to slurry type diets (i.e., shark eggs for control) to evaluate the usability of these planktons as primary food source for the mass culture of eel larvae. Feeding incid...

  1. PEMANFAATAN TUMBUHAN SEBAGAI PAKAN LARVA KUPU-KUPU DI KAWASAN TAMAN NASIONAL BANTIMURUNG BULUSARAUNG MAROS

    OpenAIRE

    Elis, Tambaru

    2015-01-01

    jenis tumbuhan yang dapat dimanfaatkan sebagai pakan larva kupu-kupu ada 14 jenis, terdiri dari 11 Familia yaitu: Caesalpiniaceae, Piperaceae, Rutaceae, Annonaceae, Aristolachiaceae, Asclepiadaceae, Papilionaceae, Bignoniaceae, Mimosaceae, Arecaceae, dan Moraceae. Organ dari setiap jenis tumbuhan yang paling disukai untuk dimakan oleh larva kupu-kupu adalah pada daun muda. The Research of species plants as feed Butterflies in Breeding Area Bantimurung Bulusaraung National Park, Maros re...

  2. Status of carbohydrate, protein and lipid profile in the mosquito larvae treated with certain phytoextracts

    Institute of Scientific and Technical Information of China (English)

    Preeti Sharma; Lalit Mohan; Kamal Kumar Dua; Chand Narayan Srivastava

    2011-01-01

    Objective:To investigate the impact of the most potent petroleum ether extract ofArtemisia annua (A. annua) andAzadirachta indica (Az. indica) on total carbohydrate, lipid and protein level ofAnopheles stephensi andCulex quinquefasciatuslarvae.Methods: Mosquito larvae were exposed to the extracts selected as per standardWHO procedure. Carbohydrate (glucose), total lipid and protein were estimated by the methods as Nelson, Bragdon and Lowry described, respectively.Results: The glucose levels were increased to27.87% and46.8%, respectively in anopheline larval tissues after treatment with petroleum ether extract ofA. annua and methanolic extract ofAz. indica. In culicine larvae, glucose levels were reduced to58.96% and24.65%, respectively. After treatment withA. annua extract, lipid contents in anopheline and culicine larvae decreased by28.57% and25.0%, respectively and increased by14.29% and50.00% in theAnopheles andCulex larvae, respectively after treatment with methanolic extract ofAz. indica. Total protein levels were reduced to63.13% and92.62% in anopheline and to32.39% and 48.12% in culicine larvae after treatment withA. annua andAz. Indica extracts, respectively. Conclusions: Two extracts produce significant alterations in the biochemical profiles of anopheline and culicine larvae. Further, the impacting factors of extracts on carbohydrate, lipid and protein contents of larvae are species and specific extraction. It indicates the disturbed metabolic activity of the larvae.

  3. Ontogeny and physiology of the digestive system of marine fish larvae

    OpenAIRE

    Zambonino, Jose-luis; Gisbert, E; C. Sarasquete; Navarro, I.; Gutiérrez, J.; Cahu, Chantal

    2008-01-01

    The ontogeny of the digestive tract of marine fish larvae has been the subject of many studies these last twenty years. Beyond the scientific interest for such animal species, particularly for developmental aspects, most of these studies aimed to come up with the expectations of commercial hatcheries by reducing the bottlenecks in larvae culture and weaning processes (switch from live preys to compound diet feeding sequence). Consequently, the profile and dietary adaptation of digestive enzym...

  4. Genomewide analysis indicates that queen larvae have lower methylation levels in the honey bee ( Apis mellifera)

    Science.gov (United States)

    Shi, Yuan Yuan; Yan, Wei Yu; Huang, Zachary Y.; Wang, Zi Long; Wu, Xiao Bo; Zeng, Zhi Jiang

    2013-02-01

    The honey bee is a social insect characterized by caste differentiation, by which a young larva can develop into either a queen or a worker. Despite possessing the same genome, queen and workers display marked differences in reproductive capacity, physiology, and behavior. Recent studies have shown that DNA methylation plays important roles in caste differentiation. To further explore the roles of DNA methylation in this process, we analyzed DNA methylome profiles of both queen larvae (QL) and worker larvae (WL) of different ages (2, 4, and 6 day old), by using methylated DNA immunoprecipitation-sequencing (meDIP-seq) technique. The global DNA methylation levels varied between the larvae of two castes. DNA methylation increased from 2-day- to 4-day-old QL and then decreased in 6-day-old larvae. In WL, methylation levels increased with age. The methylcytosines in both larvae were enriched in introns, followed by coding sequence (CDS) regions, CpG islands, 2 kbp downstream and upstream of genes, and 5' and 3' untranslated regions (UTRs). The number of differentially methylated genes (DMGs) in 2-, 4-, and 6-day-old QL and WL was 725, 3,013, and 5,049, respectively. Compared to 4- and 6-day-old WL, a large number of genes in QL were downmethylated, which were involved in many processes including development, reproduction, and metabolic regulation. In addition, some DMGs were concerned with caste differentiation.

  5. Cannibalism Affects Core Metabolic Processes in Helicoverpa armigera Larvae-A 2D NMR Metabolomics Study.

    Science.gov (United States)

    Vergara, Fredd; Shino, Amiu; Kikuchi, Jun

    2016-01-01

    Cannibalism is known in many insect species, yet its impact on insect metabolism has not been investigated in detail. This study assessed the effects of cannibalism on the metabolism of fourth-instar larvae of the non-predatory insect Helicoverpa armigera (Lepidotera: Noctuidea). Two groups of larvae were analyzed: one group fed with fourth-instar larvae of H. armigera (cannibal), the other group fed with an artificial plant diet. Water-soluble small organic compounds present in the larvae were analyzed using two-dimensional nuclear magnetic resonance (NMR) and principal component analysis (PCA). Cannibalism negatively affected larval growth. PCA of NMR spectra showed that the metabolic profiles of cannibal and herbivore larvae were statistically different with monomeric sugars, fatty acid- and amino acid-related metabolites as the most variable compounds. Quantitation of ¹H-(13)C HSQC (Heteronuclear Single Quantum Coherence) signals revealed that the concentrations of glucose, glucono-1,5-lactone, glycerol phosphate, glutamine, glycine, leucine, isoleucine, lysine, ornithine, proline, threonine and valine were higher in the herbivore larvae. PMID:27598144

  6. Effect of zinc on the growth and development of larvae of bay scallop Argopecten Irradians

    Science.gov (United States)

    Lü, Yantian

    1989-12-01

    The 48-h straight-hinge larvae of Argopecten irradians were exposed for 9 days to various concentrations of zinc in seawater. The growth rate of larvae in the 50 ppb Zn mediums was 77% that of the controls, and nearly zero in the 200 ppb Zn mediums. A progressive decrease in growth and increase in larval deformity and mortality was observed with increasing zinc concentrations from 50 to 200 ppb. 50 and 100 ppb Zn resulted in delayed development of eye spot and metamorphosis and reduced numbers of larvae at both stages. All larvae subjected to higher zinc concentrations died before attaining the eye-spot stage. The zinc concentrations which caused 50% reduction in growth (G C50) and 50% mortality (LC50) were 109 and 120 ppb respectively. Growing in the medium with 100 ppb Zn, the larvae fed with Isochrysis galbana cultured in a medium with 100 ppb Zn showed more suppressed growth and development than those fed with normal food. It is suggested that zinc contaminated food has strong influence on the bay scallop larvae.

  7. Metamorfosis del aparato digestivo de larvas carnívoras de Ceratophrys cranwelli (Anura: Leptodactylidae

    Directory of Open Access Journals (Sweden)

    Ulloa Kreisel, Zandra E.

    2000-12-01

    Full Text Available Las larvas carnívoras de Ceratophrys cranwelli presentan un tubo digestivo más corto que la mayoría de las larvas de anuros, tiene 6 veces la longitud del cuerpo del renacuajo y se caracteriza también por tener un estómago larval. El presente trabajo tiene como objetivo el determinar el grado de transformaciones en la cavidad bucofaríngea y tubo digestivo en larvas de esta especie durante la metamorfosis y comparar las estructuras digestivas estudiadas en otras especies de Leptodactylidae de la subfamilia Ceratophryinae y especies con otros hábitos alimenticios. Carnivorous larvae from Ceratophrys cranwelli present a digestive tube shorter than most of the anuran larvae, have 6 times a tadpole’s body length and they are also characterized by the presence of a larval stomach. The aim of this work is determine the grade of transformations in the buccopharyngeal cavity and digestive tube during the metamorphosis in larvae of this species and compare the digestive structures studied in other species of Leptodactylidae of the subfamily Ceratophryinae and another species with different diets.

  8. Predation on Mosquito Larvae by Mesocyclops thermocyclopoides (Copepoda: Cyclopoida) in the Presence of Alternate Prey

    Science.gov (United States)

    Kumar, Ram; Ramakrishna Rao, T.

    2003-11-01

    The cyclopoid copepod Mesocyclops thermocyclopoides, a dominant invertebrate predator in many shallow ponds and temporary water bodies in northern India, feeds on cladocerans, rotifers, ciliates and when present, on mosquito larvae also. We studied in the laboratory the prey consumption rates of the copepod on first and fourth instar larvae of two species of mosquito (Anopheles stephensi and Culex quinquefasciatus) in relation to their density. We also studied its prey selectivity with mosquito larvae in the presence of an alternate prey (the cladocerans-either Moina macrocopa or Ceriodaphnia cornuta) in different proportions. With either mosquito species, the copepod actively selected Instar-I larvae, avoiding the Instar-IV larvae, and with either instar, selected Anopheles stephensi over Culex quinquefasciatus. When prey choice included the cladoceran as an alternate prey, the copepod selected the cladoceran only when the other prey was Instar-IV mosquito larvae. Our results point to the potential and promise of M. thermocyclopoides as a biological agent for controlling larval populations of vectorially important mosquito species.

  9. Immune response of Phyllophaga polyphylla larvae is not an effective barrier against Metarhizium pingshaense

    Directory of Open Access Journals (Sweden)

    JN Enríquez-Vara

    2014-09-01

    Full Text Available Previous research has uncovered that the cuticle of P. polyphylla larvae acts as a good non-immunological barrier against M. pingshaense. In the present study we investigated whether P. polyphylla larvae also show a similarly robust immunological response against M. pingshaense. Firstly, we estimated a median lethal dose (LD50 of blastospores to be injected into the hemocoel. Secondly, we injected the estimated LD50 of blastospores into the hemocoel of larvae to quantify phenoloxidase (PO, nitric oxide (NO and antimicrobial activity as a response against fungal invasion. In contrast to a previous report that showed that M. pingshaense is unable to kill P. polyphylla after topical applications, here we demonstrate that: (a 100 % of P. polyphylla larvae died when blastospores were injected into the hemocoel and (b when injecting the LD50 into the hemocoel of the larvae, immune response did not differ with control. Our results imply that immunological responses do not protect P. polyphylla larvae against M. pingshaense infections. Thus, the cuticle seems a better defense mechanism compared to PO, NO and antimicrobial activity. One proximate explanation for our results is that blastospores are not detected by the host’s immune machinery. An ultimate explanation is that there may be a resource-based tradeoff between non-immunological and immunological barriers, in which white grubs may be investing more in cuticle at the cost of PO, NO and antimicrobial activity.

  10. Development of black soldier fly (Diptera: Stratiomyidae) larvae fed dairy manure.

    Science.gov (United States)

    Myers, Heidi M; Tomberlin, Jeffery K; Lambert, Barry D; Kattes, David

    2008-02-01

    Black soldier flies, Hermetia illucens L., are a common colonizer of animal wastes. However, all published development data for this species are from studies using artificial diets. This study represents the first examining black soldier fly development on animal wastes. Additionally, this study examined the ability of black soldier fly larvae to reduce dry matter and associated nutrients in manure. Black soldier fly larvae were fed four rates of dairy manure to determine their effects on larval and adult life history traits. Feed rate affected larval and adult development. Those fed less ration daily weighed less than those fed a greater ration. Additionally, larvae provided the least amount of dairy manure took longer to develop to the prepupal stage; however, they needed less time to reach the adult stage. Adults resulting from larvae provided 27 g dairy manure/d lived 3-4 d less than those fed 70 g dairy manure. Percentage survivorship to the prepupal or adult stages did not differ across treatments. Larvae fed 27 g dairy manure daily reduced manure dry matter mass by 58%, whereas those fed 70 g daily reduced dry matter 33%. Black soldier fly larvae were able to reduce available P by 61-70% and N by 30-50% across treatments. Based on results from this study, the black soldier fly could be used to reduce wastes and associated nutrients in confined bovine facilities. PMID:18348791

  11. Studies with normal and gamma irradiated third stage larvae of Oesophagostomum columbianum in lambs

    International Nuclear Information System (INIS)

    Results of work on the host-parasite relationship of Oesophagostomum columbianum in sheep, carried out at the Regional Centre, Srinagar, are presented. Primary infections with small numbers of O. columbianum third larvae in lambs caused establishment of more adult worms in the intestine. As the number of larvae administered to lambs in primary infections was increased, a significant decrease in the establishment of adult worms in the intestine was observed. Higher levels of primary infections in lambs resulted in stunting of both male and female adult worms in intestine but this did not affect the resultant egg production by the worms. The severity of the disease in lambs was directly related to the number of larvae administered in primary infections. Attenuation of the third stage larvae of O.columbianum was obtained when they were irradiated at 40 and 50 Krad doses from a gamma source. Whereas it was possible to stimulate only a partial protection in young lambs to O. columbianum with a single dose of 2000, 40 Krad irradiated larvae. Vaccination with the same numbers of larvae, but irradiated at 50 Krad failed to protect the animals. The presence of adult worms of O.columbianum in sites outside the intestine in lambs has been reported for the first time. (auth.)

  12. Are the moth larvae able to withstand tree fall caused by wind storm?

    Directory of Open Access Journals (Sweden)

    Michal Parák

    2015-04-01

    Full Text Available Wind storms play an important role in structuring European forests, however, the direct effects of strong wind on insects roosting in tree canopies are poorly known. In this study we assess the proportion of moth larvae which remain on Norway spruce (Picea abies [L.] Karst. trees which have fallen during high winds. Next, we contribute to the knowledge of potential importance of such larvae in forests fragmented by local wind damage. We studied the effects of wind in spruce forest in the West Carpathians in March 2013. Branches were sampled from randomly chosen fallen and standing (undamaged spruce trees in April 2013. Larvae or emerged moths were obtained from branches in the laboratory using photoeclectors. Assemblages of larvae were analysed at community level using several approaches. In total, 11 species of Lepidoptera were found on the branches, 10 of them overwinter as larvae and one as eggs. No differences were observed between abundance and species richness of larval assemblages on fallen and standing trees. Assemblages were very similar; there was no difference detected between standing and fallen trees. Overwintering larvae can successfully complete their development on wind-felled trees; hence, the emerged moths may contribute to greater infestation of standing spruce trees surviving wind disturbance.

  13. Seasonal variation in growth and survival of Strombus canarium (Linnaeus, 1758) larvae.

    Science.gov (United States)

    Cob, Z C; Arshad, A; Bujang, J S; Ghaffar, M A

    2009-05-01

    This study was conducted to analyze variation in Strombus canarium larvae development, growth and survivals when cultured during wet (main reproductive period) and dry seasons. Larvae were reared at 200 larvae L(-1) in filtered seawater (0.22 microm) and fed with Isochrysis galbana at 1000 cells mL(-1) ad libitum. The culture environment was maintained at 29 +/- 1 degrees C, salinity of 30 +/- 1 PSU and photoperiod of 12:12 light dark cycle. Growth of the larvae was described on a length-at-age basis using the modified Gompertz regression. There was high correlation in shell length-at-age relationship for both wet season (R2 = 0.99) and dry season (R2 = 0.98) culture experiments. The maximal growth rate (M) and survival rate (S) were higher for larvae cultured during wet season (M = 62.44 microm day(-1), S = 14.36-2.31%), compared with dry season (M = 43.05 microm day(-1), S = 5 +/- 1.15%). The maximal attainable larval size (a) was however lower during wet season (950.19 +/- 66.93 microm shell length) compared with dry season (1343.05 +/- 586.51 microm shell length), which might be due to significantly low larvae density in the latter. Further studies are needed to investigate variation in bio-chemical composition of the egg mass, which was suggested as the main reason for the differences. PMID:19634470

  14. Effects of dietary nickel on detoxification enzyme activities in the midgut of Spodoptera litura Fabricius larvae

    Institute of Scientific and Technical Information of China (English)

    SUN HongXia; ZHOU Qiang; TANG WenCheng; SHU YingHua; ZHANG GuRen

    2008-01-01

    Nickel accumulated in midugt of Spodoptera litura Fabricius could induce the expression of metal-Iothionein, one of the most important detoxification proteins in organisms. In the present study, the effects of dietary nickel on the activities of detoxification enzymes, such as carboxylesterase (CarE) and glutathione S-transferase (GST) in the midgut of S. litura larvae have been studied to get an un-derstanding of the detoxification mechanisms of S. litura larvae to excessive nickel. Results showed that CarE activities in the midgut of the 5th instar larvae decreased at lower levels of nickel (≤5 mg/kg), while increased with increasing nickel doses at higher levels of nickel (≥10 mg/kg) exposure in suc-cessive 3 generations. CarE activities of the 6th instar larvae were also characterized as inhibited at low levels of nickel exposure, and improved at higher levels in the 1st generation. CarE activities of 6th instar larvae in the 2rid and 3rd generations were all lower than that in control. However, GST activities in the midgut of the 5th and 6th instar larvae all increased with increasing nickel doses (1-20 mg/kg) in diets.

  15. mRNA differential display on gene expression in settlement metamorphosis process of Ruditapes philippinarum larvae

    Institute of Scientific and Technical Information of China (English)

    Lu Sumin; Bao Zhenmin; Hu Jingjie; Hu Xiaoli; Mu Chunhua; Fang Jianguang

    2008-01-01

    The mRNA differential display (DDRT-PCR) technique was adopted to find out the genes related to settlement metamorphosis development process of Ruditapes philippinarum larvae.In this study, we have obtained three hundred and forty-six amplification bands in total from pedivehger larvae, veliger larvae,eye spot larvae and post-larvae.Sixty-five out of three hundred and forty-six bands are distinctly differential display from band pattern, which can be put into four groups, standing for different expression characters.Sixteen differential display bands were cloned, sequenced and analyzed and nine different sequences are obtained in the study.Three sequences have higher similarity to the eDNAs deposited in database and three are very similar to the rDNA of other species, considered as the rDNA of Ruditapes philippinarum.The rest three sequences are found to be novel sequences after analyzed.Their accession numbers are AY916799, AY916798, and AY916797 respectively.We thought the novel sequences are possibly relevant to the early embryo development of Ruditapes philippinarum larvae and can provide some fundamental understandings that are helpful for the improvement of scallop seed raising industry.

  16. Gene expression in honey bee (Apis mellifera) larvae exposed to pesticides and Varroa mites (Varroa destructor).

    Science.gov (United States)

    Gregorc, Aleš; Evans, Jay D; Scharf, Mike; Ellis, James D

    2012-08-01

    Honey bee (Apis mellifera) larvae reared in vitro were exposed to one of nine pesticides and/or were challenged with the parasitic mite, Varroa destructor. Total RNA was extracted from individual larvae and first strand cDNAs were generated. Gene-expression changes in larvae were measured using quantitative PCR (qPCR) targeting transcripts for pathogens and genes involved in physiological processes, bee health, immunity, and/or xenobiotic detoxification. Transcript levels for Peptidoglycan Recognition Protein (PGRPSC), a pathogen recognition gene, increased in larvae exposed to Varroa mites (PVarroa-parasitized brood had higher transcripts of Deformed Wing Virus than did control larvae (PVarroa parasitism, arguably coupled with virus infection, resulted in significantly higher transcript abundances for the antimicrobial peptides abaecin, hymenoptaecin, and defensin1. Transcript levels for Prophenoloxidase-activating enzyme (PPOact), an immune end product, were elevated in larvae treated with myclobutanil and chlorothalonil (both are fungicides) (PVarroa parasitism on honey bee larval gene expression were demonstrated. Interactions between larval treatments and gene expression for the targeted genes are discussed.

  17. A 2D virtual reality system for visual goal-driven navigation in zebrafish larvae

    Science.gov (United States)

    Jouary, Adrien; Haudrechy, Mathieu; Candelier, Raphaël; Sumbre, German

    2016-01-01

    Animals continuously rely on sensory feedback to adjust motor commands. In order to study the role of visual feedback in goal-driven navigation, we developed a 2D visual virtual reality system for zebrafish larvae. The visual feedback can be set to be similar to what the animal experiences in natural conditions. Alternatively, modification of the visual feedback can be used to study how the brain adapts to perturbations. For this purpose, we first generated a library of free-swimming behaviors from which we learned the relationship between the trajectory of the larva and the shape of its tail. Then, we used this technique to infer the intended displacements of head-fixed larvae, and updated the visual environment accordingly. Under these conditions, larvae were capable of aligning and swimming in the direction of a whole-field moving stimulus and produced the fine changes in orientation and position required to capture virtual prey. We demonstrate the sensitivity of larvae to visual feedback by updating the visual world in real-time or only at the end of the discrete swimming episodes. This visual feedback perturbation caused impaired performance of prey-capture behavior, suggesting that larvae rely on continuous visual feedback during swimming. PMID:27659496

  18. Effect of damaged pine needles on growth and development of pine caterpillar larvae

    Institute of Scientific and Technical Information of China (English)

    ZHANG Lili; LI Zhenyu; LI Hailin; HAN Ruidong; ZHAO Yongli

    2006-01-01

    Chinese pine caterpillar (Dendrolimus tabulaeformis)larvae were fed with pine needles of different degrees of damage to evaluate the effects of pine needles on the growth and development of larvae.The results showed that the nutritional index of the larvae declines after feeding on the damaged pine needlings.The lowest amount of food ingested and voided feces,the lowest nutritional index,slowest development,lightest pupae and most mortality were found in those pine caterpillar larvae fed with pine needles which were 50% damaged.The damaged pine needles significantly affected the population dynamics of Chinese pine caterpillars.The nutritional indices of larvae fed with 25% and 75% damaged pine needles were similar.The nutritional index of the dark morphs was higher than that of the tinted morphs,however,their mortality was lower than that of the tinted morphs.This phenomenon was reversed at the later stage of development when the larvae were fed on 50% damaged pine needles.

  19. Effects of the ant Formica fusca on the transmission of microsporidia infecting gypsy moth larvae.

    Science.gov (United States)

    Goertz, Dörte; Hoch, Gernot

    2013-06-01

    Transmission plays an integral part in the intimate relationship between a host insect and its pathogen that can be altered by abiotic or biotic factors. The latter include other pathogens, parasitoids, or predators. Ants are important species in food webs that act on various levels in a community structure. Their social behavior allows them to prey on and transport larger prey, or they can dismember the prey where it was found. Thereby they can also influence the horizontal transmission of a pathogen in its host's population. We tested the hypothesis that an ant species like Formica fusca L. (Hymenoptera: Formicidae) can affect the horizontal transmission of two microsporidian pathogens, Nosema lymantriae Weiser (Microsporidia: Nosematidae) and Vairimorpha disparis (Timofejeva) (Microsporidia: Burenellidae), infecting the gypsy moth, Lymantria dispar L. (Lepidoptera: Erebidae: Lymantriinae). Observational studies showed that uninfected and infected L. dispar larvae are potential prey items for F. fusca. Laboratory choice experiments led to the conclusion that F. fusca did not prefer L. dispar larvae infected with N. lymantriae and avoided L. dispar larvae infected with V. disparis over uninfected larvae when given the choice. Experiments carried out on small potted oak, Quercus petraea (Mattuschka) Liebl. (Fagaceae), saplings showed that predation of F. fusca on infected larvae did not significantly change the transmission of either microsporidian species to L. dispar test larvae. Microscopic examination indicated that F. fusca workers never became infected with N. lymantriae or V. disparis after feeding on infected prey. PMID:23926361

  20. The promiscuous larvae: flexibility in the establishment of symbiosis in corals

    Science.gov (United States)

    Cumbo, V. R.; Baird, A. H.; van Oppen, M. J. H.

    2013-03-01

    Coral reefs thrive in part because of the symbiotic partnership between corals and Symbiodinium. While this partnership is one of the keys to the success of coral reef ecosystems, surprisingly little is known about many aspects of coral symbiosis, in particular the establishment and development of symbiosis in host species that acquire symbionts anew in each generation. More specifically, the point at which symbiosis is established (i.e., larva vs. juvenile) remains uncertain, as does the source of free-living Symbiodinium in the environment. In addition, the capacity of host and symbiont to form novel combinations is unknown. To explore patterns of initial association between host and symbiont, larvae of two species of Acropora were exposed to sediment collected from three locations on the Great Barrier Reef. A high proportion of larvae established symbiosis shortly after contact with sediments, and Acropora larvae were promiscuous, taking up multiple types of Symbiodinium. The Symbiodinium types acquired from the sediments reflected the symbiont assemblage within a wide range of cnidarian hosts at each of the three sites, suggesting potential regional differences in the free-living Symbiodinium assemblage. Coral larvae clearly have the capacity to take up Symbiodinium prior to settlement, and sediment is a likely source. Promiscuous larvae allow species to associate with Symbiodinium appropriate for potentially novel environments that may be experienced following dispersal.