WorldWideScience

Sample records for brugia malayi larvae

  1. Maternal influence on susceptibility of offspring to Brugia malayi infection in a murine model of filariasis.

    Science.gov (United States)

    Rajan, T V; Bailis, J M; Yates, J A; Shultz, L D; Greiner, D L; Nelson, F K

    1994-12-01

    We have used the severe combined immunodeficient C.B-17-scid/scid mouse to investigate the influences of maternal immune status and parasite burden on the susceptibility (or resistance) of offspring to infection with the human filarial parasite, Brugia malayi. C.B-17-scid/scid mice are permissive for infection while immunocompetent C.B-17(-)+/+ mice are uniformly resistant. Reciprocal matings of C.B-17-scid/scid and C.B-17(-)+/+ mice were performed. The C.B-17-scid/scid females were either naive or infected with Brugia malayi. The resulting immunocompetent C.B-17-scid/+ and C.B-17(-)+/scid progeny were challenged at weaning with an intraperitoneal injection of Brugia malayi third stage larvae known to produce patent infection in > 95% of C.B-17-scid/scid mice. We observed that 40.0%l (34/85) of the immunocompetent offspring of C.B-17-scid/scid females x C.B-17(-)+/+ males were permissive for the growth and development of Brugia malayi larvae to adults. No difference was observed in susceptibility to infection between the progeny of infected or uninfected C.B-17-scid/scid mothers mated with C.B-17(-)+/+ fathers, arguing against acquired immunological tolerance to the parasite in the former. In marked contrast, only 4.8% (2/42) of the heterozygous progeny of wild type C.B-17(-)+/+ females mated with C.B-17-scid/scid males were permissive. These observations document conversion of a 'resistant' phenotype to a 'susceptible' phenotype by manipulation of maternal immune status and provide clear evidence of maternal influence on offspring susceptibility to infection with Brugia malayi.

  2. Deteksi Brugia malayi pada Armigeres subalbatus dan Culex quinquefasciatusyang diinfeksikan darah penderita filariasis dengan metode PCR

    Directory of Open Access Journals (Sweden)

    Yahya Yahya

    2015-01-01

    Full Text Available Abstract. Pemayungdistricts, Batanghari regency of Jambi province classified as filariasis endemic areas in Jambi province since the Mf rate reached 1.5% in 2011. A study was conducted to identify Brugia malayi on experimentally infected Ar. subalbatus and Cx. quinquefasciatus. An experimental study was performed with completely randomized design and six repetitions. Standard of treatment in this study was time (hours that selected for mosquitoes to bite the patients with filariasis (experimental infection. Selected time is at 9.00 a.m, 5.00 p.m, 9.00 p.m, and at 1.00 a.m. The results showed that filarial L3 larvae did not found on Ar. subalbatus and Cx. quinquefasciatus mosquitoes during surgery at day 11th to 13th after infection. Density of microfilariae in the blood of humans as a source of infection was 17 microfilariae per 20 micro liter blood. Otherwise, after detection by PCR, our study found positive B.malayi on Cx. quinquefasciatus thorax and proboscis. It indicates that Cx. quinquefasciatusas potential vector of B.malayi filariasis compared to Ar. subalbatus. Keywords: PCR, filariasis, Armigeres subalbatus, Culex quinquefasciatus, Brugia malayi   Abstrak. Kecamatan Pemayung Kabupaten Batanghari Provinsi Jambi merupakan wilayah endemis filariasis di Provinsi Jambi Karena angka Mf rate mencapai 1,5% pada tahun 2011. Penelitian ini untuk mengetahui tingkat kerentanan nyamuk Ar. subalbatus dan Cx. quinquefasciatus terhadap infeksi B. malayi subperiodik nokturna yang dilakukan pada tahun 2013, sehingga dapat dianalisis potensi nyamuk tersebut sebagai vektor filariasis di lokasi penelitian. Desain penelitian adalah eksperimental dengan rancangan acak lengkap dan enam kali pengulangan. Variabel perlakuan dalam penelitian ini adalah waktu (jam yang dipilih untuk menggigitkan nyamuk pada penderita filariasis (infeksi percobaan. Waktu yang dipilih adalah pukul 09.00 WIB, pukul 17.00 WIB, pukul 21.00 WIB dan pukul 01.00 WIB. Hasil penelitian

  3. Detection of a new focus of Brugia malayi infection in Orissa.

    Science.gov (United States)

    Rath, R N; Mohapatra, B N; Das, B

    1989-03-01

    526 people were surveyed in a village called Chudamani, in Balasore district of Orissa, for detection of asymptomatic microfilaria (mf) carriers. Of these 36 (6.8 per cent) were cases found to harbour mf; 19 cases had Brugia malayi, 4 Wuchereria bancrofti and 5 cases had mixed infection. In 8 cases, species could not be ascertained. For the first time after 1955, a focus of B. malayi has been detected in Orissa.

  4. Suppression of Brugia malayi (sub-periodic larval development in Aedes aegypti (Liverpool strain fed on blood of animals immunized with microfilariae

    Directory of Open Access Journals (Sweden)

    K Athisaya Mary

    2005-07-01

    Full Text Available Preliminary studies were carried out to investigate the role of filarial specific antibodies, raised in an animal model against the filarial parasite, Brugia malayi (sub-periodic, in blocking their early development in an experimental mosquito host, Aedes aegypti (Liverpool strain. In order to generate filarial specific antibodies, Mongolian gerbils, Meriones unguiculatus, were immunized either with live microfilariae (mf of B. malayi or their homogenate. Mf were harvested from the peritoneal cavity of Mongolian gerbils with patent infection of B. malayi and fed to A. aegypti along with the blood from immunized animals. Development of the parasite in infected mosquitoes was monitored until they reached infective stage larvae (L3. Fewer number of parasites developed to first stage (L1 and subsequently to L2 and L3 in mosquitoes fed with blood of immunized animals, when compared to those fed with blood of control animals. The results thus indicated that filarial parasite specific antibodies present in the blood of the immunized animals resulted in the reduction of number of larvae of B. malayi developing in the mosquito host.

  5. The solution structure of the forkhead box-O DNA binding domain of Brugia malayi DAF-16a.

    Science.gov (United States)

    Casper, Sarah K; Schoeller, Scott J; Zgoba, Danielle M; Phillips, Andrew J; Morien, Thomas J; Chaffee, Gary R; Sackett, Peter C; Peterson, Francis C; Crossgrove, Kirsten; Veldkamp, Christopher T

    2014-12-01

    Brugia malayi is a parasitic nematode that causes lymphatic filariasis in humans. Here the solution structure of the forkhead DNA binding domain of Brugia malayi DAF-16a, a putative ortholog of Caenorhabditis elegans DAF-16, is reported. It is believed to be the first structure of a forkhead or winged helix domain from an invertebrate. C. elegans DAF-16 is involved in the insulin/IGF-I signaling pathway and helps control metabolism, longevity, and development. Conservation of sequence and structure with human FOXO proteins suggests that B. malayi DAF-16a is a member of the FOXO family of forkhead proteins. © 2014 Wiley Periodicals, Inc.

  6. Infective Larvae of Brugia malayi Induce Polarization of Host Macrophages that Helps in Immune Evasion

    Directory of Open Access Journals (Sweden)

    Aditi Sharma

    2018-02-01

    Full Text Available Filarial parasites suppress, divert, or polarize the host immune response to aid their survival. However, mechanisms that govern the polarization of host MΦs during early filarial infection are not completely understood. In this study, we infected BALB/c mice with infective larvae stage-3 of Brugia malayi (Bm-L3 and studied their effect on the polarization of splenic MΦs. Results showed that MΦs displayed M2-phenotype by day 3 p.i. characterized by upregulated IL-4, but reduced IL-12 and Prostaglandin-D2 secretion. Increased arginase activity, higher arginase-1 but reduced NOS2 expression and poor phagocytic and antigen processing capacity was also observed. M2 MΦs supported T-cell proliferation and characteristically upregulated p-ERK but downregulated NF-κB-p65 and NF-κB-p50/105. Notably, Bm-L3 synergized with host regulatory T-cells (Tregs and polarized M2 MΦs to regulatory MΦs (Mregs by day 7 p.i., which secreted copious amounts of IL-10 and prostaglandin-E2. Mregs also showed upregulated expression levels of MHC-II, CD80, and CD86 and exhibited increased antigen-processing capacity but displayed impaired activation of NF-κB-p65 and NF-κB-p50/105. Neutralization of Tregs by anti-GITR + anti-CD25 antibodies checked the polarization of M2 MΦs to Mregs, decreased accumulation of regulatory B cells and inflammatory monocytes, and reduced secretion of IL-10, but enhanced IL-4 production and percentages of eosinophils, which led to Bm-L3 killing. In summary, we report hitherto undocumented effects of early Bm-L3 infection on the polarization of splenic MΦs and show how infective larvae deftly utilize the functional plasticity of host MΦs to establish themselves inside the host.

  7. Mining predicted essential genes of Brugia malayi for nematode drug targets.

    Directory of Open Access Journals (Sweden)

    Sanjay Kumar

    Full Text Available We report results from the first genome-wide application of a rational drug target selection methodology to a metazoan pathogen genome, the completed draft sequence of Brugia malayi, a parasitic nematode responsible for human lymphatic filariasis. More than 1.5 billion people worldwide are at risk of contracting lymphatic filariasis and onchocerciasis, a related filarial disease. Drug treatments for filariasis have not changed significantly in over 20 years, and with the risk of resistance rising, there is an urgent need for the development of new anti-filarial drug therapies. The recent publication of the draft genomic sequence for B. malayi enables a genome-wide search for new drug targets. However, there is no functional genomics data in B. malayi to guide the selection of potential drug targets. To circumvent this problem, we have utilized the free-living model nematode Caenorhabditis elegans as a surrogate for B. malayi. Sequence comparisons between the two genomes allow us to map C. elegans orthologs to B. malayi genes. Using these orthology mappings and by incorporating the extensive genomic and functional genomic data, including genome-wide RNAi screens, that already exist for C. elegans, we identify potentially essential genes in B. malayi. Further incorporation of human host genome sequence data and a custom algorithm for prioritization enables us to collect and rank nearly 600 drug target candidates. Previously identified potential drug targets cluster near the top of our prioritized list, lending credibility to our methodology. Over-represented Gene Ontology terms, predicted InterPro domains, and RNAi phenotypes of C. elegans orthologs associated with the potential target pool are identified. By virtue of the selection procedure, the potential B. malayi drug targets highlight components of key processes in nematode biology such as central metabolism, molting and regulation of gene expression.

  8. Effects of Doxycycline on gene expression in Wolbachia and Brugia malayi adult female worms in vivo

    Directory of Open Access Journals (Sweden)

    Rao Ramakrishna U

    2012-02-01

    Full Text Available Abstract Background Most filarial nematodes contain Wolbachia symbionts. The purpose of this study was to examine the effects of doxycycline on gene expression in Wolbachia and adult female Brugia malayi. Methods Brugia malayi infected gerbils were treated with doxycycline for 6-weeks. This treatment largely cleared Wolbachia and arrested worm reproduction. RNA recovered from treated and control female worms was labeled by random priming and hybridized to the Version 2- filarial microarray to obtain expression profiles. Results and discussion Results showed significant changes in expression for 200 Wolbachia (29% of Wolbachia genes with expression signals in untreated worms and 546 B. malayi array elements after treatment. These elements correspond to known genes and also to novel genes with unknown biological functions. Most differentially expressed Wolbachia genes were down-regulated after treatment (98.5%. In contrast, doxycycline had a mixed effect on B. malayi gene expression with many more genes being significantly up-regulated after treatment (85% of differentially expressed genes. Genes and processes involved in reproduction (gender-regulated genes, collagen, amino acid metabolism, ribosomal processes, and cytoskeleton were down-regulated after doxycycline while up-regulated genes and pathways suggest adaptations for survival in response to stress (energy metabolism, electron transport, anti-oxidants, nutrient transport, bacterial signaling pathways, and immune evasion. Conclusions Doxycycline reduced Wolbachia and significantly decreased bacterial gene expression. Wolbachia ribosomes are believed to be the primary biological target for doxycycline in filarial worms. B. malayi genes essential for reproduction, growth and development were also down-regulated; these changes are consistent with doxycycline effects on embryo development and reproduction. On the other hand, many B. malayi genes involved in energy production, electron

  9. Distribution of Brugia malayi larvae and DNA in vector and non-vector mosquitoes: implications for molecular diagnostics

    Directory of Open Access Journals (Sweden)

    Christensen Bruce M

    2009-11-01

    Full Text Available Abstract Background The purpose of this study was to extend prior studies of molecular detection of Brugia malayi DNA in vector (Aedes aegypti- Liverpool and non-vector (Culex pipiens mosquitoes at different times after ingestion of infected blood. Results Parasite DNA was detected over a two week time course in 96% of pooled thoraces of vector mosquitoes. In contrast, parasite DNA was detected in only 24% of thorax pools from non-vectors; parasite DNA was detected in 56% of midgut pools and 47% of abdomen pools from non-vectors. Parasite DNA was detected in vectors in the head immediately after the blood meal and after 14 days. Parasite DNA was also detected in feces and excreta of the vector and non-vector mosquitoes which could potentially confound results obtained with field samples. However, co-housing experiments failed to demonstrate transfer of parasite DNA from infected to non-infected mosquitoes. Parasites were also visualized in mosquito tissues by immunohistololgy using an antibody to the recombinant filarial antigen Bm14. Parasite larvae were detected consistently after mf ingestion in Ae. aegypti- Liverpool. Infectious L3s were seen in the head, thorax and abdomen of vector mosquitoes 14 days after Mf ingestion. In contrast, parasites were only detected by histology shortly after the blood meal in Cx. pipiens, and these were not labeled by the antibody. Conclusion This study provides new information on the distribution of filarial parasites and parasite DNA in vector and non-vector mosquitoes. This information should be useful for those involved in designing and interpreting molecular xenomonitoring studies.

  10. In vitro silencing of Brugia malayi trehalose-6-phosphate phosphatase impairs embryogenesis and in vivo development of infective larvae in jirds.

    Directory of Open Access Journals (Sweden)

    Susheela Kushwaha

    Full Text Available The trehalose metabolic enzymes have been considered as potential targets for drug or vaccine in several organisms such as Mycobacterium, plant nematodes, insects and fungi due to crucial role of sugar trehalose in embryogenesis, glucose uptake and protection from stress. Trehalose-6-phosphate phosphatase (TPP is one of the enzymes of trehalose biosynthesis that has not been reported in mammals. Silencing of tpp gene in Caenorhabditis elegans revealed an indispensable functional role of TPP in nematodes.In the present study, functional role of B. malayi tpp gene was investigated by siRNA mediated silencing which further validated this enzyme to be a putative antifilarial drug target. The silencing of tpp gene in adult female B. malayi brought about severe phenotypic deformities in the intrauterine stages such as distortion and embryonic development arrest. The motility of the parasites was significantly reduced and the microfilarial production as well as their in vitro release from the female worms was also drastically abridged. A majority of the microfilariae released in to the culture medium were found dead. B. malayi infective larvae which underwent tpp gene silencing showed 84.9% reduced adult worm establishment after inoculation into the peritoneal cavity of naïve jirds.The present findings suggest that B. malayi TPP plays an important role in the female worm embryogenesis, infectivity of the larvae and parasite viability. TPP enzyme of B. malayi therefore has the potential to be exploited as an antifilarial drug target.

  11. Attempts at immunization against Malayan filariasis using X-irradiated infective larvae

    International Nuclear Information System (INIS)

    Ramachandran, C.P.

    1975-01-01

    Recent studies on immunity to helminthic infections have shown that some degree of protective immunity may be stimulated by inoculations of attenuated living worms or their metabolites. Although much on these lines has been done with several helminths, little if any has been done with filarial infections in general. Experiments were designed to observe the effects of attempted immunization in the rhesus monkey as well as the domestic cat by the use of attenuated infective larvae of Brugia malayi. The sub-periodic strain of Brugia malayi, the major filarial parasite of man in Malaysia, maintained in the laboratory on experimentally infected cats and rhesus monkeys were used for the preparation of X-irradiated vaccines as well as for challenge inoculations. Third-stage infective larvae of Brugia malayi were obtained from experimentally fed Aedes togoi mosquitoes. Infective larvae were irradiated by X-rays, using a Dermopan X-ray unit at exposures between 10 - 40 kR. Rhesus monkeys and cats were inoculated twice with 100 - 400 attenuated larvae per inoculation at 2 week intervals and challenged about a month later by inoculation of 100 normal larvae. Control animals for each vaccination dose as well as for challenge doses were maintained. In rhesus monkeys persistent immunity to challenge infections (expressed as failure to cause microfilaraemia) were obtained in animals vaccinated with 200 infective larvae attenuated by X-irradiation at 20000 R. Encouraged with the results obtained on rhesus monkeys, similar experiments on an enlarged scale using varying strengths of the vaccines were carried out on the domestic cat, which is a more receptive animal host for Brugia malayi. However, all cats vaccinated when challenged came down with patent infection indicating lack of any definite immunity. In all these experiments, results of vaccine control animals showed that inoculation of irradiated larvae was not followed by the infection of microfilaria in the blood, indicating

  12. Profiling extracellular vesicle release by the filarial nematode Brugia malayi reveals sex-specific differences in cargo and a sensitivity to ivermectin.

    Directory of Open Access Journals (Sweden)

    Hiruni Harischandra

    2018-04-01

    Full Text Available The filarial nematode Brugia malayi is an etiological agent of Lymphatic Filariasis. The capability of B. malayi and other parasitic nematodes to modulate host biology is recognized but the mechanisms by which such manipulation occurs are obscure. An emerging paradigm is the release of parasite-derived extracellular vesicles (EV containing bioactive proteins and small RNA species that allow secretion of parasite effector molecules and their potential trafficking to host tissues. We have previously described EV release from the infectious L3 stage B. malayi and here we profile vesicle release across all intra-mammalian life cycle stages (microfilariae, L3, L4, adult male and female worms. Nanoparticle Tracking Analysis was used to quantify and size EVs revealing discrete vesicle populations and indicating a secretory process that is conserved across the life cycle. Brugia EVs are internalized by murine macrophages with no preference for life stage suggesting a uniform mechanism for effector molecule trafficking. Further, the use of chemical uptake inhibitors suggests all life stage EVs are internalized by phagocytosis. Proteomic profiling of adult male and female EVs using nano-scale LC-MS/MS described quantitative and qualitative differences in the adult EV proteome, helping define the biogenesis of Brugia EVs and revealing sexual dimorphic characteristics in immunomodulatory cargo. Finally, ivermectin was found to rapidly inhibit EV release by all Brugia life stages. Further this drug effect was also observed in the related filarial nematode, the canine heartworm Dirofilaria immitis but not in an ivermectin-unresponsive field isolate of that parasite, highlighting a potential mechanism of action for this drug and suggesting new screening platforms for anti-filarial drug development.

  13. Defining Brugia malayi and Wolbachia symbiosis by stage-specific dual RNA-seq.

    Directory of Open Access Journals (Sweden)

    Alexandra Grote

    2017-03-01

    Full Text Available Filarial nematodes currently infect up to 54 million people worldwide, with millions more at risk for infection, representing the leading cause of disability in the developing world. Brugia malayi is one of the causative agents of lymphatic filariasis and remains the only human filarial parasite that can be maintained in small laboratory animals. Many filarial nematode species, including B. malayi, carry an obligate endosymbiont, the alpha-proteobacteria Wolbachia, which can be eliminated through antibiotic treatment. Elimination of the endosymbiont interferes with development, reproduction, and survival of the worms within the mamalian host, a clear indicator that the Wolbachia are crucial for survival of the parasite. Little is understood about the mechanism underlying this symbiosis.To better understand the molecular interplay between these two organisms we profiled the transcriptomes of B. malayi and Wolbachia by dual RNA-seq across the life cycle of the parasite. This helped identify functional pathways involved in this essential symbiotic relationship provided by the co-expression of nematode and bacterial genes. We have identified significant stage-specific and gender-specific differential expression in Wolbachia during the nematode's development. For example, during female worm development we find that Wolbachia upregulate genes involved in ATP production and purine biosynthesis, as well as genes involved in the oxidative stress response.This global transcriptional analysis has highlighted specific pathways to which both Wolbachia and B. malayi contribute concurrently over the life cycle of the parasite, paving the way for the development of novel intervention strategies.

  14. Inventory and analysis of ATP-binding cassette (ABC) systems in Brugia malayi.

    Science.gov (United States)

    Ardelli, B F; Stitt, L E; Tompkins, J B

    2010-07-01

    ABC systems are one of the largest described protein superfamilies. These systems have a domain organization that may contain 1 or more transmembrane domains (ABC_TM1F) and 1 or 2 ATP-binding domains (ABC_2). The functions (e.g., import, export and DNA repair) of these proteins distinguish the 3 classes of ABC systems. Mining and PCR-based cloning were used to identify 33 putative ABC systems from the Brugia malayi genome. There were 31 class 2 genes, commonly called ABC transporters, and 2 class 3 genes. The ABC transporters were divided into subfamilies. Three belonged to subfamily A, 16 to subfamily B, 5 to subfamily C, 1 to subfamily E and 3 to subfamilies F and G, respectively. None were placed in subfamilies D and H. Similar to other ABC systems, the ABC_2 domain of B. malayi genes was conserved and contained the Walker A and B motifs, the signature sequence/linker region and the switch region with the conserved histidine. The ABC_TM1F domain was less conserved. The relative abundance of ABC systems was quantified using real-time reverse transcription PCR and was significantly higher in female adults of B. malayi than in males and microfilaria, particularly those in subfamilies B and C, which are associated with drug resistance.

  15. Identification of anti-filarial leads against aspartate semialdehyde dehydrogenase of Wolbachia endosymbiont of Brugia malayi: combined molecular docking and molecular dynamics approaches.

    Science.gov (United States)

    Amala, Mathimaran; Rajamanikandan, Sundaraj; Prabhu, Dhamodharan; Surekha, Kanagarajan; Jeyakanthan, Jeyaraman

    2018-02-06

    Lymphatic filariasis is a debilitating vector borne parasitic disease that infects human lymphatic system by nematode Brugia malayi. Currently available anti-filarial drugs are effective only on the larval stages of parasite. So far, no effective drugs are available for humans to treat filarial infections. In this regard, aspartate semialdehyde dehydrogenase (ASDase) in lysine biosynthetic pathway from Wolbachia endosymbiont Brugia malayi represents an attractive therapeutic target for the development of novel anti-filarial agents. In this present study, molecular modeling combined with molecular dynamics simulations and structure-based virtual screening were performed to identify potent lead molecules against ASDase. Based on Glide score, toxicity profile, binding affinity and mode of interactions with the ASDase, five potent lead molecules were selected. The molecular docking and dynamics results revealed that the amino acid residues Arg103, Asn133, Cys134, Gln161, Ser164, Lys218, Arg239, His246, and Asn321 plays a crucial role in effective binding of Top leads into the active site of ASDase. The stability of the ASDase-lead complexes was confirmed by running the 30 ns molecular dynamics simulations. The pharmacokinetic properties of the identified lead molecules are in the acceptable range. Furthermore, density functional theory and binding free energy calculations were performed to rank the lead molecules. Thus, the identified lead molecules can be used for the development of anti-filarial agents to combat the pathogenecity of Brugia malayi.

  16. Detection of human filarial parasite Brugia malayi in dogs by histochemical staining and molecular techniques.

    Science.gov (United States)

    Ambily, V R; Pillai, Usha Narayana; Arun, R; Pramod, S; Jayakumar, K M

    2011-09-27

    Human filariasis caused by Brugia malayi is still a public health problem in many countries of Asia including India, Indonesia, Malaysia and Thailand. The World Health Organization (WHO) has targeted to eliminate filariasis by the year 2020 by Mass annual single dose Diethylcarbamazine Administration (MDA). Results of the MDA programme after the first phase was less satisfactory than expected. Malayan filariasis caused by B. malayi is endemic in the south of Thailand where domestic cat serves as the major reservoir host. There is no report about the occurrence of B. malayi in dogs. The present work was carried out to find out the incidence of microfilariasis in dogs and also to detect the presence of human filarial infection in dogs, if any. One hundred dogs above 6 months of age presented to the veterinary college Hospital, Mannuthy, Kerala, with clinical signs suggestive of microfilariasis - fever, anorexia, conjunctivitis, limb and scrotal oedema - were screened for microfilariae by wet film examination. Positive cases were subjected to Giemsa staining, histochemical staining and molecular techniques. Results of the study showed that 80% of dogs had microfilariasis; out of which 20% had sheathed microfilaria. Giemsa and histochemical staining character, PCR and sequencing confirmed it as B. malayi. High prevalence of B. malayi in dogs in this study emphasized the possible role of dogs in transmission of human filariasis. Copyright © 2011 Elsevier B.V. All rights reserved.

  17. Comparison of an enzyme linked immunosorbent assay (ELISA) and a radioallergosorbent test (RAST) for detection of IgE antibodies to Brugia malayi

    NARCIS (Netherlands)

    Wahyuni, Sitti; van Ree, Ronald; Mangali, Andarias; Supali, Taniawati; Yazdanbakhsh, Maria; Sartono, Erliyani

    2003-01-01

    The enzyme linked immunosorbent assay (ELISA) for specific IgE antibodies to Brugia malayi was compared with the radioallergosorbent test (RAST) for use in immunoepidemiological studies of lymphatic filariasis. Sera used were from individuals (aged 5-82 years) living in an area endemic for lymphatic

  18. Identification and characterization of nematode specific protective epitopes of Brugia malayi TRX towards development of synthetic vaccine construct for lymphatic filariasis.

    Science.gov (United States)

    Madhumathi, Jayaprakasam; Prince, Prabhu Rajaiah; Anugraha, Gandhirajan; Kiran, Pote; Rao, Donthamsetty Nageswara; Reddy, Maryada Venkata Rami; Kaliraj, Perumal

    2010-07-12

    Although multi-epitope vaccines have been evaluated for various diseases, they have not yet been investigated for lymphatic filariasis. Here, we report for the first time identification of two immunodominant B epitopes (TRXP1 and TRXP2) from the antioxidant Brugia malayi thioredoxin by studying their immune responses in mice model and human subjects. TRXP1 was also found to harbor a T epitope recognized by human PBMCs and mice splenocytes. Further, the epitopic peptides were synthesized as a single peptide conjugate (PC1) and their prophylactic efficacy was tested in a murine model of filariasis with L3 larvae. PC1 conferred a significantly high protection (75.14%) (P TRX (63.03%) (P < 0.018) in experimental filariasis. Our results suggest that multi-epitope vaccines could be a promising strategy in the control of lymphatic filariasis.

  19. Live Brugia malayi microfilariae inhibit transendothelial migration of neutrophils and monocytes.

    Directory of Open Access Journals (Sweden)

    Jan-Hendrik Schroeder

    Full Text Available Lymphatic filariasis is a major tropical disease caused by the parasite Brugia malayi. Microfilariae (Mf circulate in the peripheral blood for 2-3 hours in synchronisation with maximal feeding of the mosquito vector. When absent from the peripheral blood, Mf sequester in the capillaries of the lungs. Mf are therefore in close contact with vascular endothelial cells (EC and may induce EC immune function and/or wound repair mechanisms such as angiogenesis. In this study, Mf were co-cultured with human umbilical vein EC (HUVEC or human lung microvascular EC (HLMVEC and the transendothelial migration of leukocyte subsets was analysed. In addition, the protein and/or mRNA expression of chemokine, cytokine and angiogenic mediators in endothelial cells in the presence of live microfilariae were measured by a combination of cDNA arrays, protein arrays, ELISA and fluorescence antibody tests.Surprisingly, our findings indicate that Mf presence partially blocked transendothelial migration of monocytes and neutrophils, but not lymphocytes. However, Mf exposure did not result in altered vascular EC expression of key mediators of the tethering stage of extravasation, such as ICAM-1, VCAM-1 and various chemokines. To further analyse the immunological function of vascular EC in the presence of Mf, we measured the mRNA and/or protein expression of a number of pro-inflammatory mediators. We found that expression levels of the mediators tested were predominantly unaltered upon B. malayi Mf exposure. In addition, a comparison of angiogenic mediators induced by intact Mf and Wolbachia-depleted Mf revealed that even intact Mf induce the expression of remarkably few angiogenic mediators in vascular EC. Our study suggests that live microfilariae are remarkably inert in their induction and/or activation of vascular cells in their immediate local environment. Overall, this work presents important insights into the immunological function of the vascular endothelium during

  20. Brugia malayi excreted/secreted proteins at the host/parasite interface: stage- and gender-specific proteomic profiling.

    Directory of Open Access Journals (Sweden)

    Sasisekhar Bennuru

    Full Text Available Relatively little is known about the filarial proteins that interact with the human host. Although the filarial genome has recently been completed, protein profiles have been limited to only a few recombinants or purified proteins of interest. Here, we describe a large-scale proteomic analysis using microcapillary reverse-phase liquid chromatography-tandem-mass spectrometry to identify the excretory-secretory (ES products of the L3, L3 to L4 molting ES, adult male, adult female, and microfilarial stages of the filarial parasite Brugia malayi. The analysis of the ES products from adult male, adult female, microfilariae (Mf, L3, and molting L3 larvae identified 852 proteins. Annotation suggests that the functional and component distribution was very similar across each of the stages studied; however, the Mf contributed a higher proportion to the total number of identified proteins than the other stages. Of the 852 proteins identified in the ES, only 229 had previous confirmatory expressed sequence tags (ESTs in the available databases. Moreover, this analysis was able to confirm the presence of 274 "hypothetical" proteins inferred from gene prediction algorithms applied to the B. malayi (Bm genome. Not surprisingly, the majority (160/274 of these "hypothetical" proteins were predicted to be secreted by Signal IP and/or SecretomeP 2.0 analysis. Of major interest is the abundance of previously characterized immunomodulatory proteins such as ES-62 (leucyl aminopeptidase, MIF-1, SERPIN, glutathione peroxidase, and galectin in the ES of microfilariae (and Mf-containing adult females compared to the adult males. In addition, searching the ES protein spectra against the Wolbachia database resulted in the identification of 90 Wolbachia-specific proteins, most of which were metabolic enzymes that have not been shown to be immunogenic. This proteomic analysis extends our knowledge of the ES and provides insight into the host-parasite interaction.

  1. Galactolipids from Bauhinia racemosa as a new class of antifilarial agents against human lymphatic filarial parasite, Brugia malayi.

    Science.gov (United States)

    Sashidhara, Koneni V; Singh, Suriya P; Misra, Sweta; Gupta, Jyoti; Misra-Bhattacharya, Shailja

    2012-04-01

    Bioassay guided fractionation of ethanolic extract of the leaves of Bauhinia racemosa led to the isolation of galactolipid and catechin class of the compounds (1-7) from the most active n-butanol fraction (F4). Among the active galactolipids, 1 emerged as the lead molecule which was active on both forms of lymphatic filarial parasite, Brugia malayi. It was found to be better than the standard drug ivermectin and diethylcarbamazine (DEC) in terms of dose and efficacy. Copyright © 2012 Elsevier Masson SAS. All rights reserved.

  2. Cofactor Independent Phosphoglycerate Mutase of Brugia malayi Induces a Mixed Th1/Th2 Type Immune Response and Inhibits Larval Development in the Host

    Directory of Open Access Journals (Sweden)

    Prashant K. Singh

    2014-01-01

    Full Text Available Lymphatic filariasis is a major debilitating disease, endemic in 72 countries putting more than 1.39 billion people at risk and 120 million are already infected. Despite the significant progress in chemotherapeutic advancements, there is still need for other measures like development of an effective vaccine or discovery of novel drug targets. In this study, structural and immunological characterization of independent phosphoglycerate mutase of filarial parasite Brugia malayi was carried out. Protein was found to be expressed in all major parasite life stages and as an excretory secretory product of adult parasites. Bm-iPGM also reacted to all the categories of human bancroftian patient’s sera including endemic normals. In vivo immunological behaviour of protein was determined in immunized BALB/c mice followed by prophylactic analysis in BALB/c mice and Mastomys coucha. Immunization with Bm-iPGM led to generation of a mixed Th1/Th2 type immune response offering 58.2% protection against larval challenge in BALB/c and 65–68% protection in M. coucha. In vitro studies confirmed participation of anti-Bm-iPGM antibodies in killing of B. malayi infective larvae and microfilariae through ADCC mechanism. The present findings reveal potential immunoprotective nature of Bm-iPGM advocating its worth as an antifilarial vaccine candidate.

  3. Brugia malayi microfilariae adhere to human vascular endothelial cells in a C3-dependent manner.

    Directory of Open Access Journals (Sweden)

    Jan-Hendrik Schroeder

    2017-05-01

    Full Text Available Brugia malayi causes the human tropical disease, lymphatic filariasis. Microfilariae (Mf of this nematode live in the bloodstream and are ingested by a feeding mosquito vector. Interestingly, in a remarkable co-evolutionary adaptation, Mf appearance in the peripheral blood follows a circadian periodicity and reaches a peak when the mosquito is most likely to feed. For the remaining hours, the majority of Mf sequester in the lung capillaries. This circadian phenomenon has been widely reported and is likely to maximise parasite fitness and optimise transmission potential. However, the mechanism of Mf sequestration in the lungs remains largely unresolved. In this study, we demonstrate that B. malayi Mf can, directly adhere to vascular endothelial cells under static conditions and under flow conditions, they can bind at high (but not low flow rates. High flow rates are more likely to be experienced diurnally. Furthermore, a non-periodic nematode adheres less efficiently to endothelial cells. Strikingly C3, the central component of complement, plays a crucial role in the adherence interaction. These novel results show that microfilariae have the ability to bind to endothelial cells, which may explain their sequestration in the lungs, and this binding is increased in the presence of inflammatory mediators.

  4. Immunization of Mastomys coucha with Brugia malayi recombinant trehalose-6-phosphate phosphatase results in significant protection against homologous challenge infection.

    Directory of Open Access Journals (Sweden)

    Susheela Kushwaha

    Full Text Available Development of a vaccine to prevent or reduce parasite development in lymphatic filariasis would be a complementary approach to existing chemotherapeutic tools. Trehalose-6-phosphate phosphatase of Brugia malayi (Bm-TPP represents an attractive vaccine target due to its absence in mammals, prevalence in the major life stages of the parasite and immunoreactivity with human bancroftian antibodies, especially from endemic normal subjects. We have recently reported on the cloning, expression, purification and biochemical characterization of this vital enzyme of B. malayi. In the present study, immunoprophylactic evaluation of Bm-TPP was carried out against B. malayi larval challenge in a susceptible host Mastomys coucha and the protective ability of the recombinant protein was evaluated by observing the adverse effects on microfilarial density and adult worm establishment. Immunization caused 78.4% decrease in microfilaremia and 71.04% reduction in the adult worm establishment along with sterilization of 70.06% of the recovered live females. The recombinant protein elicited a mixed Th1/Th2 type of protective immune response as evidenced by the generation of both pro- and anti-inflammatory cytokines IL-2, IFN-γ, TNF-α, IL-4 and an increased production of antibody isotypes IgG1, IgG2a, IgG2b and IgA. Thus immunization with Bm-TPP conferred considerable protection against B. malayi establishment by engendering a long-lasting effective immune response and therefore emerges as a potential vaccine candidate against lymphatic filariasis (LF.

  5. Tissue and stage-specific distribution of Wolbachia in Brugia malayi.

    Directory of Open Access Journals (Sweden)

    Kerstin Fischer

    2011-05-01

    Full Text Available BACKGROUND: Most filarial parasite species contain Wolbachia, obligatory bacterial endosymbionts that are crucial for filarial development and reproduction. They are targets for alternative chemotherapy, but their role in the biology of filarial nematodes is not well understood. Light microscopy provides important information on morphology, localization and potential function of these bacteria. Surprisingly, immunohistology and in situ hybridization techniques have not been widely used to monitor Wolbachia distribution during the filarial life cycle. METHODS/PRINCIPAL FINDINGS: A monoclonal antibody directed against Wolbachia surface protein and in situ hybridization targeting Wolbachia 16S rRNA were used to monitor Wolbachia during the life cycle of B. malayi. In microfilariae and vector stage larvae only a few cells contain Wolbachia. In contrast, large numbers of Wolbachia were detected in the lateral chords of L4 larvae, but no endobacteria were detected in the genital primordium. In young adult worms (5 weeks p.i., a massive expansion of Wolbachia was observed in the lateral chords adjacent to ovaries or testis, but no endobacteria were detected in the growth zone of the ovaries, uterus, the growth zone of the testis or the vas deferens. Confocal laser scanning and transmission electron microscopy showed that numerous Wolbachia are aligned towards the developing ovaries and single endobacteria were detected in the germline. In inseminated females (8 weeks p.i. Wolbachia were observed in the ovaries, embryos and in decreasing numbers in the lateral chords. In young males Wolbachia were found in distinct zones of the testis and in large numbers in the lateral chords in the vicinity of testicular tissue but never in mature spermatids or spermatozoa. CONCLUSIONS: Immunohistology and in situ hybridization show distinct tissue and stage specific distribution patterns for Wolbachia in B. malayi. Extensive multiplication of Wolbachia occurs in the

  6. The role of polymorphisms in the spliced leader addition domain in determining promoter activity in Brugia malayi.

    Science.gov (United States)

    Bailey, Michelle; Chauhan, Chitra; Liu, Canhui; Unnasch, Thomas R

    2011-03-01

    Previous studies of Brugia malayi promoters have suggested that they are unusual in that they lack the CAAT or TATAA boxes that are often emblematic of eucaryotic core promoter domains. Instead, the region surrounding the spliced leader (SL) addition site appears to function as the core promoter domain in B. malayi. To test the hypothesis that polymorphisms in this SL addition domain are important determinants of promoter activity, a series of domain swap mutants were prepared replacing the SL addition domain of the B. malayi 13kDa large subunit ribosomal protein (BmRPL13) with those of other ribosomal protein (RP) promoters exhibiting a wide range of activities. These constructs were then tested for promoter activity in a homologous transient transfection system. On average, polymorphisms in the SL addition domain were found to be responsible for 80% of the variation in promoter activity exhibited by the RP promoters tested. Essentially all of this effect could be attributable to polymorphisms in the 10nt located directly upstream of the SL addition site. A comparison of the sequence of this domain to the promoter activity exhibited by the domain swap mutants suggested that promoter activity was related to the number of T residues present in the coding strand of the upstream domain. Confirming this, mutation of the upstream domain of the promoter of the BmRPS4 gene to a homogeneous stretch of 10 T residues resulted in a significant increase in promoter activity. Copyright © 2010 Elsevier B.V. All rights reserved.

  7. The heme biosynthetic pathway of the obligate Wolbachia endosymbiont of Brugia malayi as a potential anti-filarial drug target.

    Directory of Open Access Journals (Sweden)

    Bo Wu

    2009-07-01

    Full Text Available Filarial parasites (e.g., Brugia malayi, Onchocerca volvulus, and Wuchereria bancrofti are causative agents of lymphatic filariasis and onchocerciasis, which are among the most disabling of neglected tropical diseases. There is an urgent need to develop macro-filaricidal drugs, as current anti-filarial chemotherapy (e.g., diethylcarbamazine [DEC], ivermectin and albendazole can interrupt transmission predominantly by killing microfilariae (mf larvae, but is less effective on adult worms, which can live for decades in the human host. All medically relevant human filarial parasites appear to contain an obligate endosymbiotic bacterium, Wolbachia. This alpha-proteobacterial mutualist has been recognized as a potential target for filarial nematode life cycle intervention, as antibiotic treatments of filarial worms harboring Wolbachia result in the loss of worm fertility and viability upon antibiotic treatments both in vitro and in vivo. Human trials have confirmed this approach, although the length of treatments, high doses required and medical counter-indications for young children and pregnant women warrant the identification of additional anti-Wolbachia drugs.Genome sequence analysis indicated that enzymes involved in heme biosynthesis might constitute a potential anti-Wolbachia target set. We tested different heme biosynthetic pathway inhibitors in ex vivo B. malayi viability assays and report a specific effect of N-methyl mesoporphyrin (NMMP, which targets ferrochelatase (FC, the last step. Our phylogenetic analysis indicates evolutionarily significant divergence between Wolbachia heme genes and their human homologues. We therefore undertook the cloning, overexpression and analysis of several enzymes of this pathway alongside their human homologues, and prepared proteins for drug targeting. In vitro enzyme assays revealed a approximately 600-fold difference in drug sensitivities to succinyl acetone (SA between Wolbachia and human 5

  8. Functional analysis of the cathepsin-like cysteine protease genes in adult Brugia malayi using RNA interference.

    Directory of Open Access Journals (Sweden)

    Louise Ford

    Full Text Available Cathepsin-like enzymes have been identified as potential targets for drug or vaccine development in many parasites, as their functions appear to be essential in a variety of important biological processes within the host, such as molting, cuticle remodeling, embryogenesis, feeding and immune evasion. Functional analysis of Caenorhabditis elegans cathepsin L (Ce-cpl-1 and cathepsin Z (Ce-cpz-1 has established that both genes are required for early embryogenesis, with Ce-cpl-1 having a role in regulating in part the processing of yolk proteins. Ce-cpz-1 also has an important role during molting.RNA interference assays have allowed us to verify whether the functions of the orthologous filarial genes in Brugia malayi adult female worms are similar. Treatment of B. malayi adult female worms with Bm-cpl-1, Bm-cpl-5, which belong to group Ia of the filarial cpl gene family, or Bm-cpz-1 dsRNA resulted in decreased numbers of secreted microfilariae in vitro. In addition, analysis of the intrauterine progeny of the Bm-cpl-5 or Bm-cpl Pro dsRNA- and siRNA-treated worms revealed a clear disruption in the process of embryogenesis resulting in structural abnormalities in embryos and a varied differential development of embryonic stages.Our studies suggest that these filarial cathepsin-like cysteine proteases are likely to be functional orthologs of the C. elegans genes. This functional conservation may thus allow for a more thorough investigation of their distinct functions and their development as potential drug targets.

  9. Immunization with Brugia malayi Myosin as Heterologous DNA Prime Protein Boost Induces Protective Immunity against B. malayi Infection in Mastomys coucha.

    Directory of Open Access Journals (Sweden)

    Jyoti Gupta

    Full Text Available The current control strategies employing chemotherapy with diethylcarbamazine, ivermectin and albendazole have reduced transmission in some filaria-endemic areas, there is growing interest for complementary approaches, such as vaccines especially in light of threat of parasite developing resistance to mainstay drugs. We earlier demonstrated recombinant heavy chain myosin of B. malayi (Bm-Myo as a potent vaccine candidate whose efficacy was enhanced by heterologous DNA prime/protein boost (Myo-pcD+Bm-Myo vaccination in BALB/c mice. BALB/c mouse though does not support the full developmental cycle of B. malayi, however, the degree of protection may be studied in terms of transformation of challenged infective larvae (L3 to next stage (L4 with an ease of delineating the generated immunological response of host. In the current investigation, DNA vaccination with Bm-Myo was therefore undertaken in susceptible rodent host, Mastomys coucha (M. coucha which sustains the challenged L3 and facilitates their further development to sexually mature adult parasites with patent microfilaraemia. Immunization schedule consisted of Myo-pcD and Myo-pcD+Bm-Myo followed by B. malayi L3 challenge and the degree of protection was evaluated by observing microfilaraemia as well as adult worm establishment. Myo-pcD+Bm-Myo immunized animals not only developed 78.5% reduced blood microfilarial density but also decreased adult worm establishment by 75.3%. In addition, 75.4% of the recovered live females revealed sterilization over those of respective control animals. Myo-pcD+Bm-Myo triggered higher production of specific IgG and its isotypes which induced marked cellular adhesion and cytotoxicity (ADCC to microfilariae (mf and L3 in vitro. Both Th1 and Th2 cytokines were significantly up-regulated displaying a mixed immune response conferring considerable protection against B. malayi establishment by engendering a long-lasting effective immune response and therefore emerges

  10. Transcriptomes and pathways associated with infectivity, survival and immunogenicity in Brugia malayi L3

    Directory of Open Access Journals (Sweden)

    Spiro David

    2009-06-01

    Full Text Available Abstract Background Filarial nematode parasites cause serious diseases such as elephantiasis and river blindness in humans, and heartworm infections in dogs. Third stage filarial larvae (L3 are a critical stage in the life cycle of filarial parasites, because this is the stage that is transmitted by arthropod vectors to initiate infections in mammals. Improved understanding of molecular mechanisms associated with this transition may provide important leads for development of new therapies and vaccines to prevent filarial infections. This study explores changes in gene expression associated with the transition of Brugia malayi third stage larvae (BmL3 from mosquitoes into mammalian hosts and how these changes are affected by radiation. Radiation effects are especially interesting because irradiated L3 induce partial immunity to filarial infections. The underlying molecular mechanisms responsible for the efficacy of such vaccines are unkown. Results Expression profiles were obtained using a new filarial microarray with 18, 104 64-mer elements. 771 genes were identified as differentially expressed in two-way comparative analyses of the three L3 types. 353 genes were up-regulated in mosquito L3 (L3i relative to cultured L3 (L3c. These genes are important for establishment of filarial infections in mammalian hosts. Other genes were up-regulated in L3c relative to L3i (234 or irradiated L3 (L3ir (22. These culture-induced transcripts include key molecules required for growth and development. 165 genes were up-regulated in L3ir relative to L3c; these genes encode highly immunogenic proteins and proteins involved in radiation repair. L3ir and L3i have similar transcription profiles for genes that encode highly immunogenic proteins, antioxidants and cuticle components. Conclusion Changes in gene expression that normally occur during culture under conditions that support L3 development and molting are prevented or delayed by radiation. This may explain

  11. Expression of five acetylcholine receptor subunit genes in Brugia malayi adult worms

    Directory of Open Access Journals (Sweden)

    Ben-Wen Li

    2015-12-01

    Full Text Available Acetylcholine receptors (AChRs are required for body movement in parasitic nematodes and are targets of “classical” anthelmintic drugs such as levamisole and pyrantel and of newer drugs such as tribendimidine and derquantel. While neurotransmission explains the effects of these drugs on nematode movement, their effects on parasite reproduction are unexplained. The levamisole AChR type (L-AChRs in Caenorhabditis elegans is comprised of five subunits: Cel-UNC-29, Cel-UNC-38, Cel-UNC-63, Cel-LEV-1 and Cel-LEV-8. The genome of the filarial parasite Brugia malayi contains nine AChRs subunits including orthologues of Cel-unc-29, Cel-unc-38, and Cel-unc-63. We performed in situ hybridization with RNA probes to localize the expression of five AChR genes (Bm1_35890-Bma-unc-29, Bm1_20330-Bma-unc-38, Bm1_38195-Bma-unc-63, Bm1_48815-Bma-acr-26 and Bm1_40515-Bma-acr-12 in B. malayi adult worms. Four of these genes had similar expression patterns with signals in body muscle, developing embryos, spermatogonia, uterine wall adjacent to stretched microfilariae, wall of Vas deferens, and lateral cord. Three L-AChR subunit genes (Bma-unc-29, Bma-unc-38 and Bma-unc-63 were expressed in body muscle, which is a known target of levamisole. Bma-acr-12 was co-expressed with these levamisole subunit genes in muscle, and this suggests that its protein product may form receptors with other alpha subunits. Bma-acr-26 was expressed in male muscle but not in female muscle. Strong expression signals of these genes in early embryos and gametes in uterus and testis suggest that AChRs may have a role in nervous system development of embryogenesis and spermatogenesis. This would be consistent with embryotoxic effects of drugs that target these receptors in filarial worms. Our data show that the expression of these receptor genes is tightly regulated with regard to localization in adult worms and developmental stage in embryos and gametes. These results may help to explain the

  12. Immunogenicity and Protective Efficacy of Brugia malayi Heavy Chain Myosin as Homologous DNA, Protein and Heterologous DNA/Protein Prime Boost Vaccine in Rodent Model.

    Directory of Open Access Journals (Sweden)

    Jyoti Gupta

    Full Text Available We earlier demonstrated the immunoprophylactic efficacy of recombinant heavy chain myosin (Bm-Myo of Brugia malayi (B. malayi in rodent models. In the current study, further attempts have been made to improve this efficacy by employing alternate approaches such as homologous DNA (pcD-Myo and heterologous DNA/protein prime boost (pcD-Myo+Bm-Myo in BALB/c mouse model. The gene bm-myo was cloned in a mammalian expression vector pcDNA 3.1(+ and protein expression was confirmed in mammalian Vero cell line. A significant degree of protection (79.2%±2.32 against L3 challenge in pcD-Myo+Bm-Myo immunized group was observed which was much higher than that exerted by Bm-Myo (66.6%±2.23 and pcD-Myo (41.6%±2.45. In the heterologous immunized group, the percentage of peritoneal leukocytes such as macrophages, neutrophils, B cells and T cells marginally increased and their population augmented further significantly following L3 challenge. pcD-Myo+Bm-Myo immunization elicited robust cellular and humoral immune responses as compared to pcD-Myo and Bm-Myo groups as evidenced by an increased accumulation of CD4+, CD8+ T cells and CD19+ B cells in the mouse spleen and activation of peritoneal macrophages. Though immunized animals produced antigen-specific IgG antibodies and isotypes, sera of mice receiving pcD-Myo+Bm-Myo or Bm-Myo developed much higher antibody levels than other groups and there was profound antibody-dependent cellular adhesion and cytotoxicity (ADCC to B. malayi infective larvae (L3. pcD-Myo+Bm-Myo as well as Bm-Myo mice generated a mixed T helper cell phenotype as evidenced by the production of both pro-inflammatory (IL-2, IFN-γ and anti-inflammatory (IL-4, IL-10 cytokines. Mice receiving pcD-Myo on contrary displayed a polarized pro-inflammatory immune response. The findings suggest that the priming of animals with DNA followed by protein booster generates heightened and mixed pro- and anti-inflammatory immune responses that are capable of

  13. Brugia malayi gene expression in response to the targeting of the Wolbachia endosymbiont by tetracycline treatment.

    Directory of Open Access Journals (Sweden)

    Elodie Ghedin

    2009-10-01

    Full Text Available Brugia malayi, like most human filarial parasite species, harbors an endosymbiotic bacterium of the genus Wolbachia. Elimination of the endosymbiont leads to sterilization of the adult female. Previous biochemical and genetic studies have established that communication with its endobacterium is essential for survival of the worm.We used electron microscopy to examine the effects of antibiotic treatment on Wolbachia cell structure. We have also used microarray and quantitative RT-PCR analyses to examine the regulation of the B. malayi transcripts altered in response to the anti-Wolbachia treatment. Microscopy of worms taken from animals treated with tetracycline for 14 and 21 days (14 d and 21 d demonstrated substantial morphologic effects on the Wolbachia endobacterium by 14 d and complete degeneration of the endobacterial structures by 21 d. We observed upregulation of transcripts primarily encoding proteins involved in amino acid synthesis and protein translation, and downregulation of transcripts involved in cuticle biosynthesis after both 7 d and 14 d of treatment. In worms exposed to tetracycline in culture, substantial effects on endobacteria morphology were evident by day 3, and extensive death of the endobacteria was observed by day 5. In a detailed examination of the expression kinetics of selected signaling genes carried out on such cultured worms, a bimodal pattern of regulation was observed. The selected genes were upregulated during the early phase of antibiotic treatment and quickly downregulated in the following days. These same genes were upregulated once more at 6 days post-treatment.Upregulation of protein translation and amino acid synthesis may indicate a generalized stress response induced in B. malayi due to a shortage of essential nutrients/factors that are otherwise supplied by Wolbachia. Downregulation of transcripts involved in cuticle biosynthesis perhaps reflects a disruption in the normal embryogenic program. This is

  14. Production of Brugia malayi BmSXP Recombinant Protein Expressed in Escherichia coli

    Directory of Open Access Journals (Sweden)

    Khoo, T. K.

    2010-01-01

    Full Text Available A rapid antibody detection test is very useful for detection of lymphatic filariasis, especially for certification and surveillance of post-mass drug administration. One such kit, panLF RapidTM (commercialized by Malaysian BioDiagnostic Research Sdn. Bhd. had been developed in our laboratory for the detection of all species of filarial infections. It is based on the detection of anti-filarial IgG4 antibodies that react with recombinant Brugia malayi antigens, BmR1 and BmSXP. In this study, the growth of recombinant bacteria that produce BmSXP was optimized under shake flask fermentation for high yield of the recombinant antigen. The optimizations involved selection of suitable growth medium, IPTG concentration and induction time. The medium that yielded the highest biomass as well as total protein was Terrific Broth (TB medium, which is an undefined medium. Initiation of induction of protein expression was found to be best at mid-log phase (OD600 = 1.5, with IPTG concentration of 1.0 mM, and harvest time at 9 h post-induction. This study showed that under the optimized conditions, the shake flask culture produced 4 g/L biomass (dry cell weight of recombinant Escherichia coli BmSXP/pPROEXHTa/TOP10F’, which yielded 2.42 mg/L of purified BmSXP recombinant antigen. The purified antigen was analyzed by SDS-PAGE and the antigenicity of protein was confirmed by Western blot.

  15. Stage- and gender-specific proteomic analysis of Brugia malayi excretory-secretory products.

    Directory of Open Access Journals (Sweden)

    Yovany Moreno

    Full Text Available INTRODUCTION: While we lack a complete understanding of the molecular mechanisms by which parasites establish and achieve protection from host immune responses, it is accepted that many of these processes are mediated by products, primarily proteins, released from the parasite. Parasitic nematodes occur in different life stages and anatomical compartments within the host. Little is known about the composition and variability of products released at different developmental stages and their contribution to parasite survival and progression of the infection. METHODOLOGY/PRINCIPAL FINDINGS: To gain a deeper understanding on these aspects, we collected and analyzed through 1D-SDS PAGE and LC-MS/MS the Excretory-Secretory Products (ESP of adult female, adult male and microfilariae of the filarial nematode Brugia malayi, one of the etiological agents of human lymphatic filariasis. This proteomic analysis led to the identification of 228 proteins. The list includes 76 proteins with unknown function as well as also proteins with potential immunoregulatory properties, such as protease inhibitors, cytokine homologues and carbohydrate-binding proteins. Larval and adult ESP differed in composition. Only 32 proteins were shared between all three stages/genders. Consistent with this observation, different gene ontology profiles were associated with the different ESP. CONCLUSIONS/SIGNIFICANCE: A comparative analysis of the proteins released in vitro by different forms of a parasitic nematode dwelling in the same host is presented. The catalog of secreted proteins reflects different stage- and gender-specific related processes and different strategies of immune evasion, providing valuable insights on the contribution of each form of the parasite for establishing the host-parasite interaction.

  16. Physicochemical properties of the modeled structure of astacin metalloprotease moulting enzyme NAS-36 and mapping the druggable allosteric space of Heamonchus contortus, Brugia malayi and Ceanorhabditis elegans via molecular dynamics simulation.

    Science.gov (United States)

    Sharma, Om Prakash; Agrawal, Sonali; Kumar, M Suresh

    2013-12-01

    Nematodes represent the second largest phylum in the animal kingdom. It is the most abundant species (500,000) in the planet. It causes chronic, debilitating infections worldwide such as ascariasis, trichuriasis, hookworm, enterobiasis, strongyloidiasis, filariasis and trichinosis, among others. Molecular modeling tools can play an important role in the identification and structural investigation of molecular targets that can act as a vital candidate against filariasis. In this study, sequence analysis of NAS-36 from H. contortus (Heamonchus contortus), B. malayi (Brugia malayi) and C. elegans (Ceanorhabditis elegans) has been performed, in order to identify the conserved residues. Tertiary structure was developed for an insight into the molecular structure of the enzyme. Molecular Dynamics Simulation (MDS) studies have been carried out to analyze the stability and the physical properties of the proposed enzyme models in the H. contortus, B. malayi and C. elegans. Moreover, the drug binding sites have been mapped for inhibiting the function of NAS-36 enzyme. The molecular identity of this protease could eventually demonstrate how ex-sheathment is regulated, as well as provide a potential target of anthelmintics for the prevention of nematode infections.

  17. Wolbachia lipoproteins: abundance, localisation and serology of Wolbachia peptidoglycan associated lipoprotein and the Type IV Secretion System component, VirB6 from Brugia malayi and Aedes albopictus.

    Science.gov (United States)

    Voronin, Denis; Guimarães, Ana F; Molyneux, Gemma R; Johnston, Kelly L; Ford, Louise; Taylor, Mark J

    2014-10-06

    Lipoproteins are the major agonists of Wolbachia-dependent inflammatory pathogenesis in filariasis and a validated target for drug discovery. Here we characterise the abundance, localisation and serology of the Wolbachia lipoproteins: Wolbachia peptidoglycan associated lipoprotein and the Type IV Secretion System component, VirB6. We used proteomics to confirm lipoprotein presence and relative abundance; fractionation, immunoblotting and confocal and electron immuno-microscopy for localisation and ELISA for serological analysis. Proteomic analysis of Brugia malayi adult female protein extracts confirmed the presence of two lipoproteins, previously predicted through bioinformatics: Wolbachia peptidoglycan associated lipoprotein (wBmPAL) and the Type IV Secretion System component, VirB6 (wBmVirB6). wBmPAL was among the most abundant Wolbachia proteins present in an extract of adult female worms with wBmVirB6 only detected at a much lower abundance. This differential abundance was reflected in the immunogold-labelling, which showed wBmPAL localised at numerous sites within the bacterial membranes, whereas wBmVirB6 was present as a single cluster on each bacterial cell and also located within the bacterial membranes. Immunoblotting of fractionated extracts confirmed the localisation of wBmPAL to membranes and its absence from cytosolic fractions of C6/36 mosquito cells infected with wAlbB. In whole worm mounts, antibody labelling of both lipoproteins were associated with Wolbachia. Serological analysis showed that both proteins were immunogenic and raised antibody responses in the majority of individuals infected with Wuchereria bancrofti. Two Wolbachia lipoproteins, wBmPAL and wBmVirB6, are present in extracts of Brugia malayi with wBmPAL among the most abundant of Wolbachia proteins. Both lipoproteins localised to bacterial membranes with wBmVirB6 present as a single cluster suggesting a single Type IV Secretory System on each Wolbachia cell.

  18. Exome and Transcriptome Sequencing of Aedes aegypti Identifies a Locus That Confers Resistance to Brugia malayi and Alters the Immune Response

    KAUST Repository

    Juneja, Punita

    2015-03-27

    Many mosquito species are naturally polymorphic for their abilities to transmit parasites, a feature which is of great interest for controlling vector-borne disease. Aedes aegypti, the primary vector of dengue and yellow fever and a laboratory model for studying lymphatic filariasis, is genetically variable for its capacity to harbor the filarial nematode Brugia malayi. The genome of Ae. aegypti is large and repetitive, making genome resequencing difficult and expensive. We designed exome captures to target protein-coding regions of the genome, and used association mapping in a wild Kenyan population to identify a single, dominant, sex-linked locus underlying resistance. This falls in a region of the genome where a resistance locus was previously mapped in a line established in 1936, suggesting that this polymorphism has been maintained in the wild for the at least 80 years. We then crossed resistant and susceptible mosquitoes to place both alleles of the gene into a common genetic background, and used RNA-seq to measure the effect of this locus on gene expression. We found evidence for Toll, IMD, and JAK-STAT pathway activity in response to early stages of B. malayi infection when the parasites are beginning to die in the resistant genotype. We also found that resistant mosquitoes express anti-microbial peptides at the time of parasite-killing, and that this expression is suppressed in susceptible mosquitoes. Together, we have found that a single resistance locus leads to a higher immune response in resistant mosquitoes, and we identify genes in this region that may be responsible for this trait.

  19. Profiling the macrofilaricidal effects of flubendazole on adult female Brugia malayi using RNAseq

    Directory of Open Access Journals (Sweden)

    Maeghan O'Neill

    2016-12-01

    Full Text Available The use of microfilaricidal drugs for the control of onchocerciasis and lymphatic filariasis (LF necessitates prolonged yearly dosing. Prospects for elimination or eradication of these diseases would be enhanced by the availability of a macrofilaricidal drug. Flubendazole (FLBZ, a benzimidazole anthelmintic, is an appealing candidate. FLBZ has demonstrated potent macrofilaricidal effects in a number of experimental rodent models and in one human trial. Unfortunately, FLBZ was deemed unsatisfactory for use in mass drug administration campaigns due to its limited oral bioavailability. A new formulation that enables sufficient bioavailability following oral administration could render FLBZ an effective treatment for onchocerciasis and LF. Identification of drug-derived effects is important in ascertaining a dosage regimen which is predicted to be lethal to the parasite in situ. In previous histological studies, exposure to FLBZ induced damage to tissues required for reproduction and survival at pharmacologically relevant concentrations. However, more precise and quantitative indices of drug effects are needed. This study assessed drug effects using a transcriptomic approach to confirm effects observed histologically and to identify genes which were differentially expressed in treated adult female Brugia malayi. Comparative analysis across different concentrations (1 μM and 5 μM and durations (48 and 120 h provided an overview of the processes which are affected by FLBZ exposure. Genes with dysregulated expression were consistent with the reproductive effects observed via histology in our previous studies. This study revealed transcriptional changes in genes involved in embryo development. Additionally, significant downregulation was observed in genes encoding cuticle components, which may reflect changes in developing embryos, the adult worm cuticle or both. These data support the hypothesis that FLBZ acts predominantly on rapidly dividing

  20. The n-hexane and chloroform fractions of Piper betle L. trigger different arms of immune responses in BALB/c mice and exhibit antifilarial activity against human lymphatic filarid Brugia malayi.

    Science.gov (United States)

    Singh, Meghna; Shakya, Shilpy; Soni, Vishal Kumar; Dangi, Anil; Kumar, Nikhil; Bhattacharya, Shailja-Misra

    2009-06-01

    Modulation of immune functions by using herbal plants and their products has become fundamental regime of therapeutic approach. Piper betle Linn. (Piperaceae) is a widely distributed plant in the tropical and subtropical regions of the world and has been attributed as traditional herbal remedy for many diseases. We have recently reported the antifilarial and antileishmanial efficacy in the leaf extract of Bangla Mahoba landrace of P. betle which is a female plant. The present report describes the in vivo immunomodulatory efficacy of the crude methanolic extract and its n-hexane, chloroform, n-butanol fractions of the female plant at various dose levels ranging between 0.3 and 500 mg/kg in BALB/c. Attempts were also made to observe antifilarial activity of the active extracts and correlate it with the antigen specific immune responses in another rodent Mastomys coucha infected with human lymphatic filarial parasite Brugia malayi. The crude methanol extract and n-hexane fraction were found to potentiate significant (p<0.001) enhancement of both humoral (plaque forming cells, hemagglutination titre) as well as cell-mediated (lymphoproliferation, macrophage activation, delayed type hypersensitivity) immune responses in mice. The flow cytometric analysis of splenocytes of treated mice indicated enhanced population of T-cells (CD4(+), CD8(+)) and B-cells (CD19(+)). The n-hexane fraction (3 mg/kg) was found to induce biased type 2 cytokine response as revealed by increased IL-4(+) and decreased IFN-gamma(+) T-cell population while the chloroform fraction (10 mg/kg) produced a predominant type 1 cytokines. Crude methanolic extract (100 mg/kg) demonstrated a mixed type 1 and type 2 cytokine responses thus suggesting a remarkable immunomodulatory property in this plant. The induction of differential T-helper cell immune response appears ideal to overcome immunosuppression as observed in case of lymphatic, filarial Brugia malayi infection which may also be extended to other

  1. A reverse transcriptase-PCR assay for detecting filarial infective larvae in mosquitoes.

    Directory of Open Access Journals (Sweden)

    Sandra J Laney

    2008-06-01

    Full Text Available Existing molecular assays for filarial parasite DNA in mosquitoes cannot distinguish between infected mosquitoes that contain any stage of the parasite and infective mosquitoes that harbor third stage larvae (L3 capable of establishing new infections in humans. We now report development of a molecular L3-detection assay for Brugia malayi in vectors based on RT-PCR detection of an L3-activated gene transcript.Candidate genes identified by bioinformatics analysis of EST datasets across the B. malayi life cycle were initially screened by PCR using cDNA libraries as templates. Stage-specificity was confirmed using RNA isolated from infected mosquitoes. Mosquitoes were collected daily for 14 days after feeding on microfilaremic cat blood. RT-PCR was performed with primer sets that were specific for individual candidate genes. Many promising candidates with strong expression in the L3 stage were excluded because of low-level transcription in less mature larvae. One transcript (TC8100, which encodes a particular form of collagen was only detected in mosquitoes that contained L3 larvae. This assay detects a single L3 in a pool of 25 mosquitoes.This L3-activated gene transcript, combined with a control transcript (tph-1, accession # U80971 that is constitutively expressed by all vector-stage filarial larvae, can be used to detect filarial infectivity in pools of mosquito vectors. This general approach (detection of stage-specific gene transcripts from eukaryotic pathogens may also be useful for detecting infective stages of other vector-borne parasites.

  2. Recombinant Brugia malayi pepsin inhibitor (rBm33) exploits host signaling events to regulate inflammatory responses associated with lymphatic filarial infections.

    Science.gov (United States)

    Sreenivas, Kirthika; Kalyanaraman, Haripriya; Babu, Subash; Narayanan, Rangarajan Badri

    2017-11-01

    Prolonged existence of filarial parasites and their molecules within the host modulate the host immune system to instigate their survival and induce inflammatory responses that contribute to disease progression. Recombinant Brugia malayi pepsin inhibitor (rBm33) modulates the host immune responses by skewing towards Th1 responses characterized by secretion of inflammatory molecules such as TNF-α, IL-6, nitric oxide (NO). Here we also specified the molecular signaling events triggered by rBm33 in peripheral blood mononuclear cells (PBMCs) of filarial endemic normals (EN). rBm33 predominantly enhanced the levels of nitric oxide in cultured PBMCs but did not result in oxidative stress to the host cells. Further, rBm33 treatment of human PBMCs resulted in higher GSH/GSSG levels. MYD88 dependent activation was found to be associated with rBm33 specific inflammatory cytokine production. rBm33 triggered intracellular signaling events also involved JNK activation in host PBMCs. In addition, c-Fos and not NF-κB was identified as the transcription factor regulating the expression of inflammatory cytokines in rBm33 stimulated PBMCs. rBm33 marked its role in filarial pathology by altered levels of growth factors but did not have a significant impact on matrix metalloproteinases (MMPs), tissue inhibitors of matrix metalloproteinases (TIMPs) activity of host PBMCs. Thus, the study outlines the signaling network of rBm33 induced inflammatory responses within the host immune cells. Copyright © 2017 Elsevier Ltd. All rights reserved.

  3. Poly(d,l)-lactide-co-glycolide (PLGA) microspheres as immunoadjuvant for Brugia malayi antigens.

    Science.gov (United States)

    Saini, Vinay; Verma, Shiv Kumar; Murthy, P Kalpana; Kohli, Dharmveer

    2013-08-28

    Recently we identified in Brugia malayi adult worm extract (BmA) a pro-inflammatory 54-68kDa SDS-PAGE resolved fraction F6 that protects the host from the parasite via Th1/Th2 type responses. We are currently investigating F6 as a potential source of vaccine candidate(s) and the present study is aimed at investigating the suitability of poly(d,l)-lactide-co-glycolide microspheres (PLGA-Ms) as immunoadjuvant for the antigen administration in a single dose. PLGA-Ms were prepared aseptically by a modified double emulsion (w/o/w) solvent evaporation technique and their size, shape, antigen adsorption efficiency, in-process stability, and antigen release were characterized. Swiss mice were immunized by a single subcutaneous administration of BmA and F6 adsorbed on PLGA-Ms (lactide:glycolide ratios 50:50 and 75:25) and the immune responses were compared with administration of 1 or 2 doses of plain BmA and F6. Specific IgG, IgG1, IgG2a, IgG2b, IgE levels in serum, cellular-proliferative response and release of IFN-γ, TNF-α and nitric oxide from the cells of immunized host in response to the antigens/LPS/Con A challenge and antibody-dependant cellular cytotoxicity (ADCC) to parasite life stages were determined. The average size of PLGA-Ms 50:50 was smaller than the size of PLGA-Ms 75:25 and the % antigen adsorption efficiency of PLGA-Ms 50:50 was greater than PLGA-Ms 75:25. Single shot injection of PLGA-Ms 50:50/75:25-BmA/F6 produced better and stronger IgG, IgG1/IgG2a and cell-mediated immune responses than even two injections of plain BmA or F6. Further, PLGA-Ms 50:50-F6 produced stronger responses than PLGA-Ms 50:50-BmA. Anti-PLGA-Ms 50:50-F6 antibodies elicited higher ADCC response to infective larval and microfilarial stages of the parasite than anti-PLGA-Ms 75:25-F6 antibodies. The findings demonstrate that PLGA-Ms 50:50 is an excellent adjuvant for use with F6 in a single administration. This is the first ever report on PLGA as immunoadjuvant for filarial antigens

  4. Cytokine production in BALB/c mice immunized with radiation attenuated third stage larvae of the filarial nematode, Brugia pahangi

    International Nuclear Information System (INIS)

    Bancroft, A.J.; Devaney, E.; Grencis, R.K.; Else, K.J.

    1993-01-01

    BALB/c mice immunized with radiation-attenuated third stage larvae of the filarial nematode Brugia pahangi are strongly immune to challenge infection. Investigation of the profile of cytokines secreted by spleen cells from immune mice stimulated in vitro with either parasite Ag or with Con A revealed high levels of IL-5 and IL-9 and moderate levels of IL-4. In contrast, secretion of IFN-γ by spleen cells from immune animals was negligible. Spleen cells from control mice secreted low levels of all cytokines assayed. Levels of parasite-specific IgE were significantly elevated in immune animals and a peripheral blood eosinophilia was observed, which exhibited a biphasic distribution. Our results are consistent with the preferential expansion of Th2 cells in immune animals and provide the basis for dissecting the means by which radiation-attenuated larvae of filarial nematodes stimulate immunity. 5l refs., 3 figs., 3 tabs

  5. A PRELIMINARY STUDY OF MALAYAN FILARIASIS IN PUDING VILLAGE, JAMBI PROVINCE (SUMATERA, INDONESIA

    Directory of Open Access Journals (Sweden)

    Sudomo M.

    2012-09-01

    Full Text Available Beberapa daerah di Propinsi Jambi akan dikembangkan menjadi daerah transmigrasi, satu di antara­nya adalah daerah Kumpeh yang terletak berdekatan dengan daerah endemik filariasis malayi. Desa yang paling dekat dengan lokasi transmigrasi tersebut adalah desa Puding. Penelitian pendahuluan tentang penyakit filariasis telah dikerjakan di desa Puding untuk mengetahui tingkat endemisitas, periodisitas B. malayi, fauna nyamuk, jenis nyamuk yang potensial menjadi vektor filariasis, hospes reservoir dan keadaan sosial-ekonomi-budaya penduduk setempat. Mf rate pada penduduk desa Puding adalah 18,7% dan dari B. malayi jenis subperiodiknokturna. Nyamuk yang tertangkap terdiri dari enam genera yaitu genus Anopheles, Aedes, Culex, Coquilletidia, Mansonia dan Tripteroides. Dari enam genera tersebut yang potensial untuk menjadi vektor filariasis adalah genus Mansonia dan ini didukung dengan diketemukannyd larva stadium L3 (infektif Brugia sp di tubuh nyamuk tersebut. Keadaan sosial-ekonomi-budaya, khususnya menyangkut adat istiadat dan kebiasaan penduduk setempat, telah dipelajari.

  6. ORF Alignment: NC_006833 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available TRS of Brugia malayi] ... Length = 188 ... Query: 439 HPLGFARCQVYNTYIIAEARGK...LIIVDQHAAHERLVYECLKQKSSIKRQKLLLSEVVEIK 498 ... HPLGFARCQVYNTYIIAEARGKLIIVDQHAAHERLVYECLKQKSSIKRQKLLLSEVVEIK Sbjct: 1 ... HPLGFAR

  7. Diagnosis of brugian filariasis by loop-mediated isothermal amplification.

    Directory of Open Access Journals (Sweden)

    Catherine B Poole

    Full Text Available In this study we developed and evaluated a Brugia Hha I repeat loop-mediated isothermal amplification (LAMP assay for the rapid detection of Brugia genomic DNA. Amplification was detected using turbidity or fluorescence as readouts. Reactions generated a turbidity threshold value or a clear visual positive within 30 minutes using purified genomic DNA equivalent to one microfilaria. Similar results were obtained using DNA isolated from blood samples containing B. malayi microfilariae. Amplification was specific to B. malayi and B. timori, as no turbidity was observed using DNA from the related filarial parasites Wuchereria bancrofti, Onchocerca volvulus or Dirofilaria immitis, or from human or mosquito. Furthermore, the assay was most robust using a new strand-displacing DNA polymerase termed Bst 2.0 compared to wild-type Bst DNA polymerase, large fragment. The results indicate that the Brugia Hha I repeat LAMP assay is rapid, sensitive and Brugia-specific with the potential to be developed further as a field tool for diagnosis and mapping of brugian filariasis.

  8. Brugia malayi Antigen (BmA Inhibits HIV-1 Trans-Infection but Neither BmA nor ES-62 Alter HIV-1 Infectivity of DC Induced CD4+ Th-Cells.

    Directory of Open Access Journals (Sweden)

    Emily E I M Mouser

    Full Text Available One of the hallmarks of HIV-1 disease is the association of heightened CD4+ T-cell activation with HIV-1 replication. Parasitic helminths including filarial nematodes have evolved numerous and complex mechanisms to skew, dampen and evade human immune responses suggesting that HIV-1 infection may be modulated in co-infected individuals. Here we studied the effects of two filarial nematode products, adult worm antigen from Brugia malayi (BmA and excretory-secretory product 62 (ES-62 from Acanthocheilonema viteae on HIV-1 infection in vitro. Neither BmA nor ES-62 influenced HIV-1 replication in CD4+ enriched T-cells, with either a CCR5- or CXCR4-using virus. BmA, but not ES-62, had the capacity to bind the C-type lectin dendritic cell-specific intercellular adhesion molecule-3-grabbing non-integrin (DC-SIGN thereby inhibiting HIV-1 trans-infection of CD4+ enriched T-cells. As for their effect on DCs, neither BmA nor ES-62 could enhance or inhibit DC maturation as determined by CD83, CD86 and HLA-DR expression, or the production of IL-6, IL-10, IL-12 and TNF-α. As expected, due to the unaltered DC phenotype, no differences were found in CD4+ T helper (Th cell phenotypes induced by DCs treated with either BmA or ES-62. Moreover, the HIV-1 susceptibility of the Th-cell populations induced by BmA or ES-62 exposed DCs was unaffected for both CCR5- and CXCR4-using HIV-1 viruses. In conclusion, although BmA has the potential capacity to interfere with HIV-1 transmission or initial viral dissemination through preventing the virus from interacting with DCs, no differences in the Th-cell polarizing capacity of DCs exposed to BmA or ES-62 were observed. Neither antigenic source demonstrated beneficial or detrimental effects on the HIV-1 susceptibility of CD4+ Th-cells induced by exposed DCs.

  9. ASPEK ZOONOTIK PARASIT NEMATODA PADA KERA DAN BINATANG MENGERAT DI BENGKULU, SUMATERA. INDONESIA

    Directory of Open Access Journals (Sweden)

    Untung S.

    2012-09-01

    Full Text Available Twentyfive monkeys and 481 rats were examined for parasitic nematodes in Bengkulu, nine species of nematode were found infecting these animals. Five of filarían nematodes, i.e. Brugia malayi, Brugia pahangi, Dirofilaria magnilarvatum and Edesonfilaria malayensis were infecting monkeys and one speciesTBreinlia booliati, was found infecting rats. Three species of gastrointestinal helminths, i.e. Trichuris trichiura, Enterobius vermicularis and Oestophagomomum spp were found in monkeys; a lung worm, Angiostrongylus cantonensis, was found in rats. The most important nematode species is B. malayi, which was found in Presbytis cristatus (36.8 % and in Macaca fascicularis (20.0 %. T. trichiura was found in R. cristatus (47.9 % and A. cantonensis in Rattus argentiventer (4.0 % and Rattus tiomanicus (2.9%.

  10. Repurposing auranofin as a lead candidate for treatment of lymphatic filariasis and onchocerciasis.

    Directory of Open Access Journals (Sweden)

    Christina A Bulman

    2015-02-01

    Full Text Available Two major human diseases caused by filariid nematodes are onchocerciasis, or river blindness, and lymphatic filariasis, which can lead to elephantiasis. The drugs ivermectin, diethylcarbamazine (DEC, and albendazole are used in control programs for these diseases, but are mainly effective against the microfilarial stage and have minimal or no effect on adult worms. Adult Onchocerca volvulus and Brugia malayi worms (macrofilariae can live for up to 15 years, reproducing and allowing the infection to persist in a population. Therefore, to support control or elimination of these two diseases, effective macrofilaricidal drugs are necessary, in addition to current drugs. In an effort to identify macrofilaricidal drugs, we screened an FDA-approved library with adult worms of Brugia spp. and Onchocerca ochengi, third-stage larvae (L3s of Onchocerca volvulus, and the microfilariae of both O. ochengi and Loa loa. We found that auranofin, a gold-containing drug used for rheumatoid arthritis, was effective in vitro in killing both Brugia spp. and O. ochengi adult worms and in inhibiting the molting of L3s of O. volvulus with IC50 values in the low micromolar to nanomolar range. Auranofin had an approximately 43-fold higher IC50 against the microfilariae of L. loa compared with the IC50 for adult female O. ochengi, which may be beneficial if used in areas where Onchocerca and Brugia are co-endemic with L. loa, to prevent severe adverse reactions to the drug-induced death of L. loa microfilariae. Further testing indicated that auranofin is also effective in reducing Brugia adult worm burden in infected gerbils and that auranofin may be targeting the thioredoxin reductase in this nematode.

  11. SURVEI DARAH JARI FILARIASIS DI DESA BATUMARTA X KEC. MADANG SUKU III KABUPATEN OGAN KOMERING ULU (OKU TIMUR, SUMATERA SELATAN TAHUN 2012

    Directory of Open Access Journals (Sweden)

    R. Irpan Pahlepi

    2015-01-01

    Full Text Available AbstrakFilariasis atau penyakit kaki gajah adalah golongan penyakit menular yang disebabkan oleh cacing filaria  yang  ditularkan  melalui  berbagai  jenis  nyamuk.  Penyebaran  filariasis  hampir  meliputi  seluruh wilayah di Indonesia termasuk Kabupaten Ogan Komering Ulu (OKU Timur. Angka kesakitan filarisis di Kabupaten OKU Timur tahun 2007 sebesar 1,05%. Kegiatan pengobatan massal di Kabupaten OKU Timur belum pernah dilakukan sampai saat ini, sehingga perlu dilakukan penelitian yang bertujuan untuk mengetahui tingkat penyebaran penyakit filariasis. Penelitian ini merupakan penelitian survei dengan desain potong lintang. Pengambilan dan pemeriksaan sediaan darah jari dilakukan pada malam hari dimulai pukul 19.00 WIB. Jumlah penduduk yang diperiksa sebanyak 502. Hasil pemeriksaan diperoleh 4 orang positif mikrofilaria (Mf_ rate 0,8% dengan spesies Brugia  malayi  dan  kepadatan  rata-rata  200mf/ml.  Seluruh  kasus  yang  ditemukan  merupakan  kasus baru. Hasil penelitian ini menunjukkan bahwa penularan filariasis masih terjadi di Kabupaten OKU Timur sehingga perlu adanya pengobatan massal untuk mencegah penularan lebih lanjut.Kata kunci : Filariasis, Brugia malayi, Survei darah jari, OKU TimurAbstractFilariasis or elephantiasis is an infectious diseases caused by filarial worms that transmitted by various species of mosquitoes. Filariasis distributions almost covers all districts in Indonesia including East Ogan Komering Ulu (OKU. Filarisais morbidity in East OKU regency in 2007 was 1.05 %. Mass treatment in the district of East OKU have not been done yet, so it is necessary to do a research that aim to determine the prevalen of filariasis. This study is a cross-sectional survey design. Collection and examination of finger’s blood was done at night starting at 19:00. Number of people examined were 502. Examination results obtained 4 positive microfilariae (Mf_ rate 0.8 % of Brugia malayi and the average density of 200

  12. Primary structure of and immunoglobulin E response to the repeat subunit of gp15/400 from human lymphatic filarial parasites

    NARCIS (Netherlands)

    Paxton, W. A.; Yazdanbakhsh, M.; Kurniawan, A.; Partono, F.; Maizels, R. M.; Selkirk, M. E.

    1993-01-01

    We have isolated and sequenced clones encoding the repeated subunit of the surface-associated glycoprotein gp15/400 from the two nematode species predominantly responsible for lymphatic filariasis in humans: Brugia malayi and Wuchereria bancrofti. The amino acid sequence of the 15-kDa subunit,

  13. Differential expression of IgE and IgG4 specific antibody responses in asymptomatic and chronic human filariasis

    NARCIS (Netherlands)

    Kurniawan, A.; Yazdanbakhsh, M.; van Ree, R.; Aalberse, R.; Selkirk, M. E.; Partono, F.; Maizels, R. M.

    1993-01-01

    A population of 164 adult individuals resident in an area endemic for Brugia malayi lymphatic filariasis has been studied for humoral immune responses to filarial parasites. Antibody levels to Ag extracted from adult worms were determined for each of the IgG subclasses, for IgM and for IgE. The

  14. Identification of antigenic proteins of setaria cervi by immunoblotting technique

    International Nuclear Information System (INIS)

    Kaushal, N.A.; Kaushal, D.C.; Ghatak, S.

    1987-01-01

    Identification and characterization of antigenic proteins of Setaria cervi (bovine filarial parasite) adults and microfilariae was done by immunoblotting technique using hyperimmune rabbit sera against S. cervi and Brugia malayi. The antigens recognized by these sera were detected by using 125 I protein-A followed by autoradiography. Fifteen different antigens were observed to be common between adult and microfilarial stages of the parasite. Some stage specific antigens were also identified. Many antigens of S. cervi adults and microfilariae were also recognized by rabbit anti-B.malayi serum showing the existence of common antigenic determinants between the bovine and human filarial parasites

  15. Screening of the ‘Open Scaffolds’ collection from Compounds Australia identifies a new chemical entity with anthelmintic activities against different developmental stages of the barber's pole worm and other parasitic nematodes

    Directory of Open Access Journals (Sweden)

    Sarah Preston

    2017-12-01

    Full Text Available The discovery and development of novel anthelmintic classes is essential to sustain the control of socioeconomically important parasitic worms of humans and animals. With the aim of offering novel, lead-like scaffolds for drug discovery, Compounds Australia released the ‘Open Scaffolds’ collection containing 33,999 compounds, with extensive information available on the physicochemical properties of these chemicals. In the present study, we screened 14,464 prioritised compounds from the ‘Open Scaffolds’ collection against the exsheathed third-stage larvae (xL3s of Haemonchus contortus using recently developed whole-organism screening assays. We identified a hit compound, called SN00797439, which was shown to reproducibly reduce xL3 motility by ≥ 70%; this compound induced a characteristic, “coiled” xL3 phenotype (IC50 = 3.46–5.93 μM, inhibited motility of fourth-stage larvae (L4s; IC50 = 0.31–12.5 μM and caused considerable cuticular damage to L4s in vitro. When tested on other parasitic nematodes in vitro, SN00797439 was shown to inhibit (IC50 = 3–50 μM adults of Ancylostoma ceylanicum (hookworm and first-stage larvae of Trichuris muris (whipworm and eventually kill (>90% these stages. Furthermore, this compound completely inhibited the motility of female and male adults of Brugia malayi (50–100 μM as well as microfilariae of both B. malayi and Dirofilaria immitis (heartworm. Overall, these results show that SN00797439 acts against genetically (evolutionarily distant parasitic nematodes i.e. H. contortus and A. ceylanicum [strongyloids] vs. B. malayi and D. immitis [filarioids] vs. T. muris [enoplid], and, thus, might offer a novel, lead-like scaffold for the development of a relatively broad-spectrum anthelmintic. Our future work will focus on assessing the activity of SN00797439 against other pathogens that cause neglected tropical diseases, optimising analogs with improved biological activities and

  16. Development of lymphatic filarial parasite Wuchereria bancrofti (Spirurida: Onchocercidae) in mosquito species (Diptera: Culicidae) fed artificially on microfilaremic blood.

    Science.gov (United States)

    Paily, K P; Hoti, S L; Balaraman, K

    2006-11-01

    The efficiency of laboratory colonies of mosquitoes such as Anopheles stephensi Liston, Aedes aegypti (L.) Liverpool strain, Ae. aegypti wild type, Aedes albopictus (Skuse), Culex tritaeniorhynchus Giles, Culex sitiens Wiedemann, and Armigeres subalbatus Coquillett in supporting the development of Wuchereria bancrofti (Cobbold) (Spirurida: Onchocercidae) microfilariae to infective larvae was investigated. The mosquitoes were fed on heparinized microfilaremic human blood by using a membrane-feeding unit with Parafilm as membrane. The rate of infection, parasite development, and parasite burden were compared with that in the known vector mosquito Culex quinquefasciatus Say. Cx. quinquefasciatus showed the highest percentage of infection, followed by Ae. aegypti Liverpool strain and An. stephensi. The rate of development of the parasite was more or less similar in all the three species, and infective larvae were found on day 13. When the larvae were harvested on day 17, Cx. quinquefasciatus yielded the highest numbers, followed by Ae. aegypti Liverpool strain and An. stephensi. The percentage of infection was low, and the development was slow in Cx. tritaeniorhynchus compared with the other susceptible species. The parasite developed to second-stage larvae only by day 22 and to infective larvae by day 28. When 2-wk-old Cx. tritaeniorhynchus were fed on microfilaremic blood, they could develop the parasite to infective larvae by day 13 postfeeding. All other species of mosquitoes tested were found to be refractory to parasite development. It is shown that Cx. quinquefasciatus is the most suitable mosquito host for the production of infective larvae. However, Ae. aegypti Liverpool strain, which is commonly used for Brugia malayi filarial parasite, also can be used for generation of W. bancrofti infective larvae to circumvent the problem of maintaining two mosquito species.

  17. STUDI ENDEMISITAS FILARIASIS DI WILAYAH KECAMATAN PEMAYUNG, KABUPATEN BATANGHARI PASCA PENGOBATAN MASSAL TAHAP III

    Directory of Open Access Journals (Sweden)

    Yahya Yahya

    2013-05-01

    Full Text Available Abstract Filariasis endemicity research in District Pemayung, Batanghari Regency Post-Mass Drug Administration Phase III has been implemented. The study aims to determine the prevalence of filariasis, microfilaria worm species, the periodicity, reservoir determination and evaluate the results of mass treatment activities that have been 3 times. The number of people who checked their blood preparation for the examination as many as 538. Blood sampling for the periodicity of the parasite examinations performed on 4 persons, each carried out blood sampling every 2 hours for 24 hours. People microfilariae with microfilariae positive number as many as 8 people to rate microfilariae (Mf rate 1.5%.. The highest parasite density of 17.493 per 20 cu mm of blood occurred at 1:00 am and decresing to 0,415 per 20 cu mm of blood at 07.00 am. The parasite was found in sub periodic nokturna 3 subjects and 1 subject was found only be found in the morning and afternoon. The results of examination of 12 cats and two monkeys were found two positive cats with Brugia malayi microfilariae. Cats that were examined and the positive was one house cat and one stray cat. The conclusion from this study showed that filariasis was still endemic with periodicity of microfilariae was sub periodic nokturna and was zoonotic. Recommendations of this study was that mass treatment  was done by giving the drug directly and took medicine in front of the officers, examination and treatment of microfilariae positive cats. Key words: microfilariae rate, periodicity, Brugia malayi, reservoir. Abstrak  Submit : 28-03-2012  Review : 04-04-2012 Review : 11-06-2012 revisi : 29–08-2012Penelitian untuk menentukan tingkat endemisitas filariasis di wilayah Kecamatan Pemayung, Kabupaten Batanghari Pasca Pengobatan Massal Tahap III telah dilaksanakan. Penelitian bertujuan untuk mengetahui prevalensi filariasis, mengetahui spesies cacing mikrofilaria, periodisitas mikrofilaria dan pemeriksaan

  18. Filarial worms reduce Plasmodium infectivity in mosquitoes.

    Directory of Open Access Journals (Sweden)

    Matthew T Aliota

    2011-02-01

    Full Text Available Co-occurrence of malaria and filarial worm parasites has been reported, but little is known about the interaction between filarial worm and malaria parasites with the same Anopheles vector. Herein, we present data evaluating the interaction between Wuchereria bancrofti and Anopheles punctulatus in Papua New Guinea (PNG. Our field studies in PNG demonstrated that An. punctulatus utilizes the melanization immune response as a natural mechanism of filarial worm resistance against invading W. bancrofti microfilariae. We then conducted laboratory studies utilizing the mosquitoes Armigeres subalbatus and Aedes aegypti and the parasites Brugia malayi, Brugia pahangi, Dirofilaria immitis, and Plasmodium gallinaceum to evaluate the hypothesis that immune activation and/or development by filarial worms negatively impact Plasmodium development in co-infected mosquitoes. Ar. subalbatus used in this study are natural vectors of P. gallinaceum and B. pahangi and they are naturally refractory to B. malayi (melanization-based refractoriness.Mosquitoes were dissected and Plasmodium development was analyzed six days after blood feeding on either P. gallinaceum alone or after taking a bloodmeal containing both P. gallinaceum and B. malayi or a bloodmeal containing both P. gallinaceum and B. pahangi. There was a significant reduction in the prevalence and mean intensity of Plasmodium infections in two species of mosquito that had dual infections as compared to those mosquitoes that were infected with Plasmodium alone, and was independent of whether the mosquito had a melanization immune response to the filarial worm or not. However, there was no reduction in Plasmodium development when filarial worms were present in the bloodmeal (D. immitis but midgut penetration was absent, suggesting that factors associated with penetration of the midgut by filarial worms likely are responsible for the observed reduction in malaria parasite infections.These results could have an

  19. Targeting the Wolbachia cell division protein FtsZ as a new approach for antifilarial therapy.

    Directory of Open Access Journals (Sweden)

    Zhiru Li

    2011-11-01

    Full Text Available The use of antibiotics targeting the obligate bacterial endosymbiont Wolbachia of filarial parasites has been validated as an approach for controlling filarial infection in animals and humans. Availability of genomic sequences for the Wolbachia (wBm present in the human filarial parasite Brugia malayi has enabled genome-wide searching for new potential drug targets. In the present study, we investigated the cell division machinery of wBm and determined that it possesses the essential cell division gene ftsZ which was expressed in all developmental stages of B. malayi examined. FtsZ is a GTPase thereby making the protein an attractive Wolbachia drug target. We described the molecular characterization and catalytic properties of Wolbachia FtsZ. We also demonstrated that the GTPase activity was inhibited by the natural product, berberine, and small molecule inhibitors identified from a high-throughput screen. Furthermore, berberine was also effective in reducing motility and reproduction in B. malayi parasites in vitro. Our results should facilitate the discovery of selective inhibitors of FtsZ as a novel anti-symbiotic approach for controlling filarial infection. NOTE: The nucleotide sequences reported in this paper are available in GenBank™ Data Bank under the accession number wAlB-FtsZ (JN616286.

  20. Utilization of computer processed high definition video imaging for measuring motility of microscopic nematode stages on a quantitative scale: "The Worminator".

    Science.gov (United States)

    Storey, Bob; Marcellino, Chris; Miller, Melissa; Maclean, Mary; Mostafa, Eman; Howell, Sue; Sakanari, Judy; Wolstenholme, Adrian; Kaplan, Ray

    2014-12-01

    A major hindrance to evaluating nematode populations for anthelmintic resistance, as well as for screening existing drugs, new compounds, or bioactive plant extracts for anthelmintic properties, is the lack of an efficient, objective, and reproducible in vitro assay that is adaptable to multiple life stages and parasite genera. To address this need we have developed the "Worminator" system, which objectively and quantitatively measures the motility of microscopic stages of parasitic nematodes. The system is built around the computer application "WormAssay", developed at the Center for Discovery and Innovation in Parasitic Diseases at the University of California, San Francisco. WormAssay was designed to assess motility of macroscopic parasites for the purpose of high throughput screening of potential anthelmintic compounds, utilizing high definition video as an input to assess motion of adult stage (macroscopic) parasites (e.g. Brugia malayi). We adapted this assay for use with microscopic parasites by modifying the software to support a full frame analysis mode that applies the motion algorithm to the entire video frame. Thus, the motility of all parasites in a given well are recorded and measured simultaneously. Assays performed on third-stage larvae (L3) of the bovine intestinal nematode Cooperia spp., as well as microfilariae (mf) of the filarioid nematodes B. malayi and Dirofilaria immitis, yielded reproducible dose responses using the macrocyclic lactones ivermectin, doramectin, and moxidectin, as well as the nicotinic agonists, pyrantel, oxantel, morantel, and tribendimidine. This new computer based-assay is simple to use, requires minimal new investment in equipment, is robust across nematode genera and developmental stage, and does not require subjective scoring of motility by an observer. Thus, the "Worminator" provides a relatively low-cost platform for developing genera- and stage-specific assays with high efficiency and reproducibility, low labor input

  1. Lymphatic filarial species differentiation using evolutionarily modified tandem repeats: generation of new genetic markers.

    Science.gov (United States)

    Sakthidevi, Moorthy; Murugan, Vadivel; Hoti, Sugeerappa Laxmanappa; Kaliraj, Perumal

    2010-05-01

    Polymerase chain reaction based methods are promising tools for the monitoring and evaluation of the Global Program for the Elimination of Lymphatic Filariasis. The currently available PCR methods do not differentiate the DNA of Wuchereria bancrofti or Brugia malayi by a single PCR and hence are cumbersome. Therefore, we designed a single step PCR strategy for differentiating Bancroftian infection from Brugian infection based on a newly identified gene from the W. bancrofti genome, abundant larval transcript-2 (alt-2), which is abundantly expressed. The difference in PCR product sizes generated from the presence or absence of evolutionarily altered tandem repeats in alt-2 intron-3 differentiated W. bancrofti from B. malayi. The analysis was performed on the genomic DNA of microfilariae from a number of patient blood samples or microfilariae positive slides from different Indian geographical regions. The assay gave consistent results, differentiating the two filarial parasite species accurately. This alt-2 intron-3 based PCR assay can be a potential tool for the diagnosis and differentiation of co-infections by lymphatic filarial parasites. Copyright (c) 2010 Elsevier B.V. All rights reserved.

  2. Brugia timori INFECTION IN LEKEBAI, FLORES: clinical aspects

    Directory of Open Access Journals (Sweden)

    Arbain Joesoef

    2012-09-01

    Full Text Available Pengamatan filariasis pada penduduk Nualolo-Lekebai, Pulau Flores telah dilakukan pada bulan Februari 1975. Kampung Nualolo-Lekebai berpenduduk 680 jiwa, pekerjaan bertani dan menganut agama Nasrani. Kebiasaan hidup di antara penduduk di daerah ini adalah menyerahkan pelaksanaan pekerjaan berat pada kaum wanita, baik di rumah ataupun di kebun. Dalam perjalanan jauh baik ke kebun atau ke pasar, kaum wanitanya selalu berjalan kaki sedangkan kaum prianya menunggang kuda. Sejumlah 80% dari penduduk kampung ini telah diperiksa terhadap infeksi parasit filaria dan terhadap gejala filariasis. Dari hasil yang ditemukan ternyata penduduk kampung ini menderita infeksi Brugia timori dengan angka derajat infeksi sebesar 7.0% dan angka derajat elephantiasis sebesar 10.3%. Hal yang menarik yang ditemukan dalam pengamatan ini adalah tingginya angka derajat elephantiasis pada kaum wanita dibandingkan dengan pada kaum pria. Fenomena ini mungkin disebabkan oleh kebiasaan hidup kaum wanita di daerah ini sehari-hari yang bekerja lebih berat dan berjalan kaki lebih sering dan lebih jauh dibandingkan kaum prianya.

  3. Morphological and molecular characteristics of Malayfilaria sofiani Uni, Mat Udin & Takaoka n. g., n. sp. (Nematoda: Filarioidea) from the common treeshrew Tupaia glis Diard & Duvaucel (Mammalia: Scandentia) in Peninsular Malaysia.

    Science.gov (United States)

    Uni, Shigehiko; Mat Udin, Ahmad Syihan; Agatsuma, Takeshi; Saijuntha, Weerachai; Junker, Kerstin; Ramli, Rosli; Omar, Hasmahzaiti; Lim, Yvonne Ai-Lian; Sivanandam, Sinnadurai; Lefoulon, Emilie; Martin, Coralie; Belabut, Daicus Martin; Kasim, Saharul; Abdullah Halim, Muhammad Rasul; Zainuri, Nur Afiqah; Bhassu, Subha; Fukuda, Masako; Matsubayashi, Makoto; Harada, Masashi; Low, Van Lun; Chen, Chee Dhang; Suganuma, Narifumi; Hashim, Rosli; Takaoka, Hiroyuki; Azirun, Mohd Sofian

    2017-04-20

    The filarial nematodes Wuchereria bancrofti (Cobbold, 1877), Brugia malayi (Brug, 1927) and B. timori Partono, Purnomo, Dennis, Atmosoedjono, Oemijati & Cross, 1977 cause lymphatic diseases in humans in the tropics, while B. pahangi (Buckley & Edeson, 1956) infects carnivores and causes zoonotic diseases in humans in Malaysia. Wuchereria bancrofti, W. kalimantani Palmieri, Pulnomo, Dennis & Marwoto, 1980 and six out of ten Brugia spp. have been described from Australia, Southeast Asia, Sri Lanka and India. However, the origin and evolution of the species in the Wuchereria-Brugia clade remain unclear. While investigating the diversity of filarial parasites in Malaysia, we discovered an undescribed species in the common treeshrew Tupaia glis Diard & Duvaucel (Mammalia: Scandentia). We examined 81 common treeshrews from 14 areas in nine states and the Federal Territory of Peninsular Malaysia for filarial parasites. Once any filariae that were found had been isolated, we examined their morphological characteristics and determined the partial sequences of their mitochondrial cytochrome c oxidase subunit 1 (cox1) and 12S rRNA genes. Polymerase chain reaction (PCR) products of the internal transcribed spacer 1 (ITS1) region were then cloned into the pGEM-T vector, and the recombinant plasmids were used as templates for sequencing. Malayfilaria sofiani Uni, Mat Udin & Takaoka, n. g., n. sp. is described based on the morphological characteristics of adults and microfilariae found in common treeshrews from Jeram Pasu, Kelantan, Malaysia. The Kimura 2-parameter distance between the cox1 gene sequences of the new species and W. bancrofti was 11.8%. Based on the three gene sequences, the new species forms a monophyletic clade with W. bancrofti and Brugia spp. The adult parasites were found in tissues surrounding the lymph nodes of the neck of common treeshrews. The newly described species appears most closely related to Wuchereria spp. and Brugia spp., but differs from these in

  4. Serine protease inhibitors of parasitic helminths.

    Science.gov (United States)

    Molehin, Adebayo J; Gobert, Geoffrey N; McManus, Donald P

    2012-05-01

    Serine protease inhibitors (serpins) are a superfamily of structurally conserved proteins that inhibit serine proteases and play key physiological roles in numerous biological systems such as blood coagulation, complement activation and inflammation. A number of serpins have now been identified in parasitic helminths with putative involvement in immune regulation and in parasite survival through interference with the host immune response. This review describes the serpins and smapins (small serine protease inhibitors) that have been identified in Ascaris spp., Brugia malayi, Ancylostoma caninum Onchocerca volvulus, Haemonchus contortus, Trichinella spiralis, Trichostrongylus vitrinus, Anisakis simplex, Trichuris suis, Schistosoma spp., Clonorchis sinensis, Paragonimus westermani and Echinococcus spp. and discusses their possible biological functions, including roles in host-parasite interplay and their evolutionary relationships.

  5. Dicty_cDB: Contig-U12802-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available cobacter cetorum strain MIT-0... 38 0.23 AF237484_1( AF237484 |pid:none) Dirofilaria immitis intermed...87 ( O97594 ) RecName: Full=Structural maintenance of chromosomes pro... 36 0.87 U00680_1( U00680 |pid:none) Brugia malayi intermed...1305( CP000879 |pid:none) Petrotoga mobilis SJ95, complet... 38 0.30 (Q9BZF9) RecName: Full=Uveal autoantigen with coiled...ns BAC clone RP11-764E7 from 2, complet... 34 0.79 6 ( FK620261 ) 454GmaGlobSeed354893 Soybean Seed...ditis elegans clone Y71H2X, *** SEQUENCI... 38 4.5 7 ( AC146972 ) Medicago truncatula clone mth2-128d9, compl

  6. Utilization of computer processed high definition video imaging for measuring motility of microscopic nematode stages on a quantitative scale: “The Worminator”

    Directory of Open Access Journals (Sweden)

    Bob Storey

    2014-12-01

    Full Text Available A major hindrance to evaluating nematode populations for anthelmintic resistance, as well as for screening existing drugs, new compounds, or bioactive plant extracts for anthelmintic properties, is the lack of an efficient, objective, and reproducible in vitro assay that is adaptable to multiple life stages and parasite genera. To address this need we have developed the “Worminator” system, which objectively and quantitatively measures the motility of microscopic stages of parasitic nematodes. The system is built around the computer application “WormAssay”, developed at the Center for Discovery and Innovation in Parasitic Diseases at the University of California, San Francisco. WormAssay was designed to assess motility of macroscopic parasites for the purpose of high throughput screening of potential anthelmintic compounds, utilizing high definition video as an input to assess motion of adult stage (macroscopic parasites (e.g. Brugia malayi. We adapted this assay for use with microscopic parasites by modifying the software to support a full frame analysis mode that applies the motion algorithm to the entire video frame. Thus, the motility of all parasites in a given well are recorded and measured simultaneously. Assays performed on third-stage larvae (L3 of the bovine intestinal nematode Cooperia spp., as well as microfilariae (mf of the filarioid nematodes B. malayi and Dirofilaria immitis, yielded reproducible dose responses using the macrocyclic lactones ivermectin, doramectin, and moxidectin, as well as the nicotinic agonists, pyrantel, oxantel, morantel, and tribendimidine. This new computer based-assay is simple to use, requires minimal new investment in equipment, is robust across nematode genera and developmental stage, and does not require subjective scoring of motility by an observer. Thus, the “Worminator” provides a relatively low-cost platform for developing genera- and stage-specific assays with high efficiency and

  7. Cakupan Pemberian Obat Pencegahan Massal Filariasis di Kabupaten Sumba Barat Daya Tahun 2012-2013

    Directory of Open Access Journals (Sweden)

    Zahrotul Habibah

    2016-03-01

    Full Text Available Filariasis merupakan masalah kesehatan masyarakat terutama di Indonesia Timur antara lain di Kabupaten Sumba Barat Daya (SBD. Untuk mengeliminasi filariasis, WHO membuat program PemberianObat Pencegahan Masal (POPM dengan dietilkarbamazin sitrat dan albendazol setiap tahun selama 5tahun berturut-turut. Untuk mengetahui keberhasilan POPM, perlu dilakukan evaluasi cakupan POPM setiaptahun. Tujuan penelitian ini adalah mengetahui cakupan POPM di SBD pada tahun 2012-2013. Penelitanini menggunakan data POPM Dinas Kesehatan SBD pada tahun 2012 dan 2013. Cakupan POPM filariasisdihitung berdasarkan jumlah penduduk minum obat dibagi penduduk total dan jumlah penduduk sasaran.Target cakupan pengobatan penduduk sasaran adalah >85% dan dari penduduk total adalah  > 65%. Hasilpenelitian menunjukkan cakupan POPM filariasis berdasarkan penduduk total pada tahun 2012 adalah 1,96%dan tahun 2013 sebesar 1,13%. Cakupan POPM filariasis berdasarkan penduduk sasaran pada tahun 2012adalah 2,51% dan tahun 2013 adalah 1,35%. Disimpulkan bahwa cakupan POPM filariasis berdasarkanpenduduk sasaran dan penduduk total di SBD sangat rendah dan cakupan tahun 2013 lebih rendahdibandingkan tahun 2012. Kata kunci: W. bancrofti, B.malayi, B.timori, pemberian obat masal pencegahan, Sumba Barat Daya   Coverage of Mass Drugs Administration (MDA for Filariasis inSouth West Sumba on 2012-2013 AbstractFilariasis is a disease caused by Wuchereria bancrofti, Brugia malayi and Brugia timori. It is transmitted by mosquitos. It cause defect in patient’s physical condition, decrease social life, and increase health spending.WHO concepts a program to eliminate filariasis by Massal Drugs Administration (MDA of filariasis. It hasto be evaluated each year in five years by counting the coverage of MDA of filariasis in total population andtargeted population. This research used secondary data from Dinas Kesehatan in SBD to know the coverageof MDA of filariasis in SBD on 2012-2013. The coverage

  8. Plasmodium knowlesi and Wucheriria bancrofti: Their vectors and challenges for the future

    Directory of Open Access Journals (Sweden)

    Indra eVythilingam

    2012-05-01

    Full Text Available Malaria and filariasis still continue to pose public health problems in developing countries of the tropics. Although plans are ongoing for the elimination of both these parasitic vector borne diseases, we are now faced with a daunting challenge as we have a fifth species, Plasmodium knowlesi a simian malaria parasite affecting humans. Similarly in peninsular Malaysia, filariasis was mainly due to Brugia malayi, however, we now see cases of W. bancrofti in immigrant workers coming into the country. Work is on going to eliminate malaria and filariasis from the country. In order to be successful we need to revamp our control measures. Thus this paper attempts to review the vectors of malaria and filariasis in Southeast Asia with special emphasis on P. knowlesi and W. bancrofti and their control strategies.

  9. Polyanhydride Nanoparticle Delivery Platform Dramatically Enhances Killing of Filarial Worms.

    Directory of Open Access Journals (Sweden)

    Andrea M Binnebose

    Full Text Available Filarial diseases represent a significant social and economic burden to over 120 million people worldwide and are caused by endoparasites that require the presence of symbiotic bacteria of the genus Wolbachia for fertility and viability of the host parasite. Targeting Wolbachia for elimination is a therapeutic approach that shows promise in the treatment of onchocerciasis and lymphatic filariasis. Here we demonstrate the use of a biodegradable polyanhydride nanoparticle-based platform for the co-delivery of the antibiotic doxycycline with the antiparasitic drug, ivermectin, to reduce microfilarial burden and rapidly kill adult worms. When doxycycline and ivermectin were co-delivered within polyanhydride nanoparticles, effective killing of adult female Brugia malayi filarial worms was achieved with approximately 4,000-fold reduction in the amount of drug used. Additionally the time to death of the macrofilaria was also significantly reduced (five-fold when the anti-filarial drug cocktail was delivered within polyanhydride nanoparticles. We hypothesize that the mechanism behind this dramatically enhanced killing of the macrofilaria is the ability of the polyanhydride nanoparticles to behave as a Trojan horse and penetrate the cuticle, bypassing excretory pumps of B. malayi, and effectively deliver drug directly to both the worm and Wolbachia at high enough microenvironmental concentrations to cause death. These provocative findings may have significant consequences for the reduction in the amount of drug and the length of treatment required for filarial infections in terms of patient compliance and reduced cost of treatment.

  10. Biology of Paenibacillus larvae, a deadly pathogen of honey bee larvae.

    Science.gov (United States)

    Ebeling, Julia; Knispel, Henriette; Hertlein, Gillian; Fünfhaus, Anne; Genersch, Elke

    2016-09-01

    The gram-positive bacterium Paenibacillus larvae is the etiological agent of American Foulbrood of honey bees, a notifiable disease in many countries. Hence, P. larvae can be considered as an entomopathogen of considerable relevance in veterinary medicine. P. larvae is a highly specialized pathogen with only one established host, the honey bee larva. No other natural environment supporting germination and proliferation of P. larvae is known. Over the last decade, tremendous progress in the understanding of P. larvae and its interactions with honey bee larvae at a molecular level has been made. In this review, we will present the recent highlights and developments in P. larvae research and discuss the impact of some of the findings in a broader context to demonstrate what we can learn from studying "exotic" pathogens.

  11. Feeding for larvae of catfish Pangasionodon sp. larvae in different ages

    Directory of Open Access Journals (Sweden)

    Muhammad Agus Suprayudi

    2015-05-01

    Full Text Available ABSTRACT Sludge worm (Tubifex sp. as natural feed on catfish (Pangasionodon sp. larvae rearing is available in limited amount especially during rainy season. It becomes a constraint factor for larvae rearing sector. This research was conducted to evaluate the appropriate initial age of catfish larvae to get artificial feed as sludge worm replacement. Evaluation was conducted on the growth and survival of catfish larvae in 14 days of culture. There were four treatments of feeding in triplicates i.e. larvae were given natural feed without artificial feed, given artificial feed started from d3, d6, and d9 with three replications. The results showed that larvae fed on artificial feed on d3 had the lowest growth compared to the other treatments, whereas the survival was not significantly different (P>0.05 among the treatments. As a conclusion, artificial feed could be used to replace natural feed for catfish larvae started at the age of nine days. Keywords: sludge worm, catfish larvae, artificial feed  ABSTRAK Cacing sutra (Tubifex sp. tersedia dalam jumlah terbatas terutama pada musim penghujan sebagai pakan alami dalam usaha pembenihan ikan patin (Pangasionodon sp.. Ini menjadi kendala dalam usaha pembenihan. Penelitian ini dilakukan untuk mengevaluasi umur larva ikan patin yang tepat untuk mulai diberi pakan buatan menggantikan cacing sutra. Evaluasi dilakukan pada pertumbuhan dan kelangsungan hidup larva ikan patin umur 14 hari. Selama pemeliharaan, larva diberi pakan dengan empat perlakuan; pemberian pakan alami tanpa pakan buatan, pemberian pakan buatan mulai d3, d6, dan d9 dengan tiga ulangan untuk masing-masing perlakuan. Hasil penelitian menunjukkan bahwa perlakuan pemberian pakan buatan mulai d3 memiliki pertumbuhan panjang yang terkecil dibandingkan perlakuan lain, sedangkan tingkat kelangsungan hidup larva tidak berbeda nyata (P>0,05 antarperlakuan. Berdasarkan hasil penelitian, dapat disimpulkan bahwa pakan buatan dapat digunakan

  12. A Cell-Based Screen Reveals that the Albendazole Metabolite, Albendazole Sulfone, Targets Wolbachia

    Science.gov (United States)

    Bray, Walter M.; White, Pamela M.; Ruybal, Jordan; Lokey, R. Scott; Debec, Alain; Sullivan, William

    2012-01-01

    Wolbachia endosymbionts carried by filarial nematodes give rise to the neglected diseases African river blindness and lymphatic filariasis afflicting millions worldwide. Here we identify new Wolbachia-disrupting compounds by conducting high-throughput cell-based chemical screens using a Wolbachia-infected, fluorescently labeled Drosophila cell line. This screen yielded several Wolbachia-disrupting compounds including three that resembled Albendazole, a widely used anthelmintic drug that targets nematode microtubules. Follow-up studies demonstrate that a common Albendazole metabolite, Albendazole sulfone, reduces intracellular Wolbachia titer both in Drosophila melanogaster and Brugia malayi, the nematode responsible for lymphatic filariasis. Significantly, Albendazole sulfone does not disrupt Drosophila microtubule organization, suggesting that this compound reduces titer through direct targeting of Wolbachia. Accordingly, both DNA staining and FtsZ immunofluorescence demonstrates that Albendazole sulfone treatment induces Wolbachia elongation, a phenotype indicative of binary fission defects. This suggests that the efficacy of Albendazole in treating filarial nematode-based diseases is attributable to dual targeting of nematode microtubules and their Wolbachia endosymbionts. PMID:23028321

  13. Key to marine arthropod larvae

    Directory of Open Access Journals (Sweden)

    John A. Fornshell

    2012-03-01

    Full Text Available The scope of this key is restricted to the larvae of marine arthropods. The key is based solely on their morphology, patterns of body segmentation, numbers of appendages, and mode of locomotion. An effort has been made to treat all traditionally named larval forms, both planktonic and benthic. It is intended that this key be useful for a researcher working with archived museum specimens and therefore, does not include habitat information as a identifying trait, even though this information is usually available in the archived records. Within the phylum Arthropoda there are two sub-phyla and eleven classes having larval stages in the marineenvironment. Where feasible the original names of the various larval types have been used. Because this nomenclature is less commonly used today compared to the past, the more recent taxonomic affinities are included in parentheses after the original larval name. The key includes the following thirty-four larvae: Branchhiopoda nauplii; Cephalocarida nauplii; Mystacocarida nauplii; trilobite larva; protonymphon; hexapod larvae; Remipedia nauplii; nauplius - Y larvae; Cirripedia nauplii; Ascothoracida nauplii; Ostracoda nauplii; Euphausiacea nauplii; Penaeidea nauplii; Cyclopoida nauplii; Calanoida nauplii; Harpacticoida nauplii;Polyarthra nauplii; cypris larva; eryonecius larva; cypris-Y larva; elapthocaris larvae; mysis larvae; lucifer zoea; acetes zoea; acanthosoma larva; phyllosoma; antizoea larva; anomuran zoea; brachyuran zoea; calyptopis larvae; furcilia larva; crytopia larva; puerulus larva; alima larva.

  14. Larvae for layers

    DEFF Research Database (Denmark)

    Bjerrum, Lotte; Fischer, Christian Holst; Nordentoft, Steen

    2013-01-01

    Companies and researchers are in close collaboration developing a container- based system for cultivating fly larvae at organic poultry farms. In a one week process, manure will be converted to compost and the live larvae will be harvested and used for feeding laying hens. The larvae are expected...

  15. Lipoprotein biosynthesis as a target for anti-Wolbachia treatment of filarial nematodes

    Directory of Open Access Journals (Sweden)

    Slatko Barton E

    2010-10-01

    Full Text Available Abstract Background Lymphatic filariasis and onchocerciasis are debilitating diseases caused by filarial nematodes. Disease pathogenesis is induced by inflammatory responses following the death of the parasite. Wolbachia endosymbionts of filariae are potent inducers of innate and adaptive inflammation and bacterial lipoproteins have been identified as the ligands that bind toll-like receptors (TLR 2 and TLR6. Lipoproteins are important structural and functional components of bacteria and therefore enzymes involved in Wolbachia lipoprotein biosynthesis are potential chemotherapeutic targets. Results Globomycin, a signal peptidase II (LspA inhibitor, has activity against Gram-negative bacteria and a putative lspA gene has been identified from the Wolbachia genome of Brugia malayi (wBm. The amino acids required for function are strictly conserved and functionality was verified by complementation tests in a temperature-sensitive Escherichia coli lspA mutant. Also, transformation of wild type E. coli with Wolbachia lspA conferred significant globomycin resistance. A cell-based screen has been developed utilizing a Wolbachia-containing Aedes albopictus cell line to assay novel compounds active against Wolbachia. Globomycin was screened using this assay, which resulted in a dose-dependent reduction in Wolbachia load. Furthermore, globomycin was also effective in reducing the motility and viability of adult B. malayi in vitro. Conclusions These studies validate lipoprotein biosynthesis as a target in an organism for which no genetic tools are available. Further studies to evaluate drugs targeting this pathway are underway as part of the A-WOL drug discovery and development program.

  16. Larva migrans visceral: relato de caso Visceral larva migrans: case report

    Directory of Open Access Journals (Sweden)

    Alexandre Bortoli Machado

    2003-04-01

    Full Text Available Larva migrans visceral é doença infecciosa, adquirida por ingestão de ovos provenientes dos vermes Toxocara canis e/ou Toxocara cati que infestam cães e gatos; as larvas penetram a parede intestinal e migram através dos tecidos levando a alterações diversas, conseqüentes a uma resposta inflamatória imune.¹ Os autores descrevem um caso clínico de larva migrans visceral com apresentação clínica atípica.Visceral larva migrans is an infectious human disease that occurs following ingestion of eggs from the environment originating from roundworms which commonly infect dogs and cats, Toxocara canis and Toxocara cati. The larvae penetrate the gut wall and migrate through the tissues causing disorders consequent to an inflammatory immune response¹. The authors describe a clinical case of visceral larva migrans with an unusual clinical presentation and also its clinical aspects, diagnosis and treatment are reviewed.

  17. Isolamento de esporos de Paenibacillus larvae subsp. larvae no Brasil Detectionof Paenibacillus larvae subsp. larvae spores in Brazil

    Directory of Open Access Journals (Sweden)

    Dulce Maria Tocchetto Schuch

    2003-03-01

    Full Text Available Este trabalho objetivou detectar presença de esporos de Paenibacillus larvae subsp. larvae em produtos de um entreposto do interior do Estado do Rio Grande do Sul, a identificação de possíveis fontes de contaminação e a avaliação da possibilidade da transferência de esporos para colméias de apiários adjacentes a partir de produtos importados contaminados. Foram analisados mel e pólen importados disponíveis no entreposto, favo do ninho (crias, pólen e mel colhido de uma colméia sadia, mel estocado em um dos apiários e abelhas adultas. Os resultados foram positivosem relação ao mel e pólen importados, a três grupos de abelhas adultas e ao mel do favo.The objective of this work was to detect the presence of Paenibacillus larvae subsp. larvae spores in products from a warehouse located in Rio Grande do Sul State, Brazil, the identification of possible contamination sources, and the assessment of spores transference possibility from contaminated imported products from the warehouse to apiaries located in the surrounding area. Samples of imported pollen and bulk honey stocked in the warehouse, and honeycomb (brood, honey and pollen from a healthy hive, honey from one apiary and adult bees were analyzed. Imported honey and pollen, and three groups of adult bees and the honey collected from the honeycomb resulted positive.

  18. Helminth Genomics: The Implications for Human Health

    Science.gov (United States)

    Brindley, Paul J.; Mitreva, Makedonka; Ghedin, Elodie; Lustigman, Sara

    2009-01-01

    More than two billion people (one-third of humanity) are infected with parasitic roundworms or flatworms, collectively known as helminth parasites. These infections cause diseases that are responsible for enormous levels of morbidity and mortality, delays in the physical development of children, loss of productivity among the workforce, and maintenance of poverty. Genomes of the major helminth species that affect humans, and many others of agricultural and veterinary significance, are now the subject of intensive genome sequencing and annotation. Draft genome sequences of the filarial worm Brugia malayi and two of the human schistosomes, Schistosoma japonicum and S. mansoni, are now available, among others. These genome data will provide the basis for a comprehensive understanding of the molecular mechanisms involved in helminth nutrition and metabolism, host-dependent development and maturation, immune evasion, and evolution. They are likely also to predict new potential vaccine candidates and drug targets. In this review, we present an overview of these efforts and emphasize the potential impact and importance of these new findings. PMID:19855829

  19. ISOLASI BACILLUS THURINGIENSIS DARI LARVA DAN PENGUJIAN PATOGENISITASNYA TERHADAP LARVA NYAMUK VEKTOR

    Directory of Open Access Journals (Sweden)

    Blondine Ch. P.

    2012-09-01

    Full Text Available A study to evaluate pathogenic organisms as cause of mosquito larvae death was conducted at Wonokerto and Pabelan villages, Salatiga Luar Kota subdistrict, Semarang regency in Central Java from May 1991 through December 1991. Bacterial isolation from dead larvae showed that 31 B. thuringicnsis isolates were obtained from 31 larvae samples collected from 2 location e.g Wonokerto village (3 samples, Pabelan village (28 samples. Nineteen isolates (61,3% showed a pathogenicity of more than 50% to third toward instar larvae of Aedes aegypti and Culex quinquefasciatus respectively 24 hours after exposure. This study shows the possible use of B. thuringiensis for biologic control of mosquitoes which can act as vectors for human diseases.

  20. Lethal infection thresholds of Paenibacillus larvae for honeybee drone and worker larvae (Apis mellifera).

    Science.gov (United States)

    Behrens, Dieter; Forsgren, Eva; Fries, Ingemar; Moritz, Robin F A

    2010-10-01

    We compared the mortality of honeybee (Apis mellifera) drone and worker larvae from a single queen under controlled in vitro conditions following infection with Paenibacillus larvae, a bacterium causing the brood disease American Foulbrood (AFB). We also determined absolute P. larvae cell numbers and lethal titres in deceased individuals of both sexes up to 8 days post infection using quantitative real-time PCR (qPCR). Our results show that in drones the onset of infection induced mortality is delayed by 1 day, the cumulative mortality is reduced by 10% and P. larvae cell numbers are higher than in worker larvae. Since differences in bacterial cell titres between sexes can be explained by differences in body size, larval size appears to be a key parameter for a lethal threshold in AFB tolerance. Both means and variances for lethal thresholds are similar for drone and worker larvae suggesting that drone resistance phenotypes resemble those of related workers. © 2010 Society for Applied Microbiology and Blackwell Publishing Ltd.

  1. Amostragem por larva-única na vigilância de Aedes aegypti Single-larva sampling for Aedes aegypti surveillance

    Directory of Open Access Journals (Sweden)

    José Eduardo Bracco

    1995-04-01

    Full Text Available Com a finalidade de testar a metodologia de amostragem por larva-única na vigilância entomológica do Aedes aegypti, foram pesquisados domicílios do Município de Araraquara, SP (Brasil. Nos criadouros que continham larvas de Aedes uma delas foi coletada. Como controle, após a coleta da larva-única, todas as larvas foram coletadas para identificação posterior. Esse processo foi repetido no laboratório. Dos 447 domicílios visitados, apenas 12 foram considerados positivos e 20 criadouros foram identificados; destes, 13 continham larvas de Aedes; 5, larvas de Aedes e Culex e 2, larvas de Culex. Os resultados mostram o reconhecimento correto, no campo, de todos os criadouros, evidenciando que o método poderia ser utilizado na vigilância entomológica de municípios sem infestação domiciliar ou infestados apenas com uma única espécie de Aedes.Buildings in Araraquara city, Southeastern Brazil, were searched during a year for the presence of Aedes larvae using single larva sampling in order to check the single-larva methodology. In those breeding places in wich Aedes larvae were found, one of them was collected. As a control, after the single larva had been collected, all the larvae from the breeding place were collected for later identification. This process was repeated in the laboratory. Of the 447 domiciles searched, 12 were considered positive and 20 breeding places were found. Of the breeding places, 13 contained Aedes larvae, 5 both Aedes and Culex larvae and 2 Culex larvae only. The results show that all the breeding places in the field were properly recognited showing the method may be used for Aedes surveillance in cities infested with one species only or without any domiciliary infestation.

  2. Baylisascaris Larva Migrans

    Science.gov (United States)

    Kazacos, Kevin R.; Abbott, Rachel C.; van Riper, Charles

    2016-05-26

    SummaryBaylisascaris procyonis, the common raccoon roundworm, is the most commonly recognized cause of clinical larva migrans (LM) in animals, a condition in which an immature parasitic worm or larva migrates in a host animal’s tissues, causing obvious disease. Infection with B. procyonis is best known as a cause of fatal or severe neurologic disease that results when the larvae invade the brain, the spinal cord, or both; this condition is known as neural larva migrans (NLM). Baylisascariasis is a zoonotic disease, that is, one that is transmissible from animals to humans. In humans, B. procyonis can cause damaging visceral (VLM), ocular (OLM), and neural larva migrans. Due to the ubiquity of infected raccoons around humans, there is considerable human exposure and risk of infection with this parasite. The remarkable disease-producing capability of B. procyonis in animals and humans is one of the most significant aspects of the biology of ascarids (large roundworms) to come to light in recent years. Infection with B. procyonis has important health implications for a wide variety of free-ranging and captive wildlife, zoo animals, domestic animals, as well as human beings, on both an individual and population level. This report, eighth in the series of U.S. Geological Survey Circulars on zoonotic diseases, will help us to better understand the routes of Baylisascaris procyonis infections and how best to adequately monitor this zoonotic disease.

  3. Visceral larva migrans: case report

    OpenAIRE

    Machado, Alexandre Bortoli; El Achkar, Marice Emanuela

    2003-01-01

    Larva migrans visceral é doença infecciosa, adquirida por ingestão de ovos provenientes dos vermes Toxocara canis e/ou Toxocara cati que infestam cães e gatos; as larvas penetram a parede intestinal e migram através dos tecidos levando a alterações diversas, conseqüentes a uma resposta inflamatória imune.¹ Os autores descrevem um caso clínico de larva migrans visceral com apresentação clínica atípica.Visceral larva migrans is an infectious human disease that occurs following ingestion of eggs...

  4. The complete mitochondrial genome of Setaria digitata (Nematoda: Filarioidea): Mitochondrial gene content, arrangement and composition compared with other nematodes.

    Science.gov (United States)

    Yatawara, Lalani; Wickramasinghe, Susiji; Rajapakse, R P V J; Agatsuma, Takeshi

    2010-09-01

    In the present study, we determined the complete mitochondrial (mt) genome sequence (13,839bp) of parasitic nematode Setaria digitata and its structure and organization compared with Onchocerca volvulus, Dirofilaria immitis and Brugia malayi. The mt genome of S. digitata is slightly larger than the mt genomes of other filarial nematodes. S. digitata mt genome contains 36 genes (12 protein-coding genes, 22 transfer RNAs and 2 ribosomal RNAs) that are typically found in metazoans. This genome contains a high A+T (75.1%) content and low G+C content (24.9%). The mt gene order for S. digitata is the same as those for O. volvulus, D. immitis and B. malayi but it is distinctly different from other nematodes compared. The start codons inferred in the mt genome of S. digitata are TTT, ATT, TTG, ATG, GTT and ATA. Interestingly, the initiation codon TTT is unique to S. digitata mt genome and four protein-coding genes use this codon as a translation initiation codon. Five protein-coding genes use TAG as a stop codon whereas three genes use TAA and four genes use T as a termination codon. Out of 64 possible codons, only 57 are used for mitochondrial protein-coding genes of S. digitata. T-rich codons such as TTT (18.9%), GTT (7.9%), TTG (7.8%), TAT (7%), ATT (5.7%), TCT (4.8%) and TTA (4.1%) are used more frequently. This pattern of codon usage reflects the strong bias for T in the mt genome of S. digitata. In conclusion, the present investigation provides new molecular data for future studies of the comparative mitochondrial genomics and systematic of parasitic nematodes of socio-economic importance. 2010 Elsevier B.V. All rights reserved.

  5. In vitro, in silico and in vivo studies of ursolic acid as an anti-filarial agent.

    Directory of Open Access Journals (Sweden)

    Komal Kalani

    Full Text Available As part of our drug discovery program for anti-filarial agents from Indian medicinal plants, leaves of Eucalyptus tereticornis were chemically investigated, which resulted in the isolation and characterization of an anti-filarial agent, ursolic acid (UA as a major constituent. Antifilarial activity of UA against the human lymphatic filarial parasite Brugia malayi using in vitro and in vivo assays, and in silico docking search on glutathione-s-transferase (GST parasitic enzyme were carried out. The UA was lethal to microfilariae (mf; LC100: 50; IC50: 8.84 µM and female adult worms (LC100: 100; IC50: 35.36 µM as observed by motility assay; it exerted 86% inhibition in MTT reduction potential of the adult parasites. The selectivity index (SI of UA for the parasites was found safe. This was supported by the molecular docking studies, which showed adequate docking (LibDock scores for UA (-8.6 with respect to the standard antifilarial drugs, ivermectin (IVM -8.4 and diethylcarbamazine (DEC-C -4.6 on glutathione-s-transferase enzyme. Further, in silico pharmacokinetic and drug-likeness studies showed that UA possesses drug-like properties. Furthermore, UA was evaluated in vivo in B. malayi-M. coucha model (natural infection, which showed 54% macrofilaricidal activity, 56% female worm sterility and almost unchanged microfilaraemia maintained throughout observation period with no adverse effect on the host. Thus, in conclusion in vitro, in silico and in vivo results indicate that UA is a promising, inexpensive, widely available natural lead, which can be designed and developed into a macrofilaricidal drug. To the best of our knowledge this is the first ever report on the anti-filarial potential of UA from E. tereticornis, which is in full agreement with the Thomson Reuter's 'Metadrug' tool screening predictions.

  6. FAKTOR-FAKTOR YANG MEMPENGARUHI KEJADIAN FILARIASIS DI INDONESIA (DATA RISKESDAS 2007

    Directory of Open Access Journals (Sweden)

    Mardiana Mardiana

    2012-11-01

    Full Text Available Filariasis or elephantiasis diseases which caused by filaria worm and contagious through mosquito bite, still the major community health problem in Indonesia. There are several type of filaria worm in Indonesia, i.e. Wuchereria bancrofti, Brugia malayi and Brugia timori. The vectors of filariasis are Culex quinquefasciatus in the urban area, Anopheles spp, Aedes spp and Mansonia spp in the rural area. The infection risk in some area of filariasis related to the situation of local area. Various factor of environmental area which area physical, biological and also cultural social to be influence to development of transmitted filariasis by mosquito. The analysis of data Riskesdas 2007 has been done to perform of factor influence filariasis case in Indonesia. Same parameters was analyzed to case of filariasis in last 12 months; gender, ages, educations, work, mosquito net usage, sources of water, effluent dismissal, residences, water dismissal channel, existence of livestock in house. From analysis inferential, show there is no relation between genders, age, education, work, and mosquito net usage, sources of water, water dismissal channel, and existence of livestock in house to case filariasis. Statistically indicates that there is significantly difference between residences in rural and in urban to case of filariasis in last 12 months. Responder who live in rural areas (0,05% have 2,4 times risk higher than responder who live in urban (0,03%. The same as condition of water dismissal channel shows to existence of significantly differences. Responder who have water dismissal channel without cover have high risk infections of filariasis in the last 12 months were 0,05%, while the responder have water dismissal channel with cover have high risk in last 12 months were 0,03%. Keywords: Filariasis, endemic area, factors

  7. Extreme morphologies of mantis shrimp larvae

    Directory of Open Access Journals (Sweden)

    Carolin Haug

    Full Text Available ABSTRACT Larvae of stomatopods (mantis shrimps are generally categorized into four larval types: antizoea, pseudozoea (both representing early larval stages, alima and erichthus (the latter two representing later larval stages. These categories, however, do not reflect the existing morphological diversity of stomatopod larvae, which is largely unstudied. We describe here four previously unknown larval types with extreme morphologies. All specimens were found in the collections of the Zoological Museum, University of Copenhagen and were collected during the Danish Dana Expedition round the world 1928-30. These new larval types all represent erichthus-type larvae, especially differing in their shield morphologies. The shield morphology ranges from almost spherical to rather disc-like, with sometimes extremely elongated spines, but only a general systematic assignment of the larvae was possible. Further investigations of these larvae are crucial to understand their life habits and ecological impact, especially as stomatopod and other crustacean larvae might have a much more important position in the marine ecosystems than their corresponding adults.

  8. Self mixing of fly larvae during feeding

    Science.gov (United States)

    Shishkov, Olga; Johnson, Christopher; Hu, David

    How do we sustainably feed a growing world population? One solution of increasing interest is the use of black solider fly larvae, pea-sized grubs envisioned to transform hundreds of tons of food waste into a sustainable protein source. Although startups across the world are raising these larvae, a physical understanding of how they should be raised and fed remains missing. In this study, we present experiments measuring their feeding rate as a function of number of larvae. We show that larger groups of larvae have greater mixing which entrains hungry larvae around the food, increasing feeding rate. Feeding of larvae thus differs from feeding of cattle or other livestock which exhibit less self-mixing.

  9. Acute toxicity of sodium metabisulphite in larvae and post-larvae of the land crab, Cardisoma guanhumi.

    Science.gov (United States)

    Galli, Orlando B S; Fujimoto, Rodrigo Y; Abrunhosa, Fernando A

    2012-08-01

    Sodium metabisulphite (SMB) is used in marine shrimp aquaculture to prevent the occurrence of black spot. The release SMB into the estuarine environment from shrimp farm pond effluents has been reported. This study evaluated the susceptibility of larvae and post-larvae of land crab, Cardisoma guanhumi to this salt. A decrease in dissolved oxygen and pH occurred with increasing concentration of SMB and exposure time. LC(50) values after 48 h of exposure were 34 ± 1.1 mg/L, 31.1 ± 1.9 mg/L, and 30.6 ± 0.5 mg/L for I zoea larvae, megalopa larvae and stage I juveniles, respectively.

  10. Limitations of the radioimmunoprecipitation polyethylene glycol assay (RIPEGA) for detection of filarial antigens in serum

    International Nuclear Information System (INIS)

    Hamilton, R.G.; Alexander, E.; Adkinson, N.F.

    1984-01-01

    The performance of the radioimmunoprecipitation polyethylene glycol assay (RIPEGA) was examined for quantitation of filarial antigens (Brugia malayi and Dirofilaria immitis) in serum from infected human and animal hosts and non-infected controls. Multiple PEG concentrations were employed to determine the level of non-specific binding (NSB) in non-exposed human sera (NEHS) containing no filarial antigen. The NSB observed when 3 different 125 I-labelled IgG antibodies were added to 26 NEHS varied 3-fold and was correlated significantly with total serum IgM (r = 0.80, P 2 fragment of the 125 I-labelled antibody was used, but the correlation of NSB with total serum IgM remained significant (r = 0.57, P < 0.01). The presence of rheumatoid factor in NEHS sera also significantly increased NSB by an average of 3-fold. These effects eliminated the assay's ability to detect in sera from infected hosts filarial antigen the presence of which could be readily demonstrated by an immunoradiometric assay. The RIPEGA's precision (intra-assay coefficient of variation (CV) = 21% at 35% Bsub(max)) and reproducibility (inter-assay CV = 29% at 35% Bsub(max)) are less satisfactory than many alternative immunoassays. (Auth.)

  11. Molecular characterization and functional analysis of serine/threonine protein phosphatase of Toxocara canis.

    Science.gov (United States)

    Ma, Guang Xu; Zhou, Rong Qiong; Hu, Shi Jun; Huang, Han Cheng; Zhu, Tao; Xia, Qing You

    2014-06-01

    Toxocara canis (T. canis) is a widely prevalent zoonotic parasite that infects a wide range of mammalian hosts, including humans. We generated the full-length complementary DNA (cDNA) of the serine/threonine phosphatase gene of T. canis (Tc stp) using 5' rapid amplification of the cDNA ends. The 1192-bp sequence contained a continuous 942-nucleotide open reading frame, encoding a 313-amino-acid polypeptide. The Tc STP polypeptide shares a high level of amino-acid sequence identity with the predicted STPs of Loa loa (89%), Brugia malayi (86%), Oesophagostomum columbianum (76%), and Oesophagostomumdentatum (76%). The Tc STP contains GDXHG, GDXVDRG, GNHE motifs, which are characteristic of members of the phosphoprotein phosphatase family. Our quantitative real-time polymerase chain reaction analysis showed that the Tc STP was expressed in six different tissues in the adult male, with high-level expression in the spermary, vas deferens, and musculature, but was not expressed in the adult female, suggesting that Tc STP might be involved in spermatogenesis and mating behavior. Thus, STP might represent a potential molecular target for controlling T. canis reproduction. Copyright © 2014 Elsevier Inc. All rights reserved.

  12. Recent Advances on the Use of Biochemical Extracts as Filaricidal Agents

    Directory of Open Access Journals (Sweden)

    Nazeh M. Al-Abd

    2013-01-01

    Full Text Available Lymphatic filariasis is a parasitic infection that causes a devastating public health and socioeconomic burden with an estimated infection of over 120 million individuals worldwide. The infection is caused by three closely related nematode parasites, namely, Wuchereria bancrofti, Brugia malayi, and B. timori, which are transmitted to human through mosquitoes of Anopheles, Culex, and Aedes genera. The species have many ecological variants and are diversified in terms of their genetic fingerprint. The rapid spread of the disease and the genetic diversification cause the lymphatic filarial parasites to respond differently to diagnostic and therapeutic interventions. This in turn prompts the current challenge encountered in its management. Furthermore, most of the chemical medications used are characterized by adverse side effects. These complications urgently warrant intense prospecting on bio-chemicals that have potent efficacy against either the filarial worms or thier vector. In lieu of this, we presented a review on recent literature that reported the efficacy of filaricidal biochemicals and those employed as vector control agents. In addition, methods used for biochemical extraction, screening procedures, and structure of the bioactive compounds were also presented.

  13. Transcriptional response of honey bee larvae infected with the bacterial pathogen Paenibacillus larvae.

    Science.gov (United States)

    Cornman, Robert Scott; Lopez, Dawn; Evans, Jay D

    2013-01-01

    American foulbrood disease of honey bees is caused by the bacterium Paenibacillus larvae. Infection occurs per os in larvae and systemic infection requires a breaching of the host peritrophic matrix and midgut epithelium. Genetic variation exists for both bacterial virulence and host resistance, and a general immunity is achieved by larvae as they age, the basis of which has not been identified. To quickly identify a pool of candidate genes responsive to P. larvae infection, we sequenced transcripts from larvae inoculated with P. larvae at 12 hours post-emergence and incubated for 72 hours, and compared expression levels to a control cohort. We identified 75 genes with significantly higher expression and six genes with significantly lower expression. In addition to several antimicrobial peptides, two genes encoding peritrophic-matrix domains were also up-regulated. Extracellular matrix proteins, proteases/protease inhibitors, and members of the Osiris gene family were prevalent among differentially regulated genes. However, analysis of Drosophila homologs of differentially expressed genes revealed spatial and temporal patterns consistent with developmental asynchrony as a likely confounder of our results. We therefore used qPCR to measure the consistency of gene expression changes for a subset of differentially expressed genes. A replicate experiment sampled at both 48 and 72 hours post infection allowed further discrimination of genes likely to be involved in host response. The consistently responsive genes in our test set included a hymenopteran-specific protein tyrosine kinase, a hymenopteran specific serine endopeptidase, a cytochrome P450 (CYP9Q1), and a homolog of trynity, a zona pellucida domain protein. Of the known honey bee antimicrobial peptides, apidaecin was responsive at both time-points studied whereas hymenoptaecin was more consistent in its level of change between biological replicates and had the greatest increase in expression by RNA-seq analysis.

  14. Ocular Manifestations of Mosquito-Transmitted Diseases.

    Science.gov (United States)

    Karesh, James W; Mazzoli, Robert A; Heintz, Shannon K

    2018-03-01

    Of the 3,548 known mosquito species, about 100 transmit human diseases. Mosquitoes are distributed globally throughout tropical and temperate regions where standing water sources are available for egg laying and the maturation of larva. Female mosquitoes require blood meals for egg production. This is the main pathway for disease transmission. Mosquitoes carry several pathogenic organisms responsible for significant ocular pathology and vision loss including West Nile, Rift Valley, chikungunya, dengue viruses, various encephalitis viruses, malarial parasites, Francisella tularensis, microfilarial parasites, including Dirofilaria, Wuchereria, and Brugia spp., and human botfly larvae. Health care providers may not be familiar with many of these mosquito-transmitted diseases or their associated ocular findings delaying diagnosis, treatment, and recovery of visual function. This article aims to provide an overview of the ocular manifestations associated with mosquito-transmitted diseases.

  15. PERKEMBANGAN ENZIM PENCERNAAN LARVA IKAN PATIN, Pangasius hypophthalmus sp.

    Directory of Open Access Journals (Sweden)

    Irzal Effendi

    2003-05-01

    Full Text Available Development of digestive enzymes; protease, lipase and amylase were observed in patin catfish, Pangasius hypophthalmus, larvae.  The 1 day old larvae (day after hatching, with 3,37-3,97 mm length and 0,62-0,79 mg weight, were reared in aquarium 60x50x40 cm with stocking  density of 20 fish/l.  Larvae were fed  Artemia dan tubificid worms 2-8 dan 7-15 days after hatching (dAH,  respectively (schedule I;  2-6 and  5-15 dAH (schedule II; and 2-4 and 5-15 dAH (schedule III.  Chlorella was ready to eat by larvae at the entirely rearing.  For enzyme assay, larvae were sampled from each aquarium at stages of 1, 2, 3, 5, 7, 10 and 15 dAH.    Protease and lipase activity were detected in digestive tract of  1 dAH larvae.   Digestive enzymes development have a similar pattern in larvae for all feeding schedules.  Protease activity  decreased with the increasing of age until 3 dAH, then increased  until the larvae reached 7 dAH, and sharply decreased until 10 dAH and then slowly decreased thereafter. Lipase activity tended to increase slowly with age up to 3 dAH, and increased sharply until 5 dAH, and then decreased sharply until 7 dAH  before decreased again up to the end of rearing.  Amylase activity in larvae increased slowly with the increasing of age up to 5 dAH, then increased sharply until 7 dAH, and decreased thereafter.  In dimly lighted larvae, amylase activity decreased before increased up to 12 d AH, then decreased thereafter.  The amount of food organisms in larval gut, body weight and length, and survival rate of larvae were also measured and discussed.Key Words:  Digestive enzymes, development, larvae, patin catfish, Pangasius hypophthalmus ABSTRAKPenelitian ini bertujuan untuk mengetahui perkembangan enzim protease, lipase dan amilase saluran pencernaan larva ikan patin akibat perubahan skedul pemberian pakan.  Larva ikan patin (panjang 3,77–3,97 mm dan bobot 0,62-0,79 mg berumur 1 hari dipelihara di akuarium 60x

  16. First record of larvae of Chironomidae (Insecta, Diptera as prey of Temnocephala sp. (Platyhelminthes, Temnocephalidae, an ectosymbiont on larvae of Corydalidae (Megaloptera

    Directory of Open Access Journals (Sweden)

    Susana Trivinho-Strixino

    2012-09-01

    Full Text Available First record of larvae of Chironomidae (Insecta, Diptera as prey of Temnocephala sp. (Platyhelminthes, Temnocephalidae, an ectosymbiont on larvae of Corydalidae (Megaloptera. This study constitutes the first record of Temnocephala Blanchard, an ectosymbiont on Corydalidae, as a possible predator of chironomid larvae. Twenty-eight Corydalidae larvae (Corydalus and Protochauliodes were examined under stereomicroscopic in search for Temnocephala and Chironomidae larvae, of which five megalopteran larvae had 24 Temnocephala sp. associated. Furthermore, eight of these Temnocephala worms had chironomid larvae in their gut contents, an interaction previously unknown. Gut content analyses revealed Corynoneura as the commonest chironomid, but larvae of Larsia, Rheotanytarsus and Tanytarsus were recorded as well. This study included Corydalus and Protochauliodes as hosts for Temnocephala, which might be important for this worm dispersion and population dynamics.

  17. Long-wavelength photosensitivity in coral planula larvae.

    Science.gov (United States)

    Mason, Benjamin M; Cohen, Jonathan H

    2012-04-01

    Light influences the swimming behavior and settlement of the planktonic planula larvae of coral, but little is known regarding the photosensory biology of coral at this or any life-history stage. Here we used changes in the electrical activity of coral planula tissue upon light flashes to investigate the photosensitivity of the larvae. Recordings were made from five species: two whose larvae are brooded and contain algal symbionts (Porites astreoides and Agaricia agaricites), and three whose larvae are spawned and lack algal symbionts (Acropora cervicornis, Acropora palmata,and Montastrea faveolata). Photosensitivity originated from the coral larva rather than from, or in addition to, its algal symbionts as species with and without symbionts displayed similar tissue-level electrical responses to light. All species exhibited as much (or more) sensitivity to red stimuli as to blue/green stimuli, which is consistent with a role for long-wavelength visible light in the preference for substrata observed during settlement and in facilitating vertical positioning of larvae in the water column.

  18. Descrição da larva de Erythemis mithroides (Brauer e notas sobre outras larvas conhecidas do gênero (Odonata, Libellulidae Description of the larva of Erythemis mithroides (Brauer and notes on other known larvae of the genus (Odonata, Libellulidae

    Directory of Open Access Journals (Sweden)

    J.M. Costa

    1993-01-01

    Full Text Available The last instar larva of Erythemis mithroides (Brauer, 1900 is described and figured based on exuviae of reared specimens. A comparative analysis of this immature stage and the known larvae of the genus are furnished according to the data available in the literature and of specimens of E credula (Hagen, 1861 and E. vesiculosa (Fab., 1775 permiting a diagnose for the larvae of the genus Erylhemis Hagen, 1861.

  19. Fate of pharmaceuticals and pesticides in fly larvae composting

    Energy Technology Data Exchange (ETDEWEB)

    Lalander, C., E-mail: cecilia.lalander@slu.se [Department of Energy and Technology, Swedish University of Agricultural Sciences (Sweden); Senecal, J.; Gros Calvo, M. [Department of Energy and Technology, Swedish University of Agricultural Sciences (Sweden); Ahrens, L.; Josefsson, S.; Wiberg, K. [Department of Aquatic Sciences and Assessment, Swedish University of Agricultural Sciences (Sweden); Vinnerås, B. [Department of Energy and Technology, Swedish University of Agricultural Sciences (Sweden)

    2016-09-15

    A novel and efficient organic waste management strategy currently gaining great attention is fly larvae composting. High resource recovery efficiency can be achieved in this closed-looped system, but pharmaceuticals and pesticides in waste could potentially accumulate in every loop of the treatment system and spread to the environment. This study evaluated the fate of three pharmaceuticals (carbamazepine, roxithromycin, trimethoprim) and two pesticides (azoxystrobin, propiconazole) in a fly larvae composting system and in a control treatment with no larvae. It was found that the half-life of all five substances was shorter in the fly larvae compost (< 10% of control) and no bioaccumulation was detected in the larvae. Fly larvae composting could thus impede the spread of pharmaceuticals and pesticides into the environment. - Highlights: • Degradation of pharmaceuticals and pesticides in fly larvae composting (FLC). • Half-life considerably shorter in FLC than in control with no larvae. • Half-life of carbamazepine was less than two days in FLC. • No bioaccumulation in larvae detected. • FLC could impede the spreading of pharmaceuticals and pesticide in the environment.

  20. Fate of pharmaceuticals and pesticides in fly larvae composting

    International Nuclear Information System (INIS)

    Lalander, C.; Senecal, J.; Gros Calvo, M.; Ahrens, L.; Josefsson, S.; Wiberg, K.; Vinnerås, B.

    2016-01-01

    A novel and efficient organic waste management strategy currently gaining great attention is fly larvae composting. High resource recovery efficiency can be achieved in this closed-looped system, but pharmaceuticals and pesticides in waste could potentially accumulate in every loop of the treatment system and spread to the environment. This study evaluated the fate of three pharmaceuticals (carbamazepine, roxithromycin, trimethoprim) and two pesticides (azoxystrobin, propiconazole) in a fly larvae composting system and in a control treatment with no larvae. It was found that the half-life of all five substances was shorter in the fly larvae compost (< 10% of control) and no bioaccumulation was detected in the larvae. Fly larvae composting could thus impede the spread of pharmaceuticals and pesticides into the environment. - Highlights: • Degradation of pharmaceuticals and pesticides in fly larvae composting (FLC). • Half-life considerably shorter in FLC than in control with no larvae. • Half-life of carbamazepine was less than two days in FLC. • No bioaccumulation in larvae detected. • FLC could impede the spreading of pharmaceuticals and pesticide in the environment.

  1. Effects of various diets on the calcium and phosphorus composition of mealworms (Tenebrio molitor larvae) and superworms (Zophobas morio larvae).

    Science.gov (United States)

    Latney, La'Toya V; Toddes, Barbara D; Wyre, Nicole R; Brown, Dorothy C; Michel, Kathryn E; Briscoe, Johanna A

    2017-02-01

    OBJECTIVE To evaluate whether the nutritive quality of Tenebrio molitor larvae and Zophobas morio larvae, which are commonly cultured as live food sources, is influenced by 4 commercially available diets used as nutritional substrates; identify which diet best improved calcium content of larvae; and identify the feeding time interval that assured the highest calcium intake by larvae. ANIMALS 2,000 Zophobas morio larvae (ie, superworms) and 7,500 Tenebrio molitor larvae (ie, mealworms). PROCEDURES Larvae were placed in control and diet treatment groups for 2-, 7-, and 10-day intervals. Treatment diets were as follows: wheat millings, avian hand feeding formula, organic avian mash diet, and a high-calcium cricket feed. Control groups received water only. After treatment, larvae were flash-frozen live with liquid nitrogen in preparation for complete proximate and mineral analyses. Analyses for the 2-day treatment group were performed in triplicate. RESULTS The nutrient composition of the high-calcium cricket feed groups had significant changes in calcium content, phosphorus content, and metabolizable energy at the 2-day interval, compared with other treatment groups, for both mealworms and superworms. Calcium content and calcium-to-phosphorus ratios for larvae in the high-calcium cricket feed group were the highest among the diet treatments for all treatment intervals and for both larval species. CONCLUSIONS AND CLINICAL RELEVANCE A 2-day interval with the high-calcium cricket feed achieved a larval nutrient composition sufficient to meet National Research Council dietary calcium recommendations for nonlactating rats. Mealworm calcium composition reached 2,420 g/1,000 kcal at 48 hours, and superworm calcium composition reached 2,070g/1,000 kcal at 48 hours. These findings may enable pet owners, veterinarians, insect breeders, and zoo curators to optimize nutritive content of larvae fed to insectivorous animals.

  2. Image-based automatic recognition of larvae

    Science.gov (United States)

    Sang, Ru; Yu, Guiying; Fan, Weijun; Guo, Tiantai

    2010-08-01

    As the main objects, imagoes have been researched in quarantine pest recognition in these days. However, pests in their larval stage are latent, and the larvae spread abroad much easily with the circulation of agricultural and forest products. It is presented in this paper that, as the new research objects, larvae are recognized by means of machine vision, image processing and pattern recognition. More visional information is reserved and the recognition rate is improved as color image segmentation is applied to images of larvae. Along with the characteristics of affine invariance, perspective invariance and brightness invariance, scale invariant feature transform (SIFT) is adopted for the feature extraction. The neural network algorithm is utilized for pattern recognition, and the automatic identification of larvae images is successfully achieved with satisfactory results.

  3. Feeding behavior of giant gourami, Osphronemus gouramy (Lacepede larvae

    Directory of Open Access Journals (Sweden)

    Thumronk Amornsakun

    2014-06-01

    Full Text Available Feeding experiments were carried out in 15-liter glass aquaria with 10 liters of water containing 1000 larvae aged 1.5 days post-hatching (before mouth opening in three replicates. It was found that the feeding scheme of larval giant gourami aged 5-17 days (TL 8.36-13.40 mm consumed Moina. The larvae aged 14-17 days (TL 12.40-13.40 mm consumed both Moina and artificial pellet. Larvae aged more than 18-days (TL 13.60 mm consumed only artificial pellet. Daily food uptake by the larvae and juvenile were determined in a 15-liter aquaria (water volume 10 liters containing 500 larvae. The larvae were fed with Moina at density of 10 ind/ml. Aquaria without larvae were also set for a control of natural fluctuation in food density. The amount of food intake was calculated based on changes of food density in the aquarium with and without fish larvae. It was found the average uptake of Moina in digestive tract per day of larvae aged 5, 8, 11, 14 and 17 days old were 38, 52, 182, 205 and 266 individual/larva, respectively at density of 1.27, 1.73, 6.07, 6.83, and 8.87 individual/ml, respectively.

  4. The Identification of Congeners and Aliens by Drosophila Larvae.

    Directory of Open Access Journals (Sweden)

    Francisco Del Pino

    Full Text Available We investigated the role of Drosophila larva olfactory system in identification of congeners and aliens. We discuss the importance of these activities in larva navigation across substrates, and the implications for allocation of space and food among species of similar ecologies. Wild type larvae of cosmopolitan D. melanogaster and endemic D. pavani, which cohabit the same breeding sites, used species-specific volatiles to identify conspecifics and aliens moving toward larvae of their species. D. gaucha larvae, a sibling species of D. pavani that is ecologically isolated from D. melanogaster, did not respond to melanogaster odor cues. Similar to D. pavani larvae, the navigation of pavani female x gaucha male hybrids was influenced by conspecific and alien odors, whereas gaucha female x pavani male hybrid larvae exhibited behavior similar to the D. gaucha parent. The two sibling species exhibited substantial evolutionary divergence in processing the odor inputs necessary to identify conspecifics. Orco (Or83b mutant larvae of D. melanogaster, which exhibit a loss of sense of smell, did not distinguish conspecific from alien larvae, instead moving across the substrate. Syn97CS and rut larvae of D. melanogaster, which are unable to learn but can smell, moved across the substrate as well. The Orco (Or83b, Syn97CS and rut loci are necessary to orient navigation by D. melanogaster larvae. Individuals of the Trana strain of D. melanogaster did not respond to conspecific and alien larval volatiles and therefore navigated randomly across the substrate. By contrast, larvae of the Til-Til strain used larval volatiles to orient their movement. Natural populations of D. melanogaster may exhibit differences in identification of conspecific and alien larvae. Larval locomotion was not affected by the volatiles.

  5. Larva migrans visceral: relato de caso

    OpenAIRE

    Machado Alexandre Bortoli; El Achkar Marice Emanuela

    2003-01-01

    Larva migrans visceral é doença infecciosa, adquirida por ingestão de ovos provenientes dos vermes Toxocara canis e/ou Toxocara cati que infestam cães e gatos; as larvas penetram a parede intestinal e migram através dos tecidos levando a alterações diversas, conseqüentes a uma resposta inflamatória imune.¹ Os autores descrevem um caso clínico de larva migrans visceral com apresentação clínica atípica.

  6. Efektivitas Bacillus thuringiensis dalam Pengendalian Larva Nyamuk Anopheles sp.

    Directory of Open Access Journals (Sweden)

    Citra Inneke Wibowo

    2017-08-01

    Full Text Available Nyamuk Anopheles sp adalah vektor penyakit malaria. Pengendalian vektor penyakit malaria dapat dilakukan secara biologis yaitu dengan menggunakan Bacillus thuringiensis. Tujuan penelitian adalah untuk mengetahui efektivitas konsentrasi Bacillus thuringiensis dalam pengendalian larva nyamuk Anopheles sp.Penelitian ini dilakukan secara eksperimental menggunakan Rancangan Acak Lengkap Faktorial (RAL Faktorial yang terdiri atas dua faktor yaitu konsentrasi Bacillus thuringiensis dan stadia larva Anopheles dengan pengulangan tiga kali.Perlakuan yang dicobakan adalahkonsentrasi Bacillus thuringiensis (A yang terdiri atas 5 taraf:A0: konsentrasi B.thuringiensis 0 CFU.mL-1, A1: konsentrasi B.thuringiensis 102 CFU.mL-1, A2: konsentrasi B.thuringiensis 104 CFU.mL-1, A3: konsentrasi B.thuringiensis 106CFU.mL-1, A4: konsentrasi B.thuringiensis 108CFU.mL-1. Perlakuan tahapan instar larva Anopheles sp. (B adalah sebagai berikut:B1: stadia larva instar I, B2: stadia larva instar II, B3: stadia larva instar III, B4: stadia larva instar IVsehingga terdapat 60 satuan percobaan. Hasil penelitian  menunjukkan konsentrasi B. thuringiensis isolat CK dan IPB CC yang paling berpengaruh dalam pengendalian larva Anopheles sp adalah 108 CFU.mL-1 . Instar larva yang paling peka terhadap B. thuringiensis isolat IPB CC adalah instar I dan II sedangkan instar yang peka terhadap isolat CK adalah instar II, Perlakuan konsentrasi isolat B. thuringiensis dan tingkat instar larva yang paling baik dalam pengendalian larva Anopheles sp. adalah 108 CFU.mL-1, dan instar I dan II.

  7. Biofilms and Marine Invertebrate Larvae: What Bacteria Produce That Larvae Use to Choose Settlement Sites

    Science.gov (United States)

    Hadfield, Michael G.

    2011-01-01

    Communities of microorganisms form thin coats across solid surfaces in the sea. Larvae of many marine invertebrates use biofilm components as cues to appropriate settlement sites. Research on the tube-dwelling polychaete worm Hydroides elegans, a globally common member of biofouling communities, is described to exemplify approaches to understanding biofilm bacteria as a source of settlement cues and larvae as bearers of receptors for bacterial cues. The association of species of the bacterial genus Pseudoalteromonas with larval settlement in many phyla is described, and the question of whether cues are soluble or surface-bound is reviewed, concluding that most evidence points to surface-bound cues. Seemingly contradictory data for stimulation of barnacle settlement are discussed; possibly both explanations are true. Paleontological evidence reveals a relationship between metazoans and biofilms very early in metazoan evolution, and thus the receptors for bacterial cues of invertebrate larvae are very old and possibly unique. Finally, despite more than 60 years of intense investigation, we still know very little about either the bacterial ligands that stimulate larval settlement or the cellular basis of their detection by larvae.

  8. Survival of mayfly larvae under mine acid conditions

    Energy Technology Data Exchange (ETDEWEB)

    Napier, S. Jr.; Hummon, W.D.

    1976-01-01

    Mayfly larvae were abundant and diverse in riffle zones of three control streams in southeastern Ohio. But none were found in such zones of three streams having current or past histories of mine acid pollution, despite vegetative recovery of reclaimed land bordering two of the streams. Laboratory studies showed stepwise increases in non-predatory mortality of mayfly larvae with increased mine acidity. Dragonfly larvae predation on mayfly larvae was constant at pH 8.1 to 4.1, but decreased at pH 3.1 despite tolerance of dragonfly larvae to low pH conditions. Extensive acid mine pollution thus may threaten aquatic biota through removal of food sources or reduced feeding rates as well as through direct mortality.

  9. Freshly squeezed: anaphylaxis caused by drone larvae juice.

    Science.gov (United States)

    Stoevesandt, J; Trautmann, A

    2017-11-30

    Drone larvae are mostly considered a by-product of beekeeping, but have recently been advo-cated as a high-protein source of food. There are as yet no data concerning their allergenic po-tential. We report on a 29-year old bee keeper who experienced an anaphylactic reaction following the consumption of a freshly prepared beverage from raw drone larvae. Larvae-specific sensitization was confirmed by prick-to-prick and basophil activation testing. Bee stings and classical bee products including honey and royal jelly were tolerated. This is the hitherto first report on IgE-mediated allergy to drone larvae. We suggest that a certain awareness towards the allergenicity of bee larvae is required.

  10. Macrofilaricidal and microfilaricidal effects of Neurolaena lobata, a Guatemalan medicinal plant, on Brugia pahangi.

    Science.gov (United States)

    Fujimaki, Y; Kamachi, T; Yanagi, T; Cáceres, A; Maki, J; Aoki, Y

    2005-03-01

    Twelve extracts of 11 Guatemalan medicinal plants were initially screened in vitro for potential macrofilaricidal activity against Brugia pahangi, a lymphatic dwelling filarial worm, using concentrations from 125 to 1000 microg ml(-1) of each extract that could be dissolved in the culture medium. Of 12 extracts used, the ethanol extract of leaves of Neurolaena lobata showed the strongest activity against the motility of adult worms. Subsequently, the extract of N. lobata was extensively examined in vitro for macro- and micro-filaricidal effects using a series of concentrations of 500, 250, 100, 50 and 10 microg ml(-1). The effects were assessed by worm motility, microfilarial release by female worms and a MTT assay. The effect on the motility of adult worms was observed in a concentration- and time-dependent manner. The time required to stop motility of both sexes of adult worms was 6 h at 500 microg ml(-1), 24 h at 250 microg ml(-1), and 3 days for females and 4 days for males at 100 microg ml(-1). The movement of females ceased at 4 days at a concentration of 50 microg ml(-1) whereas the motility of males was only reduced. The loss of worm's viability was confirmed by the MTT assay and was similar to the motility results. These concentrations, including 10 microg ml(-1), prevented microfilarial release by females in a concentration- and time-dependent manner. Concentrations higher than 100 microg ml(-1) even induced mortality of the microfilariae. The present study suggested that the ethanol extract of Neurolaena lobata has potential macro- and micro-filaricidal activities.

  11. Reactive oxygen species production and Brugia pahangi survivorship in Aedes polynesiensis with artificial Wolbachia infection types.

    Directory of Open Access Journals (Sweden)

    Elizabeth S Andrews

    Full Text Available Heterologous transinfection with the endosymbiotic bacterium Wolbachia has been shown previously to induce pathogen interference phenotypes in mosquito hosts. Here we examine an artificially infected strain of Aedes polynesiensis, the primary vector of Wuchereria bancrofti, which is the causative agent of Lymphatic filariasis (LF throughout much of the South Pacific. Embryonic microinjection was used to transfer the wAlbB infection from Aedes albopictus into an aposymbiotic strain of Ae. polynesiensis. The resulting strain (designated "MTB" experiences a stable artificial infection with high maternal inheritance. Reciprocal crosses of MTB with naturally infected wild-type Ae. polynesiensis demonstrate strong bidirectional incompatibility. Levels of reactive oxygen species (ROS in the MTB strain differ significantly relative to that of the wild-type, indicating an impaired ability to regulate oxidative stress. Following a challenge with Brugia pahangi, the number of filarial worms achieving the infective stage is significantly reduced in MTB as compared to the naturally infected and aposymbiotic strains. Survivorship of MTB differed significantly from that of the wild-type, with an interactive effect between survivorship and blood feeding. The results demonstrate a direct correlation between decreased ROS levels and decreased survival of adult female Aedes polynesiensis. The results are discussed in relation to the interaction of Wolbachia with ROS production and antioxidant expression, iron homeostasis and the insect immune system. We discuss the potential applied use of the MTB strain for impacting Ae. polynesiensis populations and strategies for reducing LF incidence in the South Pacific.

  12. [Biotechnological aspects in "loco" larvae].

    Science.gov (United States)

    Inestrosa, N C; Labarca, R; Perelman, A; Campos, E O; Araneda, R; González, M; Brandan, E; Sánchez, J P; González-Plaza, R

    1990-10-01

    The biology of planktotrophic larvae of Concholepas concholepas is the main bottleneck towards developing biotechnologies to rear this muricid. Data concerning planktonic larvae development, diets and environmental signals triggering larval settlement and recruitment is scarce. We have begun the study of the molecular and cell biology of embryos, larvae and recruits having as a final goal, the development of appropriate biotechnologies to rear this gastropod. First, an inverse ratio between BuChE and AChE enzyme activities was established. This ratio may be a precise developmental marker for this species. Second, for the first time a phosphoinositide related regulatory pathway is reported in a muricid, opening a new approach to the biotechnological management of larvae. Third, the relation between sulfate in sea water and larval motility was studied. Concentrations below 125 microM sulfate decreases larval motility. The sulfate is incorporated in proteoglycans which participate in different developmental phenomena. Lastly, a genomic Concholepas concholepas DNA sequence, similar to that of a human growth hormone probe was detected. This is very interesting since growth factors are key molecules during development, growth and are involved in food conversion rates in fish and also, in a variety of marine invertebrates.

  13. SEBARAN LARVA IKAN DAN KAITANNYA DENGAN KONDISI OSEANOGRAFI LAUT SULAWESI

    Directory of Open Access Journals (Sweden)

    Khairul Amri

    2015-06-01

    Full Text Available Laut Sulawesi diketahui sebagai daerah penangkapan ikan yang potensial sekaligus diduga sebagai lokasi pemijahan. Berbagai jenis larva ikan pelagis maupun demersal ditemukan di perairan ini. Kelimpahan dan sebaran larva ikan di suatu perairan sangat dipengaruhi oleh kondisi oseanografi seperti temperatur, salinitas dan sejumlah parameter lainnya termasuk ketersediaan pakan. Untuk mengetahui pengaruh parameter oseanografi terhadap kelimpahan dan sebaran spasial larva ikan di Laut Sulawesi, telah dilakukan penelitian menggunakan kapal riset KR Baruna Jaya VII pada Oktober 2012. Parameter oseanografi yaitu temperatur dan salinitas diukur menggunakan iCTD dan sampling larva menggunakan bonggo net pada 18 stasiun pengukuran. Analisa hubungan kondisi oseanografi dengan sebaran larva dilakukan secara deskriptif dan pemetaan sebarannya dilakukan secara spasial. Hasil menunjukan keterkaitan sejumlah parameter oseanografi dengan kelimpahan dan sebaran spasial larva ikan. Sebaran larva famili Scombroidae dominan berada pada perairan bersalinitas tinggi karena merupakan jenis ikan oseanik. Larva ikan demersal banyak ditemukan di perairan sekitar Kep.Sangihe Talaud. Kelimpahan larva tertinggi ditemukan di perairan bagian utara dan barat lokasi penelitian dimana kelimpahan plankton tinggi ditemukan.   Celebes Sea is known as a potential fishing and spawning grounds for several pelagic fish species. Abundance and distribution of fish larvae are allegedly linked to oceanographic conditions such as temperature, salinity and others oceanographic parameters including food availablity. To see the effect of oceanographic on the abundance and spatial distribution of fish larvae in the Celebes Sea, has conducted a research in October 2012using the research vessel KR Baruna Jaya VII. The measurement of oceanographic parameters including temperature and salinity and larval sampling were done respectively by using iCTD and Bonggo net at 18 measuring stations. The

  14. Tools for automating the imaging of zebrafish larvae.

    Science.gov (United States)

    Pulak, Rock

    2016-03-01

    The VAST BioImager system is a set of tools developed for zebrafish researchers who require the collection of images from a large number of 2-7 dpf zebrafish larvae. The VAST BioImager automates larval handling, positioning and orientation tasks. Color images at about 10 μm resolution are collected from the on-board camera of the system. If images of greater resolution and detail are required, this system is mounted on an upright microscope, such as a confocal or fluorescence microscope, to utilize their capabilities. The system loads a larvae, positions it in view of the camera, determines orientation using pattern recognition analysis, and then more precisely positions to user-defined orientation for optimal imaging of any desired tissue or organ system. Multiple images of the same larva can be collected. The specific part of each larva and the desired orientation and position is identified by the researcher and an experiment defining the settings and a series of steps can be saved and repeated for imaging of subsequent larvae. The system captures images, then ejects and loads another larva from either a bulk reservoir, a well of a 96 well plate using the LP Sampler, or individually targeted larvae from a Petri dish or other container using the VAST Pipettor. Alternative manual protocols for handling larvae for image collection are tedious and time consuming. The VAST BioImager automates these steps to allow for greater throughput of assays and screens requiring high-content image collection of zebrafish larvae such as might be used in drug discovery and toxicology studies. Copyright © 2015 The Author. Published by Elsevier Inc. All rights reserved.

  15. Regional distribution of Paenibacillus larvae subspecies larvae, the causative organism of American foulbrood, in honey bee colonies of the Western United States.

    Science.gov (United States)

    Eischen, Frank A; Graham, R Henry; Cox, Robert

    2005-08-01

    We examined honey bee, Apis mellifera L., colonies pollinating almonds in California during February 2003 for Paenibacillus larvae subsp. Larvae, the causative organism of the virulent brood disease American foulbrood. Colonies originating from the Rocky Mountain area and California had significantly higher numbers (P bees, respectively) than colonies from the upper Midwest (1.28). Colonies from the northwestern, central, and southwestern United States had intermediate CFU or bacterial colony levels. Operations positive for P. larvae larvae were relatively uniform at approximately 70-80%, and no regional significant differences were found. Percentages of colonies with high CFUs (> or = 400 per 30 bees) differed significantly, with those from the Rocky Mountain region having 8.73% compared with those of the upper Midwest with 0%. The significance of CFU levels was evaluated by inoculating healthy colonies with diseased immatures and sampling adult bees. The number of CFUs detected per diseased immature was conservatively estimated to be approximately 399 CFUs per 30 adult bees. We defined this spore level as 1 disease equivalent. Based on this, 3.86% colonies in our survey had 1 or more disease equivalent number of P. larvae larvae CFUs. Operations with high P. larvae larvae spore levels in their colonies will likely observe American foulbrood if prophylaxis is not practiced diligently.

  16. Effect of gamma rays on the larvae of Rhipicephalus bursa

    International Nuclear Information System (INIS)

    Gecheva, G.

    1979-01-01

    Rhipicephalus bursa larvae were exposed to a single acute gamma-irradiation from cobalt 60 source in doses from 0.5 to 40 kiloroentgen (kr). Doses higher than 20 kr rilled the larvae, lower than 10 kr produced disturbances in tick development, dependent on radiation; larvae irradiated with 2 to 3 kr started sucking blood as larvae ordinarily do, but could not undergo metamorphosis; larvae irradiated with lower doses (0.5 and 1 kr) had a prolonged metamorphosis, the onset of oviposition was delayed and the percentage of hatched second generation larvae was reduced. (A.B.)

  17. A Madurella mycetomatis Grain Model in Galleria mellonella Larvae.

    Directory of Open Access Journals (Sweden)

    Wendy Kloezen

    Full Text Available Eumycetoma is a chronic granulomatous subcutaneous infectious disease, endemic in tropical and subtropical regions and most commonly caused by the fungus Madurella mycetomatis. Interestingly, although grain formation is key in mycetoma, its formation process and its susceptibility towards antifungal agents are not well understood. This is because grain formation cannot be induced in vitro; a mammalian host is necessary to induce its formation. Until now, invertebrate hosts were never used to study grain formation in M. mycetomatis. In this study we determined if larvae of the greater wax moth Galleria mellonella could be used to induce grain formation when infected with M. mycetomatis. Three different M. mycetomatis strains were selected and three different inocula for each strain were used to infect G. mellonella larvae, ranging from 0.04 mg/larvae to 4 mg/larvae. Larvae were monitored for 10 days. It appeared that most larvae survived the lowest inoculum, but at the highest inoculum all larvae died within the 10 day observation period. At all inocula tested, grains were formed within 4 hours after infection. The grains produced in the larvae resembled those formed in human and in mammalian hosts. In conclusion, the M. mycetomatis grain model in G. mellonella larvae described here could serve as a useful model to study the grain formation and therapeutic responses towards antifungal agents in the future.

  18. Coral larvae move toward reef sounds

    NARCIS (Netherlands)

    Vermeij, M.J.A.; Marhaver, K.L.; Huijbers, C.M.; Nagelkerken, I.; Simpson, S.D.

    2010-01-01

    Free-swimming larvae of tropical corals go through a critical life-phase when they return from the open ocean to select a suitable settlement substrate. During the planktonic phase of their life cycle, the behaviours of small coral larvae (<1 mm) that influence settlement success are difficult to

  19. Complete Genome Sequence of Paenibacillus larvae MEX14, Isolated from Honey Bee Larvae from the Xochimilco Quarter in Mexico City.

    Science.gov (United States)

    Peréz de la Rosa, D; Pérez de la Rosa, J J; Cossio-Bayugar, R; Miranda-Miranda, E; Lozano, L; Bravo-Díaz, M A; Rocha-Martínez, M K; Sachman-Ruiz, B

    2015-08-27

    Paenibacillus larvae strain MEX14 is a facultative anaerobic endospore-forming bacterium that infects Apis mellifera larvae. Strain MEX14 was isolated from domestic bee larvae collected in a backyard in Mexico City. The estimated genome size was determined to be 4.18 Mb, and it harbors 4,806 protein coding genes (CDSs). Copyright © 2015 Peréz de la Rosa et al.

  20. Sun-Compass Orientation in Mediterranean Fish Larvae.

    Science.gov (United States)

    Faillettaz, Robin; Blandin, Agathe; Paris, Claire B; Koubbi, Philippe; Irisson, Jean-Olivier

    2015-01-01

    Mortality is very high during the pelagic larval phase of fishes but the factors that determine recruitment success remain unclear and hard to predict. Because of their bipartite life history, larvae of coastal species have to head back to the shore at the end of their pelagic episode, to settle. These settlement-stage larvae are known to display strong sensory and motile abilities, but most work has been focused on tropical, insular environments and on the influence of coast-related cues on orientation. In this study we quantified the in situ orientation behavior of settlement-stage larvae in a temperate region, with a continuous coast and a dominant along-shore current, and inspected both coast-dependent and independent cues. We tested six species: one Pomacentridae, Chromis chromis, and five Sparidae, Boops boops, Diplodus annularis, Oblada melanura, Spicara smaris and Spondyliosoma cantharus. Over 85% of larvae were highly capable of keeping a bearing, which is comparable to the orientation abilities of tropical species. Sun-related cues influenced the precision of bearing-keeping at individual level. Three species, out of the four tested in sufficient numbers, oriented significantly relative to the sun position. These are the first in situ observations demonstrating the use of a sun compass for orientation by wild-caught settlement-stage larvae. This mechanism has potential for large-scale orientation of fish larvae globally.

  1. Sun-Compass Orientation in Mediterranean Fish Larvae.

    Directory of Open Access Journals (Sweden)

    Robin Faillettaz

    Full Text Available Mortality is very high during the pelagic larval phase of fishes but the factors that determine recruitment success remain unclear and hard to predict. Because of their bipartite life history, larvae of coastal species have to head back to the shore at the end of their pelagic episode, to settle. These settlement-stage larvae are known to display strong sensory and motile abilities, but most work has been focused on tropical, insular environments and on the influence of coast-related cues on orientation. In this study we quantified the in situ orientation behavior of settlement-stage larvae in a temperate region, with a continuous coast and a dominant along-shore current, and inspected both coast-dependent and independent cues. We tested six species: one Pomacentridae, Chromis chromis, and five Sparidae, Boops boops, Diplodus annularis, Oblada melanura, Spicara smaris and Spondyliosoma cantharus. Over 85% of larvae were highly capable of keeping a bearing, which is comparable to the orientation abilities of tropical species. Sun-related cues influenced the precision of bearing-keeping at individual level. Three species, out of the four tested in sufficient numbers, oriented significantly relative to the sun position. These are the first in situ observations demonstrating the use of a sun compass for orientation by wild-caught settlement-stage larvae. This mechanism has potential for large-scale orientation of fish larvae globally.

  2. Generation and selection of naïve Fab library for parasitic antigen: Anti-BmSXP antibodies for lymphatic filariasis.

    Science.gov (United States)

    Omar, Noorsharmimi; Hamidon, Nurul Hamizah; Yunus, Muhammad Hafiznur; Noordin, Rahmah; Choong, Yee Siew; Lim, Theam Soon

    2018-05-01

    Phage display has been applied successfully as a tool for the generation of monoclonal antibodies (mAbs). Naive antibody libraries are unique as they are able to overcome several limitations associated with conventional mAb generation methods like the hybridoma technology. Here, we performed an in vitro selection and generation of Fab antibodies against Brugia malayi SXP protein (BmSXP), a recombinant antigen for the detection of lymphatic filariasis. We developed a naïve multi ethnic Fab antibody library with an estimated diversity of 2.99 × 10 9 . The antibody library was used to screen for mAbs against BmSXP recombinant antigen. Soluble monoclonal Fab antibodies against BmSXP were successfully isolated from the naïve library. The Fab antibodies obtained were expressed and analyzed to show its binding capability. The diversity obtained from a pool of donors from various ethnic groups allowed for a diverse antibody library to be generated. The mAbs obtained were also functional in soluble form, which makes it useful for further downstream applications. We believe that the Fab mAbs are valuable for further studies and could also contribute to improvements in the diagnosis of filariasis. © 2017 International Union of Biochemistry and Molecular Biology, Inc.

  3. Vector competence of Aedes aegypti mosquitoes for filarial nematodes is affected by age and nutrient limitation.

    Science.gov (United States)

    Ariani, Cristina V; Juneja, Punita; Smith, Sophia; Tinsley, Matthew C; Jiggins, Francis M

    2015-01-01

    Mosquitoes are one of the most important vectors of human disease. The ability of mosquitoes to transmit disease is dependent on the age structure of the population, as mosquitoes must survive long enough for the parasites to complete their development and infect another human. Age could have additional effects due to mortality rates and vector competence changing as mosquitoes senesce, but these are comparatively poorly understood. We have investigated these factors using the mosquito Aedes aegypti and the filarial nematode Brugia malayi. Rather than observing any effects of immune senescence, we found that older mosquitoes were more resistant, but this only occurred if they had previously been maintained on a nutrient-poor diet of fructose. Constant blood feeding reversed this decline in vector competence, meaning that the number of parasites remained relatively unchanged as mosquitoes aged. Old females that had been maintained on fructose also experienced a sharp spike in mortality after an infected blood meal ("refeeding syndrome") and few survived long enough for the parasite to develop. Again, this effect was prevented by frequent blood meals. Our results indicate that old mosquitoes may be inefficient vectors due to low vector competence and high mortality, but that frequent blood meals can prevent these effects of age. Copyright © 2014 Elsevier Inc. All rights reserved.

  4. Phylum-Level Conservation of Regulatory Information in Nematodes despite Extensive Non-coding Sequence Divergence

    Science.gov (United States)

    Gordon, Kacy L.; Arthur, Robert K.; Ruvinsky, Ilya

    2015-01-01

    Gene regulatory information guides development and shapes the course of evolution. To test conservation of gene regulation within the phylum Nematoda, we compared the functions of putative cis-regulatory sequences of four sets of orthologs (unc-47, unc-25, mec-3 and elt-2) from distantly-related nematode species. These species, Caenorhabditis elegans, its congeneric C. briggsae, and three parasitic species Meloidogyne hapla, Brugia malayi, and Trichinella spiralis, represent four of the five major clades in the phylum Nematoda. Despite the great phylogenetic distances sampled and the extensive sequence divergence of nematode genomes, all but one of the regulatory elements we tested are able to drive at least a subset of the expected gene expression patterns. We show that functionally conserved cis-regulatory elements have no more extended sequence similarity to their C. elegans orthologs than would be expected by chance, but they do harbor motifs that are important for proper expression of the C. elegans genes. These motifs are too short to be distinguished from the background level of sequence similarity, and while identical in sequence they are not conserved in orientation or position. Functional tests reveal that some of these motifs contribute to proper expression. Our results suggest that conserved regulatory circuitry can persist despite considerable turnover within cis elements. PMID:26020930

  5. Assembly of the Genome of the Disease Vector Aedes aegypti onto a Genetic Linkage Map Allows Mapping of Genes Affecting Disease Transmission

    KAUST Repository

    Juneja, Punita

    2014-01-30

    The mosquito Aedes aegypti transmits some of the most important human arboviruses, including dengue, yellow fever and chikungunya viruses. It has a large genome containing many repetitive sequences, which has resulted in the genome being poorly assembled - there are 4,758 scaffolds, few of which have been assigned to a chromosome. To allow the mapping of genes affecting disease transmission, we have improved the genome assembly by scoring a large number of SNPs in recombinant progeny from a cross between two strains of Ae. aegypti, and used these to generate a genetic map. This revealed a high rate of misassemblies in the current genome, where, for example, sequences from different chromosomes were found on the same scaffold. Once these were corrected, we were able to assign 60% of the genome sequence to chromosomes and approximately order the scaffolds along the chromosome. We found that there are very large regions of suppressed recombination around the centromeres, which can extend to as much as 47% of the chromosome. To illustrate the utility of this new genome assembly, we mapped a gene that makes Ae. aegypti resistant to the human parasite Brugia malayi, and generated a list of candidate genes that could be affecting the trait. © 2014 Juneja et al.

  6. Phylum-Level Conservation of Regulatory Information in Nematodes despite Extensive Non-coding Sequence Divergence.

    Directory of Open Access Journals (Sweden)

    Kacy L Gordon

    2015-05-01

    Full Text Available Gene regulatory information guides development and shapes the course of evolution. To test conservation of gene regulation within the phylum Nematoda, we compared the functions of putative cis-regulatory sequences of four sets of orthologs (unc-47, unc-25, mec-3 and elt-2 from distantly-related nematode species. These species, Caenorhabditis elegans, its congeneric C. briggsae, and three parasitic species Meloidogyne hapla, Brugia malayi, and Trichinella spiralis, represent four of the five major clades in the phylum Nematoda. Despite the great phylogenetic distances sampled and the extensive sequence divergence of nematode genomes, all but one of the regulatory elements we tested are able to drive at least a subset of the expected gene expression patterns. We show that functionally conserved cis-regulatory elements have no more extended sequence similarity to their C. elegans orthologs than would be expected by chance, but they do harbor motifs that are important for proper expression of the C. elegans genes. These motifs are too short to be distinguished from the background level of sequence similarity, and while identical in sequence they are not conserved in orientation or position. Functional tests reveal that some of these motifs contribute to proper expression. Our results suggest that conserved regulatory circuitry can persist despite considerable turnover within cis elements.

  7. PERKEMBANGAN AWAL LARVA KERAPU KERTANG (Epinephelus lanceolatus

    Directory of Open Access Journals (Sweden)

    Philip Teguh Imanto

    2016-11-01

    Full Text Available Observasi pada larva kerapu kertang (E. lanceolatus dilaksanakan di Balai Besar Riset Perikanan Budidaya Laut (BBRPBL, Gondol-Bali, untuk mengumpulkan informasi dasar tentang perkembangan awal morfologi larva yang penting untuk menunjang keberhasilan pembenihannya. Larva berasal dari telur hasil pemijahan yang dirangsang dengan hormon (di Taiwan dan ditransportasikan segera setelah menetas (D-0 melalui transportasi udara ke laboratotium pembenihan BBRPBL, Gondol. Pengamatan dilakukan dengan memanfaatkan fasilitas tangki 500 L dengan sistem air resirkulasi. Dari data yang dihimpun diketahui bahwa rata-rata panjang total larva (D-1 2,48 mm; D-8 3,17 mm; dan tumbuh dengan cepat mencapai 10,79 mm pada D-19. Kuning telur larva yang berumur sehari (D-1 rata-rata bervolume 150,3 x 10-4 mm3 dan pada hari ketiga terserap 42,61% dan habis pada hari keempat (D-4. Butir minyak larva D-1 sebesar 41,9 x 10-4 mm3 dan masih tersisa sebesar 0,34 x 10-4 mm3 sampai dengan D-6. Mulut larva diperhitungkan sudah mencapai lebar sebesar 200 μm pada D-2. dan mampu untuk memangsa rotifer sejalan dengan pigmentasi mata yang mulai terjadi pada D-2 dan sempurna pada D-3. Dari analisis pertumbuhan terjadi titik belok (flexion point pada D-8 dan setelah itu terjadi kurva pertumbuhan yang cepat y= 0,6747x-2,5508. Berdasarkan hasil observasi tersebut maka pemberian pakan awal untuk larva kerapu kertang sudah bisa diberikan pada D-2 akhir (sore, pada D-8 komposisi pakan alami sudah harus diubah dengan memberikan pakan yang lebih besar dan bernutrisi tinggi. Observation on early development of E. lanceolatus larvae have been conducted in laboratory condition at Gondol Research Institute for Mariculture (GRIM Bali; the purpose was to gain basic data mainly on the larval development stage to support both larval rearing and aquaculture technique of this species. The larvae from egg were produced by induced spawning technique and transported on D-0 to GRIM. Observation have been

  8. Radiosensitivity of spores of Paenibacillus larvae ssp. larvae in honey

    Energy Technology Data Exchange (ETDEWEB)

    Almeida, Wanderley Mendes de [Ministerio da Agricultura, Pecuaria e Abastecimento, Rio de Janeiro, RJ (Brazil). Servico de Inspecao de Produtos de Origem Animal]. E-mail: sipa-rj@agricultura.gov.br; Vital, Helio de Carvalho [Centro Tecnologico do Exercito CTEx, Rio de Janeiro, RJ (Brazil). Div. de Defesa Quimica, Biologica e Nuclear]. E-mail: vital@ctex.eb.br; Schuch, Dulce Maria Tocchetto [Ministerio da Agricultura, Pecuaria e Abastecimento, Porto Alegre, RS (Brazil)]. E-mail: micro-lara-rs@agricultura.gov.br

    2007-07-01

    Irradiation, usually used in combination with other conventional methods of conservation, has been proven to be an efficient tool to ensure the safety of many types of foods by destroying pathogenic microorganisms and extending their shelf-lives. This work has investigated the efficacy of gamma irradiation to inactivate spores of the bacterium Paenibacillus larvae that causes the 'American foulbrood', a highly contagious disease still exotic in Brazil that kills bees and contaminates honey, preventing its commercialization and causing great economical losses. In this study, 60 g samples of two types of honey inoculated with 3.5x10{sup 3} spores/mL of that bacterium were irradiated with doses of 0, 5, 7.5, 10, 12.5 and 15 kGy and counted. The analyses indicated a mean reduction of 97.5{+-}0.7% in the number of viable spores exposed to 5 kGy. The application of doses of 7.5 kGy or higher yielded no viable spores above the detection threshold (10/mL). In addition the value of D{sub 10} (3.1{+-}0.3 kGy) was estimated and the logarithm of the population of viable spores of Paenibacillus larvae subsp. larvae was determined as linear and quadratic polynomial functions of the radiation dose. The results indicated that the dose of 10 kGy could be insufficient to assure complete sterilization of honey in some cases while suggesting that 25 kGy would perform such task adequately. (author)

  9. Radiolabeling of infective third-stage larvae of Strongyloides stercoralis by feeding [75Se]selenomethionine-labeled Escherichia coli to first- and second-stage larvae

    International Nuclear Information System (INIS)

    Aikens, L.M.; Schad, G.A.

    1989-01-01

    A technique is described for radiolabeling Strongyloides stercoralis larvae with [ 75 Se]selenomethionine. Cultures of an auxotrophic methionine-dependent stain of Escherichia coli were grown in a medium containing Dulbecco's modified Eagle's medium supplemented with 5% nutrient broth, amino acids, and [ 75 Se]selenomethionine. When the 75 Se-labeled bacterial populations were in the stationary phase of growth, cultures were harvested and the bacteria dispersed on agar plates to serve as food for S. stercoralis larvae. Use of nondividing bacteria is important for successful labeling because the isotope is not diluted by cell division and death of larvae attributable to overgrowth by bacteria is prevented. First-stage S. stercoralis larvae were recovered from feces of infected dogs and reared in humid air at 30 C on agar plates seeded with bacteria. After 7 days, infective third-stage larvae were harvested. The mean specific activity of 6 different batches of larvae ranged from 75 to 330 counts per min/larva with 91.8 +/- 9.5% of the population labeled sufficiently to produce an autoradiographic focus during a practicable, 6-wk period of exposure. Labeled infective larvae penetrated the skin of 10-day-old puppies and migrated to the small intestine, where the developed to adulthood

  10. Alimentação e comportamento de larvas de pacu, Piaractus mesopotamicus (Holmberg, 1887 Feeding and behavior of pacu, Piaractus mesopotamicus (Holmberg, 1887 larvae

    Directory of Open Access Journals (Sweden)

    Eduardo Lopes Beerli

    2004-02-01

    Full Text Available Conduziu-se este trabalho com o objetivo de avaliar o efeito da utilização de dietas naturais e artificiais sobre o desempenho e comportamento de larvas de pacu (Piaractus mesopotamicus, entre o 2º e o 10º dia de vida. Foram utilizadas 30 caixas plásticas, cada uma com 30 litros de água e renovação contínua, onde as larvas foram mantidas durante o período experimental. Cada caixa recebeu 10 larvas por litro, totalizando 300 larvas/caixa. Foram testados 6 tratamentos, cada qual com 5 repetições. Os tratamentos foram: T1-ração, T2-plâncton, T3-artêmia, T4-plâncton + ração, T5-artêmia + ração e T6-artêmia + plâncton. As larvas foram alimentadas 6 vezes ao dia, nos horários de 4, 8, 12, 16, 20 e 24 horas. A temperatura da água foi mantida constante a 27ºC, o oxigênio dissolvido permaneceu na faixa de 6,16 ± 0,34 e o pH, entre 7,16 ± 0,22. Aos 2, 4, 6, 8 e 10 dias de vida, foram coletadas amostras de 30 larvas para determinação do comprimento total e peso. No final do experimento (10º dia, as larvas que receberam artêmia + plâncton (T6 alcançaram os maiores valores de comprimento total (8,35 mm e peso corporal (3518 µg, em relação a todas as outras dietas testadas. As larvas devem permanecer em laboratório por um período de 6 dias após a eclosão, recebendo alimento do terceiro ao sexto dia. A partir do sexto dia, as larvas estão com a vesícula gasosa completamente inflada e apresentam nado contínuo.The objective of this research was to evaluate the effect of natural and artificial diets on the development and behavior of pacu (Piaractus mesopotamicus larvae, between the 2nd and 10th day post hatch. The larvaes were kept in 30L - plastic boxes (n = 30 boxes, in constant flow-through. The larvae density was 10 post-larvae/L (300 larvae/box. Six diets with 4 sampling days (4, 6, 8 and 10 days post-hatch, n = 30 larvae using 5 repetitions were tested. The diets were: T1- commercial feed, T2- plancton, T3

  11. Effect of gamma radiation on the Mediterranean flour moth, Ephestia Kuehniella, mature larvae and acceptability of irradiated larvae by Bracon hebetor females

    International Nuclear Information System (INIS)

    Mansour, M.

    2011-06-01

    Mediterranean flour moth, Ephestia kuehniella, mature 5 t h instar larvae were exposed to gamma radiation dosages ranging from 50-350 Gy at 50 Gy increment and the effects of gamma radiation on pupation, adult emergence and sex ratio were investigated. In addition, effects of irradiation on the rate of development to pupae and adults and the acceptance of irradiated larvae by B. hebetor females were examined. Results showed that the radio-sensitivity of E. kuehniella larvae increased with increasing dose. Pupation was significantly affected at 100 Gy dose, and completely prevented at 350 Gy dose. Adult emergence was only slightly different from pupation; emergence was significantly affected at 100 Gy dose and completely prevented at 300 Gy dose. Irradiation also negatively affected the rate of development of larvae to pupae and adults. While more than 98% of control larvae pupated within 10 days of treatment, this ratio decreased to about 79% in larvae exposed to 50 Gy and less than 4% in larvae exposed to 100 Gy dose. The rate of development to the adult stage was also similarly affected. While 97% of control insects emerged as adults in the 1st 20 days of treatment, this ratio decreased to about 53, 2 and zero percent in larvae exposed to 50, 100 and 150 Gy dose respectively. In addition, irradiation significantly affected male: female ratio; sex ratio was skewed in favor of males, and at 250 Gy dose all emerged moths were males. Furthermore, irradiation had no adverse effect on the degree of acceptance of mature larvae to parasitization; irradiated insects were as acceptable to B. hebetor females as unirradiated ones. (author)

  12. Effect of gamma radiation on the Mediterranean flour moth, Ephestia Kuehniella, mature larvae and acceptability of irradiated larvae by Bracon hebetor female

    International Nuclear Information System (INIS)

    Mansour, M.

    2012-01-01

    Mediterranean flour moth, Ephestia kuehniella, mature 5 t h instar larvae were exposed to gamma radiation dosages ranging from 50-350 Gy at 50 Gy increment and the effects of gamma radiation on pupation, adult emergence and sex ratio were investigated. In addition, effects of irradiation on the rate of development to pupae and adults and the acceptance of irradiated larvae by B. hebetor females were examined. Results showed that the radio-sensitivity of E. kuehniella larvae increased with increasing dose. Pupation was significantly affected at 100 Gy dose, and completely prevented at 350 Gy dose. Adult emergence was only slightly different from pupation; emergence was significantly affected at 100 Gy dose and completely prevented at 300 Gy dose. Irradiation also negatively affected the rate of development of larvae to pupae and adults. While more than 98% of control larvae pupated within 10 days of treatment, this ratio decreased to about 79% in larvae exposed to 50 Gy and less than 4% in larvae exposed to 100 Gy dose. The rate of development to the adult stage was also similarly affected. While 97% of control insects emerged as adults in the 1st 20 days of treatment, this ratio decreased to about 53, 2 and zero percent in larvae exposed to 50, 100 and 150 Gy dose respectively. In addition, irradiation significantly affected male: female ratio; sex ratio was skewed in favor of males, and at 250 Gy dose all emerged moths were males. Furthermore, irradiation had no adverse effect on the degree of acceptance of mature larvae to parasitization; irradiated insects were as acceptable to B. hebetor females as unirradiated ones. (author)

  13. Self-heating by large insect larvae?

    Science.gov (United States)

    Cooley, Nikita L; Emlen, Douglas J; Woods, H Arthur

    2016-12-01

    Do insect larvae ever self-heat significantly from their own metabolic activity and, if so, under what sets of environmental temperatures and across what ranges of body size? We examine these questions using larvae of the Japanese rhinoceros beetle (Trypoxylus dichotomus), chosen for their large size (>20g), simple body plan, and underground lifestyle. Using CO 2 respirometry, we measured larval metabolic rates then converted measured rates of gas exchange into rates of heat production and developed a mathematical model to predict how much steady state body temperatures of underground insects would increase above ambient depending on body size. Collectively, our results suggest that large, extant larvae (20-30g body mass) can self-heat by at most 2°C, and under many common conditions (shallow depths, moister soils) would self-heat by less than 1°C. By extending the model to even larger (hypothetical) body sizes, we show that underground insects with masses >1kg could heat, in warm, dry soils, by 1.5-6°C or more. Additional experiments showed that larval critical thermal maxima (CT max ) were in excess of 43.5°C and that larvae could behaviorally thermoregulate on a thermal gradient bar. Together, these results suggest that large larvae living underground likely regulate their temperatures primarily using behavior; self-heating by metabolism likely contributes little to their heat budgets, at least in most common soil conditions. Copyright © 2016 Elsevier Ltd. All rights reserved.

  14. Efecto de la temperatura sobre la viabilidad de larvas de Trichinella spiralis Effect of temperature on the viability of Trichinella spiralis larvae

    Directory of Open Access Journals (Sweden)

    Viviana R Randazzo

    2011-12-01

    Full Text Available El objetivo de este estudio fue determinar el efecto de diferentes temperaturas sobre la viabilidad de larvas libres y enquistadas de Trichinella spiralis aisladas en el sudoeste de la provincia de Buenos Aires, Argentina. Se trataron larvas libres y enquistadas a diferentes temperaturas (-30 °C, -20 °C, 4 °C, 20 °C, calentamiento gradual entre 0-100 °C. Se determinó el tiempo necesario para matar el 100 % de las larvas. Durante los primeros días, la mortalidad larvaria en todos los tratamientos con frío aumentó signifcativamente en función del tiempo. En todos los casos, las larvas libres sobrevivieron menor cantidad de días que las enquistadas. A -30 °C, -20 °C y 20 °C no se observaron diferencias signifcativas entre las curvas de mortalidad de cada estadio larvario, pero a 4 °C la mortalidad fue menos intensa entre las larvas enquistadas. El calentamiento disminuyó la viabilidad, sin observarse diferencias entre estadios larvarios. La totalidad de las larvas libres y enquistadas había muerto a los 61 y 95 días (-30 °C, a los 160 y 180 días (-20 °C, a los 280 y 330 días (4° C, y a los 460 y 590 días (20 °C, respectivamente. Fue necesaria una cocción durante 15 minutos a 90 °C para matar al 100 % de las larvas libres y a 100 °C para lograr igual mortalidad de las enquistadas. Nuestros resultados indican que la temperatura y los tiempos tradicionalmente utilizados para tratar productos cárnicos con potencial de transmisión de T. spiralis no serían los más efectivos para lograr la inactivación de la totalidad de larvas vivas de este parásito.The aim of this work was to study the effect of temperature on the viability of free and encysted larvae of Trichinella spiralis from southwest Buenos Aires province, Argentina. Larvae were treated at variable temperatures (-30 °C, -20 °C, 4 °C, 20 °C, gradual heating between 0-100 °C. The time necessary to kill 100 % of larvae was calculated. During the frst days of

  15. Bacteria Present in Comadia redtenbacheri Larvae (Lepidoptera: Cossidae).

    Science.gov (United States)

    Hernández-Flores, L; Llanderal-Cázares, C; Guzmán-Franco, A W; Aranda-Ocampo, S

    2015-09-01

    The external and internal culturable bacterial community present in the larvae of Comadia redtenbacheri Hammerschmidt, an edible insect, was studied. Characterization of the isolates determined the existence of 18 morphotypes and phylogenetic analysis of the 16S rRNA gene revealed the existence of Paenibacillus sp., Bacillus safensis, Pseudomonas sp., Bacillus pseudomycoides, Corynebacterium variabile, Enterococcus sp., Gordonia sp., Acinetobacter calcoaceticus, Arthrobacter sp., Micrococcus sp., and Bacillus cereus. Greater diversity of bacteria was found in those larvae obtained from vendors than in those directly taken from Agave plants in nature. Many of the larvae obtained from vendors presented signs of potential disease, and after the analysis, results showed a greater bacterial community compared with the larvae with a healthy appearance. This indicates that bacterial flora can vary in accordance with how the larvae are handled during extraction, collection, and transport. © The Authors 2015. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  16. Immune responses of B. malayi thioredoxin (TRX) and venom allergen homologue (VAH) chimeric multiple antigen for lymphatic filariasis.

    Science.gov (United States)

    Anugraha, Gandhirajan; Jeyaprita, Parasurama Jawaharlal; Madhumathi, Jayaprakasam; Sheeba, Tamilvanan; Kaliraj, Perumal

    2013-12-01

    Although multiple vaccine strategy for lymphatic filariasis has provided tremendous hope, the choice of antigens used in combination has determined its success in the previous studies. Multiple antigens comprising key vaccine candidates from different life cycle stages would provide a promising strategy if the antigenic combination is chosen by careful screening. In order to analyze one such combination, we have used a chimeric construct carrying the well studied B. malayi antigens thioredoxin (BmTRX) and venom allergen homologue (BmVAH) as a fusion protein (TV) and evaluated its immune responses in mice model. The efficacy of fusion protein vaccine was explored in comparison with the single antigen vaccines and their cocktail. In mice, TV induced significantly high antibody titer of 1,28,000 compared to cocktail vaccine TRX+VAH (50,000) and single antigen vaccine TRX (16,000) or VAH (50,000). Furthermore, TV elicited higher level of cellular proliferative response together with elevated levels of IFN-γ, IL-4 and IL-5 indicating a Th1/Th2 balanced response. The isotype antibody profile showed significantly high level of IgG1 and IgG2b confirming the balanced response elicited by TV. Immunization with TV antigen induced high levels of both humoral and cellular immune responses compared to either cocktail or antigen given alone. The result suggests that TV is highly immunogenic in mice and hence the combination needs to be evaluated for its prophylactic potential.

  17. Antibacterial properties of grapefruit seed extract against Paenibacillus larvae subsp. larvae.

    Science.gov (United States)

    Semprini, P; Langella, V; Pasini, B; Falda, M T; Calvarese, S

    2004-01-01

    Twenty-one samples of grapefruit seed extract (GSE) either from marketed products or provided by an apiculturist were analysed to verify their inhibition activity, in particular against Paenibacillus larvae subsp. larvae, responsible for American foulbrood. The bactericide capacity of GSE has been measured in Bacillus subtilis BGA, Bacillus cereus 11778, Bacillus cereus K250 and Micrococcus luteus 9341a; these bacteria are normally used in the laboratory to study inhibitors. The results showed that not all GSE have the same inhibitory activity and two of those analysed do not inhibit the five bacteria used. Considering that 19 samples inhibited American foulbrood bacillus, the authors conclude that the use of a natural product (such as GSE) to control this important disease of bees, can be used as a substitute for chemotherapeutic products, after appropriate expedients.

  18. Feeding frequency and caste differentiation in Bombus terrestris larvae

    NARCIS (Netherlands)

    Ribeiro, M.F.; Velthuis, H.H.W.; Duchateau, Marie José; Tweel, I. van der

    1998-01-01

    The frequency with which bumble bee larvae are fed during their development was studied using video-recordings. The behaviour of the workers while feeding worker, male and queen larvae of Bombus terrestris was recorded. At the beginning of development, female larvae of both castes were fed at a

  19. Fish larvae from the Canary region in autumn

    Directory of Open Access Journals (Sweden)

    J. M. Rodríguez

    2000-03-01

    Full Text Available In this paper, the taxonomic composition of the fish larvae community in the Canary region in autumn 1991 is presented. In total, 8699 larvae belonging to 58 fish families were studied. 176 taxonomic groups were identified, 149 at species level and the rest were identified at a higher level. The most numerous family and the one that presented the greatest number of species was Myctophidae. The most frequently caught species was Cyclothone braueri. The taxonomic composition (at family level of the fish larvae community, dominated by four mesopelagic families, was typical of oceanic regions of warm waters. The most remarkable feature of the fish larvae community was its high specific diversity.

  20. Analysis of feeding behavior of Drosophila larvae on liquid food.

    Science.gov (United States)

    Shen, Ping

    2012-05-01

    The food responses of Drosophila larvae offer an excellent opportunity to study the genetic and neural regulation of feeding behavior. Compared with fed larvae, hungry larvae are more likely to display aggressive foraging, rapid food intake, compensatory feeding, and stress-resistant food procurement. Behavioral assays have been developed to quantitatively assess particular aspects of the hunger-driven food response. In combination, these assays help define the specific role of signaling molecules or neurons in the regulation of feeding behavior in foraging larvae. This protocol describes the analysis of larvae feeding on liquid food. The test is designed for quantitative assessment of the food ingestion rate of individual larvae under different energy states. It provides a simple and reliable way to measure the graded modification of the baseline feeding rate of larvae as food deprivation is prolonged. The test is applicable to routine functional testing and larger-scale screening of genetic mutations and biologics that might affect food consumption.

  1. Abscisic acid enhances cold tolerance in honeybee larvae.

    Science.gov (United States)

    Ramirez, Leonor; Negri, Pedro; Sturla, Laura; Guida, Lucrezia; Vigliarolo, Tiziana; Maggi, Matías; Eguaras, Martín; Zocchi, Elena; Lamattina, Lorenzo

    2017-04-12

    The natural composition of nutrients present in food is a key factor determining the immune function and stress responses in the honeybee ( Apis mellifera ). We previously demonstrated that a supplement of abscisic acid (ABA), a natural component of nectar, pollen, and honey, increases honeybee colony survival overwinter. Here we further explored the role of ABA in in vitro -reared larvae exposed to low temperatures. Four-day-old larvae (L4) exposed to 25°C for 3 days showed lower survival rates and delayed development compared to individuals growing at a standard temperature (34°C). Cold-stressed larvae maintained higher levels of ABA for longer than do larvae reared at 34°C, suggesting a biological significance for ABA. Larvae fed with an ABA-supplemented diet completely prevent the low survival rate due to cold stress and accelerate adult emergence. ABA modulates the expression of genes involved in metabolic adjustments and stress responses: Hexamerin 70b, Insulin Receptor Substrate, Vitellogenin , and Heat Shock Proteins 70. AmLANCL2, the honeybee ABA receptor, is also regulated by cold stress and ABA. These results support a role for ABA increasing the tolerance of honeybee larvae to low temperatures through priming effects. © 2017 The Author(s).

  2. Abscisic acid enhances cold tolerance in honeybee larvae

    Science.gov (United States)

    Sturla, Laura; Guida, Lucrezia; Vigliarolo, Tiziana; Maggi, Matías; Eguaras, Martín; Zocchi, Elena; Lamattina, Lorenzo

    2017-01-01

    The natural composition of nutrients present in food is a key factor determining the immune function and stress responses in the honeybee (Apis mellifera). We previously demonstrated that a supplement of abscisic acid (ABA), a natural component of nectar, pollen, and honey, increases honeybee colony survival overwinter. Here we further explored the role of ABA in in vitro-reared larvae exposed to low temperatures. Four-day-old larvae (L4) exposed to 25°C for 3 days showed lower survival rates and delayed development compared to individuals growing at a standard temperature (34°C). Cold-stressed larvae maintained higher levels of ABA for longer than do larvae reared at 34°C, suggesting a biological significance for ABA. Larvae fed with an ABA-supplemented diet completely prevent the low survival rate due to cold stress and accelerate adult emergence. ABA modulates the expression of genes involved in metabolic adjustments and stress responses: Hexamerin 70b, Insulin Receptor Substrate, Vitellogenin, and Heat Shock Proteins 70. AmLANCL2, the honeybee ABA receptor, is also regulated by cold stress and ABA. These results support a role for ABA increasing the tolerance of honeybee larvae to low temperatures through priming effects. PMID:28381619

  3. Effect of gut bacterial isolates from Apis mellifera jemenitica on Paenibacillus larvae infected bee larvae.

    Science.gov (United States)

    Al-Ghamdi, Ahmad; Ali Khan, Khalid; Javed Ansari, Mohammad; Almasaudi, Saad B; Al-Kahtani, Saad

    2018-02-01

    The probiotic effects of seven newly isolated gut bacteria, from the indegenous honey bees of Saudi Arabia were investigated. In vivo bioassays were used to investigate the effects of each gut bacterium namely, Fructobacillus fructosus (T1), Proteus mirabilis (T2), Bacillus licheniformis (T3), Lactobacillus kunkeei (T4), Bacillus subtilis (T5), Enterobacter kobei (T6), and Morganella morganii (T7) on mortality percentage of honey bee larvae infected with P. larvae spores along with negative control (normal diet) and positive control (normal diet spiked with P. larvae spores). Addition of gut bacteria to the normal diet significantly reduced the mortality percentage of the treated groups. Mortality percentage in all treated groups ranged from 56.67% up to 86.67%. T6 treated group exhibited the highest mortality (86.67%), whereas T4 group showed the lowest mortality (56.67%). Among the seven gut bacterial treatments, T4 and T3 decreased the mortality 56.67% and 66.67%, respectively, whereas, for T2, T6, and T7 the mortality percentage was equal to that of the positive control (86.67%). Mortality percentages in infected larval groups treated with T1, and T5 were 78.33% and 73.33% respectively. Most of the mortality occurred in the treated larvae during days 2 and 3. Treatments T3 and T4 treatments showed positive effects and reduced mortality.

  4. Workbook on Identification of Aedes Aegypti Larvae.

    Science.gov (United States)

    Pratt, Harry D.; And Others

    This self-instructional booklet is designed to enable yellow fever control workers to identify the larvae of "Aedes aegypti." The morphological features of mosquito larvae are illustrated in this partially programed text, and the distinguishing features of "A. aegypti" indicated. A glossary is included. (AL)

  5. Larvas migrans ganglionar: Presentación de un caso

    Directory of Open Access Journals (Sweden)

    María del Carmen Luis Álvarez

    2003-04-01

    Full Text Available Las larvas migrans visceral cuya causa radica en la infestación con larvas de toxocara canis o cati, ocurre más frecuentemente en niños menores de 10 años. Se presenta el caso de un niño de 8 años de edad en el cual se diagnosticó larvas migrans ganglionar. Se comentan aspectos etioepidemiológicos de la enfermedad, su cuadro clínico y evolución. Se hace énfasis en las medidas higiénicas sanitarias de control y manipulación de excretas de animales domésticos, en este caso de perros y gatos.Visceral larvae migrans caused by the infestation with larvae of toxocara canis or cati are more frequent among children under 10. The case of an 8-year-old boy who was diagnosed ganglionar larva migrans is presented. Comments are made on some etioepidemiological aspects of the disease, as well as on his clinical picture and evolution. Emphasis is made on the hygienic and sanitary measures of control and manipulation of stools from pegs as dogs and cats. Las larvas migrans visceral cuya causa radica en la infestación con larvas de toxocara canis o cati, ocurre más frecuentemente en niños menores de 10 años. Se presenta el caso de un niño de 8 años de edad en el cual se diagnosticó larvas migrans ganglionar. Se comentan aspectos etioepidemiológicos de la enfermedad, su cuadro clínico y evolución. se hace énfasis en las medidas higiénicas sanitarias de control y manipulación de excretas de animales domésticos, en este caso de perros y gatos.

  6. Fish larvae at fronts: Horizontal and vertical distributions of gadoid fish larvae across a frontal zone at the Norwegian Trench

    DEFF Research Database (Denmark)

    Munk, Peter

    2014-01-01

    The reproduction and early life history of many fish species are linked to the physical and biological characteristics of fronts. In order to ascertain linkages between frontal physics and fish larvae, we investigated distributional differences among gadoid fish larvae comparing these to both...... the vertical and horizontal distributions of each species. However, the three-dimensional pattern of distribution differed significantly among species of larvae and species of copepods. The study underlines the complexity of bio-physical interrelationships in the frontal zone, and indicates that the zone...

  7. Effects of the Liquids Used to Kill Larvae on the Length of Forensically Important Blow Fly Lucilia sericata Meigen (Diptera: Calliphoridae Larvae

    Directory of Open Access Journals (Sweden)

    Halide Nihal Açıkgöz

    2017-12-01

    Full Text Available Forensic entomological practices rely upon accurate larval identification and measurement of larval length, for the estimation of post-mortem intervals. The methods used for killing larvae may affect the length of larvae. In the autopsy hall, corpses which are contain entomological remains have been washed with grape vinegar. Besides, while collecting and killing the larvae on corpses, crime scene teams use alcohol 70% because it is practical. The aim of this study was to determine which of hot water (90°C, cold vinegar and cold alcohol 96 % method, preserved the best the length of larvae. To achieve this aim, third instar larvae which are reared on 200 g of veal meat were killed using hot water, cold vinegar and cold alcohol. Before killing and after killing the maggots, their length was measured. To determine the difference between the groups to be compared ANOVA test, to reliability and validity analyses Kruskal-Wallis and whether there was any difference between the groups were made with Tukey’s Honestly Significant Difference (Tukey’s HSD Hot water was found to preserve the length of the larvae more accurately than cold vinegar and alcohol.

  8. Intraguild predation and cannibalism among larvae of detritivorous caddisflies in subalpine wetlands

    Science.gov (United States)

    Wissinger, S.A.; Sparks, G.B.; Rouse, G.L.; Brown, W.S.; Steltzer, Heidi

    1996-01-01

    Comparative data from subalpine wetlands in Colorado indicate that larvae of the limnephilid caddisflies, Asynarchus nigriculus and Limnephilus externus, are reciprocally abundant among habitats - Limnephilus larvae dominate in permanent waters, whereas Asynarchus larvae dominate in temporary basins. The purpose of this paper is to report on field and laboratory experiments that link this pattern of abundance to biotic interactions among larvae. In the first field experiment, growth and survival were compared in single and mixed species treatments in littoral enclosures. Larvae, which eat mainly vascular plant detritus, grew at similar rates among treatments in both temporary and permanent habitats suggesting that exploitative competition is not important under natural food levels and caddisfly densities. However, the survival of Limnephilus larvae was reduced in the presence of Asynarchus larvae. Subsequent behavioral studies in laboratory arenas revealed that Asynarchus larvae are extremely aggressive predators on Limnephilus larvae. In a second field experiment we manipulated the relative sizes of larvae and found that Limnephilus larvae were preyed on only when Asynarchus larvae had the same size advantage observed in natural populations. Our data suggest that the dominance of Asynarchus larvae in temporary habitats is due to asymmetric intraguild predation (IGP) facilitated by a phenological head start in development. These data do not explain the dominance of Limnephilus larvae in permanent basins, which we show elsewhere to be an indirect effect of salamander predation. Behavioral observations also revealed that Asynarchus larvae are cannibalistic. In contrast to the IGP on Limnephilus larvae, Asynarchus cannibalism occurs among same-sized larvae and often involves the mobbing of one victim by several conspecifics. In a third field experiment, we found that Asynarchus cannibalism was not density-dependent and occurred even at low larval densities. We

  9. VECTORS OF MALARIA AND FILARIASIS IN INDONESIA

    Directory of Open Access Journals (Sweden)

    Hoedojo Hoedojo

    2012-09-01

    Full Text Available Malaria at present is still one of the important mosquito-borne diseases in Indonesia. The disease is widespread all over the country and involves nearly all islands. Sixteen Anopheles species have been reconfirmed as malaria vectors. They were distributed geographi­cally as follows: Coastal areas and lagoons ------------------------------------- An sundaicus and An.subpictus Cultivated ricefields and swampy areas -------------------- An.aconitus, An.barbirostris, An.nigerrimus and An.sinensis Forest inland areas in shaded temporary pools, muddy animal wallows and hoof-prints -------------------------------------------------------- An.balabacensis, An.bancrofti, An.farauti, An.koliensis and An.punctulatus Swamp forest edge in ditches with vegeta- ---------------- An.letifer and An.ludlowae don Hilly areas in seepages, streams and clear moving water ---------------------------------------------- Anflavirostris, An.maculatus and Anminimus.   The species (of most general importance is An.sundaicus, which is restricted by its preference for brackish water and is prevalent in coastal areas of Java. Their types in behaviour of An.sundaicus appear as follows : 1. An.sundaicus in South Coast of Java in general. This species is essentially anthropophilic, exophagic and rests outdoor. It shows susceptible to DDT. 2. An.sundaicus in Cilacap, Central Java. This mosquito is a pure anthropophilic form. It bites man in houses and outdoors, rests indoors and is known resistant to DDT. 3. An.sundaicus in Yogyakarta and Purworejo, Central Java. This mosquito is a strong zoophilic species. It rests and prefers to bite outdoors and shows tolerance to DDT. Human filariasis in Indonesia is the result of infection by three endemic species, namely, Wuchereria bancrofti, Brugia malayi, and Brugia timori.W.bancrofti infection is found in both urban and rural areas. Twenty species of mosquitoes are confirmed as filariasis vectors. The urban type bancroftian filariasis

  10. Dynamics of Social Behavior in Fruit Fly Larvae

    Science.gov (United States)

    Durisko, Zachary; Kemp, Rebecca; Mubasher, Rameeshay; Dukas, Reuven

    2014-01-01

    We quantified the extent and dynamics of social interactions among fruit fly larvae over time. Both a wild-type laboratory population and a recently-caught strain of larvae spontaneously formed social foraging groups. Levels of aggregation initially increased during larval development and then declined with the wandering stage before pupation. We show that larvae aggregated more on hard than soft food, and more at sites where we had previously broken the surface of the food. Groups of larvae initiated burrowing sooner than solitary individuals, indicating that one potential benefit of larval aggregations is an improved ability to dig and burrow into the food substrate. We also show that two closely related species, D. melanogaster and D. simulans, differ in their tendency to aggregate, which may reflect different evolutionary histories. Our protocol for quantifying social behavior in larvae uncovered robust social aggregations in this simple model, which is highly amenable to neurogenetic analyses, and can serve for future research into the mechanisms and evolution of social behavior. PMID:24740198

  11. Paenilarvins: Iturin family lipopeptides from the honey bee pathogen Paenibacillus larvae.

    Science.gov (United States)

    Sood, Sakshi; Steinmetz, Heinrich; Beims, Hannes; Mohr, Kathrin I; Stadler, Marc; Djukic, Marvin; von der Ohe, Werner; Steinert, Michael; Daniel, Rolf; Müller, Rolf

    2014-09-05

    The bacterium Paenibacillus larvae has been extensively studied as it is an appalling honey bee pathogen. In the present work, we screened crude extracts derived from fermentations of P. larvae genotypes ERIC I and II for antimicrobial activity, following the detection of four putative secondary metabolite gene clusters that show high sequence homology to known biosynthetic gene clusters for the biosynthesis of antibiotics. Low molecular weight metabolites produced by P. larvae have recently been shown to have toxic effects on honey bee larvae. Moreover, a novel tripeptide, sevadicin, was recently characterized from laboratory cultures of P. larvae. In this study, paenilarvins, which are iturinic lipopeptides exhibiting strong antifungal activities, were obtained by bioassay-guided fractionation from cultures of P. larvae, genotype ERIC II. Their molecular structures were determined by extensive 2D NMR spectroscopy, high resolution mass spectrometry, and other methods. Paenilarvins are the first antifungal secondary metabolites to be identified from P. larvae. In preliminary experiments, these lipopeptides also affected honey bee larvae and might thus play a role in P. larvae survival and pathogenesis. However, further studies are needed to investigate their function. © 2014 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  12. Nutritional condition and vertical distribution of Baltic cod larvae

    DEFF Research Database (Denmark)

    Grønkjær, P.; Clemmesen, C.; St. John, Michael

    1997-01-01

    Newly hatched Baltic cod Gadus morhua larvae are typically found at depths >60 m. This is a region of low light and prey availability, hence generating the hypothesis that larvae have to migrate from hatching depth to the surface layer to avoid starvation and improve their nutritional condition...... aged 2-25 days (median 10 days) ranged from 0.4 to 6.2, corresponding to levels exhibited by starving and fast growing larvae in laboratory calibration studies (starvation, protein growth rate, G(pi)=-12.2% day(-1); fast-growing larvae, G(pi)=14.1% day(-1)) respectively. Seventy per cent of the field...

  13. Extreme morphologies of mantis shrimp larvae

    OpenAIRE

    Haug, Carolin; Ahyong, Shane T.; Wiethase, Joris H.; Olesen, Jørgen; Haug, Joachim T.

    2016-01-01

    ABSTRACT Larvae of stomatopods (mantis shrimps) are generally categorized into four larval types: antizoea, pseudozoea (both representing early larval stages), alima and erichthus (the latter two representing later larval stages). These categories, however, do not reflect the existing morphological diversity of stomatopod larvae, which is largely unstudied. We describe here four previously unknown larval types with extreme morphologies. All specimens were found in the collections of the Zoolo...

  14. Effect of gut bacterial isolates from Apis mellifera jemenitica on Paenibacillus larvae infected bee larvae

    Directory of Open Access Journals (Sweden)

    Ahmad Al-Ghamdi

    2018-02-01

    Full Text Available The probiotic effects of seven newly isolated gut bacteria, from the indegenous honey bees of Saudi Arabia were investigated. In vivo bioassays were used to investigate the effects of each gut bacterium namely, Fructobacillus fructosus (T1, Proteus mirabilis (T2, Bacillus licheniformis (T3, Lactobacillus kunkeei (T4, Bacillus subtilis (T5, Enterobacter kobei (T6, and Morganella morganii (T7 on mortality percentage of honey bee larvae infected with P. larvae spores along with negative control (normal diet and positive control (normal diet spiked with P. larvae spores. Addition of gut bacteria to the normal diet significantly reduced the mortality percentage of the treated groups. Mortality percentage in all treated groups ranged from 56.67% up to 86.67%. T6 treated group exhibited the highest mortality (86.67%, whereas T4 group showed the lowest mortality (56.67%. Among the seven gut bacterial treatments, T4 and T3 decreased the mortality 56.67% and 66.67%, respectively, whereas, for T2, T6, and T7 the mortality percentage was equal to that of the positive control (86.67%. Mortality percentages in infected larval groups treated with T1, and T5 were 78.33% and 73.33% respectively. Most of the mortality occurred in the treated larvae during days 2 and 3. Treatments T3 and T4 treatments showed positive effects and reduced mortality.

  15. Development of Digestive Enzyme of Patin Pangasius hypohthalmus Larvae

    Directory of Open Access Journals (Sweden)

    I. Effendi

    2007-01-01

    Full Text Available Culture of patin Pangasius hypophthalmus especially larval rearing  very depends on the supply of natural food as energy source.  Artemia is the main natural food for fish larvae as a starter food, but its price is high.  To reduce production cost, farmers tend to reduce the feeding frequency and shorten  the Artemia feeding period.  Altering feeding regime however may reduce fry quality. This relate to the availability of digestive enzymes.  The objective of this study was  to examine digestive enzymes activity in patin larvae fed with  different feeding regime.  By shorten feeding period with Artemia to 2-4 days and Tubifex,substitution, the enzymes activity of protease, lipase and amylase were revealed similar pattern   The enzymes activity tends to increase and reach the peak at day 7 , and decrease later on until day 15 after hatching.  Survival rate of fish were varied for each treatment, and the highest survival rate was obtained when larvae were fed by Artemia for 8 days.  Blood worm were not fully digested by patin larvae at early stage. Keywords: enzyme, digestion, patin, Pangasius hypophthalmus   ABSTRAK Proses budidaya ikan patin, Pangasius hypophthalmus terutama pembenihan sangat tergantung oleh ketersediaan pakan alami sebagai sumber energinya. Artemia merupakan pakan alami yang banyak diberikan pada saat larva ikan mulai makan, namun harganya relatif tinggi. Untuk menekan biaya produksi, petani ikan patin cenderung mengurangi frekuensi pemberian Artemia dan mempersingkat waktu pemberiannya. Penggeseran jadwal ini diduga mengakibatkan penurunan kualitas benih ikan patin yang dihasilkan yang berhubungan dengan kesiapan enzim pencernaannya. Penelitian ini dilakukan untuk mengetahui aktivitas enzim pada larva ikan patin dengan jadwal pemberian pakan yang berbeda. Dengan memotong waktu pemberian Artemia 2 - 4 hari dan disubstitusi dengan Tubifex, aktifitas enzim protease, lipase dan amilase pada larva ikan patin, memiliki

  16. Nonsensical choices? Fall armyworm moths choose seemingly best or worst hosts for their larvae, but neonate larvae make their own choices.

    Directory of Open Access Journals (Sweden)

    Julio C Rojas

    Full Text Available Selecting optimal host plants is critical for herbivorous insects, such as fall armyworm (Spodoptera frugiperda, an important maize pest in the Americas and Africa. Fall armyworm larvae are presumed to have limited mobility, hence female moths are presumed to be largely responsible for selecting hosts. We addressed host selection by fall armyworm moths and neonate and older (3rd-instar larvae, as mediated by resistance and herbivory in maize plants. Thus, we compared discrimination among three maize cultivars with varying degrees of resistance to fall armyworm, and between plants subjected or not to two types of herbivory. The cultivars were: (i susceptible, and deficient in jasmonic acid (JA production and green leaf volatiles (GLV emissions (inbred line B73-lox10; (ii modestly resistant (B73, and; (iii highly resistant (Mp708. The herbivory types were: (i ongoing (= fall armyworm larvae present, and; (ii future (= fall armyworm eggs present. In choice tests, moths laid more eggs on the highly resistant cultivar, and least on the susceptible cultivar, though on those cultivars larvae performed poorest and best, respectively. In the context of herbivory, moths laid more eggs: (i on plants subject to versus free of future herbivory, regardless of whether plants were deficient or not in JA and GLV production; (ii on plants subject versus free of ongoing herbivory, and; (iii on plants not deficient in compared to deficient in JA and GLV production. Neonate larvae dispersed aerially from host plants (i.e. ballooned, and most larvae colonized the modestly resistant cultivar, and fewest the highly resistant cultivar, suggesting quasi-directional, directed aerial descent. Finally, dispersing older larvae did not discriminate among the three maize cultivars, nor between maize plants and (plastic model maize plants, suggesting random, visually-oriented dispersal. Our results were used to assemble a model of host selection by fall armyworm moths and

  17. Suppressing bullfrog larvae with carbon dioxide

    Science.gov (United States)

    Gross, Jackson A.; Ray, Andrew; Sepulveda, Adam J.; Watten, Barnaby J.; Densmore, Christine L.; Layhee, Megan J.; Mark Abbey-Lambert,; ,

    2014-01-01

    Current management strategies for the control and suppression of the American Bullfrog (Lithobates catesbeianus = Rana catesbeiana Shaw) and other invasive amphibians have had minimal effect on their abundance and distribution. This study evaluates the effects of carbon dioxide (CO2) on pre- and prometamorphic Bullfrog larvae. Bullfrogs are a model organism for evaluating potential suppression agents because they are a successful invader worldwide. From experimental trials we estimated that the 24-h 50% and 99% lethal concentration (LC50 and LC99) values for Bullfrog larvae were 371 and 549 mg CO2/L, respectively. Overall, larvae that succumbed to experimental conditions had a lower body condition index than those that survived. We also documented sublethal changes in blood chemistry during prolonged exposure to elevated CO2. Specifically, blood pH decreased by more than 0.5 pH units after 9 h of exposure and both blood partial pressure of CO2 (pCO2) and blood glucose increased. These findings suggest that CO2 treatments can be lethal to Bullfrog larvae under controlled laboratory conditions. We believe this work represents the necessary foundation for further consideration of CO2 as a potential suppression agent for one of the most harmful invaders to freshwater ecosystems.

  18. [Toxicity and influencing factors of liquid chlorine on chironomid larvae].

    Science.gov (United States)

    Sun, Xing-Bin; Cui, Fu-Yi; Zhang, Jin-Song; Guo, Zhao-Hai; Xu, Feng; Liu, Li-Jun

    2005-09-01

    The excessive propagation of Chironomid larvae (red worm) in the sedimentation tanks is a difficult problem for the normal function of waterworks. The toxic effect of liquid chlorine on the different instar larvae of Chironomid was studied using distilled water as test sample. Furthermore, the effect of pH value, organic matter content, ammonia nitrogen, and algae content on toxicity of liquid chlorine was observed. The results show that the tolerance of Chironomid larvae to liquid chlorine is strengthened with the increase in instar. The 24h semi-lethal concentration (LC50) of liquid chlorine to the 4th instar larvae of Chironomid is 3.39 mg/L. Low pH value and high algae content are helpful to improve the toxic effect of liquid chlorine to Chironomid larvae. In neutral water body, the increase in organic matter content results in the decrease in the death rate of Chironomid larvae. The toxicity of liquid chlorine differs greatly in different concentrations of ammonia nitrogen. The death rate of the 4th instar larvae of Chironomid in raw water is higher by contrast with that in sedimentation tanks water for 24h disposal with various amount of liquid chlorine.

  19. Bothid larvae (Pleuronectiformes-Pisces) of the Indian Ocean

    Digital Repository Service at National Institute of Oceanography (India)

    Devi, C.B.L.

    the Indian Ocean, their regional, seasonal as well as diurnal variations. Engyprosopon grandisquamis dominated contributing to 23.2% of the total larvae. Numerically the incidence of bothid larvae suggested a uniform pattern of distribution during the two...

  20. Analysis of feeding behavior of Drosophila larvae on solid food.

    Science.gov (United States)

    Shen, Ping

    2012-05-01

    The food responses of Drosophila larvae offer an excellent opportunity to study the genetic and neural regulation of feeding behavior. Compared with fed larvae, hungry larvae are more likely to display aggressive foraging, rapid food intake, compensatory feeding, and stress-resistant food procurement. Behavioral assays have been developed to quantitatively assess particular aspects of the hunger-driven food response. In combination, these assays help define the specific role of signaling molecules or neurons in the regulation of feeding behavior in foraging larvae. This protocol is designed for quantitative assessment of the willingness of individual larvae to procure solid food under different energy states. It provides a simple and reliable way to measure the graded modification of the baseline feeding rate of larvae as the period of food deprivation is increased. The test is applicable to routine functional testing and larger-scale screening of genetic mutations and biologics that might affect food consumption.

  1. External Ophthalmomyiasis Caused by a Rare Infesting Larva, Sarcophaga argyrostoma

    Directory of Open Access Journals (Sweden)

    Shmuel Graffi

    2013-01-01

    Full Text Available Purpose. External ophthalmomyiasis (EO is caused by infesting larvae belonging to various species of flies. Most documented cases result from sheep (Oestrus ovis and Russian (Rhinoestrus purpureus botfly larvae, but we recently discovered a rare case of EO caused by flesh fly (Sarcophaga argyrostoma larvae. Here, we report the case of a patient with EO who had been hospitalized and sedated for 1 week because of unrelated pneumonia. Methods. Case report. Results. A total of 32 larvae were removed from the adnexae of both eyes. Larvae identification was confirmed through DNA analysis. Treatment with topical tobramycin resulted in complete resolution of EO. Conclusion. EO can be caused by S. argyrostoma, and the elderly and debilitated may require extra ocular protection against flies during sedation.

  2. Decapod larvae from the nearshore waters of Karwar

    Digital Repository Service at National Institute of Oceanography (India)

    Nair, V.R.; Paulinose, V.T.

    Abundance of decapod larvae at three stations in Binge Bay, Karwar has been reported based on surface collections taken during the period October 1975 to September 1976. The larvae were very common in the Bay and the postmonsoon months sustained...

  3. Effects of the Liquids Used to Kill Larvae on the Length of Forensically Important Blow Fly Lucilia sericata Meigen (Diptera: Calliphoridae) Larvae

    OpenAIRE

    Halide Nihal Açıkgöz; Ali Açıkgöz

    2017-01-01

    Forensic entomological practices rely upon accurate larval identification and measurement of larval length, for the estimation of post-mortem intervals. The methods used for killing larvae may affect the length of larvae. In the autopsy hall, corpses which are contain entomological remains have been washed with grape vinegar. Besides, while collecting and killing the larvae on corpses, crime scene teams use alcohol 70% because it is practical. The aim of this study was to determine which...

  4. Mananoligossacarídeo em dietas para larvas de tilápia Mannanoligosaccharides in diets for tilapia larvae

    Directory of Open Access Journals (Sweden)

    Kátia Kalko Schwarz

    2011-12-01

    Full Text Available Este experimento foi realizado para avaliar níveis crescentes de mananoligossacarídeo (MOS na dieta de larvas de tilápias-do-nilo (linhagem Supreme® na fase de reversão sexual durante 30 dias. Larvas de tilápia-do-nilo (n=1500, P=0,01 g ± 0,001 g foram distribuídas aleatoriamente em 30 tanques de 100 litros. Os peixes foram distribuídos em delineamento inteiramente casualizado, composto por seis tratamentos e cinco repetições. A dieta controle (isenta de MOS foi elaborada para conter aproximadamente 35% de proteína bruta e 3.100 kcal de ED/kg. As demais foram suplementadas com 0; 0,15; 0,30; 0,45; 0,60 e 0,75% de MOS em substituição ao milho da dieta controle. Com o aumento nos níveis de MOS nas dietas, foi observado aumento linear sobre o comprimento do intestino, a altura das vilosidades intestinais e a densidade dos vilos. Não houve diferença na composição corporal, no ganho em peso, no peso final, no comprimento final, no fator de condição, na taxa de sobrevivência e no número de células caliciformes do intestino das larvas. Os níveis de MOS tiveram efeito quadrático sobre a conversão alimentar, cujos melhores resultados foram obtidos com 0,34% de MOS. A utilização de MOS no nível de 0,34% em dietas para larvas de tilápia-do-nilo melhora a conversão alimentar e promove aumento do comprimento do intestino, da altura das vilosidades e da densidade de vilos intestinal.This experiment was conducted to evaluate increasing levels of mannanoligosaccharides (MOS in the diet of Nile tilapia larvae (Supreme® at the sex reversal stage for 30 days. Nile tilapia larvae (n = 1500, p = 0.01 ± 0.001 g, were randomly distributed in 30 tanks of 100 liters each, for 30 days. The fish were distributed in a randomized design with six treatments and five replicates. The control diet (no MOS was elaborated to contain approximately 35% of crude protein and 3,100 kcal DE/kg. Mannanoligosaccharides were included in the other diets

  5. Using Real-time PCR for Identification of Paenibacillus larvae

    Directory of Open Access Journals (Sweden)

    Vladimíra Kňazovická

    2011-05-01

    Full Text Available The aim of the study was identification of Paenibacillus larvae that causes American foulbrood disease (AFB in colony of bees (Apis mellifera. Bacterial isolates originated from honey samples, because presence of P. larvae in honey is treated as early diagnostic of AFB. Intense proteolytic activity and no catalase activity are typical for Gram positive rod-shaped bacteria P. larvae. We diluted honey (1:2, heated at 80 °C for 10 min and inoculated on semiselective medium MYPGP agar with nalidixic acid. Plates were cultivated at 37 °C for 48 – 72 h under the aerobic conditions. Selected colonies were transferred on MYT agar and cultivated 24 h. We analysed 30 honey samples and found 27 bacterial isolates. All isolates were Gram positive and mainly rod-shaped. No catalase activity was documented for 6 from 27 isolates. Identification was finished by real-time PCR to detect the 16S rRNA gene of Paenibacillus larvae with real-time cycler Rotor-Gene 6000. As DNA template we used genomic DNA isolated with commercial kit and DNA lysate obtaining by boiled cells. We used 2 strains of P. larvae from CCM (Czech Collection of Microorganisms as positive control. The reliable method of detection P. larvae has important rule for beekeeping.

  6. Structure and occurrence of cyphonautes larvae (Bryozoa, Ectoprocta)

    DEFF Research Database (Denmark)

    Nielsen, Claus; Worsaae, Katrine

    2010-01-01

    We have studied larvae of the freshwater ctenostome Hislopia malayensis with scanning electron microscopy (SEM), confocal laser scanning microscopy (CLSM), and LM of serial sections. Some additional observations on larvae of M. membranacea using SEM and CLSM are also reported. The overall configu...

  7. The method by which Cephenemyia trompe (Modeer larvae invade reindeer (Rangifer tarandus

    Directory of Open Access Journals (Sweden)

    John R. Anderson

    1990-09-01

    Full Text Available Laboratory electrostimulated C. trompe (Modeer females forcefully expelled (sprayed larvae for 5-20 cm. The watery spray consisted of about 20 tiny droplets containing two to several larvae. Crawling first-instar larvae exhibited negative geotactic and phototropic responses; they were subject to rapid desiccation and became immobile as the tiny droplets dried within a few seconds. When 5-50 larvae from dissectedfemales were dropped in physiological saline onto different areas of the muzzle of restrained reindeer, only larvae placed deep within the nostrils and on the lips crawled out-of-sight down the nostril passage or into the mouth. Drops of larvae placed elsewhere quickly desiccated and the larvae became immobile. Larvae deposited by wild females onto a COz-baited reindeer model with the muzzle, lips and nostrils coated with insect trapping adhesive all were stuck only along the dorsal lip below the philtrum. All experimental evidence supports a natural per os mode of invasion.

  8. IMPORTANT NEMATODE INFECTIONS IN INDONESIA

    Directory of Open Access Journals (Sweden)

    Sri Oemijati

    2012-09-01

    Full Text Available At least 13 species of intestinal nematodes and 4 species of blood and tissue nematodes have been reported infecting man in Indonesia. Five species of intestinal nematodes are very common and highly prevalent, especially in the rural areas and slums of the big cities. Those species are Ascaris lumbricoides, Necator americanus, Ancylostoma duodenale, Trichuris trichiura and Oxyuris vermicularis, while Strongyloides stercoralis is disappearing. The prevalence of the soil transmitted helminths differs from place to place, depending on many factors such as the type of soil, human behaviour etc. Three species of lymph dwelling filarial worms are known to be endemic, the urban Wuchereria bancrofti is low endemic in Jakarta and a few other cities along the north coast of Java, with Culex incriminated as vector, high endemicity is found in Irian Jaya, where Anopheline mosquitoes act as vectors. Brugia malayi is widely distributed and is still highly endemic in many areas. The zoonotic type is mainly endemic in swampy areas, and has many species of Mansonia mosquitoes as vectors. B.timori so far has been found only in the south eastern part of the archipelago and has Anopheles barbirostris as vector. Human infections with animal parasites have been diagnosed properly only when adult stages were found either in autopsies or removed tissues. Cases of infections with A. caninum, A.braziliense, A.ceylanicum, Trichostrongylus colubriformis, T.axei and Oesophagostomum apiostomum have been desribed from autopsies, while infections with Gnathostoma spiningerum have been reported from removed tissues. Infections with the larval stages such as VLM, eosinophylic meningitis, occult filanasis and other could only be suspected, since the diagnosis was extremely difficult and based on the finding and identification of the parasite. Many cases of creeping eruption which might be caused by the larval stages of A.caninum and A.braziliense and Strongyloides stercoralis

  9. Parasites of fish larvae: do they follow metabolic energetic laws?

    Science.gov (United States)

    Muñoz, Gabriela; Landaeta, Mauricio F; Palacios-Fuentes, Pamela; George-Nascimento, Mario

    2015-11-01

    Eumetazoan parasites in fish larvae normally exhibit large body sizes relative to their hosts. This observation raises a question about the potential effects that parasites might have on small fish. We indirectly evaluated this question using energetic metabolic laws based on body volume and the parasite densities. We compared the biovolume as well as the numeric and volumetric densities of parasites over the host body volume of larval and juvenile-adult fish and the average of these parasitological descriptors for castrator parasites and the parasites found in the fish studied here. We collected 5266 fish larvae using nearshore zooplankton sampling and 1556 juveniles and adult fish from intertidal rocky pools in central Chile. We considered only the parasitized hosts: 482 fish larvae and 629 juvenile-adult fish. We obtained 31 fish species; 14 species were in both plankton and intertidal zones. Fish larvae exhibited a significantly smaller biovolume but larger numeric and volumetric densities of parasites than juvenile-adult fish. Therefore, fish larvae showed a large proportion of parasite biovolume per unit of body host (cm(3)). However, the general scaling of parasitological descriptors and host body volume were similar between larvae and juvenile-adult fish. The ratio between the biovolume of parasites and the host body volume in fish larvae was similar to the proportion observed in castrator parasites. Furthermore, the ratios were different from those of juvenile-adult fish, which suggests that the presence of parasites implies a high energetic cost for fish larvae that would diminish the fitness of these small hosts.

  10. The larva of Paracapnia disala (Jewett) (Plecoptera: Capniidae)

    Science.gov (United States)

    Kenneth W. Stewart

    2010-01-01

    The larva of Paracapnia disala (Jewett) was associated from two first order headwater streams in the H.J. Andrews Experimental Forest, Oregon, U.S.A. Larvae of this first western Paracapnia species to be associated, were studied and compared morphologically with those of the eastern Paracapnia angulata...

  11. Composition, Abundance and Distribution of Brachyuran Larvae in ...

    African Journals Online (AJOL)

    ... Ocypodidae, Grapsidae and Xanthidae. Abundance of brachyuran larvae was significantly positively correlated with total zooplankton abundance (r2 = 0.8) and salinity (r2 = 0.71). Keywords: Brachyuran larvae, abundance, composition, Mida creek, Kenya West Indian Ocean Journal of Marine Science Vol. 3 (2) 2004: pp.

  12. How to kill the honey bee larva: genomic potential and virulence mechanisms of Paenibacillus larvae.

    Directory of Open Access Journals (Sweden)

    Marvin Djukic

    Full Text Available Paenibacillus larvae, a Gram positive bacterial pathogen, causes American Foulbrood (AFB, which is the most serious infectious disease of honey bees. In order to investigate the genomic potential of P. larvae, two strains belonging to two different genotypes were sequenced and used for comparative genome analysis. The complete genome sequence of P. larvae strain DSM 25430 (genotype ERIC II consisted of 4,056,006 bp and harbored 3,928 predicted protein-encoding genes. The draft genome sequence of P. larvae strain DSM 25719 (genotype ERIC I comprised 4,579,589 bp and contained 4,868 protein-encoding genes. Both strains harbored a 9.7 kb plasmid and encoded a large number of virulence-associated proteins such as toxins and collagenases. In addition, genes encoding large multimodular enzymes producing nonribosomally peptides or polyketides were identified. In the genome of strain DSM 25719 seven toxin associated loci were identified and analyzed. Five of them encoded putatively functional toxins. The genome of strain DSM 25430 harbored several toxin loci that showed similarity to corresponding loci in the genome of strain DSM 25719, but were non-functional due to point mutations or disruption by transposases. Although both strains cause AFB, significant differences between the genomes were observed including genome size, number and composition of transposases, insertion elements, predicted phage regions, and strain-specific island-like regions. Transposases, integrases and recombinases are important drivers for genome plasticity. A total of 390 and 273 mobile elements were found in strain DSM 25430 and strain DSM 25719, respectively. Comparative genomics of both strains revealed acquisition of virulence factors by horizontal gene transfer and provided insights into evolution and pathogenicity.

  13. How to kill the honey bee larva: genomic potential and virulence mechanisms of Paenibacillus larvae.

    Science.gov (United States)

    Djukic, Marvin; Brzuszkiewicz, Elzbieta; Fünfhaus, Anne; Voss, Jörn; Gollnow, Kathleen; Poppinga, Lena; Liesegang, Heiko; Garcia-Gonzalez, Eva; Genersch, Elke; Daniel, Rolf

    2014-01-01

    Paenibacillus larvae, a Gram positive bacterial pathogen, causes American Foulbrood (AFB), which is the most serious infectious disease of honey bees. In order to investigate the genomic potential of P. larvae, two strains belonging to two different genotypes were sequenced and used for comparative genome analysis. The complete genome sequence of P. larvae strain DSM 25430 (genotype ERIC II) consisted of 4,056,006 bp and harbored 3,928 predicted protein-encoding genes. The draft genome sequence of P. larvae strain DSM 25719 (genotype ERIC I) comprised 4,579,589 bp and contained 4,868 protein-encoding genes. Both strains harbored a 9.7 kb plasmid and encoded a large number of virulence-associated proteins such as toxins and collagenases. In addition, genes encoding large multimodular enzymes producing nonribosomally peptides or polyketides were identified. In the genome of strain DSM 25719 seven toxin associated loci were identified and analyzed. Five of them encoded putatively functional toxins. The genome of strain DSM 25430 harbored several toxin loci that showed similarity to corresponding loci in the genome of strain DSM 25719, but were non-functional due to point mutations or disruption by transposases. Although both strains cause AFB, significant differences between the genomes were observed including genome size, number and composition of transposases, insertion elements, predicted phage regions, and strain-specific island-like regions. Transposases, integrases and recombinases are important drivers for genome plasticity. A total of 390 and 273 mobile elements were found in strain DSM 25430 and strain DSM 25719, respectively. Comparative genomics of both strains revealed acquisition of virulence factors by horizontal gene transfer and provided insights into evolution and pathogenicity.

  14. Chironomidae bloodworms larvae as aquatic amphibian food.

    Science.gov (United States)

    Fard, Mojdeh Sharifian; Pasmans, Frank; Adriaensen, Connie; Laing, Gijs Du; Janssens, Geert Paul Jules; Martel, An

    2014-01-01

    Different species of chironomids larvae (Diptera: Chironomidae) so-called bloodworms are widely distributed in the sediments of all types of freshwater habitats and considered as an important food source for amphibians. In our study, three species of Chironomidae (Baeotendipes noctivagus, Benthalia dissidens, and Chironomus riparius) were identified in 23 samples of larvae from Belgium, Poland, Russia, and Ukraine provided by a distributor in Belgium. We evaluated the suitability of these samples as amphibian food based on four different aspects: the likelihood of amphibian pathogens spreading, risk of heavy metal accumulation in amphibians, nutritive value, and risk of spreading of zoonotic bacteria (Salmonella, Campylobacter, and ESBL producing Enterobacteriaceae). We found neither zoonotic bacteria nor the amphibian pathogens Ranavirus and Batrachochytrium dendrobatidis in these samples. Our data showed that among the five heavy metals tested (Hg, Cu, Cd, Pb, and Zn), the excess level of Pb in two samples and low content of Zn in four samples implicated potential risk of Pb accumulation and Zn inadequacy. Proximate nutritional analysis revealed that, chironomidae larvae are consistently high in protein but more variable in lipid content. Accordingly, variations in the lipid: protein ratio can affect the amount and pathway of energy supply to the amphibians. Our study indicated although environmentally-collected chironomids larvae may not be vectors of specific pathogens, they can be associated with nutritional imbalances and may also result in Pb bioaccumulation and Zn inadequacy in amphibians. Chironomidae larvae may thus not be recommended as single diet item for amphibians. © 2014 Wiley Periodicals, Inc.

  15. Quantification of vestibular-induced eye movements in zebrafish larvae

    Directory of Open Access Journals (Sweden)

    Mo Weike

    2010-09-01

    Full Text Available Abstract Background Vestibular reflexes coordinate movements or sensory input with changes in body or head position. Vestibular-evoked responses that involve the extraocular muscles include the vestibulo-ocular reflex (VOR, a compensatory eye movement to stabilize retinal images. Although an angular VOR attributable to semicircular canal stimulation was reported to be absent in free-swimming zebrafish larvae, recent studies reveal that vestibular-induced eye movements can be evoked in zebrafish larvae by both static tilts and dynamic rotations that tilt the head with respect to gravity. Results We have determined herein the basis of sensitivity of the larval eye movements with respect to vestibular stimulus, developmental stage, and sensory receptors of the inner ear. For our experiments, video recordings of larvae rotated sinusoidally at 0.25 Hz were analyzed to quantitate eye movements under infrared illumination. We observed a robust response that appeared as early as 72 hours post fertilization (hpf, which increased in amplitude over time. Unlike rotation about an earth horizontal axis, rotation about an earth vertical axis at 0.25 Hz did not evoke eye movements. Moreover, vestibular-induced responses were absent in mutant cdh23 larvae and larvae lacking anterior otoliths. Conclusions Our results provide evidence for a functional vestibulo-oculomotor circuit in 72 hpf zebrafish larvae that relies upon sensory input from anterior/utricular otolith organs.

  16. CalCOFI Larvae Counts, Scientific Names CI to CO

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  17. CalCOFI Larvae Counts, Scientific Names DH to EC

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  18. CalCOFI Larvae Counts, Scientific Names TF to U

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  19. CalCOFI Larvae Counts, Scientific Names HJ to ID

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  20. CalCOFI Larvae Counts, Scientific Names AN to AR

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  1. CalCOFI Larvae Counts, Scientific Names SJ to ST

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  2. CalCOFI Larvae Counts, Scientific Names CP to DE

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  3. CalCOFI Larvae Counts, Scientific Names C to CE

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  4. CalCOFI Larvae Counts, Scientific Names EV to GN

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  5. CalCOFI Larvae Counts, Scientific Names V to Z

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  6. CalCOFI Larvae Counts, Scientific Names ED to EU

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  7. CalCOFI Larvae Counts, Scientific Names SD to SI

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  8. CalCOFI Larvae Counts, Scientific Names MB to MO

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  9. CalCOFI Larvae Counts, Scientific Names LJ to MA

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  10. CalCOFI Larvae Counts, Scientific Names AS to BA

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  11. CalCOFI Larvae Counts, Scientific Names SB to SC

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  12. CalCOFI Larvae Counts, Scientific Names MP to NA

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  13. CalCOFI Larvae Counts, Scientific Names SU to TE

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  14. CalCOFI Larvae Counts, Scientific Names PL to PO

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  15. CalCOFI Larvae Counts, Scientific Names IE to LA

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  16. CalCOFI Larvae Counts, Scientific Names A to AM

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  17. CalCOFI Larvae Counts, Scientific Names HB to HI

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  18. CalCOFI Larvae Counts, Scientific Names OM to OX

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  19. CalCOFI Larvae Counts, Scientific Names Q to SA

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  20. CalCOFI Larvae Counts, Scientific Names PP to PZ

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  1. CalCOFI Larvae Counts, Scientific Names GO to HA

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  2. CalCOFI Larvae Counts, Scientific Names NB to OL

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  3. CalCOFI Larvae Counts, Scientific Names LB to LI

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  4. CalCOFI Larvae Counts, Scientific Names BCE to BZ

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  5. CalCOFI Larvae Counts, Scientific Names CD to CH

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  6. CalCOFI Larvae Counts, Scientific Names OY to PI

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  7. The use of fly larvae for organic waste treatment.

    Science.gov (United States)

    Čičková, Helena; Newton, G Larry; Lacy, R Curt; Kozánek, Milan

    2015-01-01

    The idea of using fly larvae for processing of organic waste was proposed almost 100 years ago. Since then, numerous laboratory studies have shown that several fly species are well suited for biodegradation of organic waste, with the house fly (Musca domestica L.) and the black soldier fly (Hermetia illucens L.) being the most extensively studied insects for this purpose. House fly larvae develop well in manure of animals fed a mixed diet, while black soldier fly larvae accept a greater variety of decaying organic matter. Blow fly and flesh fly maggots are better suited for biodegradation of meat processing waste. The larvae of these insects have been successfully used to reduce mass of animal manure, fecal sludge, municipal waste, food scrapes, restaurant and market waste, as well as plant residues left after oil extraction. Higher yields of larvae are produced on nutrient-rich wastes (meat processing waste, food waste) than on manure or plant residues. Larvae may be used as animal feed or for production of secondary products (biodiesel, biologically active substances). Waste residue becomes valuable fertilizer. During biodegradation the temperature of the substrate rises, pH changes from neutral to alkaline, ammonia release increases, and moisture decreases. Microbial load of some pathogens can be substantially reduced. Both larvae and digested residue may require further treatment to eliminate pathogens. Facilities utilizing natural fly populations, as well as pilot and full-scale plants with laboratory-reared fly populations have been shown to be effective and economically feasible. The major obstacles associated with the production of fly larvae from organic waste on an industrial scale seem to be technological aspects of scaling-up the production capacity, insufficient knowledge of fly biology necessary to produce large amounts of eggs, and current legislation. Technological innovations could greatly improve performance of the biodegradation facilities and

  8. Crustacean Larvae-Vision in the Plankton.

    Science.gov (United States)

    Cronin, Thomas W; Bok, Michael J; Lin, Chan

    2017-11-01

    We review the visual systems of crustacean larvae, concentrating on the compound eyes of decapod and stomatopod larvae as well as the functional and behavioral aspects of their vision. Larval compound eyes of these macrurans are all built on fundamentally the same optical plan, the transparent apposition eye, which is eminently suitable for modification into the abundantly diverse optical systems of the adults. Many of these eyes contain a layer of reflective structures overlying the retina that produces a counterilluminating eyeshine, so they are unique in being camouflaged both by their transparency and by their reflection of light spectrally similar to background light to conceal the opaque retina. Besides the pair of compound eyes, at least some crustacean larvae have a non-imaging photoreceptor system based on a naupliar eye and possibly other frontal eyes. Larval compound-eye photoreceptors send axons to a large and well-developed optic lobe consisting of a series of neuropils that are similar to those of adult crustaceans and insects, implying sophisticated analysis of visual stimuli. The visual system fosters a number of advanced and flexible behaviors that permit crustacean larvae to survive extended periods in the plankton and allows them to reach acceptable adult habitats, within which to metamorphose. © The Author 2017. Published by Oxford University Press on behalf of the Society for Integrative and Comparative Biology. All rights reserved. For permissions please email: journals.permissions@oup.com.

  9. Observations of the sound producing organs in achelate lobster larvae

    Directory of Open Access Journals (Sweden)

    John A. Fornshell

    2017-06-01

    Full Text Available The Achelata, lobsters lacking claws and having a phyllosoma larva, are divided into two families, the Palinuridae or spiny lobsters and the Scyllaridae or slipper lobsters. Within the Palinuridae adults of two groups were identified by Parker (1884, the Stridentesthat are capable of producing sounds, and the Silentesthat are not known to produce sounds. The Stridentes employ a file-like structure on the dorsal surface of the cephalon and a plectrum consisting of a series of ridges on the proximal segment of the second antenna to produce their sounds. All species of Achelata hatch as an unpigmented thin phyllosoma larva. The phyllosoma larva of the Stridentes have a presumptive file-like structure on the dorsal cephalon. A similar file-like structure is found on the cephalon of one species of Silentes, Palinurellus wienckki, and some but not all of the phyllosoma larvae of the Scyllaridae. No presumptive plectrum is found on the second antenna of any of the phyllosoma larvae. Presence of a presumptive file-like structure on phyllosoma larvae of Silentes and Scyllaridae suggests that the ability to produce sounds may have been lost secondarily in the Silentes and Scyllaridae.

  10. Identification of tissue-embedded ascarid larvae by ribosomal DNA sequencing.

    Science.gov (United States)

    Ishiwata, Kenji; Shinohara, Akio; Yagi, Kinpei; Horii, Yoichiro; Tsuchiya, Kimiyuki; Nawa, Yukifumi

    2004-01-01

    Polymerase chain reaction (PCR) was applied to identify tissue-embedded ascarid nematode larvae. Two sequences of the internal transcribed spacer (ITS) regions of ribosomal DNA (rDNA), ITS1 and ITS2, of the ascarid parasites were amplified and compared with those of ascarid-nematodes registered in a DNA database (GenBank). The ITS sequences of the PCR products obtained from the ascarid parasite specimen in our laboratory were compatible with those of registered adult Ascaris and Toxocara parasites. PCR amplification of the ITS regions was sensitive enough to detect a single larva of Ascaris suum mixed with porcine liver tissue. Using this method, ascarid larvae embedded in the liver of a naturally infected turkey were identified as Toxocara canis. These results suggest that even a single larva embedded in tissues from patients with larva migrans could be identified by sequencing the ITS regions.

  11. Starvation-Induced Dietary Behaviour in Drosophila melanogaster Larvae and Adults.

    Science.gov (United States)

    Ahmad, Muhammad; Chaudhary, Safee Ullah; Afzal, Ahmed Jawaad; Tariq, Muhammad

    2015-09-24

    Drosophila melanogaster larvae are classified as herbivores and known to feed on non-carnivorous diet under normal conditions. However, when nutritionally challenged these larvae exhibit cannibalistic behaviour by consuming a diet composed of larger conspecifics. Herein, we report that cannibalism in Drosophila larvae is confined not only to scavenging on conspecifics that are larger in size, but also on their eggs. Moreover, such cannibalistic larvae develop as normally as those grown on standard cornmeal medium. When stressed, Drosophila melanogaster larvae can also consume a carnivorous diet derived from carcasses of organisms belonging to diverse taxonomic groups, including Musca domestica, Apis mellifera, and Lycosidae sp. While adults are ill-equipped to devour conspecific carcasses, they selectively oviposit on them and also consume damaged cadavers of conspecifics. Thus, our results suggest that nutritionally stressed Drosophila show distinct as well as unusual feeding behaviours that can be classified as detritivorous, cannibalistic and/or carnivorous.

  12. Genome mining offers a new starting point for parasitology research.

    Science.gov (United States)

    Lv, Zhiyue; Wu, Zhongdao; Zhang, Limei; Ji, Pengyu; Cai, Yifeng; Luo, Shiqi; Wang, Hongxi; Li, Hao

    2015-02-01

    Parasites including helminthes, protozoa, and medical arthropod vectors are a major cause of global infectious diseases, affecting one-sixth of the world's population, which are responsible for enormous levels of morbidity and mortality important and remain impediments to economic development especially in tropical countries. Prevalent drug resistance, lack of highly effective and practical vaccines, as well as specific and sensitive diagnostic markers are proving to be challenging problems in parasitic disease control in most parts of the world. The impressive progress recently made in genome-wide analysis of parasites of medical importance, including trematodes of Clonorchis sinensis, Opisthorchis viverrini, Schistosoma haematobium, S. japonicum, and S. mansoni; nematodes of Brugia malayi, Loa loa, Necator americanus, Trichinella spiralis, and Trichuris suis; cestodes of Echinococcus granulosus, E. multilocularis, and Taenia solium; protozoa of Babesia bovis, B. microti, Cryptosporidium hominis, Eimeria falciformis, E. histolytica, Giardia intestinalis, Leishmania braziliensis, L. donovani, L. major, Plasmodium falciparum, P. vivax, Trichomonas vaginalis, Trypanosoma brucei and T. cruzi; and medical arthropod vectors of Aedes aegypti, Anopheles darlingi, A. sinensis, and Culex quinquefasciatus, have been systematically covered in this review for a comprehensive understanding of the genetic information contained in nuclear, mitochondrial, kinetoplast, plastid, or endosymbiotic bacterial genomes of parasites, further valuable insight into parasite-host interactions and development of promising novel drug and vaccine candidates and preferable diagnostic tools, thereby underpinning the prevention and control of parasitic diseases.

  13. A new member of the GM130 golgin subfamily is expressed in the optic lobe anlagen of the metamorphosing brain of Manduca sexta

    Directory of Open Access Journals (Sweden)

    Chiou-Miin Wang

    2003-12-01

    Full Text Available During metamorphosis of the insect brain, the optic lobe anlagen generate the proliferation centers for the visual cortices. We show here that, in the moth Manduca sexta, an 80 kDa Golgi complex protein (Ms-golgin80 is abundantly expressed in the cytoplasm of neuroblasts and ganglion mother cells in the optic lobe anlagen and proliferation centers. The predicted amino acid sequence for Ms-golgin80 is similar to that of several members of the GM130 subfamily of Golgi-associated proteins, including rat GM130 and human golgin-95. Homologs of Ms-golgin80 from Drosophila melanogaster, Caenorhabditis elegans, and Brugia malayi were identified through homology sequence search. Sequence similarities are present in three regions: the N-terminus, an internal domain of 89 amino acids, and another domain of 89 amino acids near the C-terminus. Structural similarities further suggest that these molecules play the same cellular role as GM130. GM130 is involved in the docking and fusion of coatomer (COP I coated vesicles to the Golgi membranes; it also regulates the fragmentation and subsequent reassembly of the Golgi complex during mitosis. Abundant expression of Ms-golgin80 in neuroblasts and ganglion mother cells and its reduced expression in the neuronal progeny of these cells suggest that this protein may be involved in the maintenance of the proliferative state.

  14. Phylogenetics links monster larva to deep-sea shrimp.

    Science.gov (United States)

    Bracken-Grissom, Heather D; Felder, Darryl L; Vollmer, Nicole L; Martin, Joel W; Crandall, Keith A

    2012-10-01

    Mid-water plankton collections commonly include bizarre and mysterious developmental stages that differ conspicuously from their adult counterparts in morphology and habitat. Unaware of the existence of planktonic larval stages, early zoologists often misidentified these unique morphologies as independent adult lineages. Many such mistakes have since been corrected by collecting larvae, raising them in the lab, and identifying the adult forms. However, challenges arise when the larva is remarkably rare in nature and relatively inaccessible due to its changing habitats over the course of ontogeny. The mid-water marine species Cerataspis monstrosa (Gray 1828) is an armored crustacean larva whose adult identity has remained a mystery for over 180 years. Our phylogenetic analyses, based in part on recent collections from the Gulf of Mexico, provide definitive evidence that the rare, yet broadly distributed larva, C. monstrosa, is an early developmental stage of the globally distributed deepwater aristeid shrimp, Plesiopenaeus armatus. Divergence estimates and phylogenetic relationships across five genes confirm the larva and adult are the same species. Our work demonstrates the diagnostic power of molecular systematics in instances where larval rearing seldom succeeds and morphology and habitat are not indicative of identity. Larval-adult linkages not only aid in our understanding of biodiversity, they provide insights into the life history, distribution, and ecology of an organism.

  15. Competência de peixes como predadores de larvas de Aedes aegypti, em condições de laboratório Efficacy of fish as predators of Aedes aegypti larvae, under laboratory conditions

    Directory of Open Access Journals (Sweden)

    Luciano Pamplona de Góes Cavalcanti

    2007-08-01

    Full Text Available OBJETIVO: Avaliar a competência de peixes na predação de larvas de Aedes aegypti, em condições de laboratório. MÉTODOS: Foram testados machos e fêmeas de cinco espécies de peixe. Os testes de predação duravam cinco semanas para cada espécie. Cada ensaio compreendia quatro caixas testes e quatro caixas controles. Das caixas controle, duas tinham somente um peixe e as outras duas, apenas larvas. Cada caixa teste continha um peixe e larvas. Na primeira semana foram expostas 100 larvas em cada caixa, e a cada semana acrescentavam-se 100 larvas por caixa/dia, até se obter um máximo de 500 larvas/dia. Comprimento e peso dos peixes foram medidos semanalmente. RESULTADOS: Foram utilizadas 369.000 larvas no total. O Trichogaster trichopteros foi a única espécie em que ambos os sexos predaram 100% das larvas oferecidas. O Betta splendens deixou de predar apenas 15 larvas. Machos do Poecilia reticulata apresentaram baixa capacidade larvófaga quando comparados às fêmeas da mesma espécie. Em relação ao peso e tamanho o Betta splendens mostrou-se capaz de predar 523 larvas/grama/dia. CONCLUSÕES: Fêmeas e machos de Trichogaster trichopteros e de Astyanax fasciatus, e fêmeas de Betta splendens e de Poecillia sphenops foram os peixes que apresentaram maior competência para predar as larvas. Embora com competência menor, machos de Poecillia sphenops e fêmeas de Poecilia reticulata foram capazes de eliminar o número de larvas de Aedes aegypti que possam emergir durante 24 horas num criadouro, em condições naturais. Machos de Poecilia reticulata não foram predadores eficazes.OBJECTIVE: To evaluate the efficacy of fish as predators of the Aedes aegypti larvae in laboratory conditions. METHODS: The male and female of five different fish were included in the experiment. The tests to measure their consumption ability lasted five weeks for each species. Each trial involved four test tanks and four control tanks. Two control tanks

  16. Weight changes and organ pathology in rats given edible larvae of ...

    African Journals Online (AJOL)

    Processing the larvae by boiling and sun-drying reduced the toxicity on the liver and heart but not in the kidney. More research is needed on the toxicological aspects of the consumption of Cirina forda larva. Keywords: insect larvae, processing, entomophagy, histopathology, rats. African Journal of Biomedical Research Vol.

  17. DISTRIBUSI, KELIMPAHAN DAN VARIASI UKURAN LARVA IKAN DI ESTUARIA SUNGAI MUSI

    Directory of Open Access Journals (Sweden)

    Eko Prianto

    2016-03-01

    Full Text Available Penelitian tentang distribusi, kelimpahan dan ukuran larva ikan dilakukan pada bulan Maret, Mei, Juni dan Oktober 2011. Stasiun pengambilan contoh meliputi Muara Delta Upang (stasiun 1, Muara Sungai Musi (stasiun 2 dan Pulau Payung (stasiun 3. Pengambilan larva pada siang hari menggunakan Bongo net yang berukuran mata jaring 250 µm. Hasil identifikasi diperoleh 13 famili ditinjau menurut musim, pada bulan Mei dan Oktober masing-masing diperoleh 7 famili, dan pada bulan juni sebanyak 3 famili. Kelimpahan larva ikan berkisar antara 9-46 ind/m3 dengan jumlah yang tertinggi (46 ind/m3 pada bulan Mei dan terendah pada bulan Juni (9 ind/m3. Larva ikan dari famili Gobiidae memiliki sebaran yang cukup luas baik spasial maupun temporal. Variasi ukuran larva ikan menurut famili setiap bulannya memiliki variasi ukuran yang hampir sama.  Research about the distribution, abundance and size of fish larvae was conducted in March, May, June and October 2011. Sampling stations encompasses Delta Upang (station 1, Muara Sungai Musi (station 2 and Pulau Payung (station 3. Larvae taken during the daytime using a Bongo net with mesh size of 250 µm. Identification results obtained 13 families based on the season, in May and October respectively 7 families, and in June as many as 3 families. Abundance of fish larval around 9-46 ind/m3 with the highest number (46 ind/m3 in May and the lowest in June (9 ind/m3. Larvae of Gobiidae family have a large distribution on spatial and temporal. The variation in size of fish larvae by family on each month are the same.

  18. PREVALENCE OF ANISAKID NEMATODE LARVAE INFECTING SOME MARINE FISHES FROM THE LIBYAN COAST.

    Science.gov (United States)

    Kassem, Hamed H; Bowashi, Salem Mohamed

    2015-12-01

    This study examined eight hundred ninety six marine fishes belonging to nine different fish species; Synodus saurus; Merluccius merluccius; Trachurus mediterraneus; Serranus cabrilla; Mullus surmuletus; Diplodus annularis; Spicara maena; Siganus rirulatus and Liza ramada. The fishes were bought from fish markets at five different sites on Libyan coast, from January to December 2013, for study the anisakids larvae among them. The results showed that 344/896 fishes (38.4%) were infected with Anisakids larvae. S. saurus was the highly infected (80.9%), followed by T mediterraneus (77.5%) but, S. cabrilla, S. maena, M merluccius, M surmuletus, and D. annularis were least anisakid infected showed rates of 58.2%, 53.8%, 43.7%, 36.7% & 3.6%, respectively. No parasites were in S. rirulatus and L, ramada. Ten species of Anisakids larvae was detected during the present study. Two Pseudoterranova sp. Larvae, two types of Anisakis larvae, Anisakis simplex larva and Anisakis sp. Larva, two types of Contracaecum sp. Larvae and four Hysterothylacium larvae. Females showed higher prevalence than males. The number of anisakid larvae varied according to body length and weight of infected fish, without significant difference between prevalence and seasons, but, a significant difference was between prevalence and regions.

  19. Lagrangian Observations and Modeling of Marine Larvae

    Science.gov (United States)

    Paris, Claire B.; Irisson, Jean-Olivier

    2017-04-01

    Just within the past two decades, studies on the early-life history stages of marine organisms have led to new paradigms in population dynamics. Unlike passive plant seeds that are transported by the wind or by animals, marine larvae have motor and sensory capabilities. As a result, marine larvae have a tremendous capacity to actively influence their dispersal. This is continuously revealed as we develop new techniques to observe larvae in their natural environment and begin to understand their ability to detect cues throughout ontogeny, process the information, and use it to ride ocean currents and navigate their way back home, or to a place like home. We present innovative in situ and numerical modeling approaches developed to understand the underlying mechanisms of larval transport in the ocean. We describe a novel concept of a Lagrangian platform, the Drifting In Situ Chamber (DISC), designed to observe and quantify complex larval behaviors and their interactions with the pelagic environment. We give a brief history of larval ecology research with the DISC, showing that swimming is directional in most species, guided by cues as diverse as the position of the sun or the underwater soundscape, and even that (unlike humans!) larvae orient better and swim faster when moving as a group. The observed Lagrangian behavior of individual larvae are directly implemented in the Connectivity Modeling System (CMS), an open source Lagrangian tracking application. Simulations help demonstrate the impact that larval behavior has compared to passive Lagrangian trajectories. These methodologies are already the base of exciting findings and are promising tools for documenting and simulating the behavior of other small pelagic organisms, forecasting their migration in a changing ocean.

  20. Exome and Transcriptome Sequencing of Aedes aegypti Identifies a Locus That Confers Resistance to Brugia malayi and Alters the Immune Response

    KAUST Repository

    Juneja, Punita; Ariani, Cristina V.; Ho, Yung Shwen; Akorli, Jewelna; Palmer, William J.; Pain, Arnab; Jiggins, Francis M.

    2015-01-01

    to target protein-coding regions of the genome, and used association mapping in a wild Kenyan population to identify a single, dominant, sex-linked locus underlying resistance. This falls in a region of the genome where a resistance locus was previously

  1. Annual and spatial variability in endo- and ectoparasite infections of North Sea cod (Gadus morhua Linnaeus, 1758) larvae, post-larvae and juveniles

    DEFF Research Database (Denmark)

    Mehrdana, Foojan; Bahlool, Qusay Z. M.; Skovgaard, Alf

    2014-01-01

    A parasitological investigation was performed on a total of 5380 Atlantic cod larvae, post-larvae and small juveniles sampled from the North Sea during a period of five years. The copepod Caligus elongatus (Von Nordmann, 1832) and the nematode Hysterothylacium aduncum (Rudolphi, 1802) were found ...

  2. Three different agglomerations of blood cells in a Caliroa limacina larva

    NARCIS (Netherlands)

    Barendrecht, G.

    1949-01-01

    Some time ago in our laboratory a number of larvae of Caliroa limacina Retz., the well known slug like sawfly larva of the pear, were fixed in toto and sectioned into complete series, which were coloured with EHRLICH’S or HEIDENHAIN’S haematoxylin and counterstained with eosin. Most of these larvae

  3. Chrysomya megacephala (Fabricius) larvae: A new biodiesel resource

    International Nuclear Information System (INIS)

    Li, Zhuoxue; Yang, Depo; Huang, Miaoling; Hu, Xinjun; Shen, Jiangang; Zhao, Zhimin; Chen, Jianping

    2012-01-01

    Highlights: ►Chrysomya megacephala larvae oil as a new resource transforming to biodiesel. ► Larvae were grown up on restaurant garbage for five days then oil was extracted. ► Oil content in larvae was 24.40 wt% to 26.29 wt% comparing to soybean of 20 wt%. ► Utilization of garbage reduces pollution and makes economic recycle possible. ► The properties of ultimately FAME reach the ASTM D6751 and EN 14124 standards. -- Abstract: The current energy crisis greatly affects worldwide economic development. Therefore, identifying for new energy resources is critically important. In this study, we introduce a potential biodiesel source: Chrysomya megacephala (Fabricius) larvae (CML), which are proliferative and can be fed with a variety of low cost materials, such as manure, wheat bran, rotted meat and decayed vegetation. The potential of C. megacephala (Fabricius) larvae oil (CMLO) for biodiesel applications was explored. Oil was extracted from the CML raised by feeding on restaurant garbage for five days. The oil content obtained from the dehydrated CML ranged from 24.40% to 26.29% since restaurant garbage varies in composition day to day. The acid value of the CMLO was tested to be 1.10 mg KOH/g. Four factors were subsequently considered to optimize the transesterification of CMLO to biodiesel. The optimized conditions included a 6:1 methanol to oil molar ratio, 1.6% KOH catalyst, a reaction temperature of 55 °C and a reaction time of 30 min. Under these conditions, the maximum yield of fatty acid methyl esters (FAME) from CMLO was 87.71%. Finally, properties of the FAME were within the specifications of ASTM D6751 and EN 14214 biodiesel standards. Therefore, we concluded that C. megacephala (Fabricius) larvae represent a potential alternative feedstock for biodiesel production.

  4. Vaccination of lambs with irradiated larvae of Bunostomum trigonocephalum

    International Nuclear Information System (INIS)

    Srivastava, V.K.; Singh, K.S.; Subramanian, G.

    1987-01-01

    Vaccination with a single dose of 2,000 infective larvae of Bunostomum trigonocephalum, irradiated at 40 kR, caused 80 per cent reduction in worm establishment and such lambs withstood a challenge infection which was otherwise fatal to non-vaccinated lambs. The female worms, which developed from irradiated larvae, were irregular in shape, had cuticular thickening at the genital opening and in many male worms the copulatory bursa was rudimentary. The sex ratio was adversely affected in worms developing from irradiated larvae. The population had preponderant sterile females and a very few male worms. (author)

  5. Morphological and behavioral development of the piracanjuba larvae Desenvolvimento morfológico e comportamental de larvas de piracanjuba

    Directory of Open Access Journals (Sweden)

    Cláudia Maria Reis Raposo Maciel

    2010-05-01

    Full Text Available The objective of this work was to study the morphologic development and the swimming and feeding behaviors of piracanjuba larvae, Brycon orbignyanus Valenciennes (1849 (Characiformes, Characidae, Bryconinae, during the period from zero to 172 hours after hatching (standard length = 3.62 - 11.94 mm. The morphological analyses were accomplished by using a trinocular stereo microscope, while the behavioral analyses were performed through periodic observations. In 28 hours after hatching, the larvae (standard length = 6.25 ± 0.13 mm showed the following structural and behavioral characteristics that made them become active predators able to overcome a larval critical phase, the beginning of exogenous feeding: presence of pigmented eyes, terminal and wide mouth, developed oral dentition, developing digestive tube, yolk sac reduction, fins and swim bladder formation, horizontal swimming, cannibalism, and predation. Intense cannibalism among larvae was verified from 26 to 72 hours. At the end of the metamorphosis - 172 hours after hatching - the larvae measuring 11.94 + 0.80 mm in standard length presented a flexed notochord, caudal fin bifurcation, dorsal and anal fin formation, synchronized movements, and formation of shoals, characteristics that together allow enhanced perception and locomotio in exploration of the environment, determining the best moment for transfering to the fishponds. New studies can contribute to commercial fish farming by improving feeding management, performance, survival, and productivity of this species.Objetivou-se estudar o desenvolvimento morfológico e os comportamentos natatório e alimentar de larvas de piracanjuba, Brycon orbignyanus Valenciennes (1849 (Characiformes, Characidae, Bryconinae no período de 0 a 172 horas após a eclosão (comprimento-padrão = 3,62 - 11,94 mm. As análises morfológicas foram realizadas com auxílio de um microscópio estereoscópico trinocular e as comportamentais, por meio de

  6. Assessment of Clarias gariepinus as a biological control agent against mosquito larvae.

    Science.gov (United States)

    Chala, Buze; Erko, Berhanu; Animut, Abebe; Degarege, Abraham; Petros, Beyene

    2016-05-31

    The emergence and spread of insecticide resistant mosquitoes renewed interest in investigating the use of larvivorous fish as a biological control agent. The potential of Clarias gariepinus fish in controlling Anopheles arabiensis and culicine larvae was assessed under laboratory and semi-field conditions. Small size (15-20 cm) C. gariepinus fish consumed greater number of mosquito larvae than the large size fish (25-40 cm) in the multivariate regression model (β = 13.36, 95 % CI = 4.57, 22.15). The Anopheles larvae consumed was greater in number than the culicines larvae consumed by the fish (β = 12.10, 95 % CI = 3.31, 20.89). The number of larvae consumed was greater during the night hours than during the light hours (β = 30.06, 95 % CI = 21.27, 38.85). Amount of supplementary fish food did not cause significant differences in the number of mosquito larvae consumed by the fish among different groups. C. gariepinus was observed to feed on mosquito larvae under laboratory and semi-field conditions. C. gariepinus fed on the larvae of An. arabiensis and culicines readily. Hence, it can be used as an alternative mosquito control agent in Ethiopia where the breeding habitats are small and localized.

  7. Oesophagostomum columbianum : immunization of young lambs using gamma ray attenuated inefective larvae

    International Nuclear Information System (INIS)

    Sharma, R.L.; Dhar, D.N.

    1987-01-01

    Infective Oesophagostomum columbianum larvae were successfully attenuated by exposing them to a gamma radiation dose levels of either 40 or 50 Krad. Lambs receiving a single vaccination dose of 2000 infective larvae attenuated at 40 Krad developed partial protection, whereas those vaccinated with similar dose of infection with 50 Krad irradiated larvae failed to develop any protection. A double vaccination schedule comprising of 500 and 2000 gamma attenuated (40 Krad) infective larvae induced a significantly higher level of protection against the challenge dose. The possible use of radiation attenuated larvae as vaccine for immunoprophylaxis against ovine Oesophagostomiasis has been discussed. (author). 11 refs., 2 tables

  8. Sun-Compass Orientation in Mediterranean Fish Larvae

    OpenAIRE

    Faillettaz , Robin; Blandin , Agathe; Paris , Claire B.; Koubbi , Philippe; Irisson , Jean-Olivier

    2015-01-01

    International audience; Mortality is very high during the pelagic larval phase of fishes but the factors that determine recruitment success remain unclear and hard to predict. Because of their bipartite life history , larvae of coastal species have to head back to the shore at the end of their pelagic episode , to settle. These settlement-stage larvae are known to display strong sensory and motile abilities, but most work has been focused on tropical, insular environments and on the influence...

  9. Activity of R(+ limonene against Anisakis larvae

    Directory of Open Access Journals (Sweden)

    Filippo Giarratana

    2015-12-01

    Full Text Available The aim of this work is to evaluate the activity of R(+ limonene of against Anisakidae larvae. Its effectiveness was tested in vitro. The results obtained showing a significant activity of the compound against Anisakis larvae, suggesting further investigation on its potential use in the industrial marinating process. In this regard, the use of R(+ limonene in seafood products could be interesting, also due the sensory attributes resulting from its use and its relatively safe status.

  10. Characterization of the metabolic transformation of thiamethoxam to clothianidin in Helicoverpa armigera larvae by SPE combined UPLC-MS/MS and its relationship with the toxicity of thiamethoxam to Helicoverpa armigera larvae.

    Science.gov (United States)

    Fan, Yinjun; Shi, Xueyan

    2017-09-01

    In order to characterize the metabolic transformation of thiamethoxam (TMX) to clothianidin (CLO) in Helicoverpa armigera larvae and clarify its relationship with the insecticidal toxicity of TMX, method for determination of TMX and its metabolite clothianidin (CLO) residues in H. armigera larvae by solid phase extraction (SPE) combined UPLC-MS/MS was established. Following acetonitrile extraction and purification by SPE on florisil cartridge and C 18 cartridge sequently, and cleanup by PSA adsorption, TMX and CLO residues in H. armigera larvae were successfully determined by UPLC-MS/MS. By using the established method, the concentration-time curves of TMX and its metabolite CLO in H. armigera larvae in vivo and metabolism of TMX by microsome of H. armigera larvae midguts in vitro were studied. TMX was quickly eliminated from H. armigera larvae with the elimination half-life as 4.2h. Meanwhile, only a small amount of CLO was formed from TMX metabolism, with the maximum CLO level in H. armigera larvae only accounts for the metabolic transformation of 7.99% of TMX, at 10h after intravenous TMX administration. Our results suggested that the low insecticidal efficacy of TMX against H. armigera larvae was related with the rapidly elimination of TMX from H. armigera larvae, meanwhile, CLO as TMX metabolite at a very low level in vivo didn't contribute to TMX toxicity to H. armigera larvae. In H. armigera larvae, TMX didn't act as proinsecticide for CLO in insecticidal efficacy of TMX. Copyright © 2017 Elsevier B.V. All rights reserved.

  11. Production of live prey for marine fish larvae

    OpenAIRE

    Kraul, S

    1989-01-01

    Tropical marine fish larvae vary in their requirements for live planktonic food. Selection of live prey species for culture depends on larval size and larval tolerance of water quality. This report describes some of the cultured prey species, and their uses and limits as effective food for fish larvae. Methods are presented for the culture of phytoplankton, rotifers, copepods, and other live feeds.

  12. Larvacidal Effect of Imperata Cylindrical Root Decoction against Culex sp. Larvae

    Directory of Open Access Journals (Sweden)

    Afini Tiara Resi

    2014-08-01

    Full Text Available Background: Filariasis is one of the neglected tropical diseases. About 337 of 401 districts in Indonesia are endemic areas for filariasis, especially in Sumatera, Kalimantan, and Papua. Culex sp. is one of the lymphatic filariasis vectors which can be controlled by insecticide, including larvacide. This study was conducted to determine the larvacidal effect of Imperata cylindrical root decoction against Culex sp. larvae. Methods: This study was conducted at the Laboratory of Parasitology, Faculty of Medicine, Universitas Padjadjaran during the period of September to November 2012. The study object was Culex sp. larvae III/IV instars. The design of this study was experimental laboratory using true experimental approach. The larvae were divided into three groups: negative control (distilled water, reference (Abate®, and decoction. The number of larvae in each group was 25 larvae, and the effects were evaluated by the total number of dead larvae in 48 hours under observation. The data were then analyzed by Mann-Whitney test and Probit test. Results: The result of the Mann-Whitney test to compare Imperata cylindrica root decoction treatment to distilled water as control was significant (p<0.05. However, Abate® gave a better result. The Probit test resultwas LC50: 63% and LC90: 489%. Conclusions: Imperata cylindrical root decoction has a larvacidal effect against Culex sp. larvae.

  13. Preliminary study of killing the larva of plodia interpunella by irradiation

    International Nuclear Information System (INIS)

    Wang Jide; Ma Xiaoping

    1994-01-01

    The results of killing the larva of plodia interpunella in the fruit by 60 Co γ-irradiation are described. The lowest effective dose for killing larva by irradiation is ca. 2000 Gy; the effective dose for immediately killing larva is 3000 Gy. The method is simple and easy and also suitable for the study of commercial irradiation of dry-fruit

  14. Helminths Parasite Larvae collected from Arabian Gulf Fish. 4. Description of four Larvae including two Metacercarae, one Didymozoid and one Acanthocephalan from Emirati Coasts

    International Nuclear Information System (INIS)

    Kardousha, M.M.

    2005-01-01

    Four helminth larvae from different fish hosts caught from Emirate coasts are described. Two are metacercariae related to genus Southampton's, type (I) and (II). Type (I) was found encysted in body cavities of the Indian halibut Psettodes erumei and the areolate grouper Epinephelus areolatusu and type (II) in the golden stripped goatfish Mulloides flavolineatus. The third larva is related to Acanthocephala and identified as Serrasentis sagittifer. It was collected from the body cavity of the spotted lizard fish Saurida undosquamius. The fourth larva belongs to the didymozoid trematodes, and was found infecting the kidneys of different hosts, such as Saurida undosquamis, the Jack pomfret Parastromateus niger and mackerel tuna Euthynnus affins. The larva related to Stephanostomum type (I) and type (II) and the dydimozoid type are described for the first time in the Arabian Gulf. (author)

  15. Effect of electronic beam irradiation on last instar larvae of lasioderma serricorne fabricius

    International Nuclear Information System (INIS)

    Chen Yuntang; Guo Dongquan; Lu Xiaohua; Zhang Jianwei; Yang Baoan; Du Yueguang; Liu Jiangyu; Tian Zhanjun; Zhang Xiaoyan

    2010-01-01

    The electronic beam irradiation effects on the last instar larvae of cigarette beetle (Lasioderma serricorne Fabricius) in tobacco were studied, and the mortality in 42 days, lethal time, pupation rate, emergence rate and reproductive capacity after irradiation were measured. The results showed that the mortality increased with the increase of irradiation dosage, but the larvae did not dead immediately. The last instar larvae irradiated by the dosages higher than 480 Gy could prevent the development of larvae to adults. No new generation was found after 300 Gy treatment of the last instar larvae. So 300 Gy irradiation could be considered as a suitable dose to prevent the reproduction of cigarette beetle of the last instar larvae in the tobacco. (authors)

  16. Temporal and Spatial Distribution Patterns of Echinoderm Larvae in La Parguera, Puerto Rico

    Directory of Open Access Journals (Sweden)

    Stacey M Williams

    2010-10-01

    Full Text Available This study describes temporal and spatial abundance patterns of echinoderm larvae in La Parguera, Puerto Rico. For the temporal study, larvae were sampled by a series of monthly tows taken with a 64μm mesh net between the new and full moon from April 2005 to July 2006, September 2006 and August 2007. In order to measure spatial variation of echinoderm larval bundances, oblique tows were taken with 64 and 202μm mesh nets at seven different sites within the shelf, at the shelf-edge, and at a nearby oceanic stations during August 2007. Overall, Echinoidea (sea urchin exhibited the highest abundance with a total of 11 921 larvae, representing 52.5% of the total collection. Ophiuroidea (brittle star ranked second in abundance with 45.6% of the total larvae. Holothuroidea (sea cucumber and Asteroidea larvae (sea star accounted for less than 2% of the total echinoderm larval collection. Early larval stages (2-8 day old of Diadema antillarum represented 20% of the total Echinoidea larvae. There was no marked seasonal trend of echinoderm larval abundance; Echinoidea and Ophiuroidea larvae were present in all monthly samples indicating that reproduction occurs year-round. Peak abundances of later-stage Echinoidea larvae were observed during January, July and October and of later-stage Ophiuroidea larvae during June, August and October. The observed peaks of later-stage larval abundances may be indicative of higher recruitment activity during these months. There was a significant difference of echinoderm larval abundance between spatial stations, with higher abundances collected at the shelf-edge. Later-stage (~24 day old D. antillarum larvae were mostly collected at shelf-edge and oceanic locations. In addition, the 64mm mesh net was more efficient for collection of echinoderm larvae than the 202mm mesh net. Rev. Biol. Trop. 58 (Suppl. 3: 81-88. Epub 2010 October 01.Este estudio describe patrones de abundancia temporal y espacial de larvas de

  17. Developmental Toxicity of Dextromethorphan in Zebrafish Embryos/Larvae

    Science.gov (United States)

    Xu, Zheng; Williams, Frederick E.; Liu, Ming-Cheh

    2012-01-01

    Dextromethorphan is widely used in over-the-counter cough and cold medications. Its efficacy and safety for infants and young children remains to be clarified. The present study was designed to use the zebrafish as a model to investigate the potential toxicity of dextromethorphan during the embryonic and larval development. Three sets of zebrafish embryos/larvae were exposed to dextromethorphan at 24 hours post fertilization (hpf), 48 hpf, and 72 hpf, respectively, during the embryonic/larval development. Compared with the 48 and 72 hpf exposure sets, the embryos/larvae in the 24 hpf exposure set showed much higher mortality rates which increased in a dose-dependent manner. Bradycardia and reduced blood flow were observed for the embryos/larvae treated with increasing concentrations of dextromethorphan. Morphological effects of dextromethorphan exposure, including yolk sac and cardiac edema, craniofacial malformation, lordosis, non-inflated swim bladder, and missing gill, were also more frequent and severe among zebrafish embryos/larvae exposed to dextromethorphan at 24 hpf. Whether the more frequent and severe developmental toxicity of dextromethorphan observed among the embryos/larvae in the 24 hpf exposure set, as compared with the 48 and 72 hpf exposure sets, is due to the developmental expression of the Phase I and Phase II enzymes involved in the metabolism of dextromethorphan remains to be clarified. A reverse transcription-polymerase chain reaction (RT-PCR) analysis, nevertheless, revealed developmental stage-dependent expression of mRNAs encoding SULT3 ST1 and SULT3 ST3, two enzymes previously shown to be capable of sulfating dextrorphan, an active metabolite of dextromethorphan. PMID:20737414

  18. Distribution and elimination of Norfloxacin in Fenneropenaeus chinensis larvae

    Science.gov (United States)

    Sun, Ming; Li, Jian; Zhao, Fazhen; Li, Jitao; Chang, Zhiqiang

    2013-09-01

    This study examined the distribution and elimination of Norfloxacin (NFLX) in Fenneropenaeus chinensis ovary and egg and newly hatched larvae. Mature parental shrimp were exposed to 4 or 10 mg L-1 NFLX for 2 or 5 d. Ovary and eggs of the shrimp were sampled after spawning in order to detect NFLX residue using high-performance liquid chromatography (HPLC). Results showed that NFLX residue accumulated in F. chinensis eggs after the parental exposure, with the highest residue detected in ovary. To examine the fate of NFLX residue in larvae, we further determined the concentration of NFLX residue in F. chinensis eggs and larvae at 4 different developmental stages after 24-h exposure. From the newly metamorphosed larvae (0 h post-metamorphosis, h.p.m), samples were taken at different time intervals to 72 h.p.m. HPLC assay showed that the concentrations of NFLX residue in zoea exposed to 4 and 10 mg L-1 NFLX were the highest at 1.5 h, i.e., 0.332 and 0.454 μg g-1, respectively. At the two NFLX exposure levels, the elimination time of half NFLX (half life) in nauplius was 45.36 and 49.85 h, respectively, followed by that in zoea (31.68 and 33.13 h), mysis larvae (42.24 and 47.28 h) and postlarvae (24.48 and 30.96 h). Both NFLX exposure levels had a germicidal effect. The distribution and elimination of NFLX residue in F. chinensis tissue, eggs and larvae correlated well with the drug exposure level. The disappearance of NFLX residue coincided with the larval growth, and the half-life of NFLX decreased with the larval development.

  19. Temporal and Spatial Distribution Patterns of Echinoderm Larvae in La Parguera, Puerto Rico

    Directory of Open Access Journals (Sweden)

    Stacey M Williams

    2010-10-01

    Full Text Available This study describes temporal and spatial abundance patterns of echinoderm larvae in La Parguera, Puerto Rico. For the temporal study, larvae were sampled by a series of monthly tows taken with a 64μm mesh net between the new and full moon from April 2005 to July 2006, September 2006 and August 2007. In order to measure spatial variation of echinoderm larval bundances, oblique tows were taken with 64 and 202μm mesh nets at seven different sites within the shelf, at the shelf-edge, and at a nearby oceanic stations during August 2007. Overall, Echinoidea (sea urchin exhibited the highest abundance with a total of 11 921 larvae, representing 52.5% of the total collection. Ophiuroidea (brittle star ranked second in abundance with 45.6% of the total larvae. Holothuroidea (sea cucumber and Asteroidea larvae (sea star accounted for less than 2% of the total echinoderm larval collection. Early larval stages (2-8 day old of Diadema antillarum represented 20% of the total Echinoidea larvae. There was no marked seasonal trend of echinoderm larval abundance; Echinoidea and Ophiuroidea larvae were present in all monthly samples indicating that reproduction occurs year-round. Peak abundances of later-stage Echinoidea larvae were observed during January, July and October and of later-stage Ophiuroidea larvae during June, August and October. The observed peaks of later-stage larval abundances may be indicative of higher recruitment activity during these months. There was a significant difference of echinoderm larval abundance between spatial stations, with higher abundances collected at the shelf-edge. Later-stage (~24 day old D. antillarum larvae were mostly collected at shelf-edge and oceanic locations. In addition, the 64mm mesh net was more efficient for collection of echinoderm larvae than the 202mm mesh net. Rev. Biol. Trop. 58 (Suppl. 3: 81-88. Epub 2010 October 01.

  20. Cutaneous larva migrans: a bad souvenir from the vacation.

    Science.gov (United States)

    Criado, Paulo Ricardo; Belda, Walter; Vasconcellos, Cidia; Silva, Cristiana Silveira

    2012-06-15

    Cutaneous larva migrans (CLM) is a common endemic disease in tropical and subtropical countries. This condition is caused by skin-penetrating larvae of nematodes, mainly of the hookworm Ancylostoma braziliense and other nematodes of the family Ancylostomidae. We report three cases of CLM acquired during vacations in different regions of Brazil.

  1. How elimination of lymphatic filariasis as a public health problem in the Kingdom of Cambodia was achieved.

    Science.gov (United States)

    Khieu, Virak; Or, Vandine; Tep, Chhakda; Odermatt, Peter; Tsuyuoka, Reiko; Char, Meng Chuor; Brady, Molly A; Sidwell, Joshua; Yajima, Aya; Huy, Rekol; Ramaiah, Kapa D; Muth, Sinuon

    2018-02-20

    Endemicity of lymphatic filariasis (LF) in Cambodia was proven in 1956 when microfilariae were detected in mosquitos in the Kratié province. In 2001, an extensive study confirmed the presence of both Brugia malayi and Wuchereria bancrofti microfilariae. In 2003, the Ministry of Health established a national task force to develop policies and strategies for controlling and eliminating neglected tropical diseases (NTDs), with the goal of eliminating LF by 2015. This article summarizes the work accomplished to eliminate LF as a public health problem in Cambodia. The National Program to Eliminate Lymphatic Filariasis made excellent progress in the goal towards elimination due to strong collaboration between ministries, intensive supervision by national staff, and advocacy for mobilization of internal and external resources. Mass drug administration (MDA) with diethylcarbamazine citrate and albendazole was conducted in six implementation units, achieving > 70% epidemiological coverage for five consecutive rounds, from 2005 to 2009. In 2006, in 14 provinces, healthcare workers developed a line list of lymphedema and hydrocele patients, many of whom were > 40 years old and had been affected by LF for many years. The national program also trained healthcare workers and provincial and district staff in morbidity management and disability prevention, and designated health centers to provide care for lymphedema and acute attack. Two reference hospitals were designated to administer hydrocele surgery. Effectiveness of MDA was proven with transmission assessment surveys. These found that less than 1% of school children had antigenemia in 2010, which fell to 0% in both 2013 and 2015. A separate survey in one province in 2015 using Brugia Rapid tests to test for LF antibody found one child positive among 1677 children. The list of chronic LF patients was most recently updated and confirmed in 2011-2012, with 32 lymphoedema patients and 17 hydrocele patients listed. All

  2. Ecological Factors Determining Abundance of Parasitic Mites on Aedes spp. Larvae

    Directory of Open Access Journals (Sweden)

    Nurhadi Eko Firmansyah

    2017-12-01

    Full Text Available Ability to infestation and abundance of parasitic mites in Aedes spp. larvae cannot be separated from the influence of various factors. Ecological factors have been suggested to play a role determine the presence of parasitic mites that under certain conditions become a key factor in determining the abundance of parasitic mites on Aedes spp. larvae. The aim of this study to determine the ecological factors affect the abundance of parasitic mites on Aedes spp. larvae in Bogor Regency. Capturing of Aedes spp. larvae was performed directly on the habitats found in indoor and outdoor. Capturing mites in the body of Aedes spp. larvae was performed using insect forceps. Ecological factors measured were dissolved oxygen (DO, pH, temperature, and total dissolved solid (TDS. The influence of ecological factors was analyzed using regression and correlation analysis. The result of mite identification has been obtained three species of mites that are Halacarus sp., Histiostoma sp., and Hydrozetes sp. The result indicated that total dissolved solid (TDS and temperature was the factors that determined the abundance of mites. The factors of pH, and dissolved oxygen (DO did not determine the abundance of parasitic mites of Aedes spp. larvae. The research result can be further developed as a new alternative to Dengue Hemorraghic Fever control and provide information on parasitic mites that infest Aedes spp. larvae. In addition, this results become an early step in controlling of Aedes spp. strategy platform by the parasitic mites.

  3. Description of the third instar larva of Megadytes latus (Fabricius (Coleoptera, Dytiscidae, with an identification key for described larvae of the genus Descrição da larva de terceiro ínstar de Megadytes latus (Fabricius (Coleoptera, Dytiscidae

    Directory of Open Access Journals (Sweden)

    Nelson Ferreira-Jr

    2006-09-01

    Full Text Available The last instar larva of M. latus (Fabricius, 1801 is described and figured, based on reared specimens from Serra dos Órgãos, Teresópolis, state of Rio de Janeiro, Brazil. Some notes on the biotope are provided.A larva de terceiro ínstar de M. latus (Fabricius, 1801 é descrita e ilustrada, baseado em espécimes criados da Serra dos Órgãos, Teresópolis, Rio de Janeiro, Brasil. Algumas notas acerca do biótopo onde as larvas foram coletadas são incluídas.

  4. Infective larvae of Rhabdiasidae (Nematoda): comparative morphology of seven European species.

    Science.gov (United States)

    Kuzmin, Yuriy; Junker, Kerstin; Bain, Odile

    2014-03-01

    The morphology of infective third-stage larvae of Rhabdias bufonis, R. rubrovenosa, R. sphaerocephala, R. fuscovenosa, R. elaphe, Entomelas entomelas and E. dujardini is described. The sheath structure in the studied larvae appeared to be similar to that described in other species of the family Rhabdiasidae, its chequered aspect being caused by a combination of outer longitudinal striations and inner longitudinal as well as transverse ridges. The larvae were similar in general morphology but differed in the presence/absence of anterior apical protuberances (pseudolabia), the shape and ornamentation of the tail tip, and the structure of lateral alae in the caudal region of the body. No relationship between the morphological characters of the larvae of the studied species and their taxonomic position or specificity of adult parasites to a particular host group was observed. Regardless, the larvae of each species can be identified by a combination of morphological peculiarities in the anterior and caudal regions of the body.

  5. Distribution and abundance of skipjack (Katsuwonus pelamis larvae in eastern Brazilian waters

    Directory of Open Access Journals (Sweden)

    Yasunobu Matsuura

    1982-01-01

    Full Text Available Based on data from two ichthyoplankton surveys carried out off the eastern Brazilian coast in June and November-December 1978, the larval distribution of skipjack is discussed. Skipjack larvae were more abundant in the November-December cruise (southern hemisphere spring. They occurred mainly at stations near the margin of the continental shelf or over seamounts. Out of 240 specimens of scombrid larvae collected in this area, skipjack larvae comprised only 10.4% (25 specimens, whereas the most abundant larvae were Thunnus spp. with 68.8% (165 specimens.

  6. Experimental infection in Notodiaptomus sp. (Crustacea: Calanoida with larvae of Camallanus sp. (Nematoda: Camallanidae Infecção experimental em Notodiaptomus sp. (Crustacea: Calanoida com larvas de Camallanus sp. (Nematoda: Camallanidae

    Directory of Open Access Journals (Sweden)

    M.L. Martins

    2007-04-01

    Full Text Available This trial registered the experimental infection viability with nematode larvae Camallanus sp. in Notodiaptomus sp., a crustacean, which can be an intermediate host. Adult females of nematode were dissected from the intestines of Xiphophorus maculatus (Osteichthyes: Poeciliidae, at a fish farm in the State of São Paulo. Females were slightly compressed for larvae release, collected with Pasteur pipette and separated on Petri dishes with 9ml filtered water at 28.1ºC, from zooplankton culture. Treatments consisted of Petri dishes with 60 and 105 copepods, in which 120, 150 and 210 larvae of nematode were added in four replications. Twenty-four and 36h after exposition to the larvae, the copepods were fixed in 70% alcohol to record the amount of fixed larvae. Twenty four hours after exposition, 60 copepods group with 120 larvae showed significantly higher prevalence (46.5% when compared to 105 copepods and 120 larvae (33.2%. Thus, these answers suggested that 120 larvae were enough for a successful infectivity. Experimental infection was available and so, it was used as a pattern to life cycle studies of camallanid nematodes and hosts susceptibility tests.A viabilidade da infecção experimental com larvas do nematóide Camallanus sp. em Notodiaptomus sp., crustáceo com potencial para hospedeiro intermediário foi avaliada. Fêmeas adultas do nematóide foram extraídas de Xiphophorus maculatus (Osteichthyes: Poeciliidae, provenientes de piscicultura de peixes ornamentais no estado de São Paulo. As fêmeas foram ligeiramente pressionadas para liberar as larvas, coletadas com pipeta Pasteur e separadas em placas de Petri contendo 9ml de água filtrada a 28,1ºC do próprio cultivo de zooplâncton. Os tratamentos consistiram de placas contendo 60 e 105 copépodes onde se adicionou 120, 150 e 210 larvas de nematóides em quatro repetições. Nos tempos de 24 e 36h após a exposição às larvas, os copépodes foram fixados em álcool 70% para

  7. Microplastic ingestion in fish larvae in the western English Channel.

    Science.gov (United States)

    Steer, Madeleine; Cole, Matthew; Thompson, Richard C; Lindeque, Penelope K

    2017-07-01

    Microplastics have been documented in marine environments worldwide, where they pose a potential risk to biota. Environmental interactions between microplastics and lower trophic organisms are poorly understood. Coastal shelf seas are rich in productivity but also experience high levels of microplastic pollution. In these habitats, fish have an important ecological and economic role. In their early life stages, planktonic fish larvae are vulnerable to pollution, environmental stress and predation. Here we assess the occurrence of microplastic ingestion in wild fish larvae. Fish larvae and water samples were taken across three sites (10, 19 and 35 km from shore) in the western English Channel from April to June 2016. We identified 2.9% of fish larvae (n = 347) had ingested microplastics, of which 66% were blue fibres; ingested microfibers closely resembled those identified within water samples. With distance from the coast, larval fish density increased significantly (P < 0.05), while waterborne microplastic concentrations (P < 0.01) and incidence of ingestion decreased. This study provides baseline ecological data illustrating the correlation between waterborne microplastics and the incidence of ingestion in fish larvae. Copyright © 2017 Elsevier Ltd. All rights reserved.

  8. High magnetic field induced otolith fusion in the zebrafish larvae.

    Science.gov (United States)

    Pais-Roldán, Patricia; Singh, Ajeet Pratap; Schulz, Hildegard; Yu, Xin

    2016-04-11

    Magnetoreception in animals illustrates the interaction of biological systems with the geomagnetic field (geoMF). However, there are few studies that identified the impact of high magnetic field (MF) exposure from Magnetic Resonance Imaging (MRI) scanners (>100,000 times of geoMF) on specific biological targets. Here, we investigated the effects of a 14 Tesla MRI scanner on zebrafish larvae. All zebrafish larvae aligned parallel to the B0 field, i.e. the static MF, in the MRI scanner. The two otoliths (ear stones) in the otic vesicles of zebrafish larvae older than 24 hours post fertilization (hpf) fused together after the high MF exposure as short as 2 hours, yielding a single-otolith phenotype with aberrant swimming behavior. The otolith fusion was blocked in zebrafish larvae under anesthesia or embedded in agarose. Hair cells may play an important role on the MF-induced otolith fusion. This work provided direct evidence to show that high MF interacts with the otic vesicle of zebrafish larvae and causes otolith fusion in an "all-or-none" manner. The MF-induced otolith fusion may facilitate the searching for MF sensors using genetically amenable vertebrate animal models, such as zebrafish.

  9. Cutaneous larva migrans – a threat to divers in the tropics

    Directory of Open Access Journals (Sweden)

    Olszański Romuald

    2016-09-01

    Full Text Available The article presents a dermatosis that occurs in tropical and subtropical countries. Though the definitive hosts of the cutaneous larva migrans parasite are animals, humans can become accidental hosts and they are infected when their skin comes into contact with damp soil, most frequently sand. The disease is only present in the epidermis where an itch is brought about by the mining activity of the larva. Sunbathers and divers who put on their gear on a beach, on account of the epidermis maceration caused by a prolonged exposure to water, are particularly susceptible to the penetrative activities of the larva. In Poland the cutaneous larva migrans is in most cases mistaken for nettle rash or eczema.

  10. Morphogenesis of Strongyloides stercoralis infective larvae requires the DAF-16 ortholog FKTF-1.

    Directory of Open Access Journals (Sweden)

    Michelle L Castelletto

    2009-04-01

    Full Text Available Based on metabolic and morphological similarities between infective third-stage larvae of parasitic nematodes and dauer larvae of Caenorhabditis elegans, it is hypothesized that similar genetic mechanisms control the development of these forms. In the parasite Strongyloides stercoralis, FKTF-1 is an ortholog of DAF-16, a forkhead transcription factor that regulates dauer larval development in C. elegans. Using transgenesis, we investigated the role of FKTF-1 in S. stercoralis' infective larval development. In first-stage larvae, GFP-tagged recombinant FKTF-1b localizes to the pharynx and hypodermis, tissues remodeled in infective larvae. Activating and inactivating mutations at predicted AKT phosphorylation sites on FKTF-1b give constitutive cytoplasmic and nuclear localization of the protein, respectively, indicating that its post-translational regulation is similar to other FOXO-class transcription factors. Mutant constructs designed to interfere with endogenous FKTF-1b function altered the intestinal and pharyngeal development of the larvae and resulted in some transgenic larvae failing to arrest in the infective stage. Our findings indicate that FKTF-1b is required for proper morphogenesis of S. stercoralis infective larvae and support the overall hypothesis of similar regulation of dauer development in C. elegans and the formation of infective larvae in parasitic nematodes.

  11. Irradiation effect of electronic beam on older larvae of Lasioderma serricorne (Fabricius)

    International Nuclear Information System (INIS)

    Chen Yuntang; Guo Dongquan; Zhang Jianwei; Yang Baoan

    2010-01-01

    Cigarette beetle [ Lasioderma serricorne (Fabricius) ] is an important pest of stored tobacco distributing over the world, and it is also one of the most serious pests in the tobacco warehouse. The larvae is the most serious detriment in the four states of cigarette beetle. The objective of this study was to control the damage on tobacco from cigarette beetle. The irradiation effects of electronic beam on the older larvae of cigarette beetle in tobacco were studied. The results showed that the older larvae irradiated by the doses higher than 480 Gy could prevent the development to adults; and no new generation was found after 300 Gy irradiation for older larvae. Thus 300Gy irradiation could prevent the reproduction of cigarette beetle for the older larvae in the tobacco. (authors)

  12. Activity of Selected Formulated Biorational and Synthetic Insecticides Against Larvae of Helicoverpa armigera (Lepidoptera: Noctuidae).

    Science.gov (United States)

    Vivan, L M; Torres, J B; Fernandes, P L S

    2017-02-01

    This work studied 17 insecticides belonging to nucleopolyhedrovirus (NPV), Bacillus thuringiensis (Bt kurstaki and Bt aizawai), benzoylureas (insect growth regulators [IGRs]), carbamates, organophosphates, spinosyns, and diamides against larvae of Helicoverpa armigera (Hübner), invasive species in the South American continent. Larvae of different instars were fed for 7 d with untreated or insecticide-treated diets. Mortality was recorded daily for 7 d, and surviving larvae were individually weighed on the seventh day. The NPV and Bt insecticides caused 100% mortality of first-instar larvae and first-instar and second-instar larvae, respectively. However, both NPV and Bt-based products caused low mortality of third-instar larvae and did not kill older larvae. The IGR lufenuron was highly effective against all three ages of larvae tested, whereas teflubenzuron and triflumuron produced maximum 60% mortality of second-instar larvae and lower than 50% to older larvae. Thiodicarb, chlorantraniliprole, indoxacarb, chlorpyrifos, and chlorfenapyr, irrespective of tested age, caused 100% mortality of larvae, with the last two insecticides reaching 100% mortality within 2 d of feeding on the treated diet. Flubendiamide caused lower mortality but significantly affected the weight of surviving larvae, whereas neither spinosad nor methomyl produced significant mortality or affected the weight of larvae. Based on the results, the age of H. armigera larvae plays an important role in the recommendation of NPV and Bt insecticides. Furthermore, there are potential options between biological and synthetic insecticides tested against H. armigera, and recording larval size during monitoring, in addition to the infestation level, should be considered when recommending biological-based insecticides to control this pest. © The Authors 2016. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  13. Effects of benzylisoquinoline alkaloids on the larvae of polyphagous Lepidoptera.

    Science.gov (United States)

    Miller, James S; Feeny, Paul

    1983-06-01

    Six benzylisoquinoline alkaloids were fed to the larvae of three polyphagous Lepidoptera species: Hyphantria cunea, Spodoptera eridania, and Lymantria dispar. Exposure of last instar larvae to alkaloid-containing diets over a 24-h period resulted in reduced feeding rates and reduced growth efficiencies. Lymantria dispar larvae reared from eggs on alkaloid diets took longer to reach the fifth instar, attained lower larval weights, and showed reduced survivorship. The benzylisoquinolines tested were not equally effective as toxins or feeding inhibitors. Some produced dramatic effects while others produced no effects. The relative responses of the three caterpillar species to the six alkaloids were similar. Those benzylisoquinolines with a methylene-dioxyphenyl (1,3-benzodioxole) group were consistently the most toxic or repellent while laudanosine, a relatively simple benzylisoquinoline, was generally innocuous. Available host records indicate that benzylisoquinoline-containing plants are avoided by the larvae of these moth species.

  14. Habitat stability and occurrences of malaria vector larvae in western Kenya highlands

    Directory of Open Access Journals (Sweden)

    Atieli Harrysone

    2009-10-01

    Full Text Available Abstract Background Although the occurrence of malaria vector larvae in the valleys of western Kenya highlands is well documented, knowledge of larval habitats in the uphill sites is lacking. Given that most inhabitants of the highlands actually dwell in the uphill regions, it is important to develop understanding of mosquito breeding habitat stability in these sites in order to determine their potential for larval control. Methods A total of 128 potential larval habitats were identified in hilltops and along the seasonal streams in the Sigalagala area of Kakamega district, western Kenya. Water availability in the habitats was followed up daily from August 3, 2006 to February 23, 2007. A habitat is defined as stable when it remains aquatic continuously for at least 12 d. Mosquito larvae were observed weekly. Frequencies of aquatic, stable and larvae positive habitats were compared between the hilltop and seasonal stream area using χ2-test. Factors affecting the presence/absence of Anopheles gambiae larvae in the highlands were determined using multiple logistic regression analysis. Results Topography significantly affected habitat availability and stability. The occurrence of aquatic habitats in the hilltop was more sporadic than in the stream area. The percentage of habitat occurrences that were classified as stable during the rainy season is 48.76% and 80.79% respectively for the hilltop and stream area. Corresponding frequencies of larvae positive habitats were 0% in the hilltop and 5.91% in the stream area. After the rainy season, only 23.42% of habitat occurrences were stable and 0.01% larvae positive habitats were found in the hilltops, whereas 89.75% of occurrences remained stable in the stream area resulting in a frequency of 12.21% larvae positive habitats. The logistic regression analysis confirmed the association between habitat stability and larval occurrence and indicated that habitat surface area was negatively affecting the

  15. Inhibitory effect of indole analogs against Paenibacillus larvae, the causal agent of American foulbrood disease.

    Science.gov (United States)

    Alvarado, Israel; Margotta, Joseph W; Aoki, Mai M; Flores, Fernando; Agudelo, Fresia; Michel, Guillermo; Elekonich, Michelle M; Abel-Santos, Ernesto

    2017-09-01

    Paenibacillus larvae, a Gram-positive bacterium, causes American foulbrood (AFB) in honey bee larvae (Apis mellifera Linnaeus [Hymenoptera: Apidae]). P. larvae spores exit dormancy in the gut of bee larvae, the germinated cells proliferate, and ultimately bacteremia kills the host. Hence, spore germination is a required step for establishing AFB disease. We previously found that P. larvae spores germinate in response to l-tyrosine plus uric acid in vitro. Additionally, we determined that indole and phenol blocked spore germination. In this work, we evaluated the antagonistic effect of 35 indole and phenol analogs and identified strong inhibitors of P. larvae spore germination in vitro. We further tested the most promising candidate, 5-chloroindole, and found that it significantly reduced bacterial proliferation. Finally, feeding artificial worker jelly containing anti-germination compounds to AFB-exposed larvae significantly decreased AFB infection in laboratory-reared honey bee larvae. Together, these results suggest that inhibitors of P. larvae spore germination could provide another method to control AFB. © The Authors 2017. Published by Oxford University Press on behalf of Entomological Society of America.

  16. Simulating the impact of the entrainment of winter flounder larvae

    International Nuclear Information System (INIS)

    Hess, K.W.; Sissenwine, M.P.; Saila, S.B.

    1975-01-01

    The transport of winter flounder larvae around the Millstone Point, Conn. Area by the action of tidal currents and diffusion was simulated by computer to predict the numbers which could be entrained during the operation of a local nuclear power station. A tidal hydrodynamic model with variable depth was employed to simulate currents and water levels. These techniques provided input to a transport model which simulated the concentration of larvae. A larval source in a tributary river was simulated for twenty tidal cycles, with and without entrainment. The results indicated that the reduction in winter flounder larvae near Millstone Point at the end of the pelagic stage (period during which larvae are likely to be entrained) was less than 1 percent when it was assumed that larvae have little chance of returning once lost from Millstone bight. In order to assess the effect of a 1 percent reduction in recruitment of winter flounder larvae to the benthic phase of their life cycle, the local population was simulated by a model in which year-classes and the total egg production were represented by compartments. Each year-class grew, produced eggs, suffered natural and fishing mortality according to information derived from the literature. The effect of power plant entrainment was incorporated by reducing the number of recruits to year-class I that would normally result from a specific level of egg production. For a 1 percent reduction in recruitment due to power plant entrainment, a potential 6 percent decrease in total population size following 35 years of operation was indicated. (U.S.)

  17. Studies on immunization with irradiated larvae against dictyocaulus filaria in guinea-pigs

    International Nuclear Information System (INIS)

    Akyol, F.; Cerci, H.; Duzgun, A.

    1986-01-01

    In this study, 32 guinea-pigs were immunized orally with two doses of infective D. filaria attenuated by exposure to 40 krad (group I) and 50 krad (group II) of Cs-137 source at 15 days interval. The first dose was administrated as 1000 larvae and the second was 2000 larvae. After 15 days of the second infection they were challenged with 5000 non-irradiated infective larvae. Eight guinea-pigs were used as control (group III). The control group received the challenge only. The controls developed signs of lungworm disease and 3 animals died after 10 days of challenge. The vaccinated animals showed no clinical signs. All of the surviving animals were killed 12 days after challenge and their lungs were carefully examined for detailed parasitological and pathomorphological examinations. At autopsy, an average of 91 worms was recovered from the lungs of control groups. Four worms recovered from animals given larvae irradiated at 40 krad and the pathological changes were the lightest in this group. It was established that gamma rays at 50 krad attenuated infective larvae of D. filaria to such a degree that their administration did not cause any serious pathomorphological effect in the lungs of the animals. A higher degree of protection against challenge with infective D. filaria larvae was confered on the guinea-pigs by double dose of irradiated larvae. (auhtor)

  18. Development Of Enzyme Digestive Activity Of Blue Crab Portunus Pelagicus Larvae

    OpenAIRE

    Nikhlani, Andi; Sukarti, Komsanah

    2017-01-01

    Seed production continuity of Portunus pelagicus larvae had been conducted but the results were still un-consistent Digestive activity was known to be associated with the type of feed consumed by larvae. Amylase, lipase, and trypsin enzymes were used as a biological indicators to measure the digestion of feed. The aim of this study was to describe the activity of digestive enzymes in blue swimming crab larvae. Digestive enzyme activity data obtained was presented in graphical form and anal...

  19. Chemical Composition and Food Potential of Pachymerus nucleorum Larvae Parasitizing Acrocomia aculeata Kernels.

    Directory of Open Access Journals (Sweden)

    Ariana Vieira Alves

    Full Text Available Insect consumption as food is culturally practiced in various regions of the world. In Brazil, there are more than 130 species of edible insects registered, from nine orders, among which stands out the Coleoptera. The larva of the beetle Pachymerus nucleorum Fabricius, 1792, grows into the bocaiuva fruit (Acrocomia aculeata (Jacq. Lodd. Ex Mart., 1845, which has proven nutritional quality. The aim of this work was to evaluate the nutritional potential of P. nucleorum larvae compared to bocaiuva kernels for human consumption. Proteins were the second largest portion of the larvae nutritional composition (33.13%, with percentage higher than the bocaiuva kernels (14.21%. The larval lipid content (37.87% was also high, very close to the kernels (44.96%. The fraction corresponding to fatty acids in the oil extracted from the larvae was 40.17% for the saturated and 46.52% for the unsaturated. The antioxidant activity value was 24.3 uM trolox/g of oil extracted from larvae. The larvae tryptic activity was 0.032±0.006 nmol BAPNA/min. Both the larvae and the bocaiuva kernel presented absence of anti-nutritional factors. These results favor the use of P. nucleorum larvae as food, which are a great protein and lipid sources with considerable concentrations of unsaturated fatty acids compared to the bocaiuva kernel.

  20. Cultivation of sponge larvae: settlement, survival, and growth of juveniles

    NARCIS (Netherlands)

    Caralt, de S.; Otjens, H.; Uriz, M.J.; Wijffels, R.H.

    2007-01-01

    The aim of this study was to culture sponge juveniles from larvae. Starting from larvae we expected to enhance the survival and growth, and to decrease the variation in these parameters during the sponge cultures. First, settlement success, morphological changes during metamorphosis, and survival of

  1. Effects of coded-wire-tagging on stream-dwelling Sea Lamprey larvae

    Science.gov (United States)

    Johnson, Nicholas; Swink, William D.; Dawson, Heather A.; Jones, Michael L.

    2016-01-01

    The effects of coded wire tagging Sea Lamprey Petromyzon marinus larvae from a known-aged stream-dwelling population were assessed. Tagged larvae were significantly shorter on average than untagged larvae from 3 to 18 months after tagging. However, 30 months after tagging, the length distribution of tagged and untagged larvae did not differ and tagged Sea Lampreys were in better condition (i.e., higher condition factor) and more likely to have undergone metamorphosis than the untagged population. The reason why tagged larvae were more likely to metamorphose is not clear, but the increased likelihood of metamorphosis could have been a compensatory response to the period of slower growth after tagging. Slower growth after tagging was consistent across larval size-classes, so handling and displacement from quality habitat during the early part of the growing season was likely the cause rather than the tag burden. The tag effects observed in this study, if caused by displacement and handling, may be minimized in future studies if tagging is conducted during autumn after growth has concluded for the year.

  2. Pengaruh ukuran tubuh ikan Poecilia reticulata pada daya pemangsaannya terhadap larva Culex quinquefasciatus

    Directory of Open Access Journals (Sweden)

    Noer Moehammadi

    1999-06-01

    Full Text Available The research aimed to know the influence of poecilia reticulata body size, in the feeding capacity on Culex quinquifasciatus larvae. The research was experimental method with Complete Random Design., each treatment with 5 replications. The taken body size of Poecilia reticulata were; 1,50 cm; 2.50 cm; and 3.50 cm. the size of fish €™s body was measured from the tip of snout up to the end of fin (cm. The feeding capacity was determined by subtracting the first amount of larvae which was given the rest of larvae after 24 hours. The result showed that the difference of size of Poecilia reticulate body was significantly different in the feeding capacity on Culex quinquifasciatus larvae. The fish whose body size was 1.50 cm had the lowest feeding capacity by eating 77.2 larvae for average, and the highest one was the fist which body size was 2.50 cm by eating 113.6 larvae for average, subsequently the feeding capacity decrease to the fish which body size was 3.50 cm because of eating 100,6 larvae for 24 hours.

  3. Direct Effects of Microalgae and Protists on Herring (Clupea harengus Yolk Sac Larvae.

    Directory of Open Access Journals (Sweden)

    Björn Illing

    Full Text Available This study investigated effects of microalgae (Rhodomonas baltica and heterotrophic protists (Oxyrrhis marina on the daily growth, activity, condition and feeding success of Atlantic herring (Clupea harengus larvae from hatch, through the end of the endogenous (yolk sac period. Yolk sac larvae were reared in the presence and absence of microplankton and, each day, groups of larvae were provided access to copepods. Larvae reared with microalgae and protists exhibited precocious (2 days earlier and ≥ 60% increased feeding incidence on copepods compared to larvae reared in only seawater (SW. In the absence and presence of microalgae and protists, life span and growth trajectories of yolk sac larvae were similar and digestive enzyme activity (trypsin and nutritional condition (RNA-DNA ratio markedly declined in all larvae directly after yolk sac depletion. Thus, microplankton promoted early feeding but was not sufficient to alter life span and growth during the yolk sac phase. Given the importance of early feeding, field programs should place greater emphasis on the protozooplankton-ichthyoplankton link to better understand match-mismatch dynamics and bottom-up drivers of year class success in marine fish.

  4. Direct Effects of Microalgae and Protists on Herring (Clupea harengus) Yolk Sac Larvae.

    Science.gov (United States)

    Illing, Björn; Moyano, Marta; Niemax, Jan; Peck, Myron A

    2015-01-01

    This study investigated effects of microalgae (Rhodomonas baltica) and heterotrophic protists (Oxyrrhis marina) on the daily growth, activity, condition and feeding success of Atlantic herring (Clupea harengus) larvae from hatch, through the end of the endogenous (yolk sac) period. Yolk sac larvae were reared in the presence and absence of microplankton and, each day, groups of larvae were provided access to copepods. Larvae reared with microalgae and protists exhibited precocious (2 days earlier) and ≥ 60% increased feeding incidence on copepods compared to larvae reared in only seawater (SW). In the absence and presence of microalgae and protists, life span and growth trajectories of yolk sac larvae were similar and digestive enzyme activity (trypsin) and nutritional condition (RNA-DNA ratio) markedly declined in all larvae directly after yolk sac depletion. Thus, microplankton promoted early feeding but was not sufficient to alter life span and growth during the yolk sac phase. Given the importance of early feeding, field programs should place greater emphasis on the protozooplankton-ichthyoplankton link to better understand match-mismatch dynamics and bottom-up drivers of year class success in marine fish.

  5. Tadpoles of three common anuran species from Thailand do not prey on mosquito larvae.

    Science.gov (United States)

    Weterings, Robbie

    2015-12-01

    Tadpoles are often considered to be predators of mosquito larvae and are therefore beneficial for the control of certain disease vectors. Nevertheless, only a few species have actually been recorded to prey on mosquito larvae. The mosquito larvae predation rates of tadpoles of three common Thai anuran species (Bufo melanostictus, Kaloula pulchra and Hylarana raniceps) were experimentally tested. Tadpoles in varying developmental stages were used to assess a size/age effect on the predation rate. In addition, different instars of Culex quinquefasciatus were used in order to assess a prey size effect on the predation rates. All three species failed to show any evidence of mosquito larvae predation. Neither small nor large tadpoles fed on mosquito larvae. Prey size also did not affect predation. Although tadpoles do not feed on mosquito larvae, there may be other direct or indirect inter-specific interactions that adversely impact the development of larvae in shared habitats with tadpoles. © 2015 The Society for Vector Ecology.

  6. PENGARUH PAKAN ALAMI Chaetoceros spp. TERHADAP PERKEMBANGAN DAN SINTASAN LARVA UDANG WINDU, Penaeus monodon

    Directory of Open Access Journals (Sweden)

    Samuel Lante

    2015-09-01

    Full Text Available Pakan alami berupa mikroalga merupakan salah satu faktor pendukung dalam keberhasilan usaha pembenihan udang windu, Penaeus monodon. Penelitian ini bertujuan untuk mengetahui jenis pakan alami, Chaetoceros spp., yang dapat meningkatkan pertumbuhan dan sintasan larva udang windu. Penelitian ini menggunakan 15 buah bak fiber berukuran 60 cm x 40 cm x 50 cm dengan volume 120 liter yang disi air sebanyak 100 liter. Kepadatan naupli adalah 90 ekor/liter atau 9.000 ekor/bak dan lima jenis pakan alami Chaetoceros spp. yang diuji yaitu: Chaetoceros simplex, Chaetoceros ceratosporum, Chaetoceros calcitrans, Chaetoceros amami, dan Chaetoceros gracilis. Hasil penelitian menunjukkan bahwa aplikasi kelima jenis pakan alami memberikan laju perkembangan larva yang relatif sama sampai stadia PL-1. Aplikasi Chaetoceros gracilis memberikan sintasan larva udang windu tertinggi yaitu 41,48% dan dengan Chaetoceros simplex memberikan sintasan larva terendah (28,02%. Hasil penelitian ini mengindikasikan bahwa aplikasi Chaetoceros spp. yang berbeda pada pemeliharaan larva berpengaruh terhadap sintasan larva udang windu, namun tidak berpengaruh terhadap laju metamorfosis larva. Aplikasi Chaetoceros gracilis sebagai pakan alami adalah terbaik untuk sintasan larva udang windu.

  7. Rapid bioassay to screen potential biopesticides in Tenebrio molitor larvae

    Science.gov (United States)

    A simplified assay was devised to evaluate the response of Tenebrio molitor larvae to potential insect control products. The assay incorporates punched disks of flattened whole-grain bread placed in 96-well plates, with treatments applied topically, and neonate larvae added to each well. To evalua...

  8. c-orfi and Tnpnin crnssiceps Larvae I Department of Pharmaceutical ...

    African Journals Online (AJOL)

    satisfactorily. The putative first intermediate host is a ground-dwelling coprophagous arthropod that ingests oncospheres and accommodates the development of larvae. It is presumed that vertebrates become hosts for the larvae after ingestion of infected arthropods. This is followed by penetration of the small intestine by a.

  9. Production of the catechol type siderophore bacillibactin by the honey bee pathogen Paenibacillus larvae.

    Science.gov (United States)

    Hertlein, Gillian; Müller, Sebastian; Garcia-Gonzalez, Eva; Poppinga, Lena; Süssmuth, Roderich D; Genersch, Elke

    2014-01-01

    The Gram-positive bacterium Paenibacillus larvae is the etiological agent of American Foulbrood. This bacterial infection of honey bee brood is a notifiable epizootic posing a serious threat to global honey bee health because not only individual larvae but also entire colonies succumb to the disease. In the recent past considerable progress has been made in elucidating molecular aspects of host pathogen interactions during pathogenesis of P. larvae infections. Especially the sequencing and annotation of the complete genome of P. larvae was a major step forward and revealed the existence of several giant gene clusters coding for non-ribosomal peptide synthetases which might act as putative virulence factors. We here present the detailed analysis of one of these clusters which we demonstrated to be responsible for the biosynthesis of bacillibactin, a P. larvae siderophore. We first established culture conditions allowing the growth of P. larvae under iron-limited conditions and triggering siderophore production by P. larvae. Using a gene disruption strategy we linked siderophore production to the expression of an uninterrupted bacillibactin gene cluster. In silico analysis predicted the structure of a trimeric trithreonyl lactone (DHB-Gly-Thr)3 similar to the structure of bacillibactin produced by several Bacillus species. Mass spectrometric analysis unambiguously confirmed that the siderophore produced by P. larvae is identical to bacillibactin. Exposure bioassays demonstrated that P. larvae bacillibactin is not required for full virulence of P. larvae in laboratory exposure bioassays. This observation is consistent with results obtained for bacillibactin in other pathogenic bacteria.

  10. Enantiomerization and enantioselective bioaccumulation of metalaxyl in Tenebrio molitor larvae.

    Science.gov (United States)

    Gao, Yongxin; Wang, Huili; Qin, Fang; Xu, Peng; Lv, Xiaotian; Li, Jianzhong; Guo, Baoyuan

    2014-02-01

    The enantiomerization and enantioselective bioaccumulation of metalaxyl by a single dose of exposure to Tenebrio molitor larvae under laboratory condition were studied by high-performance liquid chromatography tandem mass spectroscopy (HPLC-MS/MS) based on a ChiralcelOD-3R [cellulosetris-tris-(3, 5-dichlorophenyl-carbamate)] column. Exposure of enantiopure R-metalaxyl and S-metalaxyl in Tenebrio molitor larvae exhibited significant enantiomerization, with formation of the R enantiomers from the S enantiomers, and vice versa, which might be attributed to the chiral pesticide catalyzed by a certain enzyme in Tenebrio molitor larvae. Enantiomerization was not observed in wheat bran during the period of 21 d. In addition, bioaccumulation of rac-metalaxyl in Tenebrio molitor larvae was enantioselective with a preferential accumulation of S-metalaxyl. These results showed that enantioselectivity was caused not only by actual degradation and metabolism but also by enantiomerization, which was an important process in the environmental fate and behavior of metalaxyl enantiomers. Copyright © 2013 Wiley Periodicals, Inc.

  11. Cutaneous larva migrans in northern climates. A souvenir of your dream vacation.

    Science.gov (United States)

    Edelglass, J W; Douglass, M C; Stiefler, R; Tessler, M

    1982-09-01

    Three young women recently returned to the metropolitan Detroit area with cutaneous larva migrans. All three had vacationed at a popular club resort on the Caribbean island of Martinique. Cutaneous larva migrans is frequently seen in the southern United States, Central and South America, and other subtropical areas but rarely in northern climates. Several organisms can cause cutaneous larva migrans, or creeping eruption. The larvae of the nematode Ancylostoma braziliense are most often the causative organisms. Travel habits of Americans make it necessary for practitioners in northern climates to be familiar with diseases contracted primarily in warmer locations. The life cycle of causative organisms and current therapy are reviewed.

  12. The use of morphological and histological features as nutritional condition indices of Pagrus pagrus larvae

    Directory of Open Access Journals (Sweden)

    Marina Vera Diaz

    Full Text Available Morphometrical and histological techniques were employed to characterize Pagrus pagrus larvae nutritional condition. Larvae were reared in laboratory under controlled conditions with the main objective of testing whether these methodologies allowed finding differences between larvae from different feeding treatments. Once yolk was consumed (three days after hatching larvae were assigned to a feeding treatment: starved during the whole experiment; delayed feeding, starved during three days; fed during the entire experiment. Algae (Nannochloropsis oculata and rotifers (Brachionus plicatilis were provided to larvae for feed treatments. Larvae were fixed daily; for morphometrical purposes in 5% formaldehyde solution, and in Bouin for histological sections. Results herein obtained showed that both methodologies are sensitive enough to distinguish larvae characterized by different nutritional condition states obtained from the feeding treatments. Consequently, these methodologies could be employed in wild red porgy larvae in order to asses their nutritional condition. These techniques could also be employed to check larval quality obtained with aquaculture purposes to estimate the effects of changes in rearing protocols or kind of food supply and thus, to guaranty a higher survival of early developmental stages of reared larvae.

  13. Estuarine retention of larvae of the crab Rhithropanopeus harrisii

    Science.gov (United States)

    Cronin, Thomas W.

    1982-08-01

    Larvae of estuarine organisms continually face possible export from the parent estuary. Retention of larvae of the estuarine crab Rhithropanopeus harrisii was investigated in the upper Newport River estuary, North Carolina. All of the developmental stages occurred in the same area of the estuary with similar horizontal distributions, and the concentrations of intermediate and late stages were not greatly reduced from those of the first larval stage. This was strong evidence for the continuous retention of larvae in the upper estuary. To determine mechanisms by which retention might be effected, field studies of the vertical distributions and migrations of these larvae were made. The four zoeal stages had similar but complex vertical migration patterns, which varied from study to study. These migrations centered on the depth of no net flow, reducing longitudinal transport during development. Cross-spectral analysis of the larval migrations and the environmental cycles of light, salinity and current speed revealed that each of these external cycles affected larval depth. Megalopae of R. harrisii also migrated vertically, but they were present in much lower concentrations than the zoeal stages, an indication of a change to benthic existence in this final larval form.

  14. Nematode cysts and larvae found in Achatina fulica Bowdich, 1822.

    Science.gov (United States)

    Franco-Acuña, D O; Pinheiro, J; Torres, E J L; Lanfredi, R M; Brandolini, S V P B

    2009-02-01

    This study describes the morphology of the nematode cysts and larvae found in Achatina fulica (giant African snail) in Brazil. Sixty snails were collected in Mesquita, Rio de Janeiro State. Fourteen of the snails were naturally infected. The cysts were spherical, pink colored and measured 0.97 to 1.57 mm in diameter. In the majority of cases they had a single larvae involved in amorphous material. A total of 222 encysted larvae were recovered. Of these, 30 were utilized in the morphological study. The length of the larvae varied from 2.57 to 5.8 mm and they were classified as small--up to 3.5 mm; medium--from 3.53 to 4.5 mm; and large--greater than 4.52 mm. The average length of the larvae in the three groups was 2.85, 3.87 and 5.23 mm, respectively. The larval cuticle was white, shiny and transversally striated until the posterior end of the body. At the anterior end there is a mouth with three lips, with amphids and papillae, followed by a muscular esophagus with average length of 0.61 mm, terminating in an esophageal bulb and having a nerve ring in the middle third of the esophagus, and an intestine with an opening near the posterior end. The tail begins from this opening and has two types of ends: short and abrupt or long and gradually tapering. The difference in the tail end can suggest sexual dimorphism, although no primordial reproductive structures were observed. These characteristics were not sufficient to identify the larvae, so there is a need for further study.

  15. Seasonal occurrence and abundance of caridean shrimp larvae at Helgoland, German Bight

    Science.gov (United States)

    Wehrtmann, Ingo S.

    1989-03-01

    Plankton samples were collected from January 1985 to January 1986 three times per week at Helgoland to study seasonal occurrence and abundance of caridean shrimp larvae. A total of eleven species were obtained. Ninety-one % of all larvae collected during the sample period belonged to Crangon crangon L. and Crangon allmanni Kinahan, 6% to Philocheras trispinosus Hailstone and 3% to the remaining eight species. Collections were generally dominated by C. crangon larvae. However, C. allmanni larvae were most abundant in June coinciding with hatching activities of the population near Helgoland. C. allmanni was observed to have the highest density of all species with approximately 8 larvae per m3. Larvae of Eualus occultus (Lebour), Eualus pusiolus (Kroyer), Hippolyte varians Leach and Athanas nitescens Leach were most likely released by populations inhabiting the rocky intertidal zone around Helgoland. The presence of Processa modica Williamson & Rochanaburanon and Processa nouveli holthuisi Al-Adhub & Williamson in the German Bight was verified by observations of a series of different developmental stages. Larvae of the rare species Caridion steveni Lebour were also recorded. The observed shrimp species were placed into three different groups with respect to their seasonal occurrence. Possible advantages of the timing of larval dispersal relative to predation and food availability are given. The results on seasonal occurrence and relative abundance are discussed in relation to environmental factors (temperature, salinity) as well as to the geographical distribution of the species.

  16. Larvicidal activity of Cybistax antisyphilitica against Aedes aegypti larvae.

    Science.gov (United States)

    Rodrigues, A M S; de Paula, J E; Roblot, F; Fournet, A; Espíndola, L S

    2005-12-01

    The larvicidal activity against Aedes aegypti larvae of a stem wood hexane extract of Cybistax antisyphilitica was evaluated. Bioassay-guided fractionation of the crude extract, monitored by larvicidal assay, led to the isolation of a natural quinone identified as 2-hydroxy-3-(3-methyl-2-butenyl)-1.4-naphthoquinone (lapachol). This compound was quite potent against A. aegypti larvae (LC50 26.3 microg/ml).

  17. Occurrence of digenean larvae in freshwater snails in the Ruvu ...

    African Journals Online (AJOL)

    Occurrence of digenean larvae in freshwater snails in the Ruvu basin, Tanzania. G Nkwengulila, ESP Kigadye. Abstract. A survey was carried out on digenean larvae infecting freshwater snails in five habitats in Dar es Salaam, Ruvu and Morogoro. 9424 snails belonging to 12 species from five families were examined for ...

  18. Scanning electron microscope observations of brine shrimp larvae from space shuttle experiments

    Science.gov (United States)

    DeBell, L.; Paulsen, A.; Spooner, B.

    1992-01-01

    Brine shrimp are encysted as gastrula stage embryos, and may remain dehydrated and encysted for years without compromising their viability. This aspect of brine shrimp biology is desirable for studying development of animals during space shuttle flight, as cysts placed aboard a spacecraft may be rehydrated at the convenience of an astronaut, guaranteeing that subsequent brine shrimp development occurs only on orbit and not on the pad during launch delays. Brine shrimp cysts placed in 5 ml syringes were rehydrated with salt water and hatched during a 9 day space shuttle mission. Subsequent larvae developed to the 8th larval stage in the sealed syringes. We studied the morphogenesis of the brine shrimp larvae and found the larvae from the space shuttle experiments similar in rate of growth and extent of development, to larvae grown in sealed syringes on the ground. Extensive differentiation and development of embryos and larvae can occur in a microgravity environment.

  19. Predator response to releases of American shad larvae in the Susquehanna River basin

    Science.gov (United States)

    Johnson, James H.; Ringler, N.H.

    1998-01-01

    Predation on American shad (Alosa sapidissima) larvae within the first two hours of release was examined from 1989 to 1992 on 31 occasions at stocking sites in the Susquehanna River basin. Twenty-two fish species consumed shad larvae; the dominant predators were spotfin shiner (Cyprinella spiloptera), mimic shiner (Notropis volucellus) and juvenile smallmouth bass (Micropterus dolomieu). The number of shad larvae found in predator stomachs ranged from 0 to 900. Mortality of shad larvae at the stocking site was usually less than 2%. The greatest mortality (9.6%) occurred at the highest stocking level (1.5 million larvae). Highly variable predation rates and release levels of shad insufficient to achieve predator satiation hindered the ability to determine a specific type of functional response of predators. Predator numbers increased with stocking density, indicating short-term aggregation at the release site. Because of practical problems associated with releasing the large numbers of larvae that would be required to satiate predators, routine stocking at these levels is probably unreasonable. Releases of 400,000 to 700,000 larvae may reduce predation by offsetting depensatory mechanisms that operate on small releases and the effects of increased predation due to predator aggregation on large releases. Night stocking may reduce predation on larval shad at the release site.

  20. Clash of kingdoms or why Drosophila larvae positively respond to fungal competitors

    Directory of Open Access Journals (Sweden)

    Rohlfs Marko

    2005-01-01

    Full Text Available Abstract Background Competition with filamentous fungi has been demonstrated to be an important cause of mortality for the vast group of insects that depend on ephemeral resources (e.g. fruit, dung, carrion. Recent data suggest that the well-known aggregation of Drosophila larvae across decaying fruit yields a competitive advantage over mould, by which the larvae achieve a higher survival probability in larger groups compared with smaller ones. Feeding and locomotor behaviour of larger larval groups is assumed to cause disruption of fungal hyphae, leading to suppression of fungal growth, which in turn improves the chances of larval survival to the adult stage. Given the relationship between larval density, mould suppression and larval survival, the present study has tested whether fungal-infected food patches elicit communal foraging behaviour on mould-infected sites by which larvae might hamper mould growth more efficiently. Results Based on laboratory experiments in which Drosophila larvae were offered the choice between fungal-infected and uninfected food patches, larvae significantly aggregated on patches containing young fungal colonies. Grouping behaviour was also visible when larvae were offered only fungal-infected or only uninfected patches; however, larval aggregation was less strong under these conditions than in a heterogeneous environment (infected and uninfected patches. Conclusion Because filamentous fungi can be deadly competitors for insect larvae on ephemeral resources, social attraction of Drosophila larvae to fungal-infected sites leading to suppression of mould growth may reflect an adaptive behavioural response that increases insect larval fitness and can thus be discussed as an anti-competitor behaviour. These observations support the hypothesis that adverse environmental conditions operate in favour of social behaviour. In a search for the underlying mechanisms of communal behaviour in Drosophila, this study highlights

  1. [Infestation of the human digestive system with beetle larvae (Coleoptera: Cantharidae): a case report].

    Science.gov (United States)

    Yılmaz, Hasan; Taş Cengiz, Zeynep; Dülger, Ahmet Cumhur; Ekici, Pınar

    2014-12-01

    This study was conducted to report the digestive system infestation caused by the larvae of Coleoptera in a female pediatric patient. She was admitted to our hospital with the complaints of emergence of insect larvae from her vomit and feces, abdominal pain, inguinal pain, lack of appetite, hair loss, excessive cleaning behavior, extreme irritability, and distractibility. The larvae observed typically had the morphology of the larvae of insects related to the Cantharidae family in the Coleoptera order. For treatment, a single dose of albendazole (400 mg) was used. Consequently, in the present case, it was seen that the larvae of Coleoptera incidentally taken orally could continue to live for a period in the digestive tract of people, without losing vitality, and the larvae caused a variety of symptoms due to both their toxic agents and the possible irritation they caused.

  2. Infestation of a bird and two cats by larvae of Plodia interpunctella (Lepidoptera: Pyralidae).

    Science.gov (United States)

    Pinckney, R D; Kanton, K; Foster, C N; Steinberg, H; Pellitteri, P

    2001-09-01

    The larvae of Plodia interpunctella (Hübner), commonly known as the Indian meal moth, often cause enormous losses in stored food supplies. We present three clinical case reports of accidental infestation by P. interpunctella larvae in two domestic cats and one parakeet. A larva gained entry into the avian host and subsequently migrated to the brain. It was alive, covered with "silk-like" fibers and confirmed to be a fourth instar. Plodia interpunctella larvae were excised with forceps from the subcutaneous tissues of the ear and neck of two cats in a different household. Previous reports of infestation by P. interpunctella larvae in vertebrates are unknown.

  3. Feeding ecology of lake whitefish larvae in eastern Lake Ontario

    Science.gov (United States)

    Johnson, James H.; McKenna, James E.; Chalupnicki, Marc A.; Wallbridge, Tim; Chiavelli, Rich

    2009-01-01

    We examined the feeding ecology of larval lake whitefish (Coregonus clupeaformis) in Chaumont Bay, Lake Ontario, during April and May 2004-2006. Larvae were collected with towed ichthyoplankton nets offshore and with larval seines along the shoreline. Larval feeding periodicity was examined from collections made at 4-h intervals over one 24-h period in 2005. Inter-annual variation in diet composition (% dry weight) was low, as was spatial variation among collection sites within the bay. Copepods (81.4%), primarily cyclopoids (59.1%), were the primary prey of larvae over the 3-year period. Cladocerans (8.1%; mainly daphnids, 6.7%) and chironomids (7.3%) were the other major prey consumed. Larvae did not exhibit a preference for any specific prey taxa. Food consumption of lake whitefish larvae was significantly lower at night (i.e., 2400 and 0400 h). Substantial variation in diet composition occurred over the 24-h diel study. For the 24-h period, copepods were the major prey consumed (50.4%) and their contribution in the diet ranged from 29.3% (0400 h) to 85.9% (1200 h). Chironomids made up 33.4% of the diel diet, ranging from 8.0% (0800 h) to 69.9% (0400 h). Diel variation in the diet composition of lake whitefish larvae may require samples taken at several intervals over a 24-h period to gain adequate representation of their feeding ecology.

  4. A Single Swede Midge (Diptera: Cecidomyiidae) Larva Can Render Cauliflower Unmarketable.

    Science.gov (United States)

    Stratton, Chase A; Hodgdon, Elisabeth A; Zuckerman, Samuel G; Shelton, Anthony M; Chen, Yolanda H

    2018-05-01

    Swede midge, Contarinia nasturtii Kieffer (Diptera: Cecidomyiidae), is an invasive pest causing significant damage on Brassica crops in the Northeastern United States and Eastern Canada. Heading brassicas, like cauliflower, appear to be particularly susceptible. Swede midge is difficult to control because larvae feed concealed inside meristematic tissues of the plant. In order to develop damage and marketability thresholds necessary for integrated pest management, it is important to determine how many larvae render plants unmarketable and whether the timing of infestation affects the severity of damage. We manipulated larval density (0, 1, 3, 5, 10, or 20) per plant and the timing of infestation (30, 55, and 80 d after seeding) on cauliflower in the lab and field to answer the following questions: 1) What is the swede midge damage threshold? 2) How many swede midge larvae can render cauliflower crowns unmarketable? and 3) Does the age of cauliflower at infestation influence the severity of damage and marketability? We found that even a single larva can cause mild twisting and scarring in the crown rendering cauliflower unmarketable 52% of the time, with more larvae causing more severe damage and additional losses, regardless of cauliflower age at infestation.

  5. Infectivity of Trichinella spiralis larvae in pork buried in the ground

    Directory of Open Access Journals (Sweden)

    Jovic S.

    2001-06-01

    Full Text Available Time of survival and infectivity of Trichinella spiralis larvae in pig muscle tissue, buried at various depths in the ground were assessed. In the pork pieces the number of infective larvae was 250 ML/g. Meat originated from pig halves was divided in 39 equal pieces, 0.7 kg each, disposed in three groups of 1 3, and buried in depths of 30, 50, and 100 centimeters respectively. The pork was dug up at 13 intervals, approximately every week, until 91st day of the experiment. After each time interval, infectivity of larvae was assessed by bioassay on rats. The artificially infected rats were sacrificed on 42nd day after the infection and meat was examined by the following methods - artificial digestion and trichinoscopy. It was found that the larvae during all 90 days preserved infectivity in each depth.

  6. CalCOFI Larvae Counts Positive Tows

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for eggs captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  7. Preliminary screening of plant essential oils against larvae of Culex ...

    African Journals Online (AJOL)

    Preliminary screenings of 22 plant essential oils were tested for mortality of the mosquito larvae Culex quinquefasciatus under laboratory conditions. Percent (%) mortality of the mosquito larvae were obtained for each essential oil. At different exposure periods, viz. 1, 3, 6, 12 and 24 h among the 22 plant oils tested, eight ...

  8. Acute intestinal anisakiasis in Spain: a fourth-stage Anisakis simplex larva

    Directory of Open Access Journals (Sweden)

    Mª José Rosales

    1999-11-01

    Full Text Available A case of acute intestinal anisakiasis has been reported; a nematode larva being found in the submucosa of the ileum of a woman in Jaén (Spain. The source of infection was the ingestion of raw Engraulis encrasicholus. On the basis of its morphology, the worm has been identified as a fourth-stage larva of Anisakis simplex. In Spain, this is the ninth report of human anisakiasis and also probably the first case of anisakiasis caused by a fourth-stage larva of A. simplex.

  9. Maintained larval growth in mussel larvae exposed to acidified under-saturated seawater

    Science.gov (United States)

    Ventura, Alexander; Schulz, Sabrina; Dupont, Sam

    2016-03-01

    Ocean acidification (OA) is known to affect bivalve early life-stages. We tested responses of blue mussel larvae to a wide range of pH in order to identify their tolerance threshold. Our results confirmed that decreasing seawater pH and decreasing saturation state increases larval mortality rate and the percentage of abnormally developing larvae. Virtually no larvae reared at average pHT 7.16 were able to feed or reach the D-shell stage and their development appeared to be arrested at the trochophore stage. However larvae were capable of reaching the D-shell stage under milder acidification (pHT ≈ 7.35, 7.6, 7.85) including in under-saturated seawater with Ωa as low as 0.54 ± 0.01 (mean ± s. e. m.), with a tipping point for normal development identified at pHT 7.765. Additionally growth rate of normally developing larvae was not affected by lower pHT despite potential increased energy costs associated with compensatory calcification in response to increased shell dissolution. Overall, our results on OA impacts on mussel larvae suggest an average pHT of 7.16 is beyond their physiological tolerance threshold and indicate a shift in energy allocation towards growth in some individuals revealing potential OA resilience.

  10. Acute ecotoxicology of natural oil and gas condensate to coral reef larvae.

    Science.gov (United States)

    Negri, Andrew P; Brinkman, Diane L; Flores, Florita; Botté, Emmanuelle S; Jones, Ross J; Webster, Nicole S

    2016-02-19

    Risks posed by oil spills to coral reefs are difficult to evaluate, partially due to the absence of studies that adequately assess toxicity to relevant coral reef species. Here we experimentally tested the acute toxicity of condensate, representing a fraction of light crude oil, to coral (Acropora tenuis) and sponge (Rhopaloeides odorabile) larvae. The metamorphosis of coral larvae was inhibited at total petroleum aromatic hydrocarbon (TPAH) concentrations of water accommodated fractions (WAF) as low as 103 μg l(-1), similar to concentrations detected in seawater following large spills. The sensitivity of coral larvae increased by 40% when co-exposed to UV light that they might encounter in shallow reefal systems. Condensate WAF was more toxic to coral larvae than predicted by summing the toxicity of its main components (benzene, toluene, p-xylene and napthalene). In contrast, the sensitivity of sponge larvae to condensate WAF (>10,000 μg l(-1) TPAH) was far less than coral in the presence and absence of UV, but similar to that of other marine invertebrates. While these results highlight the relative sensitivity of coral larvae to oil, further research is needed to better understand and predict the impacts and risks posed by hydrocarbons to tropical reef systems.

  11. Effects of gamma radiation on the melanization process in larvae of stored product moths

    International Nuclear Information System (INIS)

    Lupa, D.

    1998-01-01

    Non-irradiated larvae of the Indian meal moth (Plodia interpunctella Hbn.), the Mediterranean flour moth (Ephestia (Anagasta) kuehniella Zell.), and the almond moth (Cadra cautella Wlk.) showed strong melanization after killing by freezing. However, there were some insects which showed lack of melanization or melanized only partly, sometimes like those that have been irradiated. A part of the larval body was dark black while the rest body was of natural color or only slightly gray. Also, black and gray patches were observed in the larvae. After the irradiation treatment, the number of non-melanized larvae and larvae exhibiting a slight melanization usually increased. The degree of melanization in the treated larvae was significantly different from the untreated insects. Generally, it decreased with increasing dose and time elapsed after the treatment. The melanization test for detecting irradiated moth larvae may produce inconsistent results because (a) irradiation does not completely prevent melanization in mature moth larvae, and (b) the untreated larvae, killed by freezing and examined at room temperature, often show incomplete melanization. An ideal method for detection of irradiated insects should be: (1 ) specific for irradiation and not influenced by other processes, (2) accurate and reproducible, (3) have a detection limit below the minimum dose likely to be applied to agricultural commodity as a quarantine treatment, (4) applicable to a range of pests, (5) quick and easy to perform, and (6) capable of providing an estimate of irradiation dose. The melanization test to detect irradiated larvae of the stored product moths fulfills only some of these requirements. Therefore, additional studies were performed to improve this test before it is recommended for quarantine inspection. Because visual assessment of the effects of irradiation on melanization of the moth larvae is very subjective and difficult to perform, a trial to determine the activity of

  12. Modulation of nutrient composition of black soldier fly (Hermetia illucens) larvae by feeding seaweed-enriched media.

    Science.gov (United States)

    Liland, Nina S; Biancarosa, Irene; Araujo, Pedro; Biemans, Daan; Bruckner, Christian G; Waagbø, Rune; Torstensen, Bente E; Lock, Erik-Jan

    2017-01-01

    Black soldier fly (Hermetia illucens) larvae are a promising source of protein and lipid for animal feeds. The nutritional composition of the BSF larvae depend partly on the composition of the feeding medium. The BSF lipid profile in part mimics the feeding media lipid profile, and micronutrients, like minerals and vitamins, can readily accumulate in black soldier fly larvae. However, investigative studies on bioconversion and accumulation of nutrients from media to black soldier fly larvae are scarce. Here we show that inclusion of the brown algae Ascophyllum nodosum in the substrate for black soldier fly larvae can introduce valuable nutrients, commonly associated with the marine environment, into the larvae. The omega-3 fatty acid eicosapentaenoic acid (20:5n-3), iodine and vitamin E concentrations increased in the larvae when more seaweed was included in the diet. When the feeding media consisted of more than 50% seaweed, the larvae experienced poorer growth, lower nutrient retention and lower lipid levels, compared to a pure plant based feeding medium. Our results confirm the plasticity of the nutritional make-up of black soldier fly larvae, allowing it to accumulate both lipid- and water-soluble compounds. A broader understanding of the effect of the composition of the feeding media on the larvae composition can help to tailor black soldier fly larvae into a nutrient profile more suited for specific feed or food purposes.

  13. The hatching larva of the priapulid worm Halicryptus spinulosus

    OpenAIRE

    Janssen, Ralf; Wennberg, Sofia A; Budd, Graham E

    2009-01-01

    Abstract Despite their increasing evolutionary importance, basic knowledge about the priapulid worms remains limited. In particular, priapulid development has only been partially documented. Following previous description of hatching and the earliest larval stages of Priapulus caudatus, we here describe the hatching larva of Halicryptus spinulosus. Comparison of the P. caudatus and the H. spinulosus hatching larvae allows us to attempt to reconstruct the ground pattern of priapulid developmen...

  14. DNA metabarcoding of fish larvae for detection of non-native fishes

    Science.gov (United States)

    Our objective was to evaluate the use of fish larvae for early detection of non-native fishes, comparing traditional and molecular taxonomy approaches to investigate potential efficiencies. Fish larvae present an interesting opportunity for non-native fish early detection because...

  15. Feeding by larvae of intertidal invertebrates: assessing their position in pelagic food webs.

    Science.gov (United States)

    Vargas, Cristian A; Manríquez, Patricio H; Navarrete, Sergio A

    2006-02-01

    One of the leading determinants of the structure and dynamics of marine populations is the rate of arrival of new individuals to local sites. While physical transport processes play major roles in delivering larvae to the shore, these processes become most important after larvae have survived the perils of life in the plankton, where they usually suffer great mortality. The lack of information regarding larval feeding makes it difficult to assess the effects of food supply on larval survival, or the role larvae may play in nearshore food webs. Here, we examine the spectrum of food sizes and food types consumed by the larvae of two intertidal barnacle species and of the predatory gastropod Concholepas concholepas. We conducted replicated experiments in which larvae were exposed to the food size spectrum (phytoplankton, microprotozoan and autotrophic picoplankton) found in nearshore waters in central Chile. Results show that barnacle nauplii and gastropod veligers are omnivorous grazers, incorporating significant fractions of heterotrophs in their diets. In accordance with their feeding mechanisms and body size, barnacle nauplii were able to feed on autotrophic picoplankton (concholepas larvae also consumed picoplankton cells, while competent larvae of this species ingested mostly the largest phytoplankton cells and heterotrophic protozoans. Results suggest that persistent changes in the structure of pelagic food webs can have important effects on the species-specific food availability for invertebrate larvae, which can result in large-scale differences in recruitment rates of a given species, and in the relative recruitment success of the different species that make up benthic communities.

  16. Influence of UV-irradiation on the nauplius larvae of the barnacle Chthamalus sp

    International Nuclear Information System (INIS)

    Hori, Masayuki; Nagayama, Shougo; Kawabe, Atsushi; Yamashita, Keiji.

    1990-01-01

    The purpose of this study is to investigate the influence of UV-irradiation on the nauplius larvae of the barnacle and to use this as the basis for researching the possibility of UV-irradiation as a new method for anti-macrofouling control. The nauplius larvae in the petri dishes were exposed to UV-irradiation (λ max = 253.7 nm), then the larval states and behaviour were observed. UV-intensisties were 3.0 mW·cm -2 -7.0 mW·cm -2 and the exposure time was 15 sec -10 min. The water in the petri dishes was changed intermittently but the larvae were not fed. The results were as follows: 1) UV-irradiation may have a delayed lethal effect and metamorphosis-inhibitory effect on the nauplius larvae. 2) The lethal effect of the sum of the dosages of UV on the larvae may nearly equate each other despite differences in each UV-intensity. 3) Within ca. 72 hr, 100 % of UV-irradiated larvae were dead with the dosage of at least 672 mW·sec·cm -2 and were incapable of swimming with the dosage of at least 168 mW·sec·cm -2 . 4) UV-irradiated larvae could not exuviate with the dosage of at least 246 mW·sec·cm -2 and could only exuviate with the dosage of 45 mW·sec·cm -2 . 5) After UV-irradiation even the 'actively swimming' larvae may have suffered some sort of physiological damage. (author)

  17. Effect of bodily fluids from honey bee (Apis mellifera) larvae on growth and genome-wide transcriptional response of the causal agent of American Foulbrood disease (Paenibacillus larvae).

    Science.gov (United States)

    De Smet, Lina; De Koker, Dieter; Hawley, Alyse K; Foster, Leonard J; De Vos, Paul; de Graaf, Dirk C

    2014-01-01

    Paenibacillus larvae, the causal agent of American Foulbrood disease (AFB), affects honey bee health worldwide. The present study investigates the effect of bodily fluids from honey bee larvae on growth velocity and transcription for this Gram-positive, endospore-forming bacterium. It was observed that larval fluids accelerate the growth and lead to higher bacterial densities during stationary phase. The genome-wide transcriptional response of in vitro cultures of P. larvae to larval fluids was studied by microarray technology. Early responses of P. larvae to larval fluids are characterized by a general down-regulation of oligopeptide and sugar transporter genes, as well as by amino acid and carbohydrate metabolic genes, among others. Late responses are dominated by general down-regulation of sporulation genes and up-regulation of phage-related genes. A theoretical mechanism of carbon catabolite repression is discussed.

  18. An unprecedented role reversal: ground beetle larvae (Coleoptera: Carabidae lure amphibians and prey upon them.

    Directory of Open Access Journals (Sweden)

    Gil Wizen

    Full Text Available Amphibians often feed on beetle larvae, including those of ground beetles (Carabidae. Preliminary reports have detailed an unusual trophic interaction in which, in contrast, larvae of the ground beetle Epomis prey upon juvenile and adult amphibians. While it is known that these larvae feed exclusively on amphibians, how the predator-prey encounter occurs to the advantage of the beetle larvae had been unknown to date. Using laboratory observations and controlled experiments, we recorded the feeding behavior of Epomis larvae, as well as the behavior of their amphibian prey. Here we reveal that larvae of two species of Epomis (E. circumscriptus and E. dejeani lure their potential predator, taking advantage of the amphibian's predation behavior. The Epomis larva combines a sit-and-wait strategy with unique movements of its antennae and mandibles to draw the attention of the amphibian to the presence of a potential prey. The intensity of this enticement increases with decreasing distance between the larva and the amphibian. When the amphibian attacks, the larva almost always manages to avoid the predator's protracted tongue, exploiting the opportunity to attach itself to the amphibian's body and initiate feeding. Our findings suggest that the trophic interaction between Epomis larvae and amphibians is one of the only natural cases of obligatory predator-prey role reversal. Moreover, this interaction involves a small insect larva that successfully lures and preys on a larger vertebrate. Such role reversal is exceptional in the animal world, extending our perspective of co-evolution in the arms race between predator and prey, and suggesting that counterattack defense behavior has evolved into predator-prey role reversal.

  19. Impact of ultraviolet-B radiation on planktonic fish larvae: Alteration of the osmoregulatory function

    Energy Technology Data Exchange (ETDEWEB)

    Sucre, Elliott, E-mail: elliott.sucre@univ-montp2.fr [AEO Team (Adaptation Ecophysiologique et Ontogenese), UMR 5119 Ecosym UM2, CNRS, IRD, Ifremer, UM1, Universite Montpellier 2, cc092, Pl. Eugene Bataillon, 34095 Montpellier, Cx 05 (France); Vidussi, Francesca [RESEAUX Team (Reseaux Planctoniques et Changement Environnemental), UMR 5119 Ecosym UM2, CNRS, IRD, Ifremer, UM1, Universite Montpellier 2, cc093, Pl. Eugene Bataillon, 34095 Montpellier, Cx 05 (France); Mostajir, Behzad [RESEAUX Team (Reseaux Planctoniques et Changement Environnemental), UMR 5119 Ecosym UM2, CNRS, IRD, Ifremer, UM1, Universite Montpellier 2, cc093, Pl. Eugene Bataillon, 34095 Montpellier, Cx 05 (France); Centre d' ecologie marine experimentale MEDIMEER (Mediterranean centre for Marine Ecosystem Experimental Research), Universite Montpellier 2-CNRS (UMS 3301), Station Mediterraneenne de l' Environnement Littoral, MEDIMEER, 2 Rue des Chantiers, 34200 Sete (France); Charmantier, Guy; Lorin-Nebel, Catherine [AEO Team (Adaptation Ecophysiologique et Ontogenese), UMR 5119 Ecosym UM2, CNRS, IRD, Ifremer, UM1, Universite Montpellier 2, cc092, Pl. Eugene Bataillon, 34095 Montpellier, Cx 05 (France)

    2012-03-15

    Coastal marine ecosystems are submitted to variations of several abiotic and biotic parameters, some of them related to global change. Among them the ultraviolet-B (UV-B) radiation (UVBR: 280-320 nm) may strongly impact planktonic fish larvae. The consequences of an increase of UVBR on the osmoregulatory function of Dicentrarchus labrax larvae have been investigated in this study. In young larvae of D. labrax, as in other teleosts, osmoregulation depends on tegumentary ion transporting cells, or ionocytes, mainly located on the skin of the trunk and of the yolk sac. As early D. labrax larvae passively drift in the top water column, ionocytes are exposed to solar radiation. The effect of UVBR on larval osmoregulation in seawater was evaluated through nanoosmometric measurements of the blood osmolality after exposure to different UV-B treatments. A loss of osmoregulatory capability occured in larvae after 2 days of low (50 {mu}W cm{sup -2}: 4 h L/20 h D) and medium (80 {mu}W cm{sup -2}: 4 h L/20 h D) UVBR exposure. Compared to control larvae kept in the darkness, a significant increase in blood osmolality, abnormal behavior and high mortalities were detected in larvae exposed to UVBR from 2 days on. At the cellular level, an important decrease in abundance of tegumentary ionocytes and mucous cells was observed after 2 days of exposure to UVBR. In the ionocytes, two major osmoeffectors were immunolocalized, the Na{sup +}/K{sup +}-ATPase and the Na{sup +}/K{sup +}/2Cl{sup -} cotransporter. Compared to controls, the fluorescent immunostaining was lower in UVBR-exposed larvae. We hypothesize that the impaired osmoregulation in UVBR-exposed larvae originates from the lower number of tegumentary ionocytes and mucous cells. This alteration of the osmoregulatory function could negatively impact the survival of young larvae at the surface water exposed to UVBR.

  20. The occurrence of digenean larvae in freshwater snails at Mbezi ...

    African Journals Online (AJOL)

    The occurrence of digenean larvae in freshwater snails at Mbezi-Temboni pond, Dar es Salaam. ESP Kigadye, G Nkwengulila. Abstract. The abundance of digenean larvae in snails at a pond in Mbezi-Temboni, Dar es Salaam, was investigated from July 1996 to June 1997. A total of 2,112 snails belonging to three species, ...

  1. Infectivity and development of X-irradiated third-stage larvae of Angiostrongylus cantonensis in rats

    International Nuclear Information System (INIS)

    Fujiu, Yoshinori

    1989-01-01

    Angiostrongylus cantonensis third-stage larvae were exposed to less than 10Krad of X-radiation and then given orally to white rats to examine the effects of X-radiation on infectivity and development of the irradiated third-stage larvae and on fecundity of adults developing from the irradiated third-stage larvae. The deleterious effects of X-radiation were observed at relatively lower dosage in the above three parameters. A degree in susceptibility on X-radiation was shown to be radiation-dose-dependent. Comparing to the irradiation of larvae in vitro, the irradiation of larvae in snails caused less deleterious effects at the same dose of X-irradiation. Application of X-radiation to food hygiene was also discussed. (author)

  2. Nursing protects honeybee larvae from secondary metabolites of pollen.

    Science.gov (United States)

    Lucchetti, Matteo A; Kilchenmann, Verena; Glauser, Gaetan; Praz, Christophe; Kast, Christina

    2018-03-28

    The pollen of many plants contains toxic secondary compounds, sometimes in concentrations higher than those found in the flowers or leaves. The ecological significance of these compounds remains unclear, and their impact on bees is largely unexplored. Here, we studied the impact of pyrrolizidine alkaloids (PAs) found in the pollen of Echium vulgare on honeybee adults and larvae. Echimidine, a PA present in E. vulgare pollen, was isolated and added to the honeybee diets in order to perform toxicity bioassays. While adult bees showed relatively high tolerance to PAs, larvae were much more sensitive. In contrast to other bees, the honeybee larval diet typically contains only traces of pollen and consists predominantly of hypopharyngeal and mandibular secretions produced by nurse bees, which feed on large quantities of pollen-containing bee bread. We quantified the transfer of PAs to nursing secretions produced by bees that had previously consumed bee bread supplemented with PAs. The PA concentration in these secretions was reduced by three orders of magnitude as compared to the PA content in the nurse diet and was well below the toxicity threshold for larvae. Our results suggest that larval nursing protects honeybee larvae from the toxic effect of secondary metabolites of pollen. © 2018 The Authors.

  3. Nursing protects honeybee larvae from secondary metabolites of pollen

    Science.gov (United States)

    Lucchetti, Matteo A.; Kilchenmann, Verena; Glauser, Gaetan; Praz, Christophe

    2018-01-01

    The pollen of many plants contains toxic secondary compounds, sometimes in concentrations higher than those found in the flowers or leaves. The ecological significance of these compounds remains unclear, and their impact on bees is largely unexplored. Here, we studied the impact of pyrrolizidine alkaloids (PAs) found in the pollen of Echium vulgare on honeybee adults and larvae. Echimidine, a PA present in E. vulgare pollen, was isolated and added to the honeybee diets in order to perform toxicity bioassays. While adult bees showed relatively high tolerance to PAs, larvae were much more sensitive. In contrast to other bees, the honeybee larval diet typically contains only traces of pollen and consists predominantly of hypopharyngeal and mandibular secretions produced by nurse bees, which feed on large quantities of pollen-containing bee bread. We quantified the transfer of PAs to nursing secretions produced by bees that had previously consumed bee bread supplemented with PAs. The PA concentration in these secretions was reduced by three orders of magnitude as compared to the PA content in the nurse diet and was well below the toxicity threshold for larvae. Our results suggest that larval nursing protects honeybee larvae from the toxic effect of secondary metabolites of pollen. PMID:29563265

  4. Structure of recombinant human carboxylesterase 1 isolated from whole cabbage looper larvae

    International Nuclear Information System (INIS)

    Greenblatt, Harry M.; Otto, Tamara C.; Kirkpatrick, Melanie G.; Kovaleva, Elena; Brown, Susan; Buchman, George; Cerasoli, Douglas M.; Sussman, Joel L.

    2012-01-01

    Large quantities of recombinant human carboxylesterase 1 have been produced in an economical whole insect larvae system. The crystal structure of this enzyme is essentially identical to that produced by cell culture techniques. The use of whole insect larvae as a source of recombinant proteins offers a more cost-effective method of producing large quantities of human proteins than conventional cell-culture approaches. Human carboxylesterase 1 has been produced in and isolated from whole Trichoplusia ni larvae. The recombinant protein was crystallized and its structure was solved to 2.2 Å resolution. The results indicate that the larvae-produced enzyme is essentially identical to that isolated from cultured Sf21 cells, supporting the use of this expression system to produce recombinant enzymes for crystallization studies

  5. First record of Naushonia sp. (Decapoda: Laomediidae) larva from the Equatorial Atlantic.

    Science.gov (United States)

    De Albuquerque Lira, Simone Maria; De Santana, Claudeilton Severino; Schwamborn, Ralf

    2018-02-26

    The first zoeal-stage larva of a possibly new species of mud shrimp Naushonia (Decapoda: Gebiidea: Laomediidae) was described from plankton samples taken off the Fernando de Noronha Archipelago, being the first occurrence at the oceanic islands of the Equatorial Atlantic. Five zoea I larvae were obtained and dissected for observation of mouthparts. This zoea I of Naushonia sp. is well distinguished from the first larvae of N. portoricensis (Rathbun 1901) from the Caribbean and N. cangronoides (Kingsley 1897) from the Northwest Atlantic in terms of development and setation of appendages, and possibly belongs to a new, undescribed species. The present study widens the knowledge on tropical oceanic decapod larvae and provides detailed drawings and new photographic illustrations with extended depth of field of these organisms.

  6. An improved brine shrimp larvae lethality microwell test method.

    Science.gov (United States)

    Zhang, Yi; Mu, Jun; Han, Jinyuan; Gu, Xiaojie

    2012-01-01

    This article described an improved brine shrimp larvae lethality microwell test method. A simply designed connecting vessel with alternative photoperiod was used to culture and collect high yield of active Artemia parthenogenetica nauplii for brine shrimp larvae lethality microwell test. Using this method, pure A. parthenogenetica nauplii suspension was easily cultured and harvested with high density about 100-150 larvae per milliliter and the natural mortality was reduced to near zero by elimination of unnecessary artificial disturbance. And its sensitivity was validated by determination of LC(50)-24 h of different reference toxicants including five antitumor agents, two pesticides, three organic pollutants, and four heavy metals salts, most of which exhibited LC(50)-24 h between 0.07 and 58.43 mg/L except for bleomycin and mitomycin C with LC(50)-24 h over 300 mg/L.

  7. [Effects of fermented cattle dung on the growth and development of Tenebrio molitor larvae].

    Science.gov (United States)

    Zeng, Xiang-Wei; Wang, Xia; Guo, Li-Yue; Zhan, Li-Jie; Bo, Wen-Jing; Li, Zhan; Wu, Guang-Lei; Jiang, Gao-Ming

    2012-07-01

    In order to make use of and industrialize the animal dung from large cattle farms, this paper explored the feasibility of using Tenebrio molitor to digest and utilize cattle dung. Cattle dung was mixed with the conventional feed (65% wheat bran, 30% corn flour, and 5% bean pulp) of T. molitor in definite proportions, and fermented with effective microorganisms (EM). The fermented products containing 60% and 80% of cattle dung (FD1 and FD2, respectively) were selected to feed T. molitor larvae, and the effects of the fermented products on the growth curve, death rate, pupation rate, and antioxidant system of the larvae were compared. Compared with CK (conventional deed), the FD1 made the developmental duration of the larvae prolonged by 10 days and the larvae's death rate upraised somewhat, but made the single larva's total food intake, average body mass, crude fat content, and ratio of unsaturated to saturated fat acids increased by 49%, 28%, 26%, and 32%, respectively (P molitor larvae had weak adaptability to FD2. Our findings suggested that using FD1 to feed the 3rd instar of T. molitor larvae would have good practical prospects in industrializing cattle dung.

  8. Modulation of nutrient composition of black soldier fly (Hermetia illucens larvae by feeding seaweed-enriched media.

    Directory of Open Access Journals (Sweden)

    Nina S Liland

    Full Text Available Black soldier fly (Hermetia illucens larvae are a promising source of protein and lipid for animal feeds. The nutritional composition of the BSF larvae depend partly on the composition of the feeding medium. The BSF lipid profile in part mimics the feeding media lipid profile, and micronutrients, like minerals and vitamins, can readily accumulate in black soldier fly larvae. However, investigative studies on bioconversion and accumulation of nutrients from media to black soldier fly larvae are scarce. Here we show that inclusion of the brown algae Ascophyllum nodosum in the substrate for black soldier fly larvae can introduce valuable nutrients, commonly associated with the marine environment, into the larvae. The omega-3 fatty acid eicosapentaenoic acid (20:5n-3, iodine and vitamin E concentrations increased in the larvae when more seaweed was included in the diet. When the feeding media consisted of more than 50% seaweed, the larvae experienced poorer growth, lower nutrient retention and lower lipid levels, compared to a pure plant based feeding medium. Our results confirm the plasticity of the nutritional make-up of black soldier fly larvae, allowing it to accumulate both lipid- and water-soluble compounds. A broader understanding of the effect of the composition of the feeding media on the larvae composition can help to tailor black soldier fly larvae into a nutrient profile more suited for specific feed or food purposes.

  9. Biological Role of Paenilarvins, Iturin-Like Lipopeptide Secondary Metabolites Produced by the Honey Bee Pathogen Paenibacillus larvae.

    Science.gov (United States)

    Hertlein, Gillian; Seiffert, Marlene; Gensel, Sebastian; Garcia-Gonzalez, Eva; Ebeling, Julia; Skobalj, Ranko; Kuthning, Anja; Süssmuth, Roderich D; Genersch, Elke

    2016-01-01

    The Gram-positive bacterium Paenibacillus larvae (P. larvae) is the causative agent of a deadly honey bee brood disease called American Foulbrood (AFB). AFB is a notifiable epizootic in most countries and, hence, P. larvae is of considerable relevance for veterinarians and apiculturists alike. Over the last decade, much progress has been made in the understanding of the (patho)biology of P. larvae. Recently, several non-ribosomally produced peptides (NRP) and peptide/polyketide (NRP/PK) hybrids produced by P. larvae were identified. Among these NRPs were iturin-like lipopeptides, the paenilarvins A-C. Iturins are known to exhibit strong anti-fungal activity; for some iturins, cytotoxic activity towards mammalian erythrocytes and human cancer cell lines are described. We here present our results on the analysis of the natural function of the paenilarvins during pathogenesis of P. larvae infections. We demonstrated production of paenilarvins in infected larvae. However, we could neither demonstrate cytotoxicity of paenilarvins towards cultured insect cells nor towards larvae in feeding assays. Accordingly, exposure bioassays performed with larvae infected by wild-type P. larvae and a knockout mutant of P. larvae lacking production of paenilarvins did not substantiate a role for the paenilarvins as virulence factor. Further experiments are necessary to analyze the relevance of the paenilarvins' anti-fungal activity for P. larvae infections in the presence of fungal competitors in the larval midgut or cadaver.

  10. Composting poultry manure by fly larvae (Musca domestica) eliminates Campylobacter jejuni from the manure

    DEFF Research Database (Denmark)

    Nordentoft, Steen; Hald, Birthe

    2013-01-01

    study To monitor fly larvae composting of poultry manure artificially contaminated with C. jejuni, and to investigate a possible transmission route of C. jejuni from the manure through the fly larvae to the adult fly. Conclusions The addition of fly larvae both accelerated the degradation of manure...

  11. Use of liquid nitrogen and albendazole in successfully treating cutaneous larva migrans.

    Science.gov (United States)

    Kapadia, Naseema; Borhany, Tasneem; Farooqui, Maria

    2013-05-01

    To determine the efficacy of combination treatment of Albendazole along with liquid nitrogen in cutaneous larva migrans. Quasi-experimental study. Abbasi Shaheed Hospital and The Aga Khan Hospital, Karachi, from December 2008 to December 2010. Eighteen cases of cutaneous larva migrans were collected and divided into two groups. Group-A was administered oral Albendazole 400 mg once per day along with topical steroid and oral cetrizine 10 mg once at night for 7 days. Group-B also received oral Albendazole 400 mg once per day along with cetrizine 10 mg once at night but they also received single application of liquid nitrogen to freeze the larva. It was found that in Group-A only 2 out of 9 (22%) showed improvement whereas 78% had to be given liquid nitrogen cryotherapy 3 - 7 days after Albendazole to prevent migration of larva. In Group-B, the improvement was 100% and all 9 patients were successfully treated. Use of liquid nitrogen along with oral anti-helminths is very effective in treating cutaneous larva migrans than Albendazole alone.

  12. Performance of jundiá larvae, Rhamdia quelen, fed on probiotic supplemented diets

    Directory of Open Access Journals (Sweden)

    Vilson Borba Pinto

    2015-08-01

    Full Text Available Since probiotics have proved to be a viable alternative to antibiotics as enhancers of animal growth, the performance, uniformity and mortality rates of the jundiá (Rhamdia quelen larvae fed on diets with different probiotics were evaluated. Jundiá larvae, aged four days post hatching, were fed during 21 days with the following diets, in four replicates, namely, CO: control feed, without probiotics; PP: feed with Pichia pastoris; SB: feed with Saccharomyces boulardii; BT: feed with Bacillus cereus var. toyoi. Among the tested probiotic, Bacillus cereus var. toyoi had the best results due to the fact that the larvae were 25% heavier than CO at the end of the first week; the difference increased to 28% by the end of the trial. Further, BT also improved uniformity and Fulton’s condition factor. Larvae fed on Saccharomyces boulardii had the lowest body weight, whereas those fed on Pichia pastoris grew similarly to the control diet. Mortality rate was not affected by treatments. Bacillus cereus var. toyoi improves the performance and uniformity of the larvae, but does not affect mortality rate.

  13. Food web changes under ocean acidification promote herring larvae survival.

    Science.gov (United States)

    Sswat, Michael; Stiasny, Martina H; Taucher, Jan; Algueró-Muñiz, Maria; Bach, Lennart T; Jutfelt, Fredrik; Riebesell, Ulf; Clemmesen, Catriona

    2018-05-01

    Ocean acidification-the decrease in seawater pH due to rising CO 2 concentrations-has been shown to lower survival in early life stages of fish and, as a consequence, the recruitment of populations including commercially important species. To date, ocean-acidification studies with fish larvae have focused on the direct physiological impacts of elevated CO 2 , but largely ignored the potential effects of ocean acidification on food web interactions. In an in situ mesocosm study on Atlantic herring (Clupea harengus) larvae as top predators in a pelagic food web, we account for indirect CO 2 effects on larval survival mediated by changes in food availability. The community was exposed to projected end-of-the-century CO 2 conditions (~760 µatm pCO 2 ) over a period of 113 days. In contrast with laboratory studies that reported a decrease in fish survival, the survival of the herring larvae in situ was significantly enhanced by 19 ± 2%. Analysis of the plankton community dynamics suggested that the herring larvae benefitted from a CO 2 -stimulated increase in primary production. Such indirect effects may counteract the possible direct negative effects of ocean acidification on the survival of fish early life stages. These findings emphasize the need to assess the food web effects of ocean acidification on fish larvae before we can predict even the sign of change in fish recruitment in a high-CO 2 ocean.

  14. Temporal variability of fish larvae assemblages: influence of natural and anthropogenic disturbances

    Directory of Open Access Journals (Sweden)

    David A. Reynalte-Tataje

    Full Text Available Natural and induced disturbances greatly influence the temporal distribution of ichthyoplankton abundance. This study assesses and compares the temporal variability of fish larvae assemblages in controlled and free environments to determine the influence of environment variables on the main taxa in these systems. The study was conducted at the Chapecó (without dam impact and Ligeiro (with dam impact river mouths, which are located in the upper Uruguay River. Samples were made between October 2001 and March 2004 during three reproductive periods. The larvae assemblages were composed of small and medium-sized Characiformes and Siluriformes. The variation in the distribution of larvae was mainly temporal (>85%. When the three reproductive periods were compared, it was observed in the second period, characterized by a larger water flow and a lower temperature, that there was a reduction in abundance, a lower number of taxa, an absence of stages in post-flexion and a high dissimilarity in larvae assemblage structure. In general, the environmental variables of water flow and temperature most influenced the distribution of egg and larvae abundance. In the studied area, a smaller temporal variability was observed in the structure of larvae assemblages at the sampling sites in the Chapecó River mouth than in in the Ligeiro River mouth under the influence of dams.

  15. Caffeine taste signaling in Drosophila larvae

    Directory of Open Access Journals (Sweden)

    Anthi A Apostolopoulou

    2016-08-01

    Full Text Available The Drosophila larva has a simple peripheral nervous system with a comparably small number of sensory neurons located externally at the head or internally along the pharynx to assess its chemical environment. It is assumed that larval taste coding occurs mainly via external organs (the dorsal, terminal and ventral organ. However, the contribution of the internal pharyngeal sensory organs has not been explored. Here we find that larvae require a single pharyngeal gustatory receptor neuron pair called D1, which is located in the dorsal pharyngeal sensilla, in order to avoid caffeine and to associate an odor with caffeine punishment. In contrast, caffeine-driven reduction in feeding in non-choice situations does not require D1. Hence, this work provides data on taste coding via different receptor neurons, depending on the behavioral context. Furthermore, we show that the larval pharyngeal system is involved in bitter tasting. Using ectopic expressions, we show that the caffeine receptor in neuron D1 requires the function of at least four receptor genes: the putative coreceptors Gr33a, Gr66a, the putative caffeine-specific receptor Gr93a, and yet unknown additional molecular component(s. This suggests that larval taste perception is more complex than previously assumed already at the sensory level. Taste information from different sensory organs located outside at the head or inside along the pharynx of the larva is assembled to trigger taste guided behaviours.

  16. Keragaman Genetik Metarhizium anisopliae dan Virulensinya pada Larva Kumbang Badak (Oryctes rhinoceros

    Directory of Open Access Journals (Sweden)

    Aisyah Surya Bintang

    2015-07-01

    Full Text Available Rhinoceros beetle (Oryctes rhinoceros is one of the important pests of coconut tree. One of eco-friendly control applied for this pest is by using entomopathogenic fungiMetarhizium anisopliae. There is not much information about the variability and virulence of M. anisopliae toward O. rhinoceros. M. anisopliae isolates obtained from Biological Control Laboratory, Faculty of Agriculture, Universitas Gadjah Mada were cultured on PDA medium.M. anisopliae isolates was isolated from O. rhinoceros larvae (MaOr, Lepidiota stigma larvae (MaLs, Brontispa longissima beetle (MaBl.O. rhinoceros beetles were obtained from Kulon Progo, DIY. This study used molecular test, and virulence test toward 3rd stadium of O. rhinoceros larvae by using dipping method. Molecular test by sequence and phylogenetic analysis, showed that MaOr was located at different group (out group with MaLs and MaBr. On the density 107 conidium/ml MaOr and MaLs were more virulent than MaBl towards 3rd stadium of O. rhinoceros larvae. INTISARI Kumbang badak (Oryctes rhinoceros merupakan salah satu hama penting pada tanaman kelapa. Salah satu upaya pengendalian yang ramah lingkungan adalah dengan menggunakan jamur entomopatogen, yakni Metarhizium anisopliae. Belum banyak diketahui mengenai keragaman dan juga virulensi dari M. anisopliae terhadap O. rhinoceros. Tujuan dari penelitian ini adalah untuk mengetahui keragaman genetik M. anisopliae dan virulensinya pada larva kumbang badak. Isolat yang digunakan berasal dari Laboratorium Pengendalian Hayati, Fakultas Pertanian, Universitas Gadjah Mada dalam bentuk kultur murni pada medium PDA. Isolat yang gunakan diisolasi dari larvaOryctes rhinoceros (MaOr, larva Lepidiota stigma (MaLs, dan kumbang Brontispa longissima (MaBl. Serangga yang diuji berasal dari daerah Kulon Progo, DIY. Pengujian secara molekuler dengan analisis sekuensing dan filogenetik, menunjukkan bahwa isolat MaOr terletak pada grup yang berbeda dengan MaLs dan Ma

  17. Riceland mosquito management practices for Anopheles quadrimaculatus larvae.

    Science.gov (United States)

    Allen, R A; Wilkes, W W; Lewis, C N; Meisch, M V

    2008-12-01

    Two separate but related studies were conducted regarding management of Anopheles quadrimaculatus larval populations in commercial rice fields near Cleveland, MS, in 2004. Study 1 was to evaluate the effectiveness of 2 treatments of aerially applied ultra-low volume applications of Bacillus thuringiensis var. israelensis (Bti) against An. quadrimaculatus larvae in dense, high-canopy mid- to late-season rice crop. Study 2 was to investigate the effect of preflood treatments of lambda-cyhalothrin (Karate), which is commonly used against rice water weevil (Lissorhoptrus oryzophilus), on An. quadrimaculatus larvae. Excellent initial, but short residual control (>99% control 1 day after treatment) was observed in the Bti-treated fields in both mid- and late-season rice. Little or no effect on mosquito larvae was observed in the lambda-cyhalothrin-treated fields. Results indicate that Bti can be effectively used by mosquito management personnel to control larval populations of An. quadrimaculatus in late-season rice fields; however, lambda-cyhalothrin did not effectively control larval An. quadrimaculatus when applied preflood to rice fields.

  18. BIOLARVASIDA EKSTRAK ETANOL KULIT NANAS (Ananas comosus L. Merr TERHADAP LARVA NYAMUK Culex Sp.

    Directory of Open Access Journals (Sweden)

    Siti Juariah

    2017-10-01

    Full Text Available ABSTRAK   Nanas merupakan salah satu komoditi asal Provinsi Riau. Setiap tahun nanas mengalami peningkatan dengan semakin meningkatnya produksi nanas maka limbah yang dihasilkan akan semakin meningkat. Pada limbah kulit nanas diduga terdapat senyawa alkaloid yang dapat membunuh larva nyamuk Culex Sp. Nyamuk yang termasuk dalam genus Culex dikenal sebagai vektor penular arbovirus, demam kaki gajah, dan malaria pada unggas. Pengendalian serangga umumnya dilakukan menggunakan pestisida sintetik. Penggunaan senyawa kimia yang bersifat sintetik sangat berbahaya bagi pengguna yang terpajan. Tujuan dari penelitian ini adalah untuk menentukan efektifitas ekstrak etanol kulit nanas dan mengetahui jumlah larva yang mati dengan menentukan konsentrasi terbaik dari ekstrak etanol kulit nanas (AnanascomosusL. terhadap larva nyamuk culex Sp. Penelitian ini bersifat Eksperimen Laboratory, yaitu meneliti tentang uji mortalitas larva nyamuk Culex Sp setelah pemberian ekstrak etanol kulit nanas (AnanascomosusL.. Hasil penelitian yang didapatkan bahwa ekstrak etanol kulit nanas dapat dibuktikan pada tingkat konsentrasi 1% angka kematian larva nyamuk telah mencapai 72,5%. Sedangkan pada konsentrasi 4% telah mampu membunuh larva sebesar 97,5%. Kata Kunci        : Ekstraketanol, Kulit nanas, Culex Sp.   ABSTRACT                Pineapple is one of the commodities origin of Riau Province. Each year the pineapple increases with the increasing production of pineapple so the waste generated will increase. In pineapple leaf waste is suspected of alkaloid compounds that can kill the mosquito larvae Culex Sp. The mosquitoes belonging to the genus Culex are known as arbovirus-transmitting vectors, elephant leg fever, and malaria in poultry. Insect control is generally done using synthetic pesticides. The use of synthetic chemicals is very dangerous for exposed users. The purpose of this study was to determine the effectiveness of pineapple ethanol

  19. Hemocyte quantitative changes in Anticarsia gemmatalis (Lepidoptera: Noctuidae larvae infected by AgMNPV

    Directory of Open Access Journals (Sweden)

    Fábio Goulart de Andrade

    2010-04-01

    Full Text Available The initial effects of the infection by AgMNPV in the total and differential counts of the hemocytes in Anticarsia gemmatalis (Lepidoptera: Noctuidae larvae were studied. The total number of the hemocytes did not decrease in infected larvae, as it occurred in non infected larvae. In infected larvae, the hemocyte types showed the following frequencies: plasmatocytes - 47.8%, esferulocytes - 25.9%, granulocytes - 15.8%, oenocytoids - 7.2%, prohemocytes - 2.8%, vermicytes - 0,5%. Only the percentage of the granulocytes was different among infected and non infected larvae, indicating that these cells responded quickly to the initial viral infection. These results showed the effective role of the hemocytes in the response of the A. gemmatalis to the infection by AgMNPV. The comprehension of the immunological mechanisms of this insect is an important tool to understand its biological control.Os efeitos iniciais da infecção por AgMNPV nas contagens total e diferencial dos hemócitos em Anticarsia gemmatalis (Lepidoptera: Noctuidae foram estudados. O número total de hemócitos não diminuiu nas larvas infectadas, como ocorreu nas larvas não infectadas. Nas larvas infectadas, os tipos de hemócitos apresentaram as seguintes freqüências: plasmatócitos - 47,8%, esferulócitos - 25,9%, granulócitos - 15,8%, oenocitóides - 7,2%, prohemócitos - 2,8%, vermiformes - 0,5%. Apenas a porcentagem de granulócitos foi diferente entre larvas infectadas e não infectadas, indicando que estas células responderam rapidamente à infecção viral inicial. Estes resultados mostraram o papel efetivo que dos hemócitos na resposta de A. gemmatalis à infecção por AgMNPV. A compreensão dos mecanismos imunológicos deste inseto é uma ferramenta importante para compreender seu controle biológico.

  20. Toxocara cati larvae in the eye of a child: a case report

    Directory of Open Access Journals (Sweden)

    Mohammad Zibaei

    2014-05-01

    Full Text Available Toxocariasis is a consequence of human infection by Toxocara larvae. There are symptomatic (visceral, ocular and asymptomatic course of toxocariasis. The ocular form is very rare. We present a 6-year-old patient who developed an ocular form of toxocariasis caused by Toxocara cati. He demonstrated lesions in the peripheral retina of the right eye. White granuloma was present in the superior peripheral retina. A positive immunological assay for toxocariasis essentially completed the outcomes. On the basis of clinical manifestations and conducted examinations, a diagnosis of ocular form of toxocariasis was established. Albendazole and corticosteroids were applied in treatment. Current results clearly highlight the usefulness of excretory-secretory antigens derived from larvae of Toxocara cati for the fine diagnosis ocular larva migrans caused by Toxocara larvae.

  1. Sensory Flask Cells in Sponge Larvae Regulate Metamorphosis via Calcium Signaling.

    Science.gov (United States)

    Nakanishi, Nagayasu; Stoupin, Daniel; Degnan, Sandie M; Degnan, Bernard M

    2015-12-01

    The Porifera (sponges) is one of the earliest phyletic lineages to branch off the metazoan tree. Although the body-plan of sponges is among the simplest in the animal kingdom and sponges lack nervous systems that communicate environmental signals to other cells, their larvae have sensory systems that generate coordinated responses to environmental cues. In eumetazoans (Cnidaria and Bilateria), the nervous systems of larvae often regulate metamorphosis through Ca(2+)-dependent signal transduction. In sponges, neither the identity of the receptor system that detects an inductive environmental cue (hereafter "metamorphic cues") nor the signaling system that mediates settlement and metamorphosis are known. Using a combination of behavioral assays and surgical manipulations, we show here that specialized epithelial cells-referred to as flask cells-enriched in the anterior third of the Amphimedon queenslandica larva are most likely to be the sensory cells that detect the metamorphic cues. Surgical removal of the region enriched in flask cells in a larva inhibits the initiation of metamorphosis. The flask cell has an apical sensory apparatus with a cilium surrounded by an apical F-actin-rich protrusion, and numerous vesicles, hallmarks of eumetazoan sensory-neurosecretory cells. We demonstrate that these flask cells respond to metamorphic cues by elevating intracellular Ca(2+) levels, and that this elevation is necessary for the initiation of metamorphosis. Taken together, these analyses suggest that sponge larvae have sensory-secretory epithelial cells capable of converting exogenous cues into internal signals via Ca(2+)-mediated signaling, which is necessary for the initiation of metamorphosis. Similarities in the morphology, physiology, and function of the sensory flask cells in sponge larvae with the sensory/neurosecretory cells in eumetazoan larvae suggest this sensory system predates the divergence of Porifera and Eumetazoa. © The Author 2015. Published by Oxford

  2. Chemically mediated group formation in soil-dwelling larvae and pupae of the beetle Trypoxylus dichotomus

    Science.gov (United States)

    Kojima, Wataru; Ishikawa, Yukio; Takanashi, Takuma

    2014-09-01

    Many insects form groups through interactions among individuals, and these are often mediated by chemical, acoustic, or visual cues and signals. In spite of the diversity of soil-dwelling insects, their aggregation behaviour has not been examined as extensively as that of aboveground species. We investigated the aggregation mechanisms of larvae of the Japanese rhinoceros beetle Trypoxylus dichotomus, which live in groups in humus soil. In two-choice laboratory tests, 2nd- and 3rd-instar larvae gathered at conspecific larvae irrespective of the kinship. The ablation of maxillae, which bear chemosensilla, abolished aggregation behaviour. Intact larvae also exhibited aggregation behaviour towards a larval homogenate. These results suggest that larval aggregation is mediated by chemical cues. We also demonstrated that the mature larvae of T. dichotomus built their pupal cells close to a mesh bag containing a conspecific pupal cell, which indicated that larvae utilize chemical cues emanating from these cells to select the pupation site. Thus, the larvae of T. dichotomus may use chemical cues from the conspecifics in two different contexts, i.e. larval aggregation and pupation site selection. Using conspecific cues, larvae may be able to choose suitable locations for foraging or building pupal cells. The results of the present study highlight the importance of chemical information in belowground ecology.

  3. Biophysical processes leading to the ingress of temperate fish larvae into estuarine nursery areas: A review

    Science.gov (United States)

    Teodósio, Maria Alexandra; Paris, Claire B.; Wolanski, Eric; Morais, Pedro

    2016-12-01

    A series of complementary hypotheses have been proposed to explain the recruitment of marine and temperate pelagic fish larvae originated from pelagic eggs in coastal environments. In this review, we propose a new and complementary hypothesis describing the biophysical processes intervening in the recruitment of temperate fish larvae into estuaries. This new hypothesis, the Sense Acuity And Behavioral (SAAB) hypothesis, recognizes that recruitment is unlikely if the larvae drift passively with the water currents, and that successful recruitment requires the sense acuity of temperate fish larvae and their behavioral response to the estuarine cues present in coastal areas. We propose that temperate fish larvae use a hierarchy of sensory cues (odor, sound, visual and geomagnetic cues) to detect estuarine nursery areas and to aid during navigation towards these areas. The sensorial acuity increases along ontogeny, which coincides with increased swimming capabilities. The swimming strategies of post-flexion larvae differ from offshore areas to the tidal zone. In offshore areas, innate behavior might lead larvae towards the coast guided by a sun compass or by the earth's geomagnetic field. In areas under limited influence of estuarine plumes (either in energetic nearshore areas or offshore), post-flexion larvae display a searching swimming behavior for estuarine disconnected patches (infotaxis strategy). After finding an estuarine plume, larvae may swim along the increasing cue concentration to ingress into the estuary. Here, larvae exhibit a rheotaxis behavior and avoid displacement by longshore currents by keeping bearing during navigation. When larvae reach the vicinity of an estuary, merging diel rhythms with feeding and predator avoidance strategies with tidally induced movements is essential to increase their chances of estuarine ingress. A fish larva recruitment model developed for the Ria Formosa lagoon supports the general framework of the SAAB hypothesis. In

  4. Controle de larvas de Boophilus microplus por Metarhizium anisopliae em pastagens infestadas artificialmente Control of Boophilus microplus larvae by Metarhizium anisopliae in artificially infested pastures

    Directory of Open Access Journals (Sweden)

    Lúcia Mara de Souza Basso

    2005-06-01

    Full Text Available O objetivo deste trabalho foi avaliar a eficiência do controle exercido por Metarhizium anisopliae na população de Boophilus microplus, em pastagens de Brachiaria brizantha, e do híbrido Tifton 85 (Cynodon spp., artificialmente infestadas com fêmeas ingurgitadas do carrapato. Trinta canteiros com 1 m² de área cada foram distribuídos aleatoriamente. Quinze foram pulverizados com esporos do fungo e quinze controles em cada forrageira, constituindo cinco repetições de cada tratamento, foram infestados com número e peso padronizados de fêmeas ingurgitadas do ácaro. Aplicou-se o fungo, na concentração de 1,8x10(8 conídios mL-1, em três situações: pulverização antes da infestação com o carrapato, após a infestação e posterioriormente à emergência das primeiras larvas nos capins. A ação do fungo foi avaliada no 35º, 38º, 41º, 48º, 55º e 61º dia pós-infestação, por meio da contagem de larvas recuperadas. Obteve-se controle de larvas do ácaro, que, nas avaliações realizadas entre o 35º e o 48º dia pós-infestação, variou entre 87% e 94%. As médias das contagens de estágios larvares do carrapato foram menores em todas as amostragens realizadas no capim-Tifton 85, indicando que houve efeito da pastagem na ação do fungo. A situação de aplicação influencia a atividade do fungo, com melhor resultado nas coletas realizadas entre o 41º e 55º dia após infestação em B. brizantha, e aplicação dos conídios logo após a emergência das primeiras larvas.The objective of this work was to evaluate the efficiency of Metarhizium anisopliae fungus against Boophilus microplus population in Brachiaria brizantha and Tifton 85 (Cynodon pastures, artificially infested with tick engorged females. Thirty plots of 1 m² each were randomly distributed in fifteen treated and fifteen control groups per type of grass, establishing five repetitions for each treatment. Pastures were infested with engorged tick females

  5. Thermal ecology of gregarious and solitary nettle-feeding nymphalid butterfly larvae.

    Science.gov (United States)

    Bryant, S R; Thomas, C D; Bale, J S

    2000-01-01

    Group-living in animal populations has many possible ecological and evolutionary explanations, including predator evasion and feeding facilitation. In insects, the thermal balance of solitary and gregarious larvae is likely to differ and may thus have important ecological consequences. The abilities of the larvae of four species of nettle-feeding nymphalid butterflies to thermoregulate were quantified in the field. Larval surface body temperatures of the gregarious Aglais urticae (small tortoiseshell) and Inachis io (peacock) and the solitary Polygonia c-album (comma) and Vanessa atalanta (red admiral) were measured for each instar, in both sunny and overcast conditions, over a seasonal range of temperatures. The results suggested two distinct larval thermal strategies. In the presence of direct sunlight, the exposed gregarious larvae of A. urticae and I. io regulated body temperatures at 32.5 and 31.5°C, respectively, while the temperatures of concealed larvae of P. c-album and V. atalanta were largely dependent on ambient temperatures. In the sun, the range of body temperatures recorded for A. urticae and I. io larvae was fairly narrow relative to ambient temperatures. This suggests a high degree of thermal control in these species. Modal body temperatures coincided with the temperature at which development rate is maximal. Regardless of whether changes in thermoregulation are a cause or consequence of the evolution of gregariousness, the combination of behavioural thermoregulation and gregariousness in larval insects has important implications for voltinism patterns and range extension (via increased development rates). Distributional responses of gregarious and solitary larvae to climatic warming may differ as a result of changes in cloud cover as well as changes in temperature.

  6. Extreme morphologies of mantis shrimp larvae

    DEFF Research Database (Denmark)

    Haug, Carolin; Ahyong, Shane T.; Wiethase, Joris H.

    2016-01-01

    Larvae of stomatopods (mantis shrimps) are generally categorized into four larval types: antizoea, pseudozoea (both representing early larval stages), alima and erichthus (the latt er two representing later larval stages). These categories, however, do not refl ect the existing morphological...

  7. Two alternating motor programs drive navigation in Drosophila larva.

    Directory of Open Access Journals (Sweden)

    Subhaneil Lahiri

    Full Text Available When placed on a temperature gradient, a Drosophila larva navigates away from excessive cold or heat by regulating the size, frequency, and direction of reorientation maneuvers between successive periods of forward movement. Forward movement is driven by peristalsis waves that travel from tail to head. During each reorientation maneuver, the larva pauses and sweeps its head from side to side until it picks a new direction for forward movement. Here, we characterized the motor programs that underlie the initiation, execution, and completion of reorientation maneuvers by measuring body segment dynamics of freely moving larvae with fluorescent muscle fibers as they were exposed to temporal changes in temperature. We find that reorientation maneuvers are characterized by highly stereotyped spatiotemporal patterns of segment dynamics. Reorientation maneuvers are initiated with head sweeping movement driven by asymmetric contraction of a portion of anterior body segments. The larva attains a new direction for forward movement after head sweeping movement by using peristalsis waves that gradually push posterior body segments out of alignment with the tail (i.e., the previous direction of forward movement into alignment with the head. Thus, reorientation maneuvers during thermotaxis are carried out by two alternating motor programs: (1 peristalsis for driving forward movement and (2 asymmetric contraction of anterior body segments for driving head sweeping movement.

  8. Successful determination of larval dispersal distances and subsequent settlement for long-lived pelagic larvae.

    Directory of Open Access Journals (Sweden)

    Pelayo Salinas-de-León

    Full Text Available Despite its importance, we still have a poor understanding of the level of connectivity between marine populations in most geographical locations. Taking advantage of the natural features of the southeast coast of New Zealand's North Island, we deployed a series of settlement stations and conducted plankton tows to capture recent settlers and planktonic larvae of the common intertidal gastropod Austrolittorina cincta (6-8 week larval period. Satellite image analysis and ground truthing surveys revealed the absence of suitable intertidal rocky shore habitat for A. cincta over a 100 km stretch of coastline between Kapiti Island to the south and Wanganui to the north. Fifteen settlement stations (3 replicates × 5 sites, which were used to mimic intertidal habitat suitable for A. cincta, were deployed for two months around and north of Kapiti Island (at 0.5, 1, 5, 15, 50 km. In addition, we also conducted plankton tows at each settlement station when the stations were first deployed to collect A. cincta larvae in the water column. On collection, all newly settled gastropods and larvae in the plankton samples were individually isolated, and a species-specific microsatellite marker was used to positively identify A. cincta individuals. Most of the positively identified A. cincta settlers and larvae were collected at the first three sampling stations (<5 km. However, low numbers of A. cincta settlers and larvae were also recorded at the two more distant locations (15 and 50 km. Dispersal curves modeled from our data suggested that <1% of gastropod larvae would travel more than 100 km. While our data show that most larvae are retained close to their natal populations (<5 km, a small proportion of larvae are able to travel much larger geographic distances. Our estimates of larval dispersal and subsequent settlement are one of only a few for marine species with a long-lived larva.

  9. Larva migrans cutánea en Lima. Reporte de 3 casos.

    OpenAIRE

    Legua, Pedro; Guerra, Jorge; Bussalleu, Alejandro

    2014-01-01

    Larva migrans cutánea o “erupción reptante” es una erupción cutánea causada por la migración de la larva de un nemátodo en forma errática en la piel. Ocurre usualmente como resultado de la exposición de la piel a las larvas filariformes infectantes de uncinarias propias de felinos y cánidos, que están presentes en suelos húmedos y arenosos en los que estos animales defecan (playas, jardines, parques, etc.).La larvainfectante no puede completar su ciclo vital en el hospedero humano y entonces ...

  10. Ontogenetic development of attack behaviour by turbot larvae when exposed to copepod prey

    DEFF Research Database (Denmark)

    Højgaard, Jacob K.; Bruno, Eleonora; Støttrup, Josianne Gatt

    2018-01-01

    offered small nauplii (129–202 μm), large nauplii (222–278 μm) and copepodites (342–542 μm), of the calanoid copepod Acartia tonsa. At 8 DPH, turbot larvae had the highest capture success (67%) when offered small nauplii, with a lower capture success of large nauplii (27%) but totally lacked...... by the larva on the copepod was examined, and the approach pattern of the larva was identified as a controlling mechanism for their strike distance, with the initial approach speed of larva at DPH 10 being significantly less than at DPH 8. In all successful attacks, the strike distance was less than 1.17 mm...

  11. Crown-of-Thorns Starfish Larvae Can Feed on Organic Matter Released from Corals

    Directory of Open Access Journals (Sweden)

    Ryota Nakajima

    2016-10-01

    Full Text Available Previous studies have suggested that Crown-of-Thorns starfish (COTS larvae may be able to survive in the absence of abundant phytoplankton resources suggesting that they may be able to utilize alternative food sources. Here, we tested the hypothesis that COTS larvae are able to feed on coral-derived organic matter using labeled stable isotope tracers (13C and 15N. Our results show that coral-derived organic matter (coral mucus and associated microorganisms can be assimilated by COTS larvae and may be an important alternative or additional food resource for COTS larvae through periods of low phytoplankton biomass. This additional food resource could potentially facilitate COTS outbreaks by reducing resource limitation.

  12. Development changes of cuticular hydrocarbons in Chrysomya rufifacies larvae: potential for determining larval age.

    Science.gov (United States)

    Zhu, G H; Ye, G Y; Hu, C; Xu, X H; Li, K

    2006-12-01

    Age determination is the basis of determining the postmortem interval using necrophagous fly larvae. To explore the potential of using cuticular hydrocarbons for determining the ages of fly larvae, changes of cuticular hydrocarbons in developing larvae of Chrysomya rufifacies (Macquart) (Diptera: Calliphoridae) were investigated using gas chromatography with flame-ionization detection and gas chromatography-mass spectrometry. This study showed that the larvae produced cuticular hydrocarbons typical of insects. Most of the hydrocarbons identified were alkanes with the carbon chain length of 21-31, plus six kinds of alkenes. The hydrocarbon composition of the larvae correlated with age. The statistical results showed that simple peak ratios of n-C29 divided by another eight selected peaks increased significantly with age; their relationships with age could be modelled using exponential or power functions with R(2) close to or > 0.80. These results suggest that cuticular hydrocarbon composition is a useful indicator for determining the age of larval C. rufifacies, especially for post-feeding larvae, which are difficult to differentiate by morphology.

  13. Use of liquid nitrogen and albendazole in successfully treating cutaneous larva migrans

    International Nuclear Information System (INIS)

    Kapadia, N.; Farooqui, M.; Borhany, T.

    2013-01-01

    Objective: To determine the efficacy of combination treatment of Albendazole along with liquid nitrogen in cutaneous larva migrans. Study Design: Quasi-experimental study. Place and Duration of Study: Abbasi Shaheed Hospital and The Aga Khan Hospital, Karachi, from December 2008 to December 2010. Methodology: Eighteen cases of cutaneous larva migrans were collected and divided into two groups. Group-A was administered oral Albendazole 400 mg once per day along with topical steroid and oral cetrizine 10 mg once at night for 7 days. Group-B also received oral Albendazole 400 mg once per day along with cetrizine 10 mg once at night but they also received single application of liquid nitrogen to freeze the larva. Results: It was found that in Group-A only 2 out of 9 (22%) showed improvement whereas 78% had to be given liquid nitrogen cryotherapy 3 - 7 days after Albendazole to prevent migration of larva. In Group-B, the improvement was 100% and all 9 patients were successfully treated. Conclusion: Use of liquid nitrogen along with oral anti-helminths is very effective in treating cutaneous larva migrans than Albendazole alone. (author)

  14. Abdominal Distension Associated with Luminal Fungi in the Intestines of Axolotl Larvae

    Directory of Open Access Journals (Sweden)

    Chiara Zullian

    2015-01-01

    Full Text Available Axolotls show a remarkable regeneration capacity compared with higher vertebrates, regenerating missing appendages such as limbs and tail as well as other body parts (i.e., apex of the heart, forebrain, and jaw after amputations which makes this animal a very interesting research model for tissue regeneration mechanisms. Larvae are individually housed in a 20% Holtfreter’s solution within clear plastic containers. The photoperiod light : darkness cycle is 12 : 12 h. Larvae with a total body length of less than 5 cm are fed once a day with large brine shrimp and blood worm. Albino larvae appeared to have a tendency to exhibit abdominal distention. No clinical signs of illness seemed to be associated with the condition; however, these animals exhibit a relatively slower growth rate. To better characterize this condition, we performed histological sectioning for cross sectional slide preparation on wild type and albino axolotl larvae following euthanasia. The only lesion seen in the albino larvae was a thickened gut wall and the presence of fungi within the intestines. We hypothesize that this may be due to a lower efficacy of the albino larvae’s immune system.

  15. AKTIVITAS INSEKTISIDA BAGIAN TUMBUHAN CALOPHYLLUM SOULTTRI BURM.F. (CLU IACEAE TERHADAP LARVA LEPIDOPTERA

    Directory of Open Access Journals (Sweden)

    Edy Syahputra

    2014-08-01

    Full Text Available The objective of this test was evaluate the insecticidal activity of ectract of some parts of Calophyllum soulattri (Clusiaceae against larvae of three species of Lepidoptera, i. e Crocidolomia pavonana, Plutella xylostela, and Pieris sp.. Extraction of plant materials was done by infusion method using ethanol. The bioassays were conducted by leaf-feeding method. Second-instar larvae were fed extract-treated broccoli leaves of 48 hours, then they were presented with untreated leaves until the surviving larvae larvae reached the fourth-instar stage. The number of dead larvae was recorded daily an larval mortality date were analyzed by probit method. The result showed the gummy bark exudates and bark extract of old and young C. soulattri plants were highly active against C. pavonana. The abrk extact of old C. soulattri plant was also effective against P. xilostella and Pieris sp. The gummy exudates possessed strong insecticidal activity against C. pavonana larvae with LC50 of 0.04% and prolonged the developmental time from second to fourth instar of C. soulattri 2.03-7.25 days compared with control. The bark excudate gave positive respon to alkaloid flavonoid, and tannin test. Futher studies are needed to identify insecticidal compound in those active extracts.

  16. Distribution and seasonal abundance of carangid larvae in the Arabian sea and Bay of Bengal

    Digital Repository Service at National Institute of Oceanography (India)

    Peter, K.J.; Balachandran, T.

    Carangid larvae were recorded from 8.8% of the International Indian Ocean Expedition (IIOE) stations in the Arabian Sea and 13.2% in the Bay of Bengal. Their total contribution was 1.1% of the total larvae collected. The highest number of larvae...

  17. Honey bees consider larval nutritional status rather than genetic relatedness when selecting larvae for emergency queen rearing.

    Science.gov (United States)

    Sagili, Ramesh R; Metz, Bradley N; Lucas, Hannah M; Chakrabarti, Priyadarshini; Breece, Carolyn R

    2018-05-16

    In honey bees and many other social insects, production of queens is a vital task, as colony fitness is dependent on queens. The factors considered by honey bee workers in selecting larvae to rear new queens during emergency queen rearing are poorly understood. Identifying these parameters is critical, both in an evolutionary and apicultural context. As female caste development in honey bees is dependent on larval diet (i.e. nutrition), we hypothesized that larval nutritional state is meticulously assessed and used by workers in selection of larvae for queen rearing. To test this hypothesis, we conducted a series of experiments manipulating the nutritional status of one day old larvae by depriving them of brood food for a four-hour period, and then allowing workers to choose larvae for rearing queens from nutritionally deprived and non-deprived larvae. We simultaneously investigated the role of genetic relatedness in selection of larvae for queen rearing. In all the experiments, significantly greater numbers of non-deprived larvae than deprived larvae were selected for queen rearing irrespective of genetic relatedness. Our results demonstrate that honey bees perceive the nutritional state of larvae and use that information when selecting larvae for rearing queens in the natural emergency queen replacement process.

  18. Warming and pCO2 effects on Florida stone crab larvae

    Science.gov (United States)

    Gravinese, Philip M.; Enochs, Ian C.; Manzello, Derek P.; van Woesik, Robert

    2018-05-01

    Greenhouse gas emissions are increasing ocean temperatures and the partial pressure of CO2 (pCO2), resulting in more acidic waters. It is presently unknown how elevated temperature and pCO2 will influence the early life history stages of the majority of marine coastal species. We investigated the combined effect of elevated temperature (30 °C control and 32 °C treatment) and elevated pCO2 (450 μatm control and 1100 μatm treatment) on the (i) growth, (ii) survival, (iii) condition, and (iv) morphology of larvae of the commercially important Florida stone crab, Menippe mercenaria. At elevated temperature, larvae exhibited a significantly shorter molt stage, and elevated pCO2 caused stage-V larvae to delay metamorphosis to post-larvae. On average, elevated pCO2 resulted in a 37% decrease in survivorship relative to the control; however the effect of elevated temperature reduced larval survivorship by 71%. Exposure to both elevated temperature and pCO2 reduced larval survivorship by 80% relative to the control. Despite this, no significant differences were detected in the condition or morphology of stone crab larvae when subjected to elevated temperature and pCO2 treatments. Although elevated pCO2 could result in a reduction in larval supply, future increases in seawater temperatures are even more likely to threaten the future sustainability of the stone-crab fishery.

  19. Identification of entomopathogenic Bacillus isolated from Simulium (Diptera, Simuliidae larvae and adults

    Directory of Open Access Journals (Sweden)

    Cavados CFG

    2001-01-01

    Full Text Available Entomopathogenic bacteria isolated from Simulium larvae and adults from breeding sites in the states of São Paulo and Rio de Janeiro, Brazil, were identified as 18 strains of Bacillus thuringiensis and one of B. sphaericus. Most of these strains were serotyped according to their flagellar antigens. However, nine of the B. thuringiensis samples, could not be serotyped and were designated as "autoagglutinating"; they were also shown to be toxic in preliminary tests against Aedes aegypti larvae. Additionally, B. sphaericus was also shown to be toxic towards Culex quinquefasciatus larvae.

  20. (Herklotsichthys quadrimaculatus) Larvae on Sofala Bank

    African Journals Online (AJOL)

    Abstract—Vertical larval fish movement influences their survival and dispersal, hence recruitment variability. This study presents the vertical behaviour of gold- spot herring (Herklotsichthys quadrimaculatus) larvae observed on the Sofala Bank. (Mozambique) throughout a 48-hour period when depth-stratified samples were.

  1. OCCURRENCE OF PHYTOPHAGOUS SCARABAEIDAE (INSECTA: COLEOPTERA LARVAE IN DIFFERENT SUCCESSION CROP SYSTEMS OCORRÊNCIA DE LARVAS DE SCARABAEIDAE FITÓFAGOS (INSECTA: COLEOPTERA EM DIFERENTES SISTEMAS DE SUCESSÃO DE CULTURAS

    Directory of Open Access Journals (Sweden)

    Elison Floriano Tiago

    2011-01-01

    Full Text Available Information about Scarabaeidae phytophagous are still rare for the Center-West Region of Brazil. Thus, in the experimental area of the Universidade Estadual do Mato Grosso do Sul, in Aquidauana, Mato Grosso do Sul State, Brazil, the succession of soybean, maize, and forage turnip was sowed from February 2004 to October 2005, when the larvae population dynamics was evaluated. From October 2006 to May 2008, nine succession systems were sowed, the larval density evaluated, and the identification of the current species was carried out. When the larvae were sampled for soybean, in January 2005 and 2006, the highest densities were found in the field (3.44 larvae m-2 and 4.19 larvae m-2, respectively. The forage turnip, sampled in October 2004 and 2005, showed the lowest densities (0.03 larvae m-2 and 0.02 larvae m-2, respectively. In the crop succession systems, the following species were found: Liogenys fuscus Blanchard (highest amount, Liogenys bidenticeps Moser, Anomala testaceipennis Blanchard, Paranomala inconstans (Burmeister, Geniates borelli Camerano, Cyclocephala forsteri Endrodi, Cyclocephala verticalis Burmeister, and Phyllophaga sp. For the succession systems with maize sowed at the traditional season, the highest larval densities were found, specially favoring the development of L. fuscus, while the succession systems with soybean, maize, and under fallow, and soybean, crotalaria, and forage turnip, as well as the three systems with cotton-plant, did not favor it.

    KEY-WORDS: Zea mays; Glycine max; Raphanus sativus; soil pests; larvae density.Informações sobre Scarabaeidae fitófagos são ainda escassas para a região Centro-Oeste do Brasil. Por esta razão, na área experimental da Universidade Estadual do Mato Grosso do Sul, em Aquidauana (MS, foi semeada, de fevereiro de 2004 a outubro de 2005, a sucessão de culturas soja, milho e nabo forrageiro, onde se avaliou a dinâmica da densidade larval. De outubro de 2006 a maio

  2. Distribution of Lepidopteran Larvae on Norway Spruce: Effects of Slope and Crown Aspect.

    Science.gov (United States)

    Kulfan, Ján; Dvořáčková, Katarína; Zach, Peter; Parák, Michal; Svitok, Marek

    2016-04-01

    Lepidoptera associated with Norway spruce, Picea abies (L.) Karsten, play important roles in ecosystem processes, acting as plant pests, prey for predators, and hosts for parasites and parasitoids. Their distribution patterns in spruce crowns and forests are only poorly understood. We examined how slope and crown aspect affect the occurrence and abundance of moth larvae on solitary spruce trees in a montane region in Central Europe. Moth larvae were collected from southern and northern crowns of trees growing on south- and north-facing slopes (four treatments) using emergence boxes at the end of winter and by the beating method during the growing season. Species responses to slope and crown aspect were not uniform. Treatment effects on moth larvae were stronger in the winter than during the growing season. In winter, the abundance of bud-boring larvae was significantly higher in northern than in southern crowns regardless of the slope aspect, while both slope and aspect had marginally significant effects on abundance of miners. During the growing season, the occurrence of free-living larvae was similar among treatments. Emergence boxes and beating spruce branches are complementary techniques providing valuable insights into the assemblage structure of moth larvae on Norway spruce. Due to the uneven distribution of larvae detected in this study, we recommend adoption of a protocol that explicitly includes sampling of trees from contrasting slopes and branches from contrasting crown aspect in all seasons. © The Authors 2016. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  3. Seletividade de inseticidas utilizados em cultura cafeeira para larvas de Cryptolaemus montrouzieri Mulsant Selectivity of insecticides used in the coffee crop to larvae of Cryptolaemus montrouzieri Mulsant

    Directory of Open Access Journals (Sweden)

    Luiz Carlos Dias Rocha

    2011-06-01

    Full Text Available Assim como a maioria dos cultivos, em cafeeiro, a associação de inimigos naturais com produtos fitossanitários seletivos é uma importante estratégia no manejo integrado de pragas (MIP. Dessa forma, este estudo objetivou avaliar a seletividade de agrotóxicos utilizados na cultura cafeeira sobre larvas de Cryptolaemus montrouzieri Mulsant, 1853 (Coleoptera: Coccinellidae, em laboratório. Os bioensaios foram realizados em condições controladas (25±2°C, UR de 70±10% e fotofase de 12 horas. Cada bioensaio consistiu em seis tratamentos e dez repetições, sendo cada parcela composta por duas larvas. Para as comparações das médias dos tratamentos, empregou-se um esquema fatorial inteiramente ao acaso de produtos x número de instares para os diferentes instares subsequentes à aplicação. Os inseticidas utilizados e suas respectivas dosagens de aplicação, em g de i.a. L-1 foram: tiametoxam (0,5, imidacloprido (0,7, óleo mineral (13,3, endossulfam (2,63 e dimetoato (0,48. A testemunha foi composta apenas por água destilada. A aplicação dos produtos foi realizada por meio de torre de Potter. Avaliaram-se a sobrevivência dos espécimes após serem contaminados com os produtos e os efeitos dos compostos sobre os parâmetros reprodutivos do predador. Tiametoxam (0,5, imidacloprido (0,7 e endossulfam (2,63 foram os mais prejudiciais, tendo sido observados, para os dois primeiros, 100% de mortalidade de larvas de primeiro e de segundo instares um dia após a aplicação e significativa redução na sobrevivência das larvas de terceiro e quarto instares. Dimetoato (0,48 foi nocivo para larvas de primeiro instar e levemente nocivo para larvas de quarto instar. Em função da seletividade apresentada pelo óleo mineral (13,3, este pode ser recomendado em compatibilização com o predador C. montrouzieri em programas de MIP na cultura cafeeira, sem prejuízo ao desempenho do inimigo natural.As well as most of the crops, in coffee crop, the

  4. Behavioural responses of Acroneuria lycoria (Ins. Plecopt. ) Larvae to acute and chronic acid exposure

    Energy Technology Data Exchange (ETDEWEB)

    McNichol, R.E.; Scherer, E.

    1987-01-01

    This study was designed to investigate the responses of a perlid stonefly, Acroneuria lycorias (Newman), to acute and chronic acid exposure. Larvae of this species are common in streams and rivers impacted by acidic precipitation. It is also a suggested standard toxicity test species, which in previous studies has proven to be very sensitive to some toxicants. The effects of acute and chronic acid exposure on the locomotor activity, microdistribution, and drift behaviour of the stonefly larvae were studied in laboratory streams. When subjected to a reduction in pH from 8.1 to 2.5 over an 8-h period, larvae showed little behavioural response down to pH 4.2. As the pH fell to 3.0, head-rubbing activity appeared and increased in frequency. At pH 3.0 and below, larvae showed increased gill-ventilatory movements and locomotor activity. Most larvae died within 14 h of exposure to pH 2.5; however, they did not abandon their preferred refuges before death. Larvae exposed to 5 pH levels between 4.5 and 8.2 for 30-50 d displayed no significant changes in locomotor activity, drift behaviour or microdistribution when compared to control animals. Results indicate that later instar larvae of this species are relatively acid tolerant. 29 refs 4 figs 1 tab

  5. Polarized light sensitivity and orientation in coral reef fish post-larvae.

    Directory of Open Access Journals (Sweden)

    Igal Berenshtein

    Full Text Available Recent studies of the larvae of coral-reef fishes reveal that these tiny vertebrates possess remarkable swimming capabilities, as well as the ability to orient to olfactory, auditory, and visual cues. While navigation according to reef-generated chemicals and sounds can significantly affect dispersal, the effect is limited to the vicinity of the reef. Effective long-distance navigation requires at least one other capacity-the ability to maintain a bearing using, for example, a sun compass. Directional information in the sun's position can take the form of polarized-light related cues (i.e., e-vector orientation and percent polarization and/or non-polarized-light related cues (i.e., the direct image of the sun, and the brightness and spectral gradients. We examined the response to both types of cues using commercially-reared post-larvae of the spine-cheeked anemonefish Premnas biaculeatus. Initial optomotor trials indicated that the post-larval stages are sensitive to linearly polarized light. Swimming directionality was then tested using a Drifting In-Situ Chamber (DISC, which allowed us to examine the response of the post-larvae to natural variation in light conditions and to manipulated levels of light polarization. Under natural light conditions, 28 of 29 post-larvae showed significant directional swimming (Rayleigh's test p<0.05, R = 0.74±0.23, but to no particular direction. Swimming directionality was positively affected by sky clarity (absence of clouds and haze, which explained 38% of the observed variation. Moreover, post-larvae swimming under fully polarized light exhibited a distinct behavior of tracking the polarization axis, as it rotated along with the DISC. This behavior was not observed under partially-polarized illumination. We view these findings as an indication for the use of sun-related cues, and polarized light signal in specific, by orienting coral-reef fish larvae.

  6. Polarized light sensitivity and orientation in coral reef fish post-larvae.

    Science.gov (United States)

    Berenshtein, Igal; Kiflawi, Moshe; Shashar, Nadav; Wieler, Uri; Agiv, Haim; Paris, Claire B

    2014-01-01

    Recent studies of the larvae of coral-reef fishes reveal that these tiny vertebrates possess remarkable swimming capabilities, as well as the ability to orient to olfactory, auditory, and visual cues. While navigation according to reef-generated chemicals and sounds can significantly affect dispersal, the effect is limited to the vicinity of the reef. Effective long-distance navigation requires at least one other capacity-the ability to maintain a bearing using, for example, a sun compass. Directional information in the sun's position can take the form of polarized-light related cues (i.e., e-vector orientation and percent polarization) and/or non-polarized-light related cues (i.e., the direct image of the sun, and the brightness and spectral gradients). We examined the response to both types of cues using commercially-reared post-larvae of the spine-cheeked anemonefish Premnas biaculeatus. Initial optomotor trials indicated that the post-larval stages are sensitive to linearly polarized light. Swimming directionality was then tested using a Drifting In-Situ Chamber (DISC), which allowed us to examine the response of the post-larvae to natural variation in light conditions and to manipulated levels of light polarization. Under natural light conditions, 28 of 29 post-larvae showed significant directional swimming (Rayleigh's test p<0.05, R = 0.74±0.23), but to no particular direction. Swimming directionality was positively affected by sky clarity (absence of clouds and haze), which explained 38% of the observed variation. Moreover, post-larvae swimming under fully polarized light exhibited a distinct behavior of tracking the polarization axis, as it rotated along with the DISC. This behavior was not observed under partially-polarized illumination. We view these findings as an indication for the use of sun-related cues, and polarized light signal in specific, by orienting coral-reef fish larvae.

  7. An appraisal of certain larval behavioural activities as affected by gamma irradiation of Spodoptera larvae

    International Nuclear Information System (INIS)

    Seth, R.K.; Sehgal, S.S.

    1987-01-01

    Gamma irradiation of Spodoptera litura larvae induced an abatement in their locomotor activity. The food perception range and feeding behaviour of the larvae were also impaired. Of various dosages tested, 4 Krad (the sterilizing dose for larvae) caused a decline in locomotor speed. The first instar larvae, for instance showed decline in a speed of 3.74 cm/min to 2.96 cm/min. Similarly at this dose, the third instar larvae exhibited a reduction in speed to the extent of 38 to 45 per cent, the normal speed being 8.02 cm/min. The reactive distances of the first and third instar normal larvae were 5.30 cm and 7.36, respectively. This reactive distance was reduced by about 25 per cent after irradiation at 4 Krad, thus decreasing the food perception capacity significantly. The feeding behaviour too was significantly affected whereas the dose range less than 4 Krad did not induce such a marked impact. (author). 9 refs., 2 tables

  8. Elemental concentrations of aquatic insect larvae and attached algae on tone surfaces in an uncontaminated stream

    International Nuclear Information System (INIS)

    Momoshima, N.; Sugihara, S.; Hibino, K.; Nakamura, Y.

    2009-01-01

    Elemental concentrations of aquatic insect larvae and attached algae in an uncontaminated river were analyzed by instrumental neutron activation analysis (INAA) via the k 0 -standardization method. The aquatic insect larvae found were all intolerant species. No significant difference was observed int he elemental concentrations of aquatic insect larvae and attached algae long the river. Similar elemental concentrations were observed in the aquatic insect larvae collected at a fixed sampling point for two years. An analysis by the ratio-matching technique indicated a higher generic relationship between aquatic insect larvae and attached algae than river water. (author)

  9. Cockchafer larvae smell host root scents in soil.

    Directory of Open Access Journals (Sweden)

    Sonja Weissteiner

    Full Text Available In many insect species olfaction is a key sensory modality. However, examination of the chemical ecology of insects has focussed up to now on insects living above ground. Evidence for behavioral responses to chemical cues in the soil other than CO(2 is scarce and the role played by olfaction in the process of finding host roots below ground is not yet understood. The question of whether soil-dwelling beetle larvae can smell their host plant roots has been under debate, but proof is as yet lacking that olfactory perception of volatile compounds released by damaged host plants, as is known for insects living above ground, occurs. Here we show that soil-dwelling larvae of Melolontha hippocastani are well equipped for olfactory perception and respond electrophysiologically and behaviorally to volatiles released by damaged host-plant roots. An olfactory apparatus consisting of pore plates at the antennae and about 70 glomeruli as primary olfactory processing units indicates a highly developed olfactory system. Damage induced host plant volatiles released by oak roots such as eucalyptol and anisol are detected by larval antennae down to 5 ppbv in soil air and elicit directed movement of the larvae in natural soil towards the odor source. Our results demonstrate that plant-root volatiles are likely to be perceived by the larval olfactory system and to guide soil-dwelling white grubs through the dark below ground to their host plants. Thus, to find below-ground host plants cockchafer larvae employ mechanisms that are similar to those employed by the adult beetles flying above ground, despite strikingly different physicochemical conditions in the soil.

  10. Programa de computador para reconhecimento da larva de Aedes aegypti e Aedes albopictus

    OpenAIRE

    São Thiago, André Iwersen de; Kupek, Emil; Ferreira Neto, Joaquim Alves; São Thiago, Paulo de Tarso

    2002-01-01

    Software for pattern recognition of the larvae of mosquitoes Aedes aegypti and Aedes albopictus, biological vectors of dengue and yellow fever, has been developed. Rapid field identification of larva using a digital camera linked to a laptop computer equipped with this software may greatly help prevention campaigns.Foi desenvolvido um programa de computador para reconhecimento da larva de Aedes aegypti e Aedes albopictus, vetores biológicos de dengue e febre amarela. O programa possibilita rá...

  11. 60Co accumulation from sediment and planktonic algae by midge larvae (Chironomus luridus)

    International Nuclear Information System (INIS)

    Baudin, J.P.; Nucho, R.

    1992-01-01

    This paper reports the results of several experiments carried out to evaluate uptake and retention by a limicolous midge larva of 60 Co retained in sediment, either adsorbed on mineral particles or bound to planktonic algae. In order to determine their relative contributions in radionuclide accumulation, the different vectors (water, algae and sediment) were first labelled individually and then simultaneously. 60 Co accumulation from water and from algae results in a maximum concentration factor of 30 and in a mean trophic transfer factor of 4·5 × 10 −3 . The level of contamination of midge larvae from sediment is markedly influenced by the presence of endogenous organic matter. Thus the radionuclide transfer factor is about twice as high for larvae placed in labelled raw sediment than for larvae placed in labelled incinerated sediment, in the presence as in the absence of contaminated planktonic algae. Irrespective of the contamination conditions, 60 Co depuration from midge larvae is a very rapid phenomenon that corresponds, in all cases, to a radionuclide half-life of only a few days

  12. 60Co accumulation from sediment and planktonic algae by midge larvae (Chironomus luridus)

    International Nuclear Information System (INIS)

    Baudin, J.P.; Nucho, R.

    1992-01-01

    This paper reports the results of several experiments carried out to evaluate uptake and retention by a limicolous midge larva of 60 Co retained in sediment, either adsorbed on mineral particles or bound to planktonic algae. In order to determine their relative contributions in radionuclide accumulation, the different vectors (water, algae and sediment) were first labelled individually and then simultaneously. 60 Co accumulation from water and from algae results in a maximum concentration factor of 30 and in a mean trophic transfer factor of 4.5 x 10 -3 . The level of contamination of midge larvae from sediment is markedly influenced by the presence of endogenous organic matter. Thus the radionuclide transfer factor is about twice as high for larvae placed in labelled raw sediment than for larvae placed in labelled incinerated sediment, in the presence as in the absence of contaminated planktonic algae. Irrespective of the contamination conditions, 60 Co depuration from midge larvae is a very rapid phenomenon that corresponds, in all cases, to a radionuclide half-life of only a few days. (author)

  13. Impacts on silkworm larvae midgut proteomics by transgenic Trichoderma strain and analysis of glutathione S-transferase sigma 2 gene essential for anti-stress response of silkworm larvae.

    Science.gov (United States)

    Li, Yingying; Dou, Kai; Gao, Shigang; Sun, Jianan; Wang, Meng; Fu, Kehe; Yu, Chuanjin; Wu, Qiong; Li, Yaqian; Chen, Jie

    2015-08-03

    Lepidoptera is a large order of insects that have major impacts on humans as agriculture pests. The midgut is considered an important target for insect control. In the present study, 10 up-regulated, 18 down-regulated, and one newly emerged protein were identified in the transgenic Trichoderma-treated midgut proteome. Proteins related to stress response, biosynthetic process, and metabolism process were further characterized through quantitative real-time PCR (qPCR). Of all the identified proteins, the glutathione S-transferase sigma 2 (GSTs2) gene displayed enhanced expression when larvae were fed with Trichoderma wild-type or transgenic strains. Down regulation of GSTs2 expression by RNA interference (RNAi) resulted in inhibition of silkworm growth when larvae were fed with mulberry leaves treated with the transgenic Trichoderma strain. Weight per larva decreased by 18.2%, 11.9%, and 10.7% in the untreated control, ddH2O, and GFP dsRNA groups, respectively, at 24h, while the weight decrease was higher at 42.4%, 28.8% and 32.4% at 72 h after treatment. Expression of glutathione S-transferase omega 2 (GSTo2) was also enhanced when larvae were fed with mulberry leaves treated with the transgenic Trichoderma strain. These results indicated that there was indeed correlation between enhanced expression of GSTs2 and the anti-stress response of silkworm larvae against Trichoderma. This study represents the first attempt at understanding the effects of transgenic organisms on the midgut proteomic changes in silkworm larvae. Our findings could not only broaden the biological control targets of insect at the molecular level, but also provide a theoretical foundation for biological safety evaluation of the transgenic Trichoderma strain. Copyright © 2015 Elsevier B.V. All rights reserved.

  14. First record of larvae of the water mite Hydrachna processifera Piersig, 1895 from Turkey (Acari, Hydrachnidia, Hydrachnidae

    Directory of Open Access Journals (Sweden)

    Medeni Aykut

    2018-02-01

    Full Text Available Larvae of water mite Hydrachna processifera Piersig, 1895 (Acari, Hydrachnidiae were reported on diving beetles Dytiscus marginalis Linnaeus, 1758 (Coleoptera, Dytiscidae from Turkey. The redescription of the larva was made. Earlier, the larva H. processifera was described as H. inermis, but it was subsequently synonymized with H. processifera. The larva of H. processifera is a new record for the Turkish fauna. All larvae of H. processifera were found on the mesosternum of the one specimens (prevalence = 16.7%.

  15. Reef odor: a wake up call for navigation in reef fish larvae.

    Directory of Open Access Journals (Sweden)

    Claire B Paris

    Full Text Available The behavior of reef fish larvae, equipped with a complex toolbox of sensory apparatus, has become a central issue in understanding their transport in the ocean. In this study pelagic reef fish larvae were monitored using an unmanned open-ocean tracking device, the drifting in-situ chamber (DISC, deployed sequentially in oceanic waters and in reef-born odor plumes propagating offshore with the ebb flow. A total of 83 larvae of two taxonomic groups of the families Pomacentridae and Apogonidae were observed in the two water masses around One Tree Island, southern Great Barrier Reef. The study provides the first in-situ evidence that pelagic reef fish larvae discriminate reef odor and respond by changing their swimming speed and direction. It concludes that reef fish larvae smell the presence of coral reefs from several kilometers offshore and this odor is a primary component of their navigational system and activates other directional sensory cues. The two families expressed differences in their response that could be adapted to maintain a position close to the reef. In particular, damselfish larvae embedded in the odor plume detected the location of the reef crest and swam westward and parallel to shore on both sides of the island. This study underlines the critical importance of in situ Lagrangian observations to provide unique information on larval fish behavioral decisions. From an ecological perspective the central role of olfactory signals in marine population connectivity raises concerns about the effects of pollution and acidification of oceans, which can alter chemical cues and olfactory responses.

  16. Metamorfosis del aparato digestivo de larvas carnívoras de Ceratophrys cranwelli (Anura: Leptodactylidae

    Directory of Open Access Journals (Sweden)

    Ulloa Kreisel, Zandra E.

    2000-12-01

    Full Text Available Las larvas carnívoras de Ceratophrys cranwelli presentan un tubo digestivo más corto que la mayoría de las larvas de anuros, tiene 6 veces la longitud del cuerpo del renacuajo y se caracteriza también por tener un estómago larval. El presente trabajo tiene como objetivo el determinar el grado de transformaciones en la cavidad bucofaríngea y tubo digestivo en larvas de esta especie durante la metamorfosis y comparar las estructuras digestivas estudiadas en otras especies de Leptodactylidae de la subfamilia Ceratophryinae y especies con otros hábitos alimenticios. Carnivorous larvae from Ceratophrys cranwelli present a digestive tube shorter than most of the anuran larvae, have 6 times a tadpole’s body length and they are also characterized by the presence of a larval stomach. The aim of this work is determine the grade of transformations in the buccopharyngeal cavity and digestive tube during the metamorphosis in larvae of this species and compare the digestive structures studied in other species of Leptodactylidae of the subfamily Ceratophryinae and another species with different diets.

  17. Fine structure of selected mouthpart sensory organs of gypsy moth larvae

    Science.gov (United States)

    Vonnie D.C. Shields

    2011-01-01

    Gypsy moth larvae, Lymantria dispar (L.), are major pest defoliators in most of the United States and destroy millions of acres of trees annually. They are highly polyphagous and display a wide host plant preference, feeding on the foliage of hundreds of plants, such as oak, maple, and sweet gum. Lepidopteran larvae, such as the gypsy moth, depend...

  18. Symbiotic Bacteria Enable Olive Fly Larvae to Overcome Host Defenses

    International Nuclear Information System (INIS)

    Ben-Yosef, Michael; Yuval, Boaz; Pasternak, Zohar; Jurkevitch, Edouard

    2016-01-01

    Ripe fruit offer readily available nutrients for many animals, including fruit fly larvae (Diptera: Tephritidae) and their associated rot-inducing bacteria. Yet, during most of their ontogeny, fruit remain chemically defended and effectively suppress herbivores and pathogens by high levels of secondary metabolites. Olive flies (Bactrocera oleae) are uniquely able to develop in unripe olives. Unlike other frugivorous tephritids, the larvae maintain bacteria confined within their midgut caeca. We examined the interaction between larvae, their associated bacteria, and fruit chemical defence, hypothesizing that bacterial contribution to larval development is contingent on the phenology of fruit defensive chemistry. We demonstrate that larvae require their natural complement of bacteria (Candidatus Erwinia dacicola: Enterobacteriaceae) in order to develop in unripe olives. Conversely, when feeding on ripe fruit, larval development proceeds independently of these bacteria. Our experiments suggest that bacteria counteract the inhibitory effect of oleuropein—the principal phenolic glycoside in unripe olives. In light of these results, we suggest that the unique symbiosis in olive flies, compared with other frugivorous tephritids, is understood by considering the relationship between the fly, bacteria and fruit chemistry. When applied in an evolutionary context, this approach may also point out the forces which shaped symbioses across the Tephritidae. (author)

  19. Density, Viability Conidia And Symptoms of Metarhizium anisopliae infection on Oryctes rhinoceros larvae

    Science.gov (United States)

    Indriyanti, D. R.; Putri, R. I. P.; Widiyaningrum, P.; Herlina, L.

    2017-04-01

    M. anisopliae is parasitic fungus on insect pests; it is used as a biocontrol agent. M. anisopliae can be propagated on maize or rice substrate. M. anisopliae is currently sold in the form of kaolin powder formulations. Before it is used to check the density, viability and pathogenicity of M. anisopliae. However the problem is the kaolin powder very soft, so it difficult to distinguish between kaolin and conidia. This article gives information on how to calculate conidia density, viability and symptoms of M. anisopliae infection on Oryctes rhinoceros larvae. The study was conducted in the laboratory to determine the density and viability. The pathogenicity testing was done using pots. The Pot is containing soil substrate mixed with M. Anispoliae and ten tails O. Rhinoceros larvae per pot. The results showed that the density of M. anisopliae conidia was 1.81 x 108 conidia mL-1 and the viability was 94% within 24 hours. The larval mortality began to emerge in the 1st week, and all larvae died at the sixth week. The symptom of M. anisopliae infection on Oryctes rhinoceros larvae, there was a black spot on the larval integument. The larvae movements become slow and poor appetite; it will die within 3-7 days. The larvae die hard, and the white hyphae grow on the body surface that turns green.

  20. Residual Effect of Pesticides used in Integrated Apple Production on Chrysoperlaexterna (Hagen (Neuroptera: Chrysopidae Larvae Efecto Residual de los Pesticidas utilizados en la Producción integrada de Manzanas en las Larvas de Chrysoperla externa (Hagen (Neuroptera: Chrysopidae

    Directory of Open Access Journals (Sweden)

    Alexandre P Moura

    2012-06-01

    Full Text Available Temperate fruit crops are an important economic activity for growers in southern Brazil. However, several pest species are associated to apple (Malus domestica Borkh. crops in Brazil. Pesticides are largely used to control them and one way to change this is to combine selective pesticides and predator insects. The goal of this research was to evaluate the effects of the abamectin, carbaryl, fenitrothion, methidathion, sulfur, and trichlorfon pesticides on the survival and stage length of larvae and pupae, adult oviposition from treated larvae, and hatched eggs of two Chrysoperla externa (Hagen, 1861 (Neuroptera: Chrysopidae populations. The compounds were sprayed on glass plates in accordance with the International Organization for Biological Control (IOBC recommendations. First- and second-instar larvae were exposed to pesticide residues. Carbaryl, fenitrothion, and methidathion caused 100% mortality of first- and second-instar larvae. Changes in the number of eggs laid by females from first- and second-instar larvae exposed to residues of abamectin and sulfur, or abamectin, sulfur, and trichlorfon, respectively, were not observed. Only abamectin reduced the number of hatched eggs laid by females in Bento Gonçalves from treated first-instar larvae. Sulfur reduced the viability of C. externa eggs in Bento Gonçalves and Vacaria females from treated second-instar larvae, whereas trichlorfon and abamectin reduced the viability of eggs in Vacaria females. In conclusion, carbaryl, fenitrothion and methidathion were harmful to C. externa. Trichlorfon was harmful to first-instar larvae and slightly harmful to second-instar larvae. Abamectin and sulfur were slightly harmful to first-instar larvae and harmless to second-instar larvae.El cultivo de frutas de clima templado es una actividad económica importante para agricultores del Sur de Brasil. Sin embargo, varias especies de plagas están asociadas al cultivo de la manzana (Malus domestica Borkh. en

  1. Biological control of Anopheles darlingi, Aedes aegypti and Culex quinquefasciatus larvae using shrimps

    Directory of Open Access Journals (Sweden)

    Willian Marinho Dourado Coelho

    2017-08-01

    Full Text Available Mosquitoes can act as vectors of important diseases such as malaria, dengue, Zika virus, yellow fever, Chikungunya and Mayaro fever, in addition to filariasis. The use of insecticides, larvicides, bed nets and repellents, besides the use of drugs as chemoprevention and the treatment of the sick are currently the pillars of the control of these vectors. We studied the biological control against of Anopheles darlingi, Aedes aegypti and Culex quinquefasciatus larvae using shrimps of the species M. pantanalense, M. amazonicum, M. brasiliense and M. jelskii. Larvae of mosquitoes were collected from the breeding environment and placed in a 500 and 1000 l tank containing 60 shrimps/m2. The predatory activity was evaluated for 30 days and, in all groups it was observed that 100% of the larvae were consumed in few minutes. In the environment, these same species of crustaceans were released in water bodies with the presence of larvae of these insects. In just 72 h there was a marked reduction of the larvae in the release sites of shrimps. Similarly, there was a reduction in the number of adult mosquitoes caught near the breeding sites, allowing to infer that, in places where the crustaceans were released, the predatory activity on the larvae of mosquitoes was sufficient to reduce the number of adult mosquitoes p ≤ 0,05. This is the first description of the predatory activity of M. pantanalense, M. amazonicum, M. brasiliense and M. jelskii on An. darlingi, A. aegypti and C. quinquefasciatus larvae, constituting an important tool of biological control of these parasites-vectors.

  2. Influence of irradiation on development of Caribbean fruit fly (diptera: tephritidae) larvae

    International Nuclear Information System (INIS)

    Nation, J.L.; Milne, K.; Dykstra, T.M.

    1995-01-01

    Larvae of the Caribbean fruit fly, Anastrepha suspensa (Loew), were irradiated at hatching with 0, 5, 10, 20, 50, 75, 100 and 150 Gy doses from a Cesium-137 source and dissected for measurements of the supraesophageal ganglion (brain) and proventriculus (B/Prv) as mature third instars. Cross-sectional area of a plane through the brain and proventriculus, and simple dorsal width measurements of the two organs were evaluated as indicators of radiation exposure. Brain area, brain width, and brain/proventriculus (B/Prv) ratios were significantly different from controls in insects treated with a dose ≥20 Gy. Detailed dissections of hatching larvae exposed to 50 Gy revealed reductions in brain growth, small and misshapen compound eye and leg imaginal disks, and a ventral nerve cord that was elongated and sinuous. Larvae irradiated on the 1st d of each of the three instars had smaller brains, with the percentage of reduction in brain size being greater the younger the larvae were at the time of exposure. Brain and proventriculus measurements and calculated B/Prv values are indicative of irradiation in Caribbean fruit fly larvae, but the procedure may not be adaptable for routine use by quarantine inspectors. 14 refs., 4 figs., 2 tabs

  3. Monograph On Bothid Larvae (Pleuronectiformes - Pisces)

    Digital Repository Service at National Institute of Oceanography (India)

    Devi, C.B.L.

    in the preparation of a descriptive document on the larvae of flat fishes from the Indian Ocean. However, study of the larval forms from the Indian Ocean has been made possible due to the availability of material from the Naga Expedition (1959-61) from the Gulf...

  4. Highly polygenic variation in environmental perception determines dauer larvae formation in growing populations of Caenorhabditis elegans.

    Directory of Open Access Journals (Sweden)

    James W M Green

    Full Text Available Determining how complex traits are genetically controlled is a requirement if we are to predict how they evolve and how they might respond to selection. This requires understanding how distinct, and often more simple, life history traits interact and change in response to environmental conditions. In order to begin addressing such issues, we have been analyzing the formation of the developmentally arrested dauer larvae of Caenorhabditis elegans under different conditions.We find that 18 of 22 previously identified quantitative trait loci (QTLs affecting dauer larvae formation in growing populations, assayed by determining the number of dauer larvae present at food patch exhaustion, can be recovered under various environmental conditions. We also show that food patch size affects both the ability to detect QTLs and estimates of effect size, and demonstrate that an allele of nath-10 affects dauer larvae formation in growing populations. To investigate the component traits that affect dauer larvae formation in growing populations we map, using the same introgression lines, QTLs that affect dauer larvae formation in response to defined amounts of pheromone. This identifies 36 QTLs, again demonstrating the highly polygenic nature of the genetic variation underlying dauer larvae formation.These data indicate that QTLs affecting the number of dauer larvae at food exhaustion in growing populations of C. elegans are highly reproducible, and that nearly all can be explained by variation affecting dauer larvae formation in response to defined amounts of pheromone. This suggests that most variation in dauer larvae formation in growing populations is a consequence of variation in the perception of the food and pheromone environment (i.e. chemosensory variation and in the integration of these cues.

  5. The hatching larva of the priapulid worm Halicryptus spinulosus.

    Science.gov (United States)

    Janssen, Ralf; Wennberg, Sofia A; Budd, Graham E

    2009-05-26

    Despite their increasing evolutionary importance, basic knowledge about the priapulid worms remains limited. In particular, priapulid development has only been partially documented. Following previous description of hatching and the earliest larval stages of Priapulus caudatus, we here describe the hatching larva of Halicryptus spinulosus. Comparison of the P. caudatus and the H. spinulosus hatching larvae allows us to attempt to reconstruct the ground pattern of priapulid development. These findings may further help unravelling the phylogenetic position of the Priapulida within the Scalidophora and hence contribute to the elucidation of the nature of the ecdysozoan ancestor.

  6. Cutaneous larva migrans after a trip to the Caribean

    OpenAIRE

    García-Fernández, Lisset; Calderón, María

    2014-01-01

    La larva migrans cutánea es una parasitosis ocasionada por las larvas de Ancylostoma braziliense y Ancylostoma caninum, cuyo vehículo es la arena de playas infestadas. Los perros y gatos son los hospederos definitivos. Esta parasitosis es endémica en las costas del Caribe, África, Australia y Asia. Presentamos el caso clínico de una mujer de 27 años de edad, quien tras haber realizado un viaje al Caribe mexicano y haber estado en contacto con arena de playa, presentó unas lesiones en el pie d...

  7. Development of digestive enzymes in larvae of Mayancichlid Cichlasoma urophthalmus

    OpenAIRE

    López Ramírez, G.; Cuenca Soria, C.A.; Álvarez González, C.A.; Tovar Ramírez, D.; Ortiz Galindo, José Luis; Perales García, N.; Márquez Couturier, G.; Arias Rodríguez, L.; Indy, J.R.; Contreras Sánchez, W.M.; Gisbert, E.; Moyano, F.J.

    2011-01-01

    The development of digestive enzymes during the early ontogeny of the Mayan cichlid (Cichlasoma urophthalmus) was studied using biochemical and electrophoretic techniques. From yolk absorption (6 days after hatching: dah), larvae were fed Artemia nauplii until 15 dah, afterward they were fed with commercial microparticulated trout food (45% protein and 16% lipids) from 16 to 60 dah. Several samples were collected including yolk-sac larvae (considered as day 1 after hatching) and specimens up ...

  8. Luminous vibriosis in rock lobster Jasus verreauxi (Decapoda: Palinuridae) phyllosoma larvae associated with infection by Vibrio harveyi.

    Science.gov (United States)

    Diggles, B K; Moss, G A; Carson, J; Anderson, C D

    2000-11-14

    Studies were conducted to determine the cause of outbreaks of luminous vibriosis in phyllosoma larvae of the packhorse rock lobster Jasus verreauxi reared in an experimental culture facility. On 2 separate occasions mortalities of up to 75% over a period of 4 wk were observed in 4th to 5th and 8th to 10th instar phyllosomas at water temperatures of 20 and 23 degrees C, respectively. Affected larvae became opaque, exhibited small red spots throughout the body and pereiopods, and were faintly luminous when viewed in the dark. Histopathology showed that the gut and hepatopancreas tubules of moribund phyllosomas contained massive bacterial plaques. The hepatopancreas tubules of moribund larvae were atrophic and some contained necrotic cells sloughed into the lumen. Dense, pure cultures of a bacterium identified as Vibrio harveyi were isolated from moribund larvae. The disease syndrome was reproduced by in vivo challenge and V. harveyi was successfully reisolated from diseased larvae after apparently healthy larvae were exposed by immersion to baths of more than 10(4) V. harveyi ml(-1) at 24 degrees C. Injured larvae were more susceptible to infection than were healthy larvae. Survival of larvae experimentally and naturally exposed to V. harveyi was improved when antibiotics were administered via bath exposures.

  9. Morfologia do trato digestório e dieta de larvas de Bryconamericus aff. iheringii (Boulenger, 1887 (Osteichthyes, Characidae = Morphology of Digestive tract and diet of Bryconamericus aff. iheringii larvae (Boulenger, 1887 (Osteichthyes, Characidae

    Directory of Open Access Journals (Sweden)

    Renato Ziliani Borges

    2006-01-01

    Full Text Available Este trabalho teve como objetivo analisar alguns aspectos da alimentação de larvas de Bryconamericus aff. iheringii, capturadas nos meses de julho e novembro de 2001, nas regiões limnética e litorânea do reservatório de Santa Maria, rio Piquiri, Estado do Paraná. As larvas apresentaram boca subterminal durante todo o seu desenvolvimento. O tubo digestório se diferenciou em estômago e intestino apenas no estágio de pós-flexão. As larvas consumiram, principalmente, algas e microcrustáceos, o que permitiu caracterizá-las como planctófagas. A intensa modificação morfológica no trato digestório nos indivíduos em pósflexão coincidiu com o aumento na abundância de algas em relação aos itens de origemanimal; porém, de forma geral, a ocorrência aumentou para todos os itens. A análise do grau de digestão dos itens alimentares sugeriu que indivíduos em pré-flexão alimentaram-se, possivelmente, durante o dia, e os mais desenvolvidos, durante o entardecer e no períodonoturno.The aim of this study was to analyze some feeding treats of Bryconamericus aff. iheringii larvae, sampled in both the limnetic and littoral regions of the Piquiri River, in Santa Maria reservoir, between July and November 2001. The larvae presented sub-terminal mouth in larval period. The digestive tract differentiated in terms of stomach and intestine only in the postflexion larvae. The larvae fed mainly on algae and microcrustacea allowing to characterize them as planktivorous. The intense morphologic shift in the digestive tract in the postflexion larvae coincided with an increase in the abundance of algae in relation to animals items; however, in general, all the items had their occurrence increased. Analysis of the digestion stage suggested that preflexion larvae, possibly, fed themselves during the day, and those more developed, at dusk and night.

  10. Occurrence of viral pathogens in Penaeus monodon post-larvae from aquaculture hatcheries

    Directory of Open Access Journals (Sweden)

    Toms C. Joseph

    2015-09-01

    Full Text Available Viral pathogens appear to exert the most significant constraints on the growth and survival of crustaceans under culture conditions. The prevalence of viral pathogens White Spot Syndrome Virus (WSSV, Hepatopancreatic Parvo Virus (HPV, Monodon Baculo Virus (MBV and Infectious Hypodermal and Hematopoietic Necrosis Virus (IHHNV in Penaeus monodon post-larvae was studied. Samples collected from different hatcheries and also samples submitted by farmers from Kerala were analyzed. Out of 104 samples collected, WSSV was detected in 12.5% of the post-larvae samples. Prevalence of concurrent infections by HPV, MBV and WSSV (either dual or triple infection was present in 60.6% of the total post-larvae tested. Out of the 51 double positives, 98% showed either HPV or IHHNV infection. HPV or IHHNV was detected in 11 post-larval samples showing triple viral infection. This is the first report of IHHNV from India. Result of this study reveals the lack of efficient screening strategies to eradicate viruses in hatchery reared post-larvae.

  11. Diphyllobothrium latum in Italy: plerocercoids larvae distribution in perch (Perca fluviatilis fillets

    Directory of Open Access Journals (Sweden)

    MariaLetizia Fioravanti

    2013-04-01

    Full Text Available Following the diffusion of new eating habits (consumption of uncooked, undercooked, marinated or cold-smoked fish, some cases of parasitic zoonosis from freshwater fish are recently reappeared in Italy. One of these is tapeworm Diphyllobothrium latum, whose final host could be human. This study aimed to individuate the position of plerocercoid larvae inside perch fillets (Perca fluviatilis caught in 4 different sites on Como lake in 2011. The fish analyzed were 390. The larvae totally isolated from 112 positive fishes were 164: 85 found in the right fillets and 79 in left ones. According to dorso-ventral disposition in fish, 144 larvae were individuated in dorsal muscles and 20 in ventral ones. Data collected confirm that plerocercoid larvae prefer the upper mass of perch muscle. Dietary education and sanitary care on fish supply are necessary to prevent the diffusion of tapeworm zoonosis in high-risk zones. European legislation establishes freezing to sanitize fish to be eaten raw, marinated or cold-smoked.

  12. Proteome response of Tribolium castaneum larvae to Bacillus thuringiensis toxin producing strains.

    Directory of Open Access Journals (Sweden)

    Estefanía Contreras

    Full Text Available Susceptibility of Tribolium castaneum (Tc larvae was determined against spore-crystal mixtures of five coleopteran specific and one lepidopteran specific Bacillus thuringiensis Cry toxin producing strains and those containing the structurally unrelated Cry3Ba and Cry23Aa/Cry37Aa proteins were found toxic (LC(50 values 13.53 and 6.30 µg spore-crystal mixture/µL flour disc, respectively. Using iTRAQ combined with LC-MS/MS allowed the discovery of seven novel differentially expressed proteins in early response of Tc larvae to the two active spore-crystal mixtures. Proteins showing a statistically significant change in treated larvae compared to non-intoxicated larvae fell into two major categories; up-regulated proteins were involved in host defense (odorant binding protein C12, apolipophorin-III and chemosensory protein 18 and down-regulated proteins were linked to metabolic pathways affecting larval metabolism and development (pyruvate dehydrogenase Eα subunit, cuticular protein, ribosomal protein L13a and apolipoprotein LI-II. Among increased proteins, Odorant binding protein C12 showed the highest change, 4-fold increase in both toxin treatments. The protein displayed amino acid sequence and structural homology to Tenebrio molitor 12 kDa hemolymph protein b precursor, a non-olfactory odorant binding protein. Analysis of mRNA expression and mortality assays in Odorant binding protein C12 silenced larvae were consistent with a general immune defense function of non-olfactory odorant binding proteins. Regarding down-regulated proteins, at the transcriptional level, pyruvate dehydrogenase and cuticular genes were decreased in Tc larvae exposed to the Cry3Ba producing strain compared to the Cry23Aa/Cry37Aa producing strain, which may contribute to the developmental arrest that we observed with larvae fed the Cry3Ba producing strain. Results demonstrated a distinct host transcriptional regulation depending upon the Cry toxin treatment. Knowledge

  13. Maggot Instructor: Semi-Automated Analysis of Learning and Memory in Drosophila Larvae

    Directory of Open Access Journals (Sweden)

    Urte Tomasiunaite

    2018-06-01

    Full Text Available For several decades, Drosophila has been widely used as a suitable model organism to study the fundamental processes of associative olfactory learning and memory. More recently, this condition also became true for the Drosophila larva, which has become a focus for learning and memory studies based on a number of technical advances in the field of anatomical, molecular, and neuronal analyses. The ongoing efforts should be mentioned to reconstruct the complete connectome of the larval brain featuring a total of about 10,000 neurons and the development of neurogenic tools that allow individual manipulation of each neuron. By contrast, standardized behavioral assays that are commonly used to analyze learning and memory in Drosophila larvae exhibit no such technical development. Most commonly, a simple assay with Petri dishes and odor containers is used; in this method, the animals must be manually transferred in several steps. The behavioral approach is therefore labor-intensive and limits the capacity to conduct large-scale genetic screenings in small laboratories. To circumvent these limitations, we introduce a training device called the Maggot Instructor. This device allows automatic training up to 10 groups of larvae in parallel. To achieve such goal, we used fully automated, computer-controlled optogenetic activation of single olfactory neurons in combination with the application of electric shocks. We showed that Drosophila larvae trained with the Maggot Instructor establish an odor-specific memory, which is independent of handling and non-associative effects. The Maggot Instructor will allow to investigate the large collections of genetically modified larvae in a short period and with minimal human resources. Therefore, the Maggot Instructor should be able to help extensive behavioral experiments in Drosophila larvae to keep up with the current technical advancements. In the longer term, this condition will lead to a better understanding of

  14. Responses of the metabolism of the larvae of Pocillopora damicornis to ocean acidification and warming.

    Directory of Open Access Journals (Sweden)

    Emily B Rivest

    Full Text Available Ocean acidification and warming are expected to threaten the persistence of tropical coral reef ecosystems. As coral reefs face multiple stressors, the distribution and abundance of corals will depend on the successful dispersal and settlement of coral larvae under changing environmental conditions. To explore this scenario, we used metabolic rate, at holobiont and molecular levels, as an index for assessing the physiological plasticity of Pocillopora damicornis larvae from this site to conditions of ocean acidity and warming. Larvae were incubated for 6 hours in seawater containing combinations of CO2 concentration (450 and 950 µatm and temperature (28 and 30°C. Rates of larval oxygen consumption were higher at elevated temperatures. In contrast, high CO2 levels elicited depressed metabolic rates, especially for larvae released later in the spawning period. Rates of citrate synthase, a rate-limiting enzyme in aerobic metabolism, suggested a biochemical limit for increasing oxidative capacity in coral larvae in a warming, acidifying ocean. Biological responses were also compared between larvae released from adult colonies on the same day (cohorts. The metabolic physiology of Pocillopora damicornis larvae varied significantly by day of release. Additionally, we used environmental data collected on a reef in Moorea, French Polynesia to provide information about what adult corals and larvae may currently experience in the field. An autonomous pH sensor provided a continuous time series of pH on the natal fringing reef. In February/March, 2011, pH values averaged 8.075 ± 0.023. Our results suggest that without adaptation or acclimatization, only a portion of naïve Pocillopora damicornis larvae may have suitable metabolic phenotypes for maintaining function and fitness in an end-of-the century ocean.

  15. Natural variation in gene expression in the early development of dauer larvae of Caenorhabditis elegans

    Directory of Open Access Journals (Sweden)

    Barker Gary LA

    2009-07-01

    Full Text Available Abstract Background The free-living nematode Caenorhabditis elegans makes a developmental decision based on environmental conditions: larvae either arrest as dauer larva, or continue development into reproductive adults. There is natural variation among C. elegans lines in the sensitivity of this decision to environmental conditions; that is, there is variation in the phenotypic plasticity of dauer larva development. We hypothesised that these differences may be transcriptionally controlled in early stage larvae. We investigated this by microarray analysis of different C. elegans lines under different environmental conditions, specifically the presence and absence of dauer larva-inducing pheromone. Results There were substantial transcriptional differences between four C. elegans lines under the same environmental conditions. The expression of approximately 2,000 genes differed between genetically different lines, with each line showing a largely line-specific transcriptional profile. The expression of genes that are markers of larval moulting suggested that the lines may be developing at different rates. The expression of a total of 89 genes was putatively affected by dauer larva or non-dauer larva-inducing conditions. Among the upstream regions of these genes there was an over-representation of DAF-16-binding motifs. Conclusion Under the same environmental conditions genetically different lines of C. elegans had substantial transcriptional differences. This variation may be due to differences in the developmental rates of the lines. Different environmental conditions had a rather smaller effect on transcription. The preponderance of DAF-16-binding motifs upstream of these genes was consistent with these genes playing a key role in the decision between development into dauer or into non-dauer larvae. There was little overlap between the genes whose expression was affected by environmental conditions and previously identified loci involved in

  16. Color variability and body size of larvae of two Epomis species (Coleoptera: Carabidae in Israel

    Directory of Open Access Journals (Sweden)

    Gil Wizen

    2011-07-01

    Full Text Available Species identification using the characteristics of developmental stages is challenging. However, for insect taxonomy the coloration of larval stages can be an informative feature. The use of live specimens is recommended for this because the color fades in preserved specimens. In this study we examine the possibility of using variation in coloration and color pattern of larvae in order to distinguish between two ground beetles species Epomis dejeani Dejean, 1831 and E. circumscriptus Duftschmid, 1812. We present an atlas and describe the coloration and body size of the three larval stages of the above species based on live specimens. The first instar larvae of the two Epomis species can be easily distinguished based on their color. From the second instar on, the variability in coloration and color patterns increases, creating an overlap in these attributes between larvae of the two species. Except for minor differences in color of the antennae and the base of the mandibles, larvae of the two species are indistinguishable at the second and third larval stages. To the best of our knowledge this is the first attempt to use variation in coloration and color pattern in live larvae in order to identify coleopterans. The color atlas of the larvae enables simple separation of the two Epomis species without requiring sophisticated magnifying devices, although it is less straightforward at the second and third larval stages. We found similar body lengths between the two species for all developmental stages, except for third instar larvae prior to pupation. In the two species the difference in larval body length before pupation positively correlated with that of the adult beetles. More than 70% of the adults' length can be explained by the length of the late third-instar larva; i.e. the large larvae develop into large adults. The larger specimens are the females.

  17. Performances of local poultry breed fed black soldier fly larvae reared on horse manure

    Directory of Open Access Journals (Sweden)

    Nassim Moula

    2018-03-01

    Full Text Available In poultry, feed based on maggots, like larvae of black soldier fly (Hermetia illucens is an attractive option to substitute current ingredients which are expensive and often in direct or indirect competition with human food. Little information is currently available on the utility of these larvae in poultry feed, so goals of this study were to determine whether larvae could be reared on horse manure under traditional farming conditions and to evaluate the growth performances of a local poultry fed these larvae and the fatty acids profiles of their meat. After freezing and thawing, larvae were introduced in the feed of Ardennaise chickens between 30 and 80 days of age. Birds in the control group received a commercial standard feed, while those in the treatment group received the same commercial feed in which 8% was substituted with whole fresh larvae corresponding to 2% on a dry matter basis. Means ± standard errors of larval length and weight were 20.67 ± 2.21 mm and 0.14 ± 0.02 g, respectively. Mean larval percentages of dry matter and of substances extractable in diethyl ether were 24.6% and 23.1%, respectively. Larval fatty acids profiles were predominantly composed of lauric acid (28.1% and palmitic acid (22.0%. Least squares means of weekly weights of chicken, adjusted for the effects of sex, replication and initial weights, were significantly higher (P < 0.05 by 77.03 ± 53.37 g in larvae-fed than in control chickens. All other measurements were not statistically different between larvae-fed and control chicken, including fatty acid profiles, protein content and ω6/ω3 ratio. Keywords: Insect farming, Chicken, Local breed, Growth performance, Meat quality, Fatty acid profile

  18. Comparison of two techniques used for the recovery of third-stage strongylid nematode larvae from herbage.

    Science.gov (United States)

    Krecek, R C; Maingi, N

    2004-07-14

    A laboratory trial to determine the efficacy of two methods in recovering known numbers of third-stage (L3) strongylid nematode larvae from herbage was carried out. Herbage samples consisting almost entirely of star grass (Cynodon aethiopicus) that had no L3 nematode parasitic larvae were collected at Onderstepoort, South Africa. Two hundred grams samples were placed in fibreglass fly gauze bags and seeded with third-stage strongylid nematode larvae at 11 different levels of herbage infectivity ranging from 50 to 8000 L3/kg. Eight replicates were prepared for each of the 11 levels of herbage infectivity. Four of these were processed using a modified automatic Speed Queen heavy-duty washing machine at a regular normal cycle, followed by isolation of larvae through centrifugation-flotation in saturated sugar solution. Larvae in the other four samples were recovered after soaking the herbage in water overnight and the larvae isolated with the Baermann technique of the washing. There was a strong correlation between the number of larvae recovered using both methods and the number of larvae in the seeded samples, indicating that the two methods give a good indication of changes in the numbers of larvae on pasture if applied in epidemiological studies. The washing machine method recovered higher numbers of larvae than the soaking and Baermann method at all levels of pasture seeding, probably because the machine washed the samples more thoroughly and a sugar centrifugation-flotation step was used. Larval suspensions obtained using the washing machine method were therefore cleaner and thus easier to examine under the microscope. In contrast, the soaking and Baermann method may be more suitable in field-work, especially in places where resources and equipment are scarce, as it is less costly in equipment and less labour intensive. Neither method recovered all the larvae from the seeded samples. The recovery rates for the washing machine method ranged from 18 to 41% while

  19. Hubungan keberadaan larva nyamuk Aedes Spp dengan kasus Demam Berdarah Dengue di Kota Bandung

    Directory of Open Access Journals (Sweden)

    Lukman Hakim

    2015-12-01

    Full Text Available Abstract. Bandung is the region with most cases of dengue hemorrhagic fever (DHF in West Java with 24,491 cases in the period 2009-2013. Dengue virus transmission occurs from DHF patients through the bite of Aedes aegypti and Ae. albopictus as the primary vector, while Ae. polynesiensis, Ae. scutellaris and Ae. (Finlayaniveus as secondary vectors. To determine the relationship of the presence of larvae of Aedes spp with DHF, has conducted research with larval survey and analysis of dengue cases in the city of Bandung. Research was carried out by recording DHF patients in the period 2011-2013, then visit to interview and survey of Aedes mosquito larvae in water containers inside and outside the home. Samples were successfully visited are 402 houses consist of 201 houses with DHF cases and 201 without DHF cases. The results showed that of 402 samples were obtained 75 positive of larvae of Aedes spp (house index/HI 18.7% consisted of 36 without DHF patient and 39 with DHF patient. Among the 8 villages research sites, highest HI is Cijaura village is 21.9%, and the lowest is village Manjahlega (11.1% (9 houses, while in the Cidurian village was  not found Aedes mosquitoes larvae. The most number of houses which positive of larvae of Aedes spp water containers are Sekejati village (37 houses, whereas the least was the Manjahlega village (2 houses. The results of chi square analysis and correlation, showed that there was no significant association between the presence of larvae of Aedes spp with DHF cases. Concluded, the presence of larvae of Aedes spp not significant associated with DHF cases in Bandung City, West Java. For the occurrence of dengue cases, beside the presence of Aedes spp, is also influenced by other factors such as the vector capacity, dengue virus virulence and host immune status. We recommended, to DHF control, beside conducting the control of dengue vector, is also needs to be carried out the other activities related to the

  20. Schinus terebinthifolius Leaf Extract Causes Midgut Damage, Interfering with Survival and Development of Aedes aegypti Larvae.

    Science.gov (United States)

    Procópio, Thamara Figueiredo; Fernandes, Kenner Morais; Pontual, Emmanuel Viana; Ximenes, Rafael Matos; de Oliveira, Aline Rafaella Cardoso; Souza, Carolina de Santana; Melo, Ana Maria Mendonça de Albuquerque; Navarro, Daniela Maria do Amaral Ferraz; Paiva, Patrícia Maria Guedes; Martins, Gustavo Ferreira; Napoleão, Thiago Henrique

    2015-01-01

    In this study, a leaf extract from Schinus terebinthifolius was evaluated for effects on survival, development, and midgut of A. aegypti fourth instar larvae (L4), as well as for toxic effect on Artemia salina. Leaf extract was obtained using 0.15 M NaCl and evaluated for phytochemical composition and lectin activity. Early L4 larvae were incubated with the extract (0.3-1.35%, w/v) for 8 days, in presence or absence of food. Polymeric proanthocyanidins, hydrolysable tannins, heterosid and aglycone flavonoids, cinnamic acid derivatives, traces of steroids, and lectin activity were detected in the extract, which killed the larvae at an LC50 of 0.62% (unfed larvae) and 1.03% (fed larvae). Further, the larvae incubated with the extract reacted by eliminating the gut content. No larvae reached the pupal stage in treatments at concentrations between 0.5% and 1.35%, while in the control (fed larvae), 61.7% of individuals emerged as adults. The extract (1.0%) promoted intense disorganization of larval midgut epithelium, including deformation and hypertrophy of cells, disruption of microvilli, and vacuolization of cytoplasms, affecting digestive, enteroendocrine, regenerative, and proliferating cells. In addition, cells with fragmented DNA were observed. Separation of extract components by solid phase extraction revealed that cinnamic acid derivatives and flavonoids are involved in larvicidal effect of the extract, being the first most efficient in a short time after larvae treatment. The lectin present in the extract was isolated, but did not show deleterious effects on larvae. The extract and cinnamic acid derivatives were toxic to A. salina nauplii, while the flavonoids showed low toxicity. S. terebinthifolius leaf extract caused damage to the midgut of A. aegypti larvae, interfering with survival and development. The larvicidal effect of the extract can be attributed to cinnamic acid derivatives and flavonoids. The data obtained using A. salina indicates that caution

  1. Schinus terebinthifolius Leaf Extract Causes Midgut Damage, Interfering with Survival and Development of Aedes aegypti Larvae.

    Directory of Open Access Journals (Sweden)

    Thamara Figueiredo Procópio

    Full Text Available In this study, a leaf extract from Schinus terebinthifolius was evaluated for effects on survival, development, and midgut of A. aegypti fourth instar larvae (L4, as well as for toxic effect on Artemia salina. Leaf extract was obtained using 0.15 M NaCl and evaluated for phytochemical composition and lectin activity. Early L4 larvae were incubated with the extract (0.3-1.35%, w/v for 8 days, in presence or absence of food. Polymeric proanthocyanidins, hydrolysable tannins, heterosid and aglycone flavonoids, cinnamic acid derivatives, traces of steroids, and lectin activity were detected in the extract, which killed the larvae at an LC50 of 0.62% (unfed larvae and 1.03% (fed larvae. Further, the larvae incubated with the extract reacted by eliminating the gut content. No larvae reached the pupal stage in treatments at concentrations between 0.5% and 1.35%, while in the control (fed larvae, 61.7% of individuals emerged as adults. The extract (1.0% promoted intense disorganization of larval midgut epithelium, including deformation and hypertrophy of cells, disruption of microvilli, and vacuolization of cytoplasms, affecting digestive, enteroendocrine, regenerative, and proliferating cells. In addition, cells with fragmented DNA were observed. Separation of extract components by solid phase extraction revealed that cinnamic acid derivatives and flavonoids are involved in larvicidal effect of the extract, being the first most efficient in a short time after larvae treatment. The lectin present in the extract was isolated, but did not show deleterious effects on larvae. The extract and cinnamic acid derivatives were toxic to A. salina nauplii, while the flavonoids showed low toxicity. S. terebinthifolius leaf extract caused damage to the midgut of A. aegypti larvae, interfering with survival and development. The larvicidal effect of the extract can be attributed to cinnamic acid derivatives and flavonoids. The data obtained using A. salina indicates

  2. Utilization Efficiency of Yolk Egg on Maanvis (Pterophyllum scalare Embryos and Larvae in Different Incubation Temperatures

    Directory of Open Access Journals (Sweden)

    T. Budiardi

    2007-01-01

    Full Text Available This study was performed to determine the efficiency of yolk egg utilization in embryos and larvae, hatching rate, incubation time to hatch, and growth rate of maanvis (Pterophyllum scalare larvae incubated at room remperature, 27oC, and 30oC.  Results of study showed that yolk egg utilization efficiency of embryos and larvae incubated at 30oC was 73.70% and 0,18%, respectively, and no different with that of room and 27oC incubation temperatures.  Hatching rate of eggs incubated at 30oC (84.75% was also same with that of other treatments.  However, incubation time to hatch (27.41 hours was shorter than that of other treatments.  The growth rate by length of larvae (2.16% and survival rate (75.28% incubated at 30oC was also higher compared with that of other treatments.  Thus, in general, optimum temperature for egg hatching and larval rearing of maanvis was 30oC. Keywords: maanvis, Pterophyllum scalare, egg yolk, larvae, embryo, temperature   ABSTRAK Penelitian ini dilakukan untuk mengetahui efisiensi pemanfaatan kuning telur pada embrio dan larva, derajat penetasan, lama inkubasi telur hingga menetas, dan laju pertumbuhan serta kelangsungan hidup larva ikan maanvis (Pterophyllum scalare yang diinkubasi pada suhu ruang, 27oC dan 30oC.  Hasil penelitian menunjukkan bahwa nilai efisiensi pemanfaatan kuning telur bila diinkubasi pada suhu 30oCsebesar 73,70% pada fase embrio dan 0,18% pada fase larva, dan tidak berbeda dengan suhu ruang dan 27oC.  Demikian juga dengan derajat penetasan telur  (84,75% tidak berbeda dengan perlakuan lainnya.  Sementara itu, lama inkubasi telur hingga menetas (27,41 jam lebih cepat dibandingkan dengan suhu inkubasi perlakuan lainnya. Demikian juga dengan laju pertumbuhan panjang (2,16% dan kelangsungan hidup larva (75,28% lebih tinggi dibandingkan dengan perlakuan lainnya. Dengan demikian, secara umum suhu optimal untuk penetasan dan pemeliharaan larva ikan maanvis adalah 30°C. Kata kunci: ikan maanvis

  3. Cryopreservation of third-stage larvae of Strongylus vulgaris (large strongyle of horses).

    Science.gov (United States)

    Titoy, G A; Van Rensburg, L J

    1997-06-01

    A technique for the cryopreservation of third-stage larvae of Strongylus vulgaris is described. Infective larvae of S. vulgaris were exsheathed in a 0.16% sodium hypochlorite solution and then transferred into cryotubes containing 0.09% saline. The samples were stored in the gas phase of liquid nitrogen.

  4. Live and formulated diet evaluation through initial growth and survival of jundiá larvae, Rhamdia quelen Alimento vivo e formulado, crescimento inicial e sobrevivência de pós-larvas de jundiá, Rhamdia quelen

    Directory of Open Access Journals (Sweden)

    Paulo César Falanghe Carneiro

    2003-12-01

    Full Text Available Live diet (LD dependence and the lack of suitable formulated diets (FD are major constraints for the expansion of larviculture of many fish species. The low digestibility and nutritional quality of FD are factors that might explain their failure as a stand-alone starter food. To determine whether FD in combination with LD (zooplankton may efficiently increase larval growth and survival of jundiá (Rhamdia quelen, when compared to fish fed by either types of diet alone, jundiá larvae (5.57 mm; 1.41 mg were initially stocked into 12 10-L aquaria (100 larvae per aquarium. Replicate groups (n=4 were fed ad libitum one of the three diets for 20 (when fed FD or 48 days (when fed LD or the combined diets. Larvae fed FD alone presented significantly lower survival and growth rates as compared to larvae fed LD or a combination of both (co-fed. In addition, co-fed larvae grew better (170 mg in relation to those fed solely with LD (110 mg. Such better performance of combined feeding indicates that most of the required nutrients are in balance when both diet sources are included. More can be learned about fish larvae nutrition by further testing the effect of feeding combined diets, which include zooplankton, than only testing new ingredients or protein sources commonly used in the elaboration of juvenile or adult fish feeds.A larvicultura da maioria das espécies de peixes enfrenta o desafio da dependência do alimento vivo (AL e da falta de dietas formuladas (DF que atendam plenamente às necessidades das larvas. A baixa digestibilidade e a qualidade nutricional das DFs são alguns dos fatores que explicam o insucesso quando as larvas recebem apenas FD. Para avaliar o efeito da combinação da DF com o AL no crescimento e na sobrevivência de larvas de jundiá (Rhamdia quelen, comparando com o uso separado da DF ou do AL, larvas recém eclodidas (5,57 mm; 1,41 mg foram estocadas inicialmente em 12 aquários de 10 L (100 larvas por aquário. Quatro r

  5. Tracking movement and temperature selection of larvae of two forensically important blow fly species within a "maggot mass".

    Science.gov (United States)

    Johnson, Aidan P; Wighton, Samuel J; Wallman, James F

    2014-11-01

    The current study responds to the lack of understanding about the temperatures experienced by individual blow fly larvae within "maggot masses." The temperature selection of both aggregating (in a mass) and nonaggregating larvae was compared and their pattern of movement assessed. Infrared imaging determined the temperatures within a mass and in the vicinity of the constituent individual larvae, whose movements were tracked by dyeing their tissues red. Individual Chrysomya rufifacies larvae selected temperatures above 27°C, significantly higher than the temperature selected by Calliphora vicina larvae (24.5°C). However, this same difference was not seen within a mass, with both species selecting temperatures around 28°C. Larval movement in a mass was nonrandom, indicating that larvae actively select their position in a mass. Furthermore, larvae have a strong tendency to select the hottest part of a mass; therefore, maximum mass temperatures might provide a reliable proxy for the actual temperatures experienced by larvae. © 2014 American Academy of Forensic Sciences.

  6. Prevalence of American Foulbrood and Paenibacillus Larvae Genotypes in Bulgaria

    OpenAIRE

    RUSENOVA, Nikolina; PARVANOV, Parvan

    2016-01-01

    This study aimed to analyse the prevalence of American foulbrood and Paenibacillus larvae genotypes in Bulgaria. For this purpose, data concerning American foulbrood outbreaks were used. Also, available data on the number of destroyed bee families covering a twenty-five-year period (1989 - 2013) was collected from the register of Bulgarian Food Safety Agency. In addition, Paenibacillus larvae genotypes in 15 apiaries were established by rep - PCR with BOXA1R and MBOREP1 primers. Results showe...

  7. Studies with normal and gamma irradiated third stage larvae of Oesophagostomum columbianum in lambs

    International Nuclear Information System (INIS)

    Sharma, R.L.; Dhar, D.N.

    1979-01-01

    Results of work on the host-parasite relationship of Oesophagostomum columbianum in sheep, carried out at the Regional Centre, Srinagar, are presented. Primary infections with small numbers of O. columbianum third larvae in lambs caused establishment of more adult worms in the intestine. As the number of larvae administered to lambs in primary infections was increased, a significant decrease in the establishment of adult worms in the intestine was observed. Higher levels of primary infections in lambs resulted in stunting of both male and female adult worms in intestine but this did not affect the resultant egg production by the worms. The severity of the disease in lambs was directly related to the number of larvae administered in primary infections. Attenuation of the third stage larvae of O.columbianum was obtained when they were irradiated at 40 and 50 Krad doses from a gamma source. Whereas it was possible to stimulate only a partial protection in young lambs to O. columbianum with a single dose of 2000, 40 Krad irradiated larvae. Vaccination with the same numbers of larvae, but irradiated at 50 Krad failed to protect the animals. The presence of adult worms of O.columbianum in sites outside the intestine in lambs has been reported for the first time. (auth.)

  8. Dipteran larvae and microbes facilitate nutrient sequestration in the Nepenthes gracilis pitcher plant host.

    Science.gov (United States)

    Lam, Weng Ngai; Chong, Kwek Yan; Anand, Ganesh S; Tan, Hugh Tiang Wah

    2017-03-01

    The fluid-containing traps of Nepenthes carnivorous pitcher plants (Nepenthaceae) are often inhabited by organisms known as inquilines. Dipteran larvae are key components of such communities and are thought to facilitate pitcher nitrogen sequestration by converting prey protein into inorganic nitrogen, although this has never been demonstrated in Nepenthes Pitcher fluids are also inhabited by microbes, although the relationship(s) between these and the plant is still unclear. In this study, we examined the hypothesis of digestive mutualism between N. gracilis pitchers and both dipteran larvae and fluid microbes. Using dipteran larvae, prey and fluid volumes mimicking in situ pitcher conditions, we conducted in vitro experiments and measured changes in available fluid nitrogen in response to dipteran larvae and microbe presence. We showed that the presence of dipteran larvae resulted in significantly higher and faster releases of ammonium and soluble protein into fluids in artificial pitchers, and that the presence of fluid microbes did likewise for ammonium. We showed also that niche segregation occurs between phorid and culicid larvae, with the former fragmenting prey carcasses and the latter suppressing fluid microbe levels. These results clarify the relationships between several key pitcher-dwelling organisms, and show that pitcher communities facilitate nutrient sequestration in their host. © 2017 The Author(s).

  9. Genetic and Biochemical Diversity of Paenibacillus larvae Isolated from Tunisian Infected Honey Bee Broods

    Directory of Open Access Journals (Sweden)

    Chadlia Hamdi

    2013-01-01

    Full Text Available Paenibacillus larvae is the causative agent of American foulbrood (AFB, a virulent disease of honeybee (Apis mellifera larvae. In Tunisia, AFB has been detected in many beekeeping areas, where it causes important economic losses, but nothing is known about the diversity of the causing agent. Seventy-five isolates of P. larvae, identified by biochemical tests and 16S rRNA gene sequencing, were obtained from fifteen contaminated broods showing typical AFB symptoms, collected in different locations in the northern part of the country. Using BOX-PCR, a distinct profile of P. larvae with respect to related Paenibacillus species was detected which may be useful for its identification. Some P. larvae-specific bands represented novel potential molecular markers for the species. BOX-PCR fingerprints indicated a relatively high intraspecific diversity among the isolates not described previously with several molecular polymorphisms identifying six genotypes on polyacrylamide gel. Polymorphisms were also detected in several biochemical characters (indol production, nitrate reduction, and methyl red and oxidase tests. Contrary to the relatively high intraspecies molecular and phenotypic diversity, the in vivo virulence of three selected P. larvae genotypes did not differ significantly, suggesting that the genotypic/phenotypic differences are neutral or related to ecological aspects other than virulence.

  10. Survival dynamics of scleractinian coral larvae and implications for dispersal

    Science.gov (United States)

    Graham, E. M.; Baird, A. H.; Connolly, S. R.

    2008-09-01

    Survival of pelagic marine larvae is an important determinant of dispersal potential. Despite this, few estimates of larval survival are available. For scleractinian corals, few studies of larval survival are long enough to provide accurate estimates of longevity. Moreover, changes in mortality rates during larval life, expected on theoretical grounds, have implications for the degree of connectivity among reefs and have not been quantified for any coral species. This study quantified the survival of larvae from five broadcast-spawning scleractinian corals ( Acropora latistella, Favia pallida, Pectinia paeonia, Goniastrea aspera, and Montastraea magnistellata) to estimate larval longevity, and to test for changes in mortality rates as larvae age. Maximum lifespans ranged from 195 to 244 d. These longevities substantially exceed those documented previously for coral larvae that lack zooxanthellae, and they exceed predictions based on metabolic rates prevailing early in larval life. In addition, larval mortality rates exhibited strong patterns of variation throughout the larval stage. Three periods were identified in four species: high initial rates of mortality; followed by a low, approximately constant rate of mortality; and finally, progressively increasing mortality after approximately 100 d. The lifetimes observed in this study suggest that the potential for long-distance dispersal may be substantially greater than previously thought. Indeed, detection of increasing mortality rates late in life suggests that energy reserves do not reach critically low levels until approximately 100 d after spawning. Conversely, increased mortality rates early in life decrease the likelihood that larvae transported away from their natal reef will survive to reach nearby reefs, and thus decrease connectivity at regional scales. These results show how variation in larval survivorship with age may help to explain the seeming paradox of high genetic structure at metapopulation scales

  11. Feeding Behaviour on Host Plants May Influence Potential Exposure to Bt Maize Pollen of Aglais Urticae Larvae (Lepidoptera, Nymphalidae).

    Science.gov (United States)

    Lang, Andreas; Otto, Mathias

    2015-08-31

    Non-target butterfly larvae may be harmed by feeding on host plants dusted with Bt maize pollen. Feeding patterns of larvae and their utilization of host plants can affect the adverse Bt impact because the maize pollen is distributed unequally on the plant. In a field study, we investigated the feeding of larvae of the Small Tortoiseshell, Aglais urticae, on nettles, Urtica dioica. Young larvae used smaller host plants than older larvae. In general, the position of the larvae was in the top part of the host plant, but older larvae showed a broader vertical distribution on the nettles. Leaf blades and leaf tips were the plant parts most often consumed. Leaf veins were consumed but midribs were fed on to a lesser extent than other plant veins, particularly by young larvae. The feeding behavior of the larvae may increase possible exposure to Bt maize pollen because pollen densities are expected to be higher on the top parts and along leaf veins of nettles.

  12. Feeding Behaviour on Host Plants May Influence Potential Exposure to Bt Maize Pollen of Aglais Urticae Larvae (Lepidoptera, Nymphalidae

    Directory of Open Access Journals (Sweden)

    Andreas Lang

    2015-08-01

    Full Text Available Non-target butterfly larvae may be harmed by feeding on host plants dusted with Bt maize pollen. Feeding patterns of larvae and their utilization of host plants can affect the adverse Bt impact because the maize pollen is distributed unequally on the plant. In a field study, we investigated the feeding of larvae of the Small Tortoiseshell, Aglais urticae, on nettles, Urtica dioica. Young larvae used smaller host plants than older larvae. In general, the position of the larvae was in the top part of the host plant, but older larvae showed a broader vertical distribution on the nettles. Leaf blades and leaf tips were the plant parts most often consumed. Leaf veins were consumed but midribs were fed on to a lesser extent than other plant veins, particularly by young larvae. The feeding behavior of the larvae may increase possible exposure to Bt maize pollen because pollen densities are expected to be higher on the top parts and along leaf veins of nettles.

  13. Looking for Larvae Above an Erupting Submarine Volcano, NW Rota-1, Mariana Arc

    Science.gov (United States)

    Beaulieu, S.; Hanson, M.; Tunnicliffe, V.; Chadwick, W. W., Jr.; Breuer, E. R.

    2016-02-01

    In 2009 the first marine protected areas for deep-sea hydrothermal vents in U.S. waters were established as part of the Volcanic Unit of the Marianas Trench Marine National Monument. In this region, hydrothermal vents are located along the Mariana Arc and back-arc spreading center. In particular hydrothermal vents are located near the summit of NW Rota-1, an active submarine volcano on the Mariana Arc which was erupting between 2003 and 2010 and ceased as of 2014. NW Rota-1 experienced a massive landslide in late 2009, decimating the habitat on the southern side of the volcano. This project looked at zooplankton tow samples taken from the water column above NW Rota-1 in 2010, searching for larvae which have the potential to recolonize the sea floor after such a major disturbance. Samples were sorted in entirety into coarse taxa, and then larvae were removed for DNA barcoding. Overall zooplankton composition was dominated by copepods, ostracods, and chaetognaths, the majority of which are pelagic organisms. Comparatively few larvae of benthic invertebrates were found, but shrimp, gastropod, barnacle, and polychaete larvae did appear in low numbers in the samples. Species-level identification obtained via genetic barcoding will allow for these larvae to be matched to species known to inhabit the benthic communities at NW Rota-1. Identified larvae will give insight into the organisms which can re-colonize the seafloor vent communities after a disturbance such as the 2009 landslide. Communities at hydrothermal vents at other submarine volcanoes in the Monument may act as sources for these larvae, but connectivity in this region of complex topography is unknown. As the microinvertebrate biodiversity in the Monument has yet to be fully characterized, our project also provides an opportunity to better describe both the zooplankton and benthic community composition in this area of the Monument.

  14. A preliminary account on the distribution of decapod larvae in the Konkan waters

    Digital Repository Service at National Institute of Oceanography (India)

    Achuthankutty, C.T.; Nair, S.R.S.

    Decapod larval distribution in Konkan coastal waters was studied during the premonsoon season (March-April). Sergestid was the largest group forming 80.55% of the total decapod crustacean larvae. Penaeid larvae constituted only 0.65% and M. dobsoni...

  15. Stereoselectivity in bioaccumulation and excretion of epoxiconazole by mealworm beetle (Tenebrio molitor) larvae.

    Science.gov (United States)

    Lv, Xiaotian; Liu, Chen; Li, Yaobin; Gao, Yongxin; Wang, Huili; Li, Jianzhong; Guo, Baoyuan

    2014-09-01

    Stereoselectivity in bioaccumulation and excretion of stereoisomers of epoxiconazole by mealworm beetle (Tenebrio molitor) larvae through dietary exposure was investigated. Liquid chromatography tandem mass spectrometry (HPLC-MS/MS) method that use a ChiralcelOD-3R[cellulosetris-Tris-(3, 5-dichlorophenyl-carbamate)] chromatography column was applied to carry out chiral separation of the stereoisomers. Wheat bran was spiked with racemic epoxiconazole at two dose levels of 20mg/kg and 2mg/kg (dry weight) to feed T. molitor larvae. The results showed that both the doses of epoxiconazole were taken up by Tenebrio molitor larvae rapidly at the initial stages. There was a significant trend of stereoselective bioaccumulation in the larvae with a preferential accumulation of (-)-epoxiconazole in the 20mg/kg dose. The stereoselectivity in bioaccumulation in the 2mg/kg dosage was not obvious compared to the 20mg/kg group. Results of excretion indicated an active excretion is an important pathway for the larvae to eliminate epoxiconazole which was a passive transport process with non stereoselectivity. The faster elimination might be the reason for the low accumulation of epoxiconazole, as measured by bioaccumulation factor (BAF). Copyright © 2014 Elsevier Inc. All rights reserved.

  16. Sustainable production of housefly (Musca domestica) larvae as a protein-rich feed ingredient by utilizing cattle manure

    Science.gov (United States)

    Hussein, Mahmoud; Pillai, Viju V.; Goddard, Joshua M.; Park, Hui G.; Kothapalli, Kumar S.; Ross, Deborah A.; Ketterings, Quirine M.; Brenna, J. Thomas; Milstein, Mark B.; Marquis, Helene; Johnson, Patricia A.; Nyrop, Jan P.

    2017-01-01

    The common housefly, Musca domestica, is a considerable component of nutrient recycling in the environment. Use of housefly larvae to biodegrade manure presents an opportunity to reduce waste disposal while the rapidly assimilated insect biomass can also be used as a protein rich animal feed. In this study, we examine the biodegradation of dairy cattle manure using housefly larvae, and the nutritional value of the resulting larva meal as a feed ingredient. Our results demonstrated that dairy cattle manure presents a balanced substrate for larval growth, and the spent manure showed reductions in concentration of total nitrogen (24.9%) and phosphorus (6.2%) with an overall reduction in mass. Larva yield at an optimum density was approximately 2% of manure weight. Nutritional analysis of M. domestica larva meal showed values comparable to most high protein feed ingredients. Larva meal was 60% protein with a well-balanced amino acid profile, and 20% fat with 57% monounsaturated fatty acids, and 39% saturated fatty acids. Larva meal lacked any significant amount of omega-3 fatty acids. Evaluation of micronutrients in larva meal suggested that it is a good source of calcium and phosphorus (0.5% and 1.1% respectively). The nutritional value of larva meal closely matches that of fishmeal, making it a potentially attractive alternative for use as a protein-rich feed ingredient for livestock and aquaculture operations. PMID:28170420

  17. Probiotic effects on cobia Rachycentron canadum larvae reared in a recirculating aquaculture system

    Directory of Open Access Journals (Sweden)

    M. Angélica Garrido-Pereira

    2014-11-01

    Full Text Available Cobia (Rachycentron canadum is a marine finfish with good potential for mariculture. This study analyzes the effects of probiotic Bacillus spp. on the performance of cobia larvae reared in a recirculating aquaculture system (RAS. Larvae were stocked into two independent RAS for 26 days after hatching. One of the systems (Probiotic treatment received the addition of a commercial probiotic consisting of B. subtilis, B. licheniformis and B. pumilus directly into the water and by live feed. Survival, final weight and water quality were not affected by probiotics. Results showed larvae of the probiotic treatment demonstrated a greater resistance to salinity stress. Immunohistochemical analysis showed a higher expression of CD4 in probiotic treatment. These results suggest that Bacillus spp. probiotics used in RAS have a potential stimulating impact on immune system differentiation and increases salinity stress resistance of cobia larvae.

  18. 周期型马来丝虫复合基因重组质粒和相应表达蛋白的免疫学研究%Immunology comparision of composite gene recombinant plasmid and expressed protein of periodical Brugia malayi

    Institute of Scientific and Technical Information of China (English)

    王慧; 方政; 徐倩; 陆施娟; 钱一言; 徐怿琳; 方浩; 徐邦生

    2014-01-01

    的复合重组质粒/复合重组蛋白/CpG组小鼠淋巴细胞刺激增殖指数(1.629±0.235)高于复合重组蛋白组(1.248±0.110,P<0.05);免疫4、6周后,复合重组质粒/复合重组蛋白/CpG组和复合重组质粒/CpG组小鼠血清IFN-γ水平[(101.660±5.101)、(178.265±7.139)mg/L,(102.067±3.722)、(115.148±6.031)mg/L]均高于复合重组蛋白组[(75.438±2.102)、(82.004±3.777) mg/L,P均<0.05];免疫后6周,复合重组质粒/复合重组蛋白/CpG组和复合重组蛋白/CpG组的小鼠血清IL-4水平[(75.385±3.318)、(46.363±3.672)mg/L]均明显高于复合重组质粒/CpG组[(36.691±3.443)mg/L,P均<0.05).结论 pcDNA3.1-BmCPI/BmGAPDH核酸疫苗和相应蛋白疫苗均可诱导BALB/c小鼠产生特异性体液和细胞免疫应答反应.核酸疫苗-蛋白疫苗联合免疫效果有明显的优势.%Objective To construct a plasmid DNA vector expressing cysteine protease inhibitor and glyceraldehydes-3-phosphate dehydrogenase of periodic Brugia malayi(BmCPI/BmGAPDH),and purify the recombinant protein after transfecting the vector into human cervical carcinoma cells(Hela) for expression.To make a comparison of immunity efficacy between the recombinant plasmid and the homologous protein and to a lay theoretic and experimental basis for developing novel anti-filarial genetic engineering vaccines.Methods The amplified genes BmCPI and BmGAPDH and a plasmid vector were double enzymes digested and ligated to construct a recombinant plasmid pcDNA3.1 (+)-BmCPI/BmGAPDH,and this plasmid was transfected to Hela cells after being identified.G418 was used for screening transfectants,and the monoclonal resistant cell strain was determined by RT-PCR and SDS-PAGE.The recombinant protein was purified by affnity chromatography and identified by Western blotting.Sixty BALB/c mice were divided into 5 groups,12 per group,and they were immunized at 2,4,and 6 weeks.Mice in control groups were injected with PBS 100 μ1 or pcDNA3.1 100 μg/CpG 30 μg,and mice in experimental groups were injected with pcDNA3.1-BmCPI/BmGAPDH 100 μg/CpG 30

  19. Gastrointestinal symptoms resembling ulcerative proctitis caused by larvae of the drone fly Eristalis tenax.

    Science.gov (United States)

    Desoubeaux, Guillaume; Gaillard, Julien; Borée-Moreau, Diane; Bailly, Éric; Andres, Christian R; Chandenier, Jacques

    2014-04-01

    We report a case of facultative intestinal myiasis due to larvae of the drone fly Eristalis tenax, also named the rat-tailed maggots. The development of larvae in the lower bowel was responsible for non-specific gastrointestinal symptoms that resembled ulcerative proctitis. The diagnosis was established upon the observation of four spontaneously excreted mobile larvae. The definite identification of the E. tenax species was made possible by scanning electron microscopy. The clinical outcome was satisfactory.

  20. Uncommon Human Urinary Tract Myiasis Due to Psychoda Sp. Larvae, Kashan, Iran: A Case Report.

    Science.gov (United States)

    Rasti, Sima; Dehghani, Rouhullah; Khaledi, Hassan Naeimi; Takhtfiroozeh, Sayed Mahdi; Chimehi, Elahe

    2016-01-01

    Contamination of human and animal body tissues with flies' larvae and diptera cause myiasis. A 26 yr old female patient refers to Kashan Shahid Beheshti Hospital, central Iran because of urogenital infection, pain in the right part of stomach, smelly and reddish vaginal discharge and frequent urination. In the first checking, urine sample was taken. In the sample, active and alive larvae were seen. The live samples were taken to the Environmental Health Department Lab of Kashan University of Medical Sciences in clean glass jars. In the morphological survey, Psychoda sp larvae were identified. In Iran, this study is the first report of this species of larva that causes urinary myiasis. This fly larva is not carnivore or bloodsucker and feeds on bacterial agents. Observance of personal hygiene especially during defecation and urination is essential to prevent contamination of this type of myiasis.

  1. Ultrastructural characteristics of nurse cell-larva complex of four species of Trichinella in several hosts

    Directory of Open Access Journals (Sweden)

    Sacchi L.

    2001-06-01

    Full Text Available The nurse cell-larva complex of nematodes of the genus Trichinella plays an Important role in the survival of the larva in decaying muscles, frequently favouring the transmission of the parasite in extreme environmental conditions. The ultrastructure of the nurse cell-larva complex in muscles from different hosts infected with T. nativa (a walrus and a polar bear, T. spiralis (horses and humans, T. pseudospiralis (a laboratory mouse and T. papuae (a laboratory mouse were examined. Analysis with transmission electron microscope showed that the typical nurse cell structure was present in all examined samples, irrespective of the species of larva, of the presence of a collagen capsule, of the age of infection and of the host species, suggesting that there exists a molecular mechanism that in the first stage of larva invasion is similar for encapsulated and non-encapsulated species.

  2. Inclusion of copepod Acartia tonsa nauplii in the feeding of Centropomus undecimalis larvae increases stress resistance

    Directory of Open Access Journals (Sweden)

    Wanessa de Melo-Costa

    2015-09-01

    Full Text Available This research represents the first result of studies of the common snook Centropomus undecimalis larvae from broodstock matured in captivity in Brazil. The aim of this study was to evaluate if the inclusion of Acartia tonsa nauplii improves stress resistance of common snook larvae. The larvae were fed with: rotifers Brachionus plicatilis (10 to 15 mL-1; A. tonsa nauplii (0.25 to 0.5 mL-1 and rotifers (5 to 7.5 mL-1, and A. tonsa nauplii (0.12 to 0.25 mL-1. The average percentage of survival of the treatments was 11.9%. At 20 days of age, larvae were subjected to thermal stress. Subsequently, the stress resistance was evaluated. Common snook larvae fed B. plicatilis+A. tonsa reached a higher weight and length (7.5 ± 0.00 mg and 9.1 ± 0.23 mm, respectively and resisted more heat stress (87.4% than larvae fed other foods, indicating that the feed mixture is satisfactory as a starter diet for larvae of common snook. However, more research is needed to confirm these results.

  3. Caffeine administration alters the behaviour and development of Galleria mellonella larvae.

    Science.gov (United States)

    Maguire, Ronan; Kunc, Martin; Hyrsl, Pavel; Kavanagh, Kevin

    2017-11-01

    The effect of feeding caffeine on the behaviour and neural proteome of Galleria mellonella larvae was assessed. Caffeine was administered to larvae by force feeding and the metabolites theobromine and theophylline were subsequently detected by RP-HPLC analysis. Administration of caffeine to larvae resulted in reduced movement and a reduction in the formation of pupae. The production of the muscle relaxant theophylline may contribute to the reduction in larval movement. Analysis of the changes in proteome of the brain and surrounding tissues of caffeine fed larvae revealed an increase in the abundance of immune related proteins such as immune-related Hdd1 (6.28 fold increase) and hemolin (1.68 fold increase), ATPase associated proteins such as H+ transporting ATP synthase O subunit isoform 1 (1.87 fold increase) and H+ transporting ATP synthase delta subunit (1.53 fold increase) and proteins indicative of brain trauma such as troponin T transcript variant B, partial (1.55 fold increase). Proteins involved in development and protein degradation such as SUMO-activating enzyme subunit 1 (3.08 fold decrease) and chitin deacetylase, partial (3.67 fold decrease) were decreased in abundance. The results presented here indicate that caffeine is metabolised in a similar way in G. mellonella larvae to that in mammals and results in a variety of behavioural and developmental alterations. Utilisation of insects for studying the effects of caffeine and other neuroactive compounds may offer new insights into their mode of action and reduce the need to use mammals for this type of analysis. Copyright © 2017 Elsevier Inc. All rights reserved.

  4. Hemolymph amino acid analysis of individual Drosophila larvae.

    Science.gov (United States)

    Piyankarage, Sujeewa C; Augustin, Hrvoje; Grosjean, Yael; Featherstone, David E; Shippy, Scott A

    2008-02-15

    One of the most widely used transgenic animal models in biology is Drosophila melanogaster, the fruit fly. Chemical information from this exceedingly small organism is usually accomplished by studying populations to attain sample volumes suitable for standard analysis methods. This paper describes a direct sampling technique capable of obtaining 50-300 nL of hemolymph from individual Drosophila larvae. Hemolymph sampling performed under mineral oil and in air at 30 s intervals up to 120 s after piercing larvae revealed that the effect of evaporation on amino acid concentrations is insignificant when the sample was collected within 60 s. Qualitative and quantitative amino acid analyses of obtained hemolymph were carried out in two optimized buffer conditions by capillary electrophoresis with laser-induced fluorescence detection after derivatizing with fluorescamine. Thirteen amino acids were identified from individual hemolymph samples of both wild-type (WT) control and the genderblind (gb) mutant larvae. The levels of glutamine, glutamate, and taurine in the gb hemolymph were significantly lower at 35%, 38%, and 57% of WT levels, respectively. The developed technique that samples only the hemolymph fluid is efficient and enables accurate organism-level chemical information while minimizing errors associated with possible sample contaminations, estimations, and effects of evaporation compared to the traditional hemolymph-sampling techniques.

  5. Insect Larvae: A New Platform to Produce Commercial Recombinant Proteins.

    Science.gov (United States)

    Targovnik, Alexandra M; Arregui, Mariana B; Bracco, Lautaro F; Urtasun, Nicolas; Baieli, Maria F; Segura, Maria M; Simonella, Maria A; Fogar, Mariela; Wolman, Federico J; Cascone, Osvaldo; Miranda, Maria V

    2016-01-01

    In Biotechnology, the expression of recombinant proteins is a constantly growing field and different hosts are used for this purpose. Some valuable proteins cannot be produced using traditional systems. Insects from the order Lepidoptera infected with recombinant baculovirus have appeared as a good choice to express high levels of proteins, especially those with post-translational modifications. Lepidopteran insects, which are extensively distributed in the world, can be used as small protein factories, the new biofactories. Species like Bombyx mori (silkworm) have been analyzed in Asian countries to produce a great number of recombinant proteins for use in basic and applied science and industry. Many proteins expressed in this larva have been commercialized. Several recombinant proteins produced in silkworms have already been commercialized. On the other hand, species like Spodoptera frugiperda, Heliothis virescens, Rachiplusia nu, Helicoverpa zea and Trichoplusia ni are widely distributed in both the occidental world and Europe. The expression of recombinant proteins in larvae has the advantage of its low cost in comparison with insect cell cultures. A wide variety of recombinant proteins, including enzymes, hormones and vaccines, have been efficiently expressed with intact biological activity. The expression of pharmaceutically proteins, using insect larvae or cocoons, has become very attractive. This review describes the use of insect larvae as an alternative to produce commercial recombinant proteins.

  6. Distribution patterns and predilection muscles of Trichinella zimbabwensis larvae in experimentally infected Nile crocodiles (Crocodylus niloticus Laurenti

    Directory of Open Access Journals (Sweden)

    Louis J. La Grange

    2014-02-01

    Full Text Available No controlled studies have been conducted to determine the predilection muscles of Trichinella zimbabwensis larvae in Nile crocodiles (Crocodylus niloticus or the influence of infection intensity on the distribution of the larvae in crocodiles. The distribution of larvae in muscles of naturally infected Nile crocodiles and experimentally infected caimans (Caiman crocodilus and varans (Varanus exanthematicus have been reported in literature. To determine the distribution patterns of T. zimbabwensis larvae and predilection muscles, 15 crocodiles were randomly divided into three cohorts of five animals each, representing high infection (642 larvae/kg of bodyweight average, medium infection (414 larvae/kg of bodyweight average and low infection (134 larvae/kg of bodyweight average cohorts. In the high infection cohort, high percentages of larvae were observed in the triceps muscles (26% and hind limb muscles (13%. In the medium infection cohort, high percentages of larvae were found in the triceps muscles (50%, sternomastoid (18% and hind limb muscles (13%. In the low infection cohort, larvae were mainly found in the intercostal muscles (36%, longissimus complex (27%, forelimb muscles (20% and hind limb muscles (10%. Predilection muscles in the high and medium infection cohorts were similar to those reported in naturally infected crocodiles despite changes in infection intensity. The high infection cohort had significantly higher numbers of larvae in the sternomastoid, triceps, intercostal, longissimus complex, external tibial flexor, longissimus caudalis and caudal femoral muscles (p < 0.05 compared with the medium infection cohort. In comparison with the low infection cohort, the high infection cohort harboured significantly higher numbers of larvae in all muscles (p < 0.05 except for the tongue. The high infection cohort harboured significantly higher numbers of larvae (p < 0.05 in the sternomastoid, triceps, intercostal, longissimus complex

  7. Ovos de Toxocara sp. e larvas de Ancylostoma sp. em praça pública de Lavras, MG Toxocara sp. eggs and Ancylostoma sp. larva in public parks, Brazil

    Directory of Open Access Journals (Sweden)

    Antônio Marcos Guimarães

    2005-04-01

    Full Text Available Larva migrans visceral e cutânea são zoonoses parasitárias causadas pela infecção da larva de Toxocara sp. e Ancylostoma sp., respectivamente. O objetivo do estudo foi verificar a contaminação por ovos de Toxocara sp. e ovos e larvas de Ancylostoma sp. em amostras de solos coletadas de praças públicas e de áreas de recreação infantil de Lavras, Estado de Minas Gerais, por meio da técnica de centrífugo-flutuação e do método de Baermann. A ocorrência de ovos de Toxocara sp. e, ovos e larvas de Ancylostoma sp. foi observada em 69,6% (16/23 das amostras de solo coletadas de praças públicas. A contaminação somente por ovos de Ancylostoma sp. em amostras de solo coletadas em escolas/creches foi de 22,2% (4/18. A percentagem de amostras de areia coletadas de escolas/creches contaminadas somente com larvas de Ancylostoma sp. foi de 11,1% (2/18. Praças públicas são as áreas com maior risco potencial de infecção por Toxocara sp. e Ancylostoma sp. Exame coproparasitológico realizado em 174 amostras de fezes de cães observou 58% e 23%, respectivamente, com ovos de Ancylostoma sp. e Toxocara sp.Visceral and cutaneous larva migrans are parasitic zoonoses caused by the infection of larval nematodes Toxocara sp. and Ancylostoma sp. respectively. The objective of this study was to investigate the contamination by Toxocara sp. eggs and Ancylostoma sp. eggs and larva of soil samples collected from public parks and children's playground areas in state of Minas Gerais, Brazil, using both Baermann's method and centrifugal flotation technique. Toxocara sp. and Ancylostoma sp. eggs were observed in soil samples collected from public squares in 17.4% (4/23 and 69.6 (16/23 respectively. In schools and child day care settings the contamination by Ancylostoma sp. larva in sand samples was 11.1% (2/18. Public parks are settings of more potential risk of Toxocara sp. eggs and Ancylostoma sp. infection. Stool parasitology testing of 174 stool

  8. Influence of nutrient substrates on the expression of cellulases in Cerambyx cerdo L. (Coleoptera: Cerambycidae larvae

    Directory of Open Access Journals (Sweden)

    Pavlović R.

    2012-01-01

    Full Text Available The expression and distribution of digestive cellulases along the midgut of Cerambyx cerdo larvae were analyzed for the first time and are presented in this article. Four groups of larvae were examined: larvae developed in the wild; larvae taken from the wild and successively reared on an artificial diet based on polenta; and larvae hatched in the laboratory and reared on two different artificial diets. Seven endocellulase and seven β-D-glucosidase isoforms were detected in all midgut extracts of C. cerdo with a zymogram after native PAGE. We observed that C. cerdo larvae are capable of producing cellulase isoforms with different PAGE mobilities depending on the nutrient substrate. From our findings it can be assumed that, depending on the distribution of endocellulase and β-D-glucosidase, cellulose molecules are first fragmented in the anterior and middle midgut by endo-β-1,4-glucanase; subsequently, the obtained fragments are broken down by β-D-glucosidase mostly in middle midgut.

  9. The hatching larva of the priapulid worm Halicryptus spinulosus

    Directory of Open Access Journals (Sweden)

    Budd Graham E

    2009-05-01

    Full Text Available Abstract Despite their increasing evolutionary importance, basic knowledge about the priapulid worms remains limited. In particular, priapulid development has only been partially documented. Following previous description of hatching and the earliest larval stages of Priapulus caudatus, we here describe the hatching larva of Halicryptus spinulosus. Comparison of the P. caudatus and the H. spinulosus hatching larvae allows us to attempt to reconstruct the ground pattern of priapulid development. These findings may further help unravelling the phylogenetic position of the Priapulida within the Scalidophora and hence contribute to the elucidation of the nature of the ecdysozoan ancestor.

  10. Effects of irradiation of Bombyx mori larvae on the evolution of ecdysteroid titer in haemolymph and ecdysone metabolism

    International Nuclear Information System (INIS)

    Coulon, Madeleine; Feyereisen, Rene

    1977-01-01

    Second and third instar larvae of B. mori show a peak of ecdysteroids in the haemolymph towards the end of each instar. Second instar larvae which are X-ray treated at 0 h die at the third ecdysis. In these larvae, titer and metabolism of ecdysone is disturbed. Larvae X-ray treated at 24h in the second instar mostly become permanent larvae of the third instar, having a very low level of circulating ecdysteroids, which hardly metabolize injected ecdysone [fr

  11. Effect of ivermectin on the larvae of Anopheles gambiae and Culex quinquefasciatus

    DEFF Research Database (Denmark)

    Derua, Yahya A.; Malongo, Bernard B.; Simonsen, Paul E.

    2016-01-01

    . Methods: A total of 1800 laboratory reared mosquito larvae of each species were used in the bioassays. Twelve replicates were performed, each testing 6 concentrations of ivermectin (0.0, 0.001, 0.01, 0.1, 1.0 and 10.0 parts per million (ppm)) against third instar larvae of An. gambiae and Cx...

  12. Early larvae ontogeny of the Neotropical fishes: Prochilodus costatus and P. argenteus (Characiformes: Prochilodontidae).

    Science.gov (United States)

    dos Santos, José Enemir; Sales, Naiara Guimarães; dos Santos, Marcella Lourenço; Arantes, Fábio Pereira; Godinho, Hugo Pereira

    2016-06-01

    Early development of fish larvae is a highly dynamic process and its study may provide important information about ontogenetic development, bioenergetic growth, behaviour, taxonomic characteristics for identification in natural environments, identification of spawning areas, and population monitoring. With the aim to provide knowledge about their growth and behaviour, to support larval rearing, and also taxonomic purposes, we studied the life history of the Prochilodus argenteus and P. costatus from hatching until the complete absorption of the yolk. Larvae were obtained through artificial reproduction at the Hydrobiology and Aquaculture Station of Três Marias, Minas Gerais, Brazil. Immediately after hatching, 100 larvae of each species were put in two plastic incubators for conditioning. On a daily basis, larvae behavior was recorded and 14 larvae of each species were collected to analyse body morphology. On the first day after hatching, larvae of P. costatus and P. argenteus showed an elongated and transparent body; the yolk sac was filled with individualized yolk globules. In both species, the embryonic fin rounded the caudal region of the body, the retina was non-pigmented and the gut was obliterated. At the second day post-hatching, larvae of both species dendritic chromatophores had emerged, the mouth was obliterated and the pectoral fin was observed. The larvae showed 38-43 myomeres in P. costatus and 42-43 in P. argenteus. For both species, the gas bladder was inflated and the lumen of the gut was already open. On the third day post-hatching, the mouth of P. costatus and P. argenteus was already open in a sub-terminal position; the retina was pigmented; the gill arches had lamellar protrusions and were partially covered by the operculum. On the fourth day post-hatching, the pigmentation pattern was maintained with greater intensity; the mouth occupied a terminal position, the yolk sac was almost completely reabsorbed, and the pectoral and caudal fins

  13. A note on the record of Rastrelliger (Mackerel) larvae from the Indian Ocean

    Digital Repository Service at National Institute of Oceanography (India)

    Peter, K.J.

    from Gulf of Thailand and South China Sea They resemble the larvae of a scombrid relative, the Pacific mackerel Pneumatophorous diego, but differ in having less pigmentation and deeper body The larvae have a fairly stubby body, with 30 myomeres big eyes...

  14. siRNA transfection in larvae of the barnacle Amphibalanus amphitrite

    KAUST Repository

    Zhang, G.

    2015-06-25

    RNA interference (RNAi) provides an efficient and specific technique for functional genomic studies. Yet, no successful application of RNAi has been reported in barnacles. In this study, siRNA against p38 MAPK was synthesized and then transfected into A. amphitrite larvae at either the nauplius or cyprid stage, or at both stages. Effects of siRNA transfection on the p38 MAPK level were hardly detectable in the cyprids when they were transfected at the nauplius stage. In contrast, larvae that were transfected at the cyprid stage showed lower levels of p38 MAPK than the blank and reagent controls. However, significantly decreased levels of phosphorylated p38 MAPK (pp38 MAPK) and reduced settlement rates were observed only in ‘double transfections’, in which larvae were exposed to siRNA solution at both the nauplius and cyprid stages. A relatively longer transfection time and more larval cells directly exposed to siRNA might explain the higher efficiency of double transfection experiments.

  15. siRNA transfection in larvae of the barnacle Amphibalanus amphitrite

    KAUST Repository

    Zhang, G.; He, L.-S.; Wong, Y. H.; Yu, L.; Qian, P.-Y.

    2015-01-01

    RNA interference (RNAi) provides an efficient and specific technique for functional genomic studies. Yet, no successful application of RNAi has been reported in barnacles. In this study, siRNA against p38 MAPK was synthesized and then transfected into A. amphitrite larvae at either the nauplius or cyprid stage, or at both stages. Effects of siRNA transfection on the p38 MAPK level were hardly detectable in the cyprids when they were transfected at the nauplius stage. In contrast, larvae that were transfected at the cyprid stage showed lower levels of p38 MAPK than the blank and reagent controls. However, significantly decreased levels of phosphorylated p38 MAPK (pp38 MAPK) and reduced settlement rates were observed only in ‘double transfections’, in which larvae were exposed to siRNA solution at both the nauplius and cyprid stages. A relatively longer transfection time and more larval cells directly exposed to siRNA might explain the higher efficiency of double transfection experiments.

  16. Uncommon Human Urinary Tract Myiasis Due to Psychoda Sp. Larvae, Kashan, Iran: A Case Report

    Directory of Open Access Journals (Sweden)

    Sima RASTI

    2016-10-01

    Full Text Available Contamination of human and animal body tissues with flies’ larvae and diptera cause myiasis. A 26 yr old female patient refers to Kashan Shahid Beheshti Hospital, central Iran because of urogenital infection, pain in the right part of stomach, smelly and reddish vaginal discharge and frequent urination. In the first checking, urine sample was taken. In the sample, active and alive larvae were seen. The live samples were taken to the Environmental Health Department Lab of Kashan University of Medical Sciences in clean glass jars. In the morphological survey, Psychoda sp larvae were identified. In Iran, this study is the first report of this species of larva that causes urinary myiasis. This fly larva is not carnivore or bloodsucker and feeds on bacterial agents. Observance of personal hygiene especially during defecation and urination is essential to prevent contamination of this type of myiasis.

  17. Cholesterol oxidase interference on the emergence and viability of cotton boll weevil larvae

    Directory of Open Access Journals (Sweden)

    Santos Roseane Cavalcanti

    2002-01-01

    Full Text Available The aim of this work was to evaluate the influence of the enzyme cholesterol oxidase (Coase on emergence and viability of larvae of the cotton boll weevil (Anthonomus grandis Boheman, 1843. A series of bioassays was performed with eggs and neonate larvae exposed to different enzyme concentrations in artificial diet. Larval survival was affected at all enzyme concentrations tested, and the six-day LD50 was 53 mug/mL (CI 95%: 43-59. Coase also interfered with hatching of larvae after eggs were floated for 15 min in Coase solution at different concentrations. Observations at the light and electronic microscopic level of midguts from larvae fed on artificial diet containing 53 mug/mL of Coase and collected at six days revealed highly vacuolated regions in the epithelial cells as well as partial degradation of the basal membrane and microvilli.

  18. Host Recognition Responses of Western (Family: Chrysomelidae) Corn Rootworm Larvae to RNA Interference and Bt Corn.

    Science.gov (United States)

    Zukoff, Sarah N; Zukoff, Anthony L

    2017-01-01

    Western corn rootworm Diabrotica virgifera virgifera LeConte is an important pest of corn whose larvae exhibit particular quantifiable patterns of locomotion after exposure to, and removal from, host roots and nonhost roots. Using EthoVision software, the behavior and locomotion of the western corn rootworm larvae was analyzed to determine the level of host recognition to germinated roots of differing corn hybrids containing either rootworm targeted Bt genes, RNA interference (RNAi) technology, the stack of both Bt and RNAi, or the isoline of these. The behavior of the rootworm larvae indicated a significant host preference response to all corn hybrids (with or without insecticidal traits) compared to the filter paper and oat roots. A weaker host response to the RNAi corn roots was observed in the susceptible larvae when compared to the resistant larvae, but not for the Bt + RNAi vector stack. Additionally, the resistant larvae demonstrated a weaker host response to the isoline corn roots when compared to the susceptible larvae. Although weaker, these host responses were significantly different from those observed in the negative controls, indicating that all hybrids tested do contain the contact cues necessary to elicit a host preference response by both Cry3Bb1-resistant and Cry3Bb1-susceptible larvae that would work to hinder resistance development in refuge in a bag fields. © The Authors 2017. Published by Oxford University Press on behalf of Entomological Society of America.

  19. Hyperprolinemic larvae of the drosophilid fly, Chymomyza costata, survive cryopreservation in liquid nitrogen.

    Science.gov (United States)

    Kostál, Vladimír; Zahradnícková, Helena; Šimek, Petr

    2011-08-09

    The larva of the drosophilid fly, Chymomyza costata, is probably the most complex metazoan organism that can survive submergence in liquid nitrogen (-196 °C) in a fully hydrated state. We examined the associations between the physiological and biochemical parameters of differently acclimated larvae and their freeze tolerance. Entering diapause is an essential and sufficient prerequisite for attaining high levels of survival in liquid nitrogen (23% survival to adult stage), although cold acclimation further improves this capacity (62% survival). Profiling of 61 different metabolites identified proline as a prominent compound whose concentration increased from 20 to 147 mM during diapause transition and subsequent cold acclimation. This study provides direct evidence for the essential role of proline in high freeze tolerance. We increased the levels of proline in the larval tissues by feeding larvae proline-augmented diets and found that this simple treatment dramatically improved their freeze tolerance. Cell and tissue survival following exposure to liquid nitrogen was evident in proline-fed nondiapause larvae, and survival to adult stage increased from 0% to 36% in proline-fed diapause-destined larvae. A significant statistical correlation was found between the whole-body concentration of proline, either natural or artificial, and survival to the adult stage in liquid nitrogen for diapause larvae. Differential scanning calorimetry analysis suggested that high proline levels, in combination with a relatively low content of osmotically active water and freeze dehydration, increased the propensity of the remaining unfrozen water to undergo a glass-like transition (vitrification) and thus facilitated the prevention of cryoinjury.

  20. Toxocara cati larva migrans in domestic pigs--detected at slaughterhouse control in Norway.

    Science.gov (United States)

    Davidson, Rebecca K; Mermer, Anna; Øines, Øivind

    2012-11-21

    Routine Trichinella meat inspection at the slaughterhouse detected one larva in a pooled batch of 100 pig samples. The larva was sent to the Norwegian Veterinary Institute (NVI) for species identification.Morphological examination revealed that the larva was not Trichinella spp. Molecular analysis was performed. PCR and sequencing of 5S/ITS identified the larva as Toxocara cati. A second round of digests was carried out at the meat inspection laboratory, in smaller batches to try to identify the infected animal. No further larvae were detected and it was not possible to identify which of the 100 animals the larva had come from. This is the first time that Toxocara cati has been reported in slaughterhouse pigs in Norway.Although the infected individual could not be identified, the meat originated from one of six potential farms. A small survey regarding rodent control and cats was sent to each of these farms. Cats had restricted access to food storage areas (two farms reported that cats had access) whilst none of the farms allowed cats into the production housing. Cats were, however, present on all the farms (mostly stray cats of unknown health status). Half of the farms also reported seeing rodents in the pig housing during the previous six months and half reported finding rodents in the feed and straw storage areas. We were unable to narrow down the source of infection - however contamination of food or bedding material, with cat faeces or infected rodents, in addition to the presence of infected rodents in pig housing remain potential routes of infection.

  1. Food and feeding ecology of Brazilian sardine (Sardinella brasiliensis larvae from the southeastern Brazilian Bight

    Directory of Open Access Journals (Sweden)

    Frederico W. Kurtz

    2001-01-01

    Full Text Available Results from depth integrated and vertically stratified plankton samples collected in the southeastern Brazilian Bight were used to study the feeding behavior of Brazilian sardine (Sardinella brasiliensis larvae. Sampling of the ichthyoplankton was carried out with 60 cm Bongo nets in the Bight during the spawning seasons of 1991/92 and 1992/93. The sampling of microzooplankton was carried out in the coastal region off Ubatuba, using the closing-type plankton net, in December 1995. The feeding study was based on a total of 901 captured larvae. Gut content analysis of the sardine larvae showed a diurnal pattern of food intake. Copepod nauplii dominated the diet of the preflexion and flexion larvae, but they were the second in abundance for the postflexion larvae which fed preferentially on copepodites and adults of Oncaea spp. Averaged feeding incidence of the 901 larvae was 37.6%, but it increased to 58.5% for day-caught larvae. Seventy percent of the food particles were found in the mid-gut and food eaten showed a natural increase in digestion from fore-gut to hind-gut. Vertical distribution of microzooplankton revealed that copepod nauplii were present in densities of 10-20 ind. L-1, mainly in the upper mixed layer (0-20 m depth, but higher densities of copepodite and adult of Oncaea, Oithona and Paracalamis were found within and beneath the thermocline. These results show that Brazilian sardine larvae can successfully adapt their diet, feeding on the most abundant food particles in the upper mixed layer of the survey area.Plâncton amostrado na região sudeste do Brasil, em coletas integradas verticalmente e estratificadas, foi utilizado no estudo do comportamento alimentar das larvas de sardinha-verdadeira (Sardinella brasiliensis. As coletas de ictioplâncton foram realizadas com rede tipo Bongo de 60 cm de diâmetro durante os períodos de desova de 1991/92 e 1992/93. Microzooplâncton foi amostrado na região costeira ao largo de Ubatuba

  2. First analysis of the secretome of the canine heartworm, Dirofilaria immitis

    Directory of Open Access Journals (Sweden)

    Geary James

    2012-07-01

    Full Text Available Abstract Background The characterization of proteins released from filariae is an important step in addressing many of the needs in the diagnosis and treatment of these clinically important parasites, as well as contributing to a clearer understanding of their biology. This report describes findings on the proteins released during in vitro cultivation of adult Dirofilaria immitis , the causative agent of canine and feline heartworm disease. Differences in protein secretion among nematodes in vivo may relate to the ecological niche of each parasite and the pathological changes that they induce. Methods The proteins in the secretions of cultured adult worms were run on Tris-Glycine gels, bands separated and peptides from each band analysed by ultra mass spectrometry and compared with a FastA dataset of predicted tryptic peptides derived from a genome sequence of D. immitis. Results This study identified 110 proteins. Of these proteins, 52 were unique to D. immitis . A total of 23 (44% were recognized as proteins likely to be secreted. Although these proteins were unique, the motifs were conserved compared with proteins secreted by other nematodes. Conclusion The present data indicate that D. immitis secretes proteins that are unique to this species, when compared with Brugia malayi. The two major functional groups of molecules represented were those representing cellular and of metabolic processes. Unique proteins might be important for maintaining an infection in the host environment, intimately involved in the pathogenesis of disease and may also provide new tools for the diagnosis of heartworm infection.

  3. Single multivalent vaccination boosted by trickle larval infection confers protection against experimental lymphatic filariasis.

    Science.gov (United States)

    Joseph, S K; Ramaswamy, K

    2013-07-18

    The multivalent vaccine BmHAT, consisting of the Brugia malayi infective larval (L3) antigens heat shock protein12.6 (HSP12.6), abundant larval transcript-2 (ALT-2) and tetraspanin large extra cellular loop (TSP-LEL), was shown to be protective in rodent models from our laboratory. We hypothesize that since these antigens were identified using protective antibodies from immune endemic normal individuals, the multivalent vaccine can be augmented by natural L3 infections providing protection to the vaccinated host. This hypothesis was tested using single dose of DNA and protein or protein alone of the BmHAT vaccination in gerbils followed by live trickle L3 infection as booster dose. Vaccine-induced protection in gerbils was determined by worm establishment, micropore chamber assay and by antibody dependant cell cytotoxicity (ADCC) assay. Results were compared with the traditional prime-boost vaccination regimen. Gerbils vaccinated with BmHAT and boosted with L3 trickle infection were protected 51% (BmHAT DNA-protein) and 48% (BmHAT protein) respectively. BmHAT vaccination plus L3 trickle booster generated significant titer of antigen-specific IgG antibodies comparable to the traditional prime boost vaccination approach. BmHAT vaccination plus L3 trickle booster also generated antigen-specific cells in the spleen of vaccinated animals and these cells secreted predominantly IFN-γ and IL-4 in response to the vaccine antigens. These studies thus show that single dose of BmHAT multivalent vaccination followed by L3 trickle booster infection can confer significant protection against lymphatic filariasis. Copyright © 2013 Elsevier Ltd. All rights reserved.

  4. Single multivalent vaccination boosted by trickle larval infection confers protection against experimental lymphatic filariasis

    Science.gov (United States)

    Joseph, SK; Ramaswamy, K

    2013-01-01

    The multivalent vaccine BmHAT, consisting of the Brugia malayi infective larval (L3) antigens heat shock protein12.6 (HSP12.6), abundant larval transcript-2 (ALT-2) and tetraspanin large extra cellular loop (TSP-LEL), was shown to be protective in rodent models from our laboratory. We hypothesize that since these antigens were identified using protective antibodies from immune endemic normal individuals, the multivalent vaccine can be augmented by natural L3 infections providing protection to the vaccinated host. This hypothesis was tested using single dose of DNA and Protein or Protein alone of the BmHAT vaccination in gerbils followed by live trickle L3 infection as booster dose. Vaccine-induced protection in gerbils was determined by worm establishment, micropore chamber assay and by antibody dependant cell cytotoxicity (ADCC) assay. Results were compared with the traditional prime-boost vaccination regimen. Gerbils vaccinated with BmHAT and boosted with L3 trickle infection were protected 51% (BmHAT DNA-Protein) and 48% (BmHAT Protein) respectively. BmHAT vaccination plus L3 trickle booster generated significant titer of antigen-specific IgG antibodies comparable to the traditional prime boost vaccination approach. BmHAT vaccination plus L3 trickle booster also generated antigen-specific cells in the spleen of vaccinated animals and these cells secreted predominantly IFN-γ and IL-4 in response to the vaccine antigens. These studies thus show that single dose of BmHAT multivalent vaccination followed by L3 trickle booster infection can confer significant protection against lymphatic filariasis. PMID:23735679

  5. Comparative studies on the biology and filarial susceptibility of selected blood-feeding and autogenous Aedes togoi sub-colonies

    Directory of Open Access Journals (Sweden)

    Anuluck Junkum

    2003-06-01

    Full Text Available Blood-feeding and autogenous sub-colonies were selected from a laboratory, stock colony of Aedes togoi, which was originally collected from Koh Nom Sao, Chanthaburi province, Southeast Thailand. Comparative biology and filarial susceptibility between the two sub-colonies (blood-feeding: F11, F13; autogeny: F38, F40 were investigated to evaluate their viability and vectorial capacity. The results of comparison on biology revealed intraspecific differences, i.e., the average egg deposition/gravid female (F11/F38; F13/F40, embryonation rate (F13/F40, hatchability rate (F11/F38; F13/F40, egg width (F11/F38, wing length of females (F13/F40, and wing length and width of males (F11/F38 in the blood-feeding sub-colony were significantly greater than that in the autogenous sub-colony; and egg length (F11/F38 and width (F13/F40, and mean longevity of adult females (F11/F38 and males (F13/F40 in the blood-feeding sub-colony were significantly less than that in the autogenous sub-colony. The results of comparison on filarial susceptibility demonstrated that both sub-colonies yielded similar susceptibilities to Brugia malayi [blood-feeding/autogeny = 56.7% (F11/53.3%(F38, 60%(F13/83.3%(F40] and Dirofilaria immitis [blood-feeding/autogeny = 85.7%(F11/75%(F38, 45%(F13/29.4%(F40], suggesting autogenous Ae. togoi sub-colony was an efficient laboratory vector in study of filariasis.

  6. Gregarious settlement in cypris larvae: the effects of cyprid age and assay duration

    NARCIS (Netherlands)

    Head, R.M.; Berntsson, K.M.; Dahlström, M.; Overbeke, J.C.; Thomason, J.C.

    2004-01-01

    Gregarious behaviour of marine larvae is perhaps most clearly associated with finding a suitable habitat in a changeable or restricted environment, or with finding other conspecifics with which to mate. Prior work has shown that in settlement assays using cypris larvae of the barnacle Balanus

  7. The Effect of Water Content of Medium Containing Oryctes rhinoceros Larvae on Metarhizium anisopliae Pathogenicity

    Directory of Open Access Journals (Sweden)

    Dyah Rini Indriyanti

    2017-08-01

    Full Text Available The entomopathogenic fungus, Metarhizium anisopliae (Metschnikoff Sorokin (Ascomycota: Hypocrealeswould effectively infect the target host on the appropriate medium water content. The aim of this study was to analyze the influence of water content of medium on the effectiveness of M. anisopliae fungus infection on O. rhinoceros larvae in the laboratory. Fifty healthy third instar larvae of O. rhinoceros were  obtained from field. The M. anisopliae obtained from Estate Crop Protection Board in Salatiga. The conidia density and viability of M. anisopliae were examined before used. The medium for maintaining the larva was the sawdust that had been sterilized. A total of 50 plastic cups were prepared to place 50 larvae (1 larva/cup. Each cup was filled with 100 g medium  of sawdust plus 2 g of M. anisopliae which was then stirred until mixed, with different water content: P1 (20%, P2 (40%, P3 (60%, P4 (80% and P5 (98%. The result indicated that  the water content of the medium affected the effectiveness of M. anisopliae fungus infection on O. rhinoceros larvae. The water content influenced the duration of larval mortality at each treatment. An important finding in this study is that controlling O. rhineceros larvae  with M. anisopliae can be done by manipulating the water content of medium. The benefit of this study may be used for the recommendation of O. rhinoceros pest control using M. anisopliae  with an effective water media content.

  8. Methodical aspects of rearing decapod larvae, Pagurus bernhardus (Paguridae) and Carcinus maenas (Portunidae)

    Science.gov (United States)

    Dawirs, R. R.

    1982-12-01

    Improved methods for experimental rearing of Pagurus bernhardus and Carcinus maenas larvae are presented. Isolated maintenance was found essential for reliable statistical evaluation of results obtained from stages older than zoea-1. Only by isolated rearing is it possible to calculate mean values ±95% confidence intervals of stage duration. Mean values (without confidence intervals) can only be given for group-reared larvae if mortality is zero. Compared to group rearing, isolated rearing led to better survival, shorter periods of development and stimulated growth. Due to different swimming behavior P. bernhardus zoeae needed larger water volumes than Carcinus maenas larvae. P. bernhardus zoeae were reared with best results when isolated in Petri dishes (ca. 50 ml). They fed on newly hatched brine shrimp nauplii ( Artemia spp.). P. bernhardus megalopa did not require any gastropod shell or substratum; it developed best in glass vials without any food. C. maenas larvae could be reared most sucessfully in glass vials (ca 20 ml) under a simulated day-night regime (LD 16:8); constant darkness had a detrimental effect on development, leading to prolonged stage-duration times. C. maenas larvae were fed a mixture of newly hatched brine shrimp naupli and rotifers ( Brachionus plicatilis).

  9. Effects of pesticides on DNA and protein of shrimp larvae Litopenaeus stylirostris of the California Gulf.

    Science.gov (United States)

    Galindo Reyes, J Guillermo; Leyva, Nancy R; Millan, Olivia A; Lazcano, Guadalupe A

    2002-10-01

    Recently, diverse pathologies and massive mortalities have been presented in shrimp hatcheries located along the California Gulf; therefore, toxic responses of shrimp larvae were used as biomarkers of pesticide pollution, because in this region intensive agriculture is practiced. Shrimp larvae were exposed to DDT, azinphosmethyl, permethrine, parathion, chlorpyrifos, malathion, endosulfan, and carbaryl, in order to determine LC50, DNA adducts and/or breaks, and total protein in larvae. The results indicate reductions in protein and DNA in larvae exposed to these pesticides, and in those exposed to DDT, breaks and/or adducts were registered. It is possible that pesticide pollution is a cause of these problems, because reduction in protein indicates a decrease in larvae growth rate and DNA breaks or adducts have been related to pathologies and carcinogenesis in many aquatic organisms.

  10. Marine Invertebrate Larvae Associated with Symbiodinium: A Mutualism from the Start?

    Directory of Open Access Journals (Sweden)

    Miguel Mies

    2017-05-01

    Full Text Available Symbiodinium are dinoflagellate photosynthetic algae that associate with a diverse array of marine invertebrates, and these relationships are comprehensively documented for adult animal hosts. Conversely, comparatively little is known about the associations during larval development of animal hosts, although four different metazoan phyla (Porifera, Cnidaria, Acoelomorpha, and Mollusca produce larvae associated with Symbiodinium. These phyla represent considerable diversities in larval forms, manner of symbiont acquisition, and requirements on the presence of symbionts for successful metamorphosis. Importantly, the different requirements are conveyed by specific symbiont types that are selected by the host animal larvae. Nevertheless, it remains to be determined whether these associations during larval stages already represent mutualistic interactions, as evident from the relationship of Symbiodinium with their adult animal hosts. For instance, molecular studies suggest that the host larval transcriptome is nearly unaltered after symbiont acquisition. Even so, a symbiosis-specific gene has been identified in Symbiodinium that is expressed in larval host stages, and similar genes are currently being described for host organisms. However, some reports suggest that the metabolic exchange between host larvae and Symbiodinium may not cover the energetic requirements of the host. Here, we review current studies to summarize what is known about the association between metazoan larvae and Symbiodinium. In particular, our aim was to gather in how far the mutualistic relationship present between adult animals hosts and Symbiodinium is already laid out at the time of symbiont acquisition by host larvae. We conclude that the mutualistic relationship between animal hosts and algal symbionts in many cases is not set up during larval development. Furthermore, symbiont identity may influence whether a mutualism can be established during host larval stages.

  11. Marine Invertebrate Larvae Associated with Symbiodinium: A Mutualism from the Start?

    KAUST Repository

    Mies, Miguel

    2017-05-30

    Symbiodinium are dinoflagellate photosynthetic algae that associate with a diverse array of marine invertebrates, and these relationships are comprehensively documented for adult animal hosts. Conversely, comparatively little is known about the associations during larval development of animal hosts, although four different metazoan phyla (Porifera, Cnidaria, Acoelomorpha, and Mollusca) produce larvae associated with Symbiodinium. These phyla represent considerable diversities in larval forms, manner of symbiont acquisition, and requirements on the presence of symbionts for successful metamorphosis. Importantly, the different requirements are conveyed by specific symbiont types that are selected by the host animal larvae. Nevertheless, it remains to be determined whether these associations during larval stages already represent mutualistic interactions, as evident from the relationship of Symbiodinium with their adult animal hosts. For instance, molecular studies suggest that the host larval transcriptome is nearly unaltered after symbiont acquisition. Even so, a symbiosis-specific gene has been identified in Symbiodinium that is expressed in larval host stages, and similar genes are currently being described for host organisms. However, some reports suggest that the metabolic exchange between host larvae and Symbiodinium may not cover the energetic requirements of the host. Here, we review current studies to summarize what is known about the association between metazoan larvae and Symbiodinium. In particular, our aim was to gather in how far the mutualistic relationship present between adult animals hosts and Symbiodinium is already laid out at the time of symbiont acquisition by host larvae. We conclude that the mutualistic relationship between animal hosts and algal symbionts in many cases is not set up during larval development. Furthermore, symbiont identity may influence whether a mutualism can be established during host larval stages.

  12. Locomotion and attachment of leaf beetle larvae Gastrophysa viridula (Coleoptera, Chrysomelidae).

    Science.gov (United States)

    Zurek, Daniel B; Gorb, Stanislav N; Voigt, Dagmar

    2015-02-06

    While adult green dock leaf beetles Gastrophysa viridula use tarsal adhesive setae to attach to and walk on smooth vertical surfaces and ceilings, larvae apply different devices for similar purposes: pretarsal adhesive pads on thoracic legs and a retractable pygopod at the 10th abdominal segment. Both are soft smooth structures and capable of wet adhesion. We studied attachment ability of different larval instars, considering the relationship between body weight and real contact area between attachment devices and the substrate. Larval gait patterns were analysed using high-speed video recordings. Instead of the tripod gait of adults, larvae walked by swinging contralateral legs simultaneously while adhering by the pygopod. Attachment ability of larval instars was measured by centrifugation on a spinning drum, revealing that attachment force decreases relative to weight. Contributions of different attachment devices to total attachment ability were investigated by selective disabling of organs by covering them with melted wax. Despite their smaller overall contact area, tarsal pads contributed to a larger extent to total attachment ability, probably because of their distributed spacing. Furthermore, we observed different behaviour in adults and larvae when centrifuged: while adults gradually slipped outward on the centrifuge drum surface, larvae stayed at the initial position until sudden detachment.

  13. Detrimental effects of geldanamycin on adults and larvae of Trichinella spiralis

    Directory of Open Access Journals (Sweden)

    Othman A. A.

    2016-06-01

    Full Text Available Trichinellosis is a zoonotic disease affecting mainly the temperate regions. The treatment is a challenge for the physician, and the available therapy is far from ideal. Therefore, this work aimed to evaluate the effect of heat shock protein 90 inhibitor, geldanamycin, on the adult worms and larvae of Trichinella spiralis. This research comprised an in vivo study in which T. spiralis-infected mice were treated by two different doses of geldanamycin, thereafter larval count and pathological changes were determined in the muscles. Meanwhile, the in vitro study investigated the effect of two different concentrations of geldanamycin on adult worms and larvae of T. spiralis via transmission electron microscopy. The in vivo study showed significant reduction of muscle larval counts under the effect of geldanamycin. Moreover, characteristic changes were noted as regards the parasite and the inflammatory response. The in vitro study revealed degenerative changes in the body wall of larvae and adults of T. spiralis under the influence of geldanamycin. In conclusion, heat shock protein 90 inhibitor, geldanamycin, seems to have detrimental effects on the adults and larvae of T. spiralis. It, or one of its derivatives, could be an adjuvant to anthelmintic therapy of trichinellosis, but more studies are warranted to establish its usefulness.

  14. Development of Tribolium castaneum (Herbst) larvae after gamma irradiation of eggs

    International Nuclear Information System (INIS)

    Mehta, V.K.; Sethi, G.R.; Garg, A.K.

    1990-01-01

    Development of Rust-red flour beetle, Tribolium castaneum larvae, after gamma irradiation of eggs of two different age groups was studied. Results indicated that, if 2 to 3 day old eggs were irradiated with 6 Krad, the development of larvae emerging from such eggs is completely arrested at the end of 18 days after hatching. In case of comparatively older eggs (3 to 4 day old), 8 Krad dose of gamma radiation was required to produce the similar results. However, treatment with 10 Krad resulted in 100 per cent egg mortality in both the age groups. The studies thus reveal that survival of the larvae depends not only on the radiation dose and the time period elapsed after irradiation but also on the age of eggs at the time of exposure. (author). 9 refs., 1 tab

  15. Rate of sediment intake by midge larvae (Chironomus plumosus: diptera) using a 134Cs tracer

    International Nuclear Information System (INIS)

    Gerking, S.D.; Berg, A.; Gerard, P.

    1976-01-01

    The food intake and assimilation of midge larvae (Chironomus plumosus) were determined by a 134 Cs technique which utilized the principle that the rate of excretion can be substituted for the rate of absorption when the larvae are in 134 Cs equilibrium with their environment. The larvae were introduced into contaminated sediments until they reached 134 Cs equilibrium. The time of reaching equilibrium and levels of radioactivity were the same at 10 and at 15 0 C (70 hr at a level of 1367 dpm/mg of larva) and were both significantly different from that at 20 0 C (40 hr at 1062 dpm/mg of larva). Cesium-134 elimination was followed on equilibrated larvae for as long as 330 hr. One egestion compartment (fast) and two excretion (medium and slow) compartments could be recognized at the three experimental temperatures. The loss rates from the second and third compartments at 10 0 C were slower and stretched out over longer time periods compared with those at 15 0 C, while the loss rate from the first compartment was much more comparable at the two temperatures. The first and second compartments merged at 20 0 C, while the slow compartment rose to almost three times that at 15 0 C. The food intake was nearly the same at the three temperatures (0.0986, 0.0893 and 0.0876 mg dry sediment/mg of larva/day). Thus, the larvae relied on an increase in assimilation to meet increased metabolic requirements at higher temperatures rather than depending upon a higher food intake. The gross growth efficiencies varied with temperature from 9.9 percent at 10 0 C to 15.1 percent at 15 0 C

  16. Modeling peripheral olfactory coding in Drosophila larvae.

    Directory of Open Access Journals (Sweden)

    Derek J Hoare

    Full Text Available The Drosophila larva possesses just 21 unique and identifiable pairs of olfactory sensory neurons (OSNs, enabling investigation of the contribution of individual OSN classes to the peripheral olfactory code. We combined electrophysiological and computational modeling to explore the nature of the peripheral olfactory code in situ. We recorded firing responses of 19/21 OSNs to a panel of 19 odors. This was achieved by creating larvae expressing just one functioning class of odorant receptor, and hence OSN. Odor response profiles of each OSN class were highly specific and unique. However many OSN-odor pairs yielded variable responses, some of which were statistically indistinguishable from background activity. We used these electrophysiological data, incorporating both responses and spontaneous firing activity, to develop a bayesian decoding model of olfactory processing. The model was able to accurately predict odor identity from raw OSN responses; prediction accuracy ranged from 12%-77% (mean for all odors 45.2% but was always significantly above chance (5.6%. However, there was no correlation between prediction accuracy for a given odor and the strength of responses of wild-type larvae to the same odor in a behavioral assay. We also used the model to predict the ability of the code to discriminate between pairs of odors. Some of these predictions were supported in a behavioral discrimination (masking assay but others were not. We conclude that our model of the peripheral code represents basic features of odor detection and discrimination, yielding insights into the information available to higher processing structures in the brain.

  17. Influence of larval period on responses of overwintering green frog (Rana clamitans) larvae exposed to contaminated sediments

    Energy Technology Data Exchange (ETDEWEB)

    Snodgrass, J.W.; Hopkins, W.A.; Jackson, B.P.; Baionno, J.A.; Broughton, J. [Towson State University, Towson, MD (US). Dept. of Biological Science

    2005-06-01

    Pond-breeding amphibians exhibit large intra- and interspecific differences in the duration of the aquatic larval phase. In contaminated aquatic environments, a prolonged larval phase means prolonged exposure to pollutants and, potentially, more severe toxic effects. In the laboratory, we tested this hypothesis by exposing green frog larvae (Rana clamitans) to commercial clean sand (control), sediment from an abandoned surface mine (mine), or sediment contaminated with coal combustion waste (CCW). By collecting eggs late in the breeding season, we obligated larvae to overwinter and spend a protracted amount of time exposed to contaminated sediments. The experiment was continued until all larvae either successfully completed metamorphosis or died (301 d). Larvae exposed to mine sediments accumulated significant levels of Pb and Zn, whereas larvae exposed to CCW-contaminated sediment accumulated significant levels of As, Se, Sr, and V. Larvae exposed to mine sediments suffered sublethal effects in the form of reduced growth and size at metamorphosis, but the proportion of larvae successfully completing metamorphosis (93%) was the same for both control and mine treatments. In contrast, larvae exposed to CCW-contaminated sediment suffered greatly reduced survival (13%) compared to both control and mine treatments. Moreover, among larvae in the CCW treatment, the majority of mortality occurred during the latter part the overwintering period (after day 205), corresponding to the onset of metamorphosis in the controls. Our results suggest that the length of the larval period may be one of many life-history or ecological characteristics that influence the sensitivity of aquatic breeding amphibians to environmental pollutants.

  18. Ultrastructural observations of the larva of Tubiluchus corallicola (Priapulida)

    Science.gov (United States)

    Higgins, R. P.; Storch, V.

    1989-03-01

    Larvae of Tubiluchus corallicola van der Land 1968 were investigated by scanning and transmission electron microscopy. The scalids are sensory organs, each has a bipolar receptor cell with a single apical cilium similar to the scalid in the adult. Muscle cells of the larva are more differentiated than previously reported for other Priapulida; the larval arrangement of circular and longitudinal musculature differs from that of the adult, and a diaphragm is reported for the first time in Priapulida. The diaphragm may function in hydrostatic control of eversion and inversion of the introvert and mouth cone. The functional morphology of these two structures is discussed and contrasted with the Kinorhyncha.

  19. Chemical composition and fatty acid profile of edible larva of Cirina ...

    African Journals Online (AJOL)

    The nutrient composition of the larva of Cirina forda (Westwood) was determined. It contained 33.12 (0.87 g/100g crude protein, 9.40 (0.16 g/100g crude fibre, 12.24 (18 g/ 100g fat, 7.12 ( 0.32 gl 100g ash, 38.12 (0.65 g/ 100g carbohydrate and gross energy value of 359 (2.83 Kcal/ 100g. The larva is an excellent source of ...

  20. External morphology of the two cypridiform ascothoracid-larva instars of Dendrogaster: The evolutionary significance of the two-step metamorphosis and comparison of lattice organs between larvae and adult males (Crustacea, Thecostraca, Ascothoracida)

    DEFF Research Database (Denmark)

    Kolbasov, G.A.; Grygier, M.J.; Høeg, Jens Thorvald

    2008-01-01

    We describe the external morphology of the two cypridiform larval instars (first and second ascothoracid-larvae, or -a-cyprids") of the ascothoracidan genus Dendrogaster. Ascothoracid-larvae of five species were studied with light and scanning electron microscopy, including both ascothoracid-larv...

  1. Molecular identification of nematode larvae different from those of the Trichinella genus detected by muscle digestion.

    Science.gov (United States)

    Marucci, Gianluca; Interisano, Maria; La Rosa, Giuseppe; Pozio, Edoardo

    2013-05-20

    Although larvae of the genus Trichinella are the most common parasite species detected in vertebrate muscles using artificial digestion, nematode larvae belonging to other genera are sometimes detected and incorrectly identified as Trichinella. However, it is often very difficult to identify these larvae at the species, genus or family level using microscopy because of the absence of specific morphological characters or cuticle damage, and the only means of identification is PCR and sequencing of specific molecular markers (12S mtDNA; COI; 18S rDNA; and ITS1). From 2008 to 2011, 18 nematode isolates not belonging to the genus Trichinella were collected from different host species. Eleven of these isolates were successfully identified at the species, genus or superfamily level: larvae from two common kestrels, three hooded crows, a hen harrier and a domestic pig were identified as Toxocara cati; larvae from a badger were identified as Toxocara canis; larvae from a domestic pig were identified as a free-living nematode of the genus Panagrolaimus; larvae from a wild boar were identified as belonging to the Metastrongylus genus; and larvae from a rough-legged buzzard were identified as belonging to the superfamily Filarioidea. The recovery of nematodes belonging to genera other than Trichinella during routine meat inspection suggests that the persons performing the analyses need to be informed of the possibility of false positives and that a molecular-based identification system that allows for a rapid and reliable response must be adopted (i.e., a DNA barcoding-like system). Copyright © 2013 Elsevier B.V. All rights reserved.

  2. Effects of kinship or familiarity? Small thrips larvae experience lower predation risk only in groups of mixed-size siblings

    NARCIS (Netherlands)

    de Bruijn, P.J.A.; Sabelis, M.W.; Egas, M.

    2014-01-01

    In many species of insects, larvae are distributed in an aggregated fashion. As they may differ in size and size matters to predation risk, small larvae may be less likely to fall prey to predators when near large and therefore better-defended larvae. We hypothesize that the small larvae may profit

  3. Nutritional Transition Period in Early Larvae Clarias Gariepinus

    International Nuclear Information System (INIS)

    Ing, N.S.; Chew, H.H.

    2015-01-01

    The nutritional transition period of Clarias gariepinus were described based on the early development from hatching to 120 hours after hatching (hAH) reared at 27.5 - 28.6 degree Celsius. Newly hatched larvae had a large greenish yolk sac volume (0.99 ± 0.31 mm"3) located below a straight undeveloped digestive tract, mouth not opened, eyes unpigmented and the larvae lie on the bottom of rearing tank. During endogenous feeding period, the larval feeding system has developed rapidly with development oesophagus. Yolk sac were not completely depleted at the onset of exogenous feeding (36 hAH, 0.19 ± 0.11 mm"3), and a period of mixed nutrition was observed up to 68 hAH when yolk was completely exhausted. Yolk sac volume was significantly different by time at hatching, 6, 12 and 18 to 36 hAH (ANOVA, P<0.05). At 36 hAH, the larvae commenced feeding once morphologically developed with opened anus, functional jaw and intestine, and demonstrated horizontally swimming. The rudimentary chemoreceptors like olfactory organs and taste buds that were found on the barbels and oral cavity assisted in food detection and commenced feeding without vision. Due to the cannibalistic behaviour at early stage, feed are suggested to be provided during 36 hAH and avoided delay feeding in the larval rearing. (author)

  4. Infection of silkworm larvae by the entomopathogenic fungus Metarhizium anisopliae

    Directory of Open Access Journals (Sweden)

    Lucineia de Fátima Chasko Ribeiro

    Full Text Available ABSTRACT: The isolate E9 of Metarhizium anisopliae was used in commercial hybrids of Bombyx mori larvae to evaluate its biological effect. Symptomatological analyses showed typical signs of fungal infection. Histopathology revealed the presence of large numbers of hemocytes in the hemocoel, and on the sixth dpi the bodies of the insects appeared to be colonised by the fungus. The isolate E9 is pathogenic to larvae B. mori and; therefore, death of the insects was caused by the colonization of fungus in the epidermal and mesodermal tissues.

  5. Effects of algal diets and starvation on growth, survival and fatty acid composition of Solen marginatus (Bivalvia: Solenidae larvae

    Directory of Open Access Journals (Sweden)

    Fiz Da Costa

    2012-08-01

    Full Text Available The aim of this study was to investigate whether it is necessary to feed Solen marginatus (Pennánt, 1777 larvae externally and the evolution of fatty acids in the neutral and polar lipids during larval development in starved larvae and larvae fed on two different microalgal diets. Larvae were subjected to three different treatments: 1. 10 equivalent cells (Isochrysis galbana, Pavlova lutheri and Chaetoceros calcitrans plus 20 equivalent cells of Tetraselmis suecica; 2. 80 equivalent cells of I. galbana and 3. starvation during eight days, and then individuals were re-fed on diet 1. The best results for growth were observed in larvae fed on diet 1. Starved larvae reached the best survival rate at day 8 (66%. However, three days after re-feeding all larvae died, suggesting that the “point of no return” was exceeded. In spite of the large size of S. marginatus eggs and the great amount of stored reserves, the larvae need to feed on microalgae to undergo metamorphosis. Non-methyle-interrupted dienoic fatty acids and their precursors 16:1n-7 and 18:1n-9 are of great importance in starved larvae. Saturated fatty acids, especially 16:0, fuel larval development. A certain degree of bioconversion of 18:2n-6 to 20:4n-6 was observed in S. marginatus larvae.

  6. Efficacy of photodynamic therapy against larvae of Aedes aegypti: confocal microscopy and fluorescence-lifetime imaging

    Science.gov (United States)

    de Souza, L. M.; Pratavieira, S.; Inada, N. M.; Kurachi, C.; Corbi, J.; Guimarães, F. E. G.; Bagnato, V. S.

    2014-03-01

    Recently a few demonstration on the use of Photodynamic Reaction as possibility to eliminate larvae that transmit diseases for men has been successfully demonstrated. This promising tool cannot be vastly used due to many problems, including the lake of investigation concerning the mechanisms of larvae killing as well as security concerning the use of photosensitizers in open environment. In this study, we investigate some of the mechanisms in which porphyrin (Photogem) is incorporated on the Aedes aegypti larvae previously to illumination and killing. Larvae at second instar were exposed to the photosensitizer and after 30 minutes imaged by a confocal fluorescence microscope. It was observed the presence of photosensitizer in the gut and at the digestive tract of the larva. Fluorescence-Lifetime Imaging showed greater photosensitizer concentration in the intestinal wall of the samples, which produces a strong decrease of the Photogem fluorescence lifetime. For Photodynamic Therapy exposition to different light doses and concentrations of porphyrin were employed. Three different light sources (LED, Fluorescent lamp, Sun light) also were tested. Sun light and fluorescent lamp shows close to 100% of mortality after 24 hrs. of illumination. These results indicate the potential use of photodynamic effect against the LARVAE of Aedes aegypti.

  7. Effects of gamma radiation on respiration of larvae of Pieris brassicae L

    International Nuclear Information System (INIS)

    Miah, M.A.H.

    1979-01-01

    The oxygen consumption and respiratory quotient of larvae of Pieris brassicae, the cabbage white butterfly were studied following treatment with 6, 9 and 12 krad of gamma radiation from a 60 Co source. The dose rate was 1.229 krad/min. Oxygen consumption and R.Q. were measured at 25 0 C with a Warburg respirometer. There was no difference in oxygen consumption and R.Q. between larvae of each sex though the rate of oxygen consumption with body weight increased in females and decreased in males. Irradiation did not produce any noticeable change in oxygen consumption of larvae. But the R.Q.'s in the treated individuals were higher than in the untreated ones indicating greater use of carbohydrates. (author)

  8. Toxocara cati larva migrans in domestic pigs - detected at slaughterhouse control in Norway

    Directory of Open Access Journals (Sweden)

    Davidson Rebecca K

    2012-11-01

    Full Text Available Abstract Routine Trichinella meat inspection at the slaughterhouse detected one larva in a pooled batch of 100 pig samples. The larva was sent to the Norwegian Veterinary Institute (NVI for species identification. Morphological examination revealed that the larva was not Trichinella spp. Molecular analysis was performed. PCR and sequencing of 5S/ITS identified the larva as Toxocara cati. A second round of digests was carried out at the meat inspection laboratory, in smaller batches to try to identify the infected animal. No further larvae were detected and it was not possible to identify which of the 100 animals the larva had come from. This is the first time that Toxocara cati has been reported in slaughterhouse pigs in Norway. Although the infected individual could not be identified, the meat originated from one of six potential farms. A small survey regarding rodent control and cats was sent to each of these farms. Cats had restricted access to food storage areas (two farms reported that cats had access whilst none of the farms allowed cats into the production housing. Cats were, however, present on all the farms (mostly stray cats of unknown health status. Half of the farms also reported seeing rodents in the pig housing during the previous six months and half reported finding rodents in the feed and straw storage areas. We were unable to narrow down the source of infection – however contamination of food or bedding material, with cat faeces or infected rodents, in addition to the presence of infected rodents in pig housing remain potential routes of infection.

  9. Body size, swimming speed, or thermal sensitivity? Predator-imposed selection on amphibian larvae.

    Science.gov (United States)

    Gvoždík, Lumír; Smolinský, Radovan

    2015-11-02

    Many animals rely on their escape performance during predator encounters. Because of its dependence on body size and temperature, escape velocity is fully characterized by three measures, absolute value, size-corrected value, and its response to temperature (thermal sensitivity). The primary target of the selection imposed by predators is poorly understood. We examined predator (dragonfly larva)-imposed selection on prey (newt larvae) body size and characteristics of escape velocity using replicated and controlled predation experiments under seminatural conditions. Specifically, because these species experience a wide range of temperatures throughout their larval phases, we predict that larvae achieving high swimming velocities across temperatures will have a selective advantage over more thermally sensitive individuals. Nonzero selection differentials indicated that predators selected for prey body size and both absolute and size-corrected maximum swimming velocity. Comparison of selection differentials with control confirmed selection only on body size, i.e., dragonfly larvae preferably preyed on small newt larvae. Maximum swimming velocity and its thermal sensitivity showed low group repeatability, which contributed to non-detectable selection on both characteristics of escape performance. In the newt-dragonfly larvae interaction, body size plays a more important role than maximum values and thermal sensitivity of swimming velocity during predator escape. This corroborates the general importance of body size in predator-prey interactions. The absence of an appropriate control in predation experiments may lead to potentially misleading conclusions about the primary target of predator-imposed selection. Insights from predation experiments contribute to our understanding of the link between performance and fitness, and further improve mechanistic models of predator-prey interactions and food web dynamics.

  10. Temperature-dependent settlement of planula larvae of two scyphozoan jellyfish from the North Sea

    Science.gov (United States)

    Gambill, Maria; McNaughton, Sadie L.; Kreus, Markus; Peck, Myron A.

    2018-02-01

    Exploring the settlement dynamics of the planula larvae is critical to understanding the establishment of polyp populations that can give rise to blooms of scyphozoan jellyfish. We conducted experiments to examine the effects of temperature on settlement of planulae of the scyphozoans Cyanea lamarckii and Chrysaora hysoscella, two jellyfish commonly encountered within the North Sea. When provided immediate access to substrate, larvae of C. lamarckii were able to settle at each of 12 temperatures between 9 and 27 °C. Most settlement occurred within the first five days and warmer temperatures were not only associated with decreased time to settlement but also increased settlement success. When not allowed access to substrate and maintained in the water column, planula larvae remained competent to settle for 21, 21 and 14 days at 11.3, 13.4 and 19.4 °C, respectively. Based on these maximum times of competency, hydrodynamic model simulations suggested that the planula larvae of C. lamarckii released in May could be transported up to 100 km before settlement. A substrate choice experiment indicated that larvae of C. hysoscella settled in similar numbers onto PET, wood and concrete. Settlement was highest at 20 °C and a 12/12 light/dark regime and lower at 10 °C and 15 °C in total darkness. The results of all three experiments suggest that projected warming of the North Sea will not impede the settlement of planula larvae of resident C. lamarckii and C. hysoscella populations. Species- and/or population-specific differences may exist in the ecophysiology of planula larvae and additional experiments are needed to understand the mechanisms promoting the establishment of new benthic populations of polyps. That information, combined with process knowledge on the productivity of benthic polyps, will be needed to better understand and predict climate-dependent changes in the production of scyphozoans and other gelatinous plankton.

  11. Energy density of zooplankton and fish larvae in the southern Catalan Sea (NW Mediterranean)

    Science.gov (United States)

    Barroeta, Ziortza; Olivar, M. Pilar; Palomera, Isabel

    2017-06-01

    In marine communities, energy of small planktonic organisms is transferred to their predators through feeding. The energy accumulated as organic substances by the different plankton organisms (Energetic Density content, ED) has been analysed in high latitudes and tropical areas, but not in the Mediterranean Sea. In this study, we approach this type of investigation for Mediterranean plankton through measures of total calorimetric content using an oxygen bomb calorimeter. We examined the spatiotemporal variation in the ED of microplankton (50-200 μm) and mesozooplankton (200-2000 μm), and two plankton-consumers, sardine (Sardina pilchardus) and anchovy (Engraulis encrasicolus) larvae. The study was carried out during the winter and summer of 2013 off the Ebro River Delta (NW Mediterranean Sea). Both plankton fractions showed a more coastal distribution and higher biomasses during winter, the period of sardine larvae occurrences, in front of a wider cross-shelf distribution and lower biomasses in summer, when anchovy appeared. ED values increased with the size of each plankton component, i.e., microzooplankton < mesozooplankton < fish larvae. A tendency for higher plankton ED in the winter period was observed, although being only significant for coastal zone, associated to the more productive waters there. Sardine and anchovy larvae showed an increasing trend in the amount of energy during development, with significantly lower ED between early larvae (6-10 mm standard length) and late postflexion stages (16-20 mm standard length). Small larvae of both species departed from a similarly low ED content, but in the next two size classes sardine larvae showed higher ED values than anchovy, being significantly higher in the 16-20 mm size class. Information on larval feeding patterns and larval growth rates for each species were used to discuss differences in energy allocation strategies.

  12. Ocean Acidification Has Multiple Modes of Action on Bivalve Larvae.

    Directory of Open Access Journals (Sweden)

    George G Waldbusser

    Full Text Available Ocean acidification (OA is altering the chemistry of the world's oceans at rates unparalleled in the past roughly 1 million years. Understanding the impacts of this rapid change in baseline carbonate chemistry on marine organisms needs a precise, mechanistic understanding of physiological responses to carbonate chemistry. Recent experimental work has shown shell development and growth in some bivalve larvae, have direct sensitivities to calcium carbonate saturation state that is not modulated through organismal acid-base chemistry. To understand different modes of action of OA on bivalve larvae, we experimentally tested how pH, PCO2, and saturation state independently affect shell growth and development, respiration rate, and initiation of feeding in Mytilus californianus embryos and larvae. We found, as documented in other bivalve larvae, that shell development and growth were affected by aragonite saturation state, and not by pH or PCO2. Respiration rate was elevated under very low pH (~7.4 with no change between pH of ~ 8.3 to ~7.8. Initiation of feeding appeared to be most sensitive to PCO2, and possibly minor response to pH under elevated PCO2. Although different components of physiology responded to different carbonate system variables, the inability to normally develop a shell due to lower saturation state precludes pH or PCO2 effects later in the life history. However, saturation state effects during early shell development will carry-over to later stages, where pH or PCO2 effects can compound OA effects on bivalve larvae. Our findings suggest OA may be a multi-stressor unto itself. Shell development and growth of the native mussel, M. californianus, was indistinguishable from the Mediterranean mussel, Mytilus galloprovincialis, collected from the southern U.S. Pacific coast, an area not subjected to seasonal upwelling. The concordance in responses suggests a fundamental OA bottleneck during development of the first shell material

  13. Ocean Acidification Has Multiple Modes of Action on Bivalve Larvae.

    Science.gov (United States)

    Waldbusser, George G; Hales, Burke; Langdon, Chris J; Haley, Brian A; Schrader, Paul; Brunner, Elizabeth L; Gray, Matthew W; Miller, Cale A; Gimenez, Iria; Hutchinson, Greg

    2015-01-01

    Ocean acidification (OA) is altering the chemistry of the world's oceans at rates unparalleled in the past roughly 1 million years. Understanding the impacts of this rapid change in baseline carbonate chemistry on marine organisms needs a precise, mechanistic understanding of physiological responses to carbonate chemistry. Recent experimental work has shown shell development and growth in some bivalve larvae, have direct sensitivities to calcium carbonate saturation state that is not modulated through organismal acid-base chemistry. To understand different modes of action of OA on bivalve larvae, we experimentally tested how pH, PCO2, and saturation state independently affect shell growth and development, respiration rate, and initiation of feeding in Mytilus californianus embryos and larvae. We found, as documented in other bivalve larvae, that shell development and growth were affected by aragonite saturation state, and not by pH or PCO2. Respiration rate was elevated under very low pH (~7.4) with no change between pH of ~ 8.3 to ~7.8. Initiation of feeding appeared to be most sensitive to PCO2, and possibly minor response to pH under elevated PCO2. Although different components of physiology responded to different carbonate system variables, the inability to normally develop a shell due to lower saturation state precludes pH or PCO2 effects later in the life history. However, saturation state effects during early shell development will carry-over to later stages, where pH or PCO2 effects can compound OA effects on bivalve larvae. Our findings suggest OA may be a multi-stressor unto itself. Shell development and growth of the native mussel, M. californianus, was indistinguishable from the Mediterranean mussel, Mytilus galloprovincialis, collected from the southern U.S. Pacific coast, an area not subjected to seasonal upwelling. The concordance in responses suggests a fundamental OA bottleneck during development of the first shell material affected only by

  14. Susceptibilidade de larvas de Cerotoma arcuata Olivier (Coleoptera: Chrysomelidae a Beauveria bassiana (Bals. Vuillemin, Metarhizium anisopliae (Metsch. Sorokin e Bacillus thuringiensis Berliner Susceptibility of Cerotoma arcuata Olivier (Coleoptera: Chrysomelidae larvae to Beauveria bassiana (Bals. Vuillemin, Metarhizium anisopliae (Metsch. Sorokin and Bacillus thuringiensis Berliner

    Directory of Open Access Journals (Sweden)

    Maria Lucia França Teixeira

    2007-02-01

    Full Text Available Larvas de 2° instar de Cerotoma arcuata foram avaliadas em relação à susceptibilidade aos fungos entomopatogênicos Beauveria bassiana, Metarhizium anisopliae e a bactéria Bacillus thuringiensis com as toxinas Cry3. Os insetos adultos foram mantidos em gaiolas e alimentados com plântulas de feijão (Phaseolus vulgaris L. e as larvas em "gerbox" com cotilédones de plântulas de feijão recém-germinadas. Das oito estirpes de B. bassiana avaliadas, CG 156 e CG 213 causaram 100% de mortalidade das larvas, as duas estirpes de M. anisopliae CG 210 e CG 321 foram patogênicas, eliminando 80 e 100% das larvas de C. arcuata, e, das cinco estirpes de B. thuringiensis testadas, o isolado CG 940 causou 70% de mortalidade das larvas.Second instar larvae of Cerotoma arcuata were evaluated concerning the susceptibility to fungi Beauveria bassiana and Metarhizium anisopliae and Bacillus thuringiensis strains containing Cry3 toxin. Adults of C. arcuata were kept in large cages and fed on bean seedlings and the larvae were reared in ‘gearbox’ feeding on germinated Phaseolus bean cotyledons. Strains CG 156 and CG 213 of B. bassiana killed 100% of the insect larvae and strains CG 210 and CG 321 of M. anisopliae killed 80 and 100% of the insect larvae. Strain CG 940 of B. thuringiensis killed 70% of the insect larvae.

  15. Reduction of Escherichia coli, Salmonella Enteritidis and Campylobacter jejuni in poultry manure by rearing of Musca domestica fly larvae

    DEFF Research Database (Denmark)

    Nordentoft, Steen; Fischer, C.; Bjerrum, L.

    2017-01-01

    A major barrier for using animal waste as substrate for production of insects for feed or food is the concern for safety of the end products. In this study we investigated how rearing of fly larvae of Musca domestica in poultry manure influenced the counts of three pathogenic test strains...... of the larvae stage. This study provides data for evaluation of feed safety of fly larvae reared on animal waste. Furthermore suggests a potential use for reduction of these pathogens in manure........ Enteritidis, and C. jejuni was faster in manure with rearing of fly larvae than in manure without larvae; an 8 log10 reduction of all three test bacteria was observed within four days in manure with larvae; compared to manure without larvae where a 1 to 2 log10 was observed. We found no sign of propagation...

  16. Dynamic of decapod crustacean larvae on the entrance of Guanabara bay

    Directory of Open Access Journals (Sweden)

    Lohengrin Dias de Almeida Fernandes

    2002-12-01

    Full Text Available In the present study, we observed seasonal variations in the density of decapod larvae as well as changes in density related to diurnal and tidal cycles. Among the decapod larvae collected, portunids and grapsids were the most abundant, especially during nocturnal ebb tides and near the surface. The same results were obtained in late winter (September and late summer (March. These results demonstrated a flow of decapod larvae from Guanabara Bay to adjacent coastal waters. Luciferid (Lucifer faxoni was the only group with high densities during flood tides and we suggest this is an evidence of L. faxoni larvae entering Guanabara Bay in late winter. Probably these changes in distribution of Lucifer faxoni among winter and summer were related to reproductive cycle in the bay. For the portunids, grapsids and ocypodids, a similar dispersion strategy was observed towards adjacent coastal waters in the surface during nocturnal ebb tides.Larvas de crustáceos decápodes são organismos planctônicos comuns tanto em regiões costeiras rasas como em estuários. Nesse trabalho, foi acompanhada a variação da densidade das larvas de decápodes num ponto estratégico entre a porção interior da baía de Guanabara e a região costeira adjacente. A coleta de grandes quantidades de zoés de braquiúros, principalmente das famílias Portunidae e Grapsidae, na superfície durante as marés de vazante noturnas sugere uma tendência de exportação para a região costeira adjacente. A repetição desse padrão no inverno e no verão demonstrou que as respostas dos organismos às variações de luz e maré não foram alteradas de modo significativo entre as duas estações do ano, exceto para os luciferídeos. O fluxo observado para a única espécie de luciferídeo capturada (Lucifer faxoni foi significativamente diferente entre os dois períodos do ano analisados. É provável que essas diferenças na distribuição de Lucifer faxoni seja relacionada ao ciclo

  17. Development of Metarhizium anisopliae and Beauveria bassiana formulations for control of malaria mosquito larvae

    NARCIS (Netherlands)

    Bukhari, S.T.; Takken, W.; Koenraadt, C.J.M.

    2011-01-01

    Background The entomopathogenic fungi Metarhizium anisopliae and Beauveria bassiana have demonstrated effectiveness against anopheline larvae in the laboratory. However, utilising these fungi for the control of anopheline larvae under field conditions, relies on development of effective means of

  18. High mortality of the larvae of the common mussel at low concentrations of tributyltin

    Energy Technology Data Exchange (ETDEWEB)

    Beaumont, A.R.; Budd, M.D.

    1984-11-01

    Laboratory reared veliger larvae of the common mussel Mytilus edulis were grown for 15 days in filtered seawater containing 10 ..mu..g l/sup -1/, 1 ..mu..g l/sup -1/ and 0.1 ..mu..g l/sup -1/ tributyltin oxide, (TBTO), the biocide in recent antifouling paint formulations. No larvae survived longer than 5 days in 10 ..mu..g l/sup -1/ TBTO. Approximately half the larvae subjected to 0.1 ..mu..g/sup -1/ TBTO were dead by day 15 (approximately 15 day LC/sub 50/ = 0.1 ..sqrt..g l/sup -1/ TBTO) and most of the surviving larvae were moribund and had grown significantly more slowly than controls. It is noted that current recorded levels of TBT at several UK estuarine sites are higher than 0.1 ..mu..g l/sup -1/ and there has therefore probably been a high mortality of mussel larvae at such sites. The results are discussed in relation to the reported short-term toxicity of organotins to other marine organisms and the value of carrying out longer term tests at low levels of TBT is pointed out.

  19. In vitro effects of household products on Calliphoridae larvae development: implication for forensic entomology.

    Science.gov (United States)

    Aubernon, Cindy; Devigne, Cedric; Hedouin, Valery; Gosset, Didier; Charabidze, Damien

    2015-01-01

    Several parameters can delay the first arrival of flies on a corpse and the subsequent development of the larvae. This study focuses on the development of Lucilia sericata (Diptera: Calliphoridae) (Meigen, 1826) on household chemical-contaminated substrates. bleach, perfume, hydrochloric acid, caustic soda, insecticide, mosquito repellent, and gasoline in quantities consistent with an amount that could possibly be spilled on a corpse were mixed with beef liver to simulate contaminated fleshes. Larvae were bred at 25 °C on these media until emergence. Four developmental parameters were followed: survival rates, development times, sex ratios, and adult sizes. Hydrochloric acid, insecticide, and gasoline killed all larvae. In low quantities, caustic soda and mosquito repellent increased the development time and decreased the adult size. However, high quantities of these chemicals killed all larvae. Lastly, bleach and perfume did not affect the survival rate and barely impacted the development time or adult size. These results demonstrate common household products spilled on a corpse can strongly affect the development of Calliphoridae larvae. The effects of such products should be considered in forensic entomology cases. © 2014 American Academy of Forensic Sciences.

  20. A novel mode of induction of the humoral innate immune response in Drosophila larvae

    Directory of Open Access Journals (Sweden)

    Hiroyuki Kenmoku

    2017-03-01

    Full Text Available Drosophila adults have been utilized as a genetically tractable model organism to decipher the molecular mechanisms of humoral innate immune responses. In an effort to promote the utility of Drosophila larvae as an additional model system, in this study, we describe a novel aspect of an induction mechanism for innate immunity in these larvae. By using a fine tungsten needle created for manipulating semi-conductor devices, larvae were subjected to septic injury. However, although Toll pathway mutants were susceptible to infection with Gram-positive bacteria as had been shown for Drosophila adults, microbe clearance was not affected in the mutants. In addition, Drosophila larvae were found to be sensitive to mechanical stimuli with respect to the activation of a sterile humoral response. In particular, pinching with forceps to a degree that might cause minor damage to larval tissues could induce the expression of the antifungal peptide gene Drosomycin; notably, this induction was partially independent of the Toll and immune deficiency pathways. We therefore propose that Drosophila larvae might serve as a useful model to analyze the infectious and non-infectious inflammation that underlies various inflammatory diseases such as ischemia, atherosclerosis and cancer.

  1. The effect of 210Pb and stable lead on the induction of mouthpart deformities in chironomid larvae

    International Nuclear Information System (INIS)

    Bird, G.A.; Schwartz, W.J.; Hoffman, D.

    1995-07-01

    To determine whether mouthpart deformities in chironomid larvae from Port Hope Harbour, Ontario, are the result of exposure to ionizing radiation or heavy metals in the sediment, Chironomus tentans larvae were exposed in the laboratory to concentrations of 210 Pb and stable lead representative of contaminant levels in the harbour. Exposure to 100, 1000, and 2000 Bq 210 Pb·g -1 dry sediment had no effect on the survival, growth of the larvae or frequency of deformities. Likewise, exposure to 0.5 and 5.0 mg lead·g -1 dry sediment had no effect on the larvae, but exposure to 35.0 mg lead·g -1 dry sediment resulted in 100% mortality of the larvae. These results indicate that the observed mouthpart deformities in chironomid larvae in Port Hope Harbour are not the result of radiation exposure. They also indicate that heavy metals (lead) may be having an impact on the population. (author). 28 refs., 9 tabs., 4 figs

  2. Elementary budget of stag beetle larvae associated with selective utilization of nitrogen in decaying wood

    Science.gov (United States)

    Tanahashi, Masahiko; Ikeda, Hiroshi; Kubota, Kôhei

    2018-06-01

    Wood degradation by insects plays important roles for the forest matter cycling. Since wood is deficient in nitrogen compared to the insect body, wood-feeding insects need to assimilate the nitrogen selectively and discard an excess carbon. Such a stoichiometric imbalance between food and body will cause high metabolic cost; therefore, wood-feeding insects may somehow alleviate the stoichiometric imbalance. Here, we investigated the carbon and nitrogen budgets of the larvae of stag beetle, Dorcus rectus, which feed on decaying wood. Assimilation efficiency of ingested wood was 22%, and those values based on the carbon and nitrogen were 27 and 45%, respectively, suggesting the selective digestion of nitrogen in wood. Element-based gross growth efficiency was much higher for nitrogen (45%) than for carbon (3%). As a result, the larvae released 24% of the ingested carbon as volatile, whereas almost no gaseous exchange was observed for nitrogen. Moreover, solubility-based elementary analysis revealed that the larvae mainly utilized alkaline-soluble-water-insoluble fraction of wood, which is rich in nitrogen. Actually, the midgut of the larvae was highly alkaline (pH 10.3). Stag beetle larvae are known to exhibit coprophagy, and here we also confirmed that alkaline-soluble-water-insoluble nitrogen increased again from fresh feces to old feces in the field. Stable isotope analysis suggested the utilization of aerial nitrogen by larvae; however, its actual contribution is still disputable. Those results suggest that D. rectus larvae selectively utilize alkaline-soluble nitrogenous substrates by using their highly alkaline midgut, and perhaps associate with microbes that enhance the nitrogen recycling in feces.

  3. Elementary budget of stag beetle larvae associated with selective utilization of nitrogen in decaying wood.

    Science.gov (United States)

    Tanahashi, Masahiko; Ikeda, Hiroshi; Kubota, Kôhei

    2018-05-03

    Wood degradation by insects plays important roles for the forest matter cycling. Since wood is deficient in nitrogen compared to the insect body, wood-feeding insects need to assimilate the nitrogen selectively and discard an excess carbon. Such a stoichiometric imbalance between food and body will cause high metabolic cost; therefore, wood-feeding insects may somehow alleviate the stoichiometric imbalance. Here, we investigated the carbon and nitrogen budgets of the larvae of stag beetle, Dorcus rectus, which feed on decaying wood. Assimilation efficiency of ingested wood was 22%, and those values based on the carbon and nitrogen were 27 and 45%, respectively, suggesting the selective digestion of nitrogen in wood. Element-based gross growth efficiency was much higher for nitrogen (45%) than for carbon (3%). As a result, the larvae released 24% of the ingested carbon as volatile, whereas almost no gaseous exchange was observed for nitrogen. Moreover, solubility-based elementary analysis revealed that the larvae mainly utilized alkaline-soluble-water-insoluble fraction of wood, which is rich in nitrogen. Actually, the midgut of the larvae was highly alkaline (pH 10.3). Stag beetle larvae are known to exhibit coprophagy, and here we also confirmed that alkaline-soluble-water-insoluble nitrogen increased again from fresh feces to old feces in the field. Stable isotope analysis suggested the utilization of aerial nitrogen by larvae; however, its actual contribution is still disputable. Those results suggest that D. rectus larvae selectively utilize alkaline-soluble nitrogenous substrates by using their highly alkaline midgut, and perhaps associate with microbes that enhance the nitrogen recycling in feces.

  4. A new procedure for marinating fresh anchovies and ensuring the rapid destruction of Anisakis larvae.

    Science.gov (United States)

    Sánchez-Monsalvez, I; de Armas-Serra, C; Martínez, J; Dorado, M; Sánchez, A; Rodríguez-Caabeiro, F

    2005-05-01

    The consumption of marinated anchovies is the main route of transmission of anisakiasis in Spain. Because this country is one of the world's major tourist destinations, this traditional food also poses a potential health risk to millions of foreign visitors. Anisakis larvae are not destroyed by the traditional marinating procedure, and alternative methods, such as long-term storage in brine, freezing, or hydrostatic pressure treatment, all present major difficulties. In this study, we used high food-grade acetic acid concentrations (10, 20, 30, and 40% [vol/vol] in line with the quantum satis rule) to destroy these larvae rapidly, and we report data on the survival of Anisakis larvae exposed directly to different marinades and when the larvae are placed under the fish musculature. The percentage of salt and acetic acid in the fish tissue water phase was also determined. A marinating procedure is proposed that ensures the rapid death of Anisakis through the use of strong acetic acid concentrations. Posttreatment washes with water reduce these to levels acceptable to consumers. The sensory characteristics of the product were shown to be satisfactory. The actual selection of an acetic acid concentration for marinating depends on costs and the processing time available. The physiological stress of the larvae exposed to the different marinades was determined by measuring the levels of their stress proteins. The latter are good indicators of injury and might reflect the infectivity of larvae. In addition, we also used a rat model to determine the infectivity of larvae considered microscopically dead.

  5. Patogenicidade de isolados de Beauveria bassiana para ovos, larvas e ninfas ingurgitadas de Rhipicephalus sanguineus Pathogenicity of Beauveria bassiana isolates towards eggs, larvae and engorged nymphs of Rhipicephalus sanguineus

    Directory of Open Access Journals (Sweden)

    Nancy Prette

    2005-08-01

    Full Text Available O presente trabalho objetivou avaliar a ação dos isolados JAB 07, CB 7 e AM 9 do fungo Beauveria bassiana para ovos, larvas e ninfas ingurgitadas de Rhipicephalus sanguineus. Padronizou-se a concentração de 109 conídios mL-1 para cada isolado e por meio de diluições seriadas, obtiveram-se as suspensões com concentrações de 10(8 e 10(7con. mL-1. Preparou-se um bioensaio para cada fase do ciclo de vida do carrapato. Cada ensaio foi composto por 10 grupos tratamentos, formados por um isolado do fungo e uma concentração de conídios, e um grupo controle contendo apenas o veículo das suspensões. Os isolados do fungo, aplicados nas diferentes concentrações de esporos, causaram redução no percentual de eclosão de larvas oriundas de ovos infectados (0,7 a 12,1% de eclosão e no percentual de ecdise de larvas (4,7 a 33,7% de ecdise e ninfas (0 a 16,7% de ecdise. Não houve diferença entre os isolados (P>0,05 quanto à infecção de ovos, mas a aplicação de 109 con./mL de JAB 07 e AM 9 promoveu redução significativa da eclosão de larvas, em relação à concentração de 10(7con. mL-1. O isolado CB 7 foi o mais eficaz na redução do número de ecdises de larvas. Os isolados e as concentrações de conídios não diferiram (P>0,05 quanto à capacidade de redução do percentual de ecdise de ninfas, mas evidenciou-se intensa atividade patogênica do fungo.The aim of the present study was to determine the action of isolates JAB 07, CB 7 and AM 9 of the fungus Beauveria bassiana on eggs, larvae and engorged nymphs of Rhipicephalus sanguineus tick. A concentration of 109 conidia mL-1 was standardized for each isolate and suspensions containing 10(8 and 10(7 conidia mL-1 were obtained by serial dilution. A bioassay was prepared for each phase of the life cycle of the tick. Each assay comprised 10 treatment groups, consisting of one fungal isolate and one conidial concentration, and one control group containing only the vehicle of

  6. HISTOLOGICAL STUDY ON INTERNAL ORGANS DEVELOPMENT OF MANGROVE SNAPPER, Lutjanus argentimaculatus LARVAE

    Directory of Open Access Journals (Sweden)

    Ketut Mahardika

    2012-12-01

    Full Text Available Mangrove snapper, Lutjanus argentimaculatus is one of highly economic value of marine fish commodity. Culture of this species has been developed a few years ago. Basic data on biological aspect is still limited whereas those kinds of information are needed. Histological study to determine development of internal organs of the larvae of mangrove snapper was conducted. Amount of 15-20 larvae each from 1 day after DAH hatching (1 DAH up to 30 days after hatching (30 DAH were collected, fixed in Bouin’s solution for 4-6 hours and then transferred into 70% alcohol. The samples were then embedded in paraffin wax and the sections were stained with haematoxylineosin (H&E. Results showed that the eye retina of the mangrove snapper larvae well developed on 3 DAH, whereas their digestive tract was on 5 DAH. Under this condition, the larvae started feeding as showed by present of natural food tissues in the intestine. Development of digestive tract and other internal organs reached their complete form like in adult fish after 20 DAH.

  7. Fly larvae as sustainable bioconverters of waste for feed in the future

    DEFF Research Database (Denmark)

    Nordentoft, Steen; Aabo, Søren

    2014-01-01

    How to provide enough food and feed for the growing population is a major challenge for the nextgeneration. Improved economy in many developing countries increases the demand for protein from meator fish. This may lead to depletion of the seas and overexploitation of agricultural land in the in s......How to provide enough food and feed for the growing population is a major challenge for the nextgeneration. Improved economy in many developing countries increases the demand for protein from meator fish. This may lead to depletion of the seas and overexploitation of agricultural land......, or nutrients may be refined fromprocessed insects, however there is a huge need for technological development in order to automateculture and harvest of the insects.In nature insects and insect larvae are important feed sources for poultry and the larva of the commonhouse fly (Musca domestica) have been shown...... to be especially rich in essential amino and fatty acids. Atthe Food institute we have investigated in feed safety of using these fly larvae as feed for egg laying hens.The larvae were reared on poultry manure which implies the risk of transmission of pathogenicmicroorganism between animals and to humans, as well...

  8. Behavioral Responses of Concholepas concholepas (Bruguière, 1789) Larvae to Natural and Artificial Settlement Cues and Microbial Films.

    Science.gov (United States)

    Rodriguez, S R; Riquelme, C; Campos, E O; Chavez, P; Brandan, E; Inestrosa, N C

    1995-12-01

    The behavioral responses of veliger larvae of the gastropod Concholepas concholepas were studied in the presence of different natural and artificial settlement cues and microbial films. Early pre-competent larvae stopped swimming, sank (due to ciliary arrests, retraction of the velum into the shell, or both), and remained inactive on the substratum when exposed to conspecific mucus and hemolymph. In both cases the effect was time-dependent and the number of larvae showing these behaviors decreased over time. Larvae exposed to NH4Cl (ammonium ion) showed a similar time- and dose-dependent response. A positive and time-dependent response was also observed when larvae were exposed to different extracellular matrix (ECM) components (i.e., collagen, gelatin, and fibronectin) and sulfated polysaccharides (i.e., carrageenan, heparin, and chondroitin sulfate). In this case the larvae remained attached to the substratum. However, the effect of sulfated polysaccharides on C. concholepas larval behavior was faster than that observed with other ECM molecules. We also studied the responses of premetamorphic C. concholepas larvae exposed to different microbial films. In chemotaxis experiments with different films, with glass as the substratum, larvae showed a significant preference for multispecific and diatoms films. When shells of C. concholepas were used as the substratum, the preference for multispecific films was clear and significant. Likewise, larvae showed velar contractions in the presence of all the films tested. Larvae exposed to multispecific films and to the microalga Prasinocladus marinus showed an increased ciliar movement. The finding that mucus and hemolymph of conspecific adults and ECM molecules (mainly sulfated polysaccharides) induce the cessation of swimming of C. concholepas larvae suggests a possible role for cell-surface receptors in mediating the larval response of marine organisms. Likewise, the positive chemotaxis responses of C. concholepas larvae to

  9. Susceptibility of irradiated Galleria mellonella F1Larvae to Entomopathogenic Nematodes

    International Nuclear Information System (INIS)

    Salem, H.M.; Rizk, S.A.; Sayed, R.M.; Hussein, M.A; Hafez, S.E

    2008-01-01

    Combined effect of substerilizing doses of gamma radiation (40 and 100 Gy) and different concentrations of entomopathogenic nematodes (20, 40, 60, and 80 IJs) on the greater wax moth, Galleria mellonella was studied. The 4th larval instar resulted from irradiated male parent pupae mated with normal female were tested for susceptibility to Heterorhabditis bacteriophora BA1 and Steinernema carpocapsae BA2. The mortality rate of the larvae increased by increrasing radiation dose and nematode concentrations. The reproduction of both nematode strains decreased significantly with increasing the treatments (radiation dose and nematode concentrations). In addition, exposure to gamma radiation and entomopathogenic nematodes significantly decreased the total haemocyte count (THC) of the larvae with increasing radiation doses (40 and 100 Gy) and both nematode strains concentrations (20 and 40 IJs) and reached the minimal count at the combiend effect. Finally, larvae were more susceptible to Steinernema carpocapsa than Heterorhabditis bacteriophora. (author)

  10. Dose/dose-rate responses of shrimp larvae to UV-B radiation

    International Nuclear Information System (INIS)

    Damkaer, D.M.

    1981-01-01

    Previous work indicated dose-rate thresholds in the effects of UV-B on the near-surface larvae of three shrimp species. Additional observations suggest that the total dose response varies with dose-rate. Below 0.002 Wm -2 sub([DNA]) irradiance no significant effect is noted in activity, development, or survival. Beyond that dose-rate threshold, shrimp larvae are significantly affected if the total dose exceeds about 85 Jm -2 sub([DNA]). Predictions cannot be made without both the dose-rate and the dose. These dose/dose-rate thresholds are compared to four-year mean dose/dose-rate solar UV-B irradiances at the experimental site, measured at the surface and calculated for 1 m depth. The probability that the shrimp larvae would receive lethal irradiance is low for the first half of the season of surface occurrence, even with a 44% increase in damaging UV radiation. (orig.)

  11. Dose/dose-rate responses of shrimp larvae to UV-B radiation

    Energy Technology Data Exchange (ETDEWEB)

    Damkaer, D.M.; Dey, D.B.; Heron, G.A.

    1981-01-01

    Previous work indicated dose-rate thresholds in the effects of UV-B on the near-surface larvae of three shrimp species. Additional observations suggest that the total dose response varies with dose-rate. Below 0.002 Wm/sup -2/sub((DNA)) irradiance no significant effect is noted in activity, development, or survival. Beyond that dose-rate threshold, shrimp larvae are significantly affected if the total dose exceeds about 85 Jm/sup -2/sub((DNA)). Predictions cannot be made without both the dose-rate and the dose. These dose/dose-rate thresholds are compared to four-year mean dose/dose-rate solar UV-B irradiances at the experimental site, measured at the surface and calculated for 1 m depth. The probability that the shrimp larvae would receive lethal irradiance is low for the first half of the season of surface occurrence, even with a 44% increase in damaging UV radiation.

  12. Fish larvae from the Gulf of California

    Directory of Open Access Journals (Sweden)

    Gerardo Aceves-Medina

    2003-03-01

    Full Text Available Taxonomic composition of fish larvae was analysed from 464 plankton samples obtained during 10 oceanographic surveys in the Gulf of California between 1984 and 1988. We identified 283 taxa: 173 species, 57 genera, and 53 families. Tropical and subtropical species predominated except during the winter, when temperate-subarctic species were dominant. The most abundant species were the mesopelagic Benthosema panamense, Triphoturus mexicanus and Vinciguerria lucetia, but the coastal pelagic species Engraulis mordax, Opisthonema spp., Sardinops caeruleus and Scomber japonicus were also prominent. The taxonomic composition of the ichthyoplankton shows the seasonality of the Gulf as well as environmental changes that occurred between the 1984-1987 warm period and the 1956-1957 cool period previously reported. The presence of E. mordax larvae as one of the most abundant species in the Gulf provides evidence of the reproduction of this species two years before the development of the northern anchovy fishery and the decline of the sardine fishery in the Gulf of California.

  13. Observations of cocooned Hydrobaenus (Diptera: Chironomidae) larvae in Lake Michigan

    Science.gov (United States)

    Tucker, Taaja R.; Hudson, Patrick L.; Riley, Stephen

    2016-01-01

    Larvae of the family Chironomidae have developed a variety of ways to tolerate environmental stress, including the formation of cocoons, which allows larvae to avoid unfavorable temperature conditions, drought, or competition with other chironomids. Summer cocoon formation by younger instars of the genus Hydrobaenus Fries allows persistence through increased temperatures and/or intermittent dry periods in arid regions or temporary habitats, but this behavior was not observed in the Great Lakes until the current study. Cocoon-aestivating Hydrobaenus sp. larvae were found in benthic grab samples collected in 2010–2013 near Sleeping Bear Dunes National Lakeshore in northern Lake Michigan with densities up to 7329/m2. The aestivating species was identified as Hydrobaenus johannseni (Sublette, 1967), and the associated chironomid community was typical for an oligotrophic nearshore system. Hydrobaenus cocoon formation in the Great Lakes was likely previously unnoticed due to the discrepancies between the genus' life history and typical benthos sampling procedures which has consequences for describing chironomid communities where Hydrobaenus is present.

  14. EFECTO INSECTICIDA DEL EXTRACTO DE Bocconia frutescens L. SOBRE LARVAS DE CHISAS

    Directory of Open Access Journals (Sweden)

    CONSUELO MONTES R

    2013-12-01

    Full Text Available Esta investigación se realizó en el municipio de Puracé Cauca, para evaluar el efecto insecticida del extracto de Bocconia frutescens sobre larvas de chisa Ancognatha vulgaris. Se empleo un diseño de bloques completos al azar, con cinco tratamientos y tres repeticiones. Los tratamiento T1, T2 y T3 corresponden a concentraciones de 14%, 17% y 20 % del extracto de zarcillejo, T4 tratamiento químico (Carbofuran y T5 Testigo. Las variables evaluadas fueron: presencia de larvas de chisas sanas y larvas afectadas, daño en plantas, evaluado como intensidad y porcentaje de infestación. Se presentaron diferencias significativas para las variables: intensidad e infestación, larvas de chisas sanas y afectadas-muertas, en diferentes días de evaluación. El mejor tratamiento fue el T2, seguido por T3 y T1. Para el porcentaje de daño causado a la planta los mejores tratamientos fueron T2 y T5 con 57% para intensidad y para infestación 55% y 45% en T2 y T3. El análisis fitoquímico mostró la presencia de alcaloides, terpenos, antronas y cumarinas en el extracto. El efecto causado por el extracto sobre las larvas fue deshidratación y flacidez hasta provocar la muerte, lo cual se atribuyea la acción de alguno de sus metabòlitos o la combinación de varios.

  15. Oceanographic and behavioural assumptions in models of the fate of coral and coral reef fish larvae.

    Science.gov (United States)

    Wolanski, Eric; Kingsford, Michael J

    2014-09-06

    A predictive model of the fate of coral reef fish larvae in a reef system is proposed that combines the oceanographic processes of advection and turbulent diffusion with the biological process of horizontal swimming controlled by olfactory and auditory cues within the timescales of larval development. In the model, auditory cues resulted in swimming towards the reefs when within hearing distance of the reef, whereas olfactory cues resulted in the larvae swimming towards the natal reef in open waters by swimming against the concentration gradients in the smell plume emanating from the natal reef. The model suggested that the self-seeding rate may be quite large, at least 20% for the larvae of rapidly developing reef fish species, which contrasted with a self-seeding rate less than 2% for non-swimming coral larvae. The predicted self-recruitment rate of reefs was sensitive to a number of parameters, such as the time at which the fish larvae reach post-flexion, the pelagic larval duration of the larvae, the horizontal turbulent diffusion coefficient in reefal waters and the horizontal swimming behaviour of the fish larvae in response to auditory and olfactory cues, for which better field data are needed. Thus, the model suggested that high self-seeding rates for reef fish are possible, even in areas where the 'sticky water' effect is minimal and in the absence of long-term trapping in oceanic fronts and/or large-scale oceanic eddies or filaments that are often argued to facilitate the return of the larvae after long periods of drifting at sea. © 2014 The Author(s) Published by the Royal Society. All rights reserved.

  16. Gelatinous plankton is central to the diet of European eel (Anguilla anguilla) larvae in the Sargasso Sea

    DEFF Research Database (Denmark)

    Ayala, Daniel Jiro; Munk, Peter; Lundgreen, Regitze B. C.

    2018-01-01

    endangered species. Next-generation 18S rRNA gene sequencing data of Sargasso Sea eel larvae gut contents and marine snow aggregates was compared with a reference plankton database to assess the trophic relations of eel larvae. Gut contents of A. anguilla larvae were not well explained by the eukaryotic...

  17. Pathogenicity Assay of Vibrio harveyi in Tiger Shrimp Larvae Employing Rifampicin-Resistant as A Molecular Marker

    Directory of Open Access Journals (Sweden)

    . Widanarni

    2007-12-01

    Full Text Available Rifampicin-resistant marker was employed as a reporter to assay pathogenicity of Vibrio harveyi  in shrimp larvae.  V. harveyi M. G3 and G7 that difference not schizotyping as shown by Pulsed-Filed Gel Electrophoresis (PFGE used in this study. Spontaneous mutation was conducted to generate V. harveyi resistant to rifampicin. Two groups of shrimp post-larvae (PL5 were immersed for 30 min in 106 CFU/ml of mutants and wild type of V. harveyi, respectively; and then placed in a 2 liter shrimp rearing tank for five days. A control group was immersed in sterile seawater. Growth curve analysis and pathogenicity assay of V. harveyi  showed that each of the V. harveyi mutant exhibited almost identical profiles to that of the wild type parental strain and did not show alteration in their pathogenicity. Sample from dead shrimp larvae showed that the dead shrimp larvae were infected by V. harveyi RfR, indicated that rifampicin-resistant marker effective as a reporter to assay pathogenicity of Vibrio harveyi in shrimp larvae. Key words: shrimp larvae, Vibrio harveyi, rifampicin-resistant, molecular marker

  18. The gut microbiota in larvae of the housefly Musca domestica and their horizontal transfer through feeding.

    Science.gov (United States)

    Zhao, Yao; Wang, Wanqiang; Zhu, Fen; Wang, Xiaoyun; Wang, Xiaoping; Lei, Chaoliang

    2017-12-01

    House fly larvae provide a prolific and sustainable source of proteins used in poultry and fish feed. Wheat bran is a superior diet for house fly larvae and has been widely investigated to exploit its potential in the food and feed area. Using Illumina MiSeq 16S rDNA sequencing, this study investigated the gut microbiota of house fly larvae feeding on wheat bran and the bacterial community in the wheat bran. The bacterial communities in the house fly larvae were dominated by the phyla Proteobacteria and Firmicutes. Enterobacteriaceae and Providencia were the predominant bacteria at the family and genus levels, respectively. Some bacteria in the phyla Actinobacteria, Proteobacteria, Bacteroidetes and Firmicutes may be transferred from the gut of house flies to the wheat bran during feeding and may be involved in degrading and utilizing polysaccharides in the cell wall of wheat bran. The significance of the gut microbiota of house fly larvae, their transferring and roles in degradation of wheat bran is discussed. These findings regarding the gut microbiota of house fly larvae will provide opportunities for research on the impact of microbial communities on poultry and fish.

  19. Effects of Foodstuffs on Intestinal Length in Larvae of Rhacophorus arboreus (Anura: Rhacophoridae) : Developmental Biology

    OpenAIRE

    SHINRI, HORIUCHI; YUTAKA, KOSHIDA; Department of Biology, College of General Education, Osaka University; Department of Biology, College of General Education, Osaka University

    1989-01-01

    Correlation between foodstuffs and intestinal length was examined in larvae of Rhacophorus arboreus (Anura: Rhacophoridae). The larva, being heterophagous, has a tube-like intestine provided with neither epithelial outfoldings nor villi, and intestinal length is found to be a good morphological index of digestive and absorptive functions of the intestine. The results obtained were summarized as follows: The grown larva fed on boiled spinach had an intestine more than 1.5 times as long as that...

  20. Toxicity of cypermethrin on the embryo and larvae of Gangetic mystus, Mystus cavasius

    NARCIS (Netherlands)

    Ali, Md Haider; Sumon, Kizar Ahmed; Sultana, Marin; Rashid, Harunur

    2018-01-01

    The objective of the present study was to elucidate the effects of cypermethrin on the embryo and the larvae of Gangetic mystus, Mystus cavasius. Therefore, fertilized eggs (n = 100) and 1-day-old larvae (n = 100) were exposed to six different concentrations of cypermethrin (0, 2, 4, 8, 16 and 32 μg

  1. Comparison of three artificial digestion methods for detection of non-encapsulated Trichinella pseudospiralis larvae in pork

    DEFF Research Database (Denmark)

    Nockler, K.; Reckinger, S.; Szabo, I.

    2009-01-01

    In a ring trial involving five laboratories (A, B, C, D, and E), three different methods of artificial digestion were compared for the detection of non-encapsulated Trichinella pseudospiralis larvae in minced meat. Each sample panel consisted often 1 g minced pork samples. All samples in each panel...... were derived from a bulk meat preparation with a nominal value of either 7 or 17 larvae per g (Ipg). Samples were tested for the number of muscle larvae using the magnetic stirrer method (labs A, B, and E), stomacher method (lab B), and Trichomatic 35 (R) (labs C and D). T. pseudospiralis larvae were...... by using the magnetic stirrer method (22%), followed by the stomacher method (25%), and Trichomatic 35 (R) (30%). Results revealed that T. pseudospiralis larvae in samples with a nominal value of 7 and 17 Ipg can be detected by all three methods of artificial digestion....

  2. Sublethal pesticide doses negatively affect survival and the cellular responses in American foulbrood-infected honeybee larvae

    Science.gov (United States)

    López, Javier Hernández; Krainer, Sophie; Engert, Antonia; Schuehly, Wolfgang; Riessberger-Gallé, Ulrike; Crailsheim, Karl

    2017-02-01

    Disclosing interactions between pesticides and bee infections is of most interest to understand challenges that pollinators are facing and to which extent bee health is compromised. Here, we address the individual and combined effect that three different pesticides (dimethoate, clothianidin and fluvalinate) and an American foulbrood (AFB) infection have on mortality and the cellular immune response of honeybee larvae. We demonstrate for the first time a synergistic interaction when larvae are exposed to sublethal doses of dimethoate or clothianidin in combination with Paenibacillus larvae, the causative agent of AFB. A significantly higher mortality than the expected sum of the effects of each individual stressor was observed in co-exposed larvae, which was in parallel with a drastic reduction of the total and differential hemocyte counts. Our results underline that characterizing the cellular response of larvae to individual and combined stressors allows unmasking previously undetected sublethal effects of pesticides in colony health.

  3. Efikasi Ekstrak Daun dan Bunga Kecombrang (Etlingera elatior terhadap Larva Aedes aegypti

    Directory of Open Access Journals (Sweden)

    Meiske Elisabeth Koraag

    2016-12-01

    Full Text Available Abstract. Three widely known dengue vector control programs in Indonesia are chemical, biological, and environmental modification control where chemical control with organophosphate insecticide (malathion and temephos is the most common. The long term use of chemical insecticide will result in the vector beingtolerant and eventually resistant to insecticide. One of the alternative solutions is to use biological larvacide from the plant. The objective of this study was to determine the lethal concentration of the extract of Kecombrang (Etlingera elatior leaves and flowers against Aedes aegypti larvae. This was an experimentalstudy where the sample size was determined by using the Federer formula. The study used six different concentrations and four repetitions. Two controls group, Bacillus thuringiensis and water used as positive and negative control. The results showed that the LC50 and LC90 of Kecombrang leave extract were 1.20% and 2.05% respectively whereas for Kecombrang flowers extract were 0,05% and 0.09% respectively. Extract of Kecombrang leaves and flowers is effective to kill Ae. aegypti larvae where the flowers extract is more effective than the leaves extract in killing Ae. aegypti larvae.Keywords: dengue, Ae. aegypti, larvae, Etlingera elatiorAbstrak. Pengendalian vektor penular demam berdarah dengue (DBD yang selama ini dikenal yaitu pengendalian secara kimia, biologi dan modifikasi lingkungan. Pengendalian vektor DBD di Indonesia masih banyak dilakukan dengan menggunakan insektisida dari golongan organofosfat (malation dan temefos. Penggunaan insektisida kimia dalam jangka waktu lama akan memberi efek menekan dan menyeleksi serangga vektor sasaran untuk menjadi toleran sampai resisten. Salah satu solusi alternatif yaitu menggunakan larvasida yang berasal dari tanaman. Penelitian ini bertujuan untuk menentukan daya bunuh ekstrak daun dan bunga kecombrang (Etlingera elatior terhadap larva nyamuk Ae. aegypti. Jenis penelitian yang

  4. Tracking radioactive larvae of Strongyloides ratti in the host

    International Nuclear Information System (INIS)

    Wilson, P.A.G.

    1979-01-01

    Infective larvae of homogonic Strongyloides ratti grown in faecal culture with 32 P or 75 Se acquired a significant amount of radioactivity which was firmly attached to them. Heating removed most of the 32 P but left 75 Se in place. Subcutaneous injection of virgin and nursing mother rats with living and heat-killed ratioactive larvae resulted in a pattern of labelling in the small intestine of injected animals and, in the case of 75 Se, those of suckling pups, which can only be explained if labelled worms follow the natural migratory routes. The use of this tool in migratory studies is discussed, with precautions to allow for flaws in the technique. (author)

  5. Microvascular system forming in skeletal muscle near trichinella larvae

    International Nuclear Information System (INIS)

    Berzentsev, Y.A.; Oksov, I.V.

    1986-01-01

    The fine structure and dynamics of formation of the microcirculatory system about the larvae of the two Trichinella species, providing for the rapid entry of nutrient substances to the larvae, were investigated in the muscles of white mice. Hitological, hitochemical, autoradiographic, and electron-microscopic methods were used in the investigation. At a certain period of the experiment, the greatest quantity of RNA was found in the endotheliocyte cytoplasm, tritium-thymidine label was incorporated into the nuclei, and mitoses were visible. The transition to tissue parasitism was accompanied by a complication of the relationships with the host and the formation of a more complex independent microcirculatory system, which ensures a more intensive influx of blood

  6. Nueva especie de Parathelohania (Microsporidia en larvas de Anopheles aquasalis (Diptera: Culicidae en Venezuela

    Directory of Open Access Journals (Sweden)

    Frances Osborn

    2002-12-01

    Full Text Available Se describen los síntomas en larvas de A. aquasalis infectadas naturalmente con un microsporidio parasítico, y la ultraestructura de las esporas del mismo. Las larvas fueron criadas bajo condiciones de laboratorio en concentraciones de salinidad de 10 g/l y 20 g/l, registrándose diariamente la mortalidad y la fecha del cambio de estadío de las mismas. Las larvas infectadas fueron procesadas por rnicroscopía electrónica de transmisión usando métodos convencionales con pH 7.2 y 260 mOsm/I. El incremento de la infección por los microsporidios estuvo correlacionado positivamente con un aumento en la duración promedio del cuarto estadío de 2.88 a 6.33 días en 10 g/l de sal y de 2.47 a 6.14 días en 20 g/l. La mortalidad de las larvas también aumentó en aproximadamente 50% durante este estadío a ambas concentraciones de salinidad. No se observaron estas alteraciones en los otros estadíos. Las esporas maduras de los microsporidios fueron encontradas en el intestino de las larvas. Estas esporas mostraron forma de barril y dimensiones de 2.6 x 2.4 µm aproximadamente. La reducción en la supervivencia de las larvas de A. aquasalis infectadas con los microsporidios, y el aumento del tiempo de su desarrollo sugiere que este parásito podría ser un posible controlador biológico de esta plaga. El microsporidio descrito presenta características similares a las del género Parathelohania. Se sugiere que el microsporidio encontrado en las larvas de A. aquasalis es una especie nueva y se propone nombrarla Parathelohania aquasalensis. Este trabajo representa el primer reporte de un microsporidio encontrado en un díptero en Venezuela.The symptoms of Anopheles aquasalis larvae naturally infected by a microsporidium, and the ultrastructure of the infecting spores is describes. The larvae were maintained under laboratory conditions in salt concentrations of 10 g/l and 20 g/l of water. Daily recordings of the mortality of the larvae were made and

  7. Temperature Dependence of Respiration in Larvae and Adult Colonies of the Corals Acropora tenuis and Pocillopora damicornis

    Directory of Open Access Journals (Sweden)

    Dwi Haryanti

    2015-06-01

    Full Text Available Although algal symbionts can become a source of reactive oxygen species under stressful conditions, symbiotic planulae of the coral Pocillopora damicornis are highly tolerant to thermal stress compared with non-symbiotic planulae of Acropora tenuis. As a first step to understand how P. damicornis planulae attain high stress tolerance, we compared the respiration rate and temperature dependence between symbiotic planulae of P. damicornis and non-symbiotic planulae of A. tenuis, as well as between larvae and adult branches within each species. Larvae and adult branches of both species had similar temperature dependency of respiration rate, with the temperature coefficient (Q10 values of about 2. Planula larvae of P. damicornis had a significantly lower respiration rate than that of A. tenuis larvae at 25–30 °C, but not at 32 °C, whereas adult branches of P. damicornis had a significantly higher respiration rate than that of A. tenuis branches at all temperatures. Thus, P. damicornis larvae appear to be capable of reducing their respiration rate to a greater extent than A. tenuis larvae, which could partly explain why P. damicornis larvae had high survivorship under thermal stress, although other antioxidant or photoprotective mechanisms should be investigated in the future.

  8. A sleep state in Drosophila larvae required for neural stem cell proliferation

    Science.gov (United States)

    Szuperak, Milan; Churgin, Matthew A; Borja, Austin J; Raizen, David M; Fang-Yen, Christopher

    2018-01-01

    Sleep during development is involved in refining brain circuitry, but a role for sleep in the earliest periods of nervous system elaboration, when neurons are first being born, has not been explored. Here we identify a sleep state in Drosophila larvae that coincides with a major wave of neurogenesis. Mechanisms controlling larval sleep are partially distinct from adult sleep: octopamine, the Drosophila analog of mammalian norepinephrine, is the major arousal neuromodulator in larvae, but dopamine is not required. Using real-time behavioral monitoring in a closed-loop sleep deprivation system, we find that sleep loss in larvae impairs cell division of neural progenitors. This work establishes a system uniquely suited for studying sleep during nascent periods, and demonstrates that sleep in early life regulates neural stem cell proliferation. PMID:29424688

  9. [Organic waste treatment by earthworm vermicomposting and larvae bioconversion: review and perspective].

    Science.gov (United States)

    Zhang, Zhi-jian; Liu, Meng; Zhu, Jun

    2013-05-01

    There is a growing attention on the environmental pollution and loss of potential regeneration of resources due to the poor handling of organic wastes, while earthworm vermicomposting and larvae bioconversion are well-known as two promising biotechnologies for sustainable wastes treatments, where earthworms or housefly larvae are employed to convert the organic wastes into humus like material, together with value-added worm product. Taken earthworm ( Eisenia foetida) and housefly larvae ( Musca domestica) as model species, this work illustrates fundamental definition and principle, operational process, technical mechanism, main factors, and bio-chemical features of organisms of these two technologies. Integrated with the physical and biochemical mechanisms, processes of biomass conversion, intestinal digestion, enzyme degradation and microflora decomposition are comprehensively reviewed on waste treatments with purposes of waste reduction, value-addition, and stabilization.

  10. Predation of Piaractus mesopotamicus and Oreochromis niloticus larvae by Pantala flavescens with different length classes - doi: 10.4025/actascibiolsci.v33i4.5470 Predation of Piaractus mesopotamicus and Oreochromis niloticus larvae by Pantala flavescens with different length classes - doi: 10.4025/actascibiolsci.v33i4.5470

    Directory of Open Access Journals (Sweden)

    Carlos Eduardo Bento Fernandes

    2011-09-01

    Full Text Available The experiment had as objective to study the survival of Piaractus mesopotamicus and Oreochromis niloticus larvae subject to predation by Pantala flavescens larvae with different length classes. We used 120 larvae of P. mesopotamicus, 120 of O. niloticus, and also 24 larvae of Pantala flavescens, distributed in 24 aquariums with useful volume for 2 L, being placed one Odonate for aquarium. The treatments differed as regard to the prey species and the predator size, being kept a control treatment. An aquarium (2 L containing one larvae of Odonate and 10 larvae of fish were considered an experimental unit. After the beginning, each three hours (18:00, 21:00, 0:00, 3:00, 6:00, 9:00, 12:00, 15:00 and 18:00h, the remnant larvae of fish (alive in each experimental unit was quantified, and we replaced the consumed larvae, so that we always had 10 larvae of fish at each aquarium after each counting. For both fish species, there was a slight increase in consumption by the Odonate with intermediate size, but the values did not differ statistically (p > 0.05. Larvae of Odonate in the treatments with greater length presented a lower consumption (p The experiment had as objective to study the survival of Piaractus mesopotamicus and Oreochromis niloticus larvae subject to predation by Pantala flavescens larvae with different length classes. We used 120 larvae of P. mesopotamicus, 120 of O. niloticus, and also 24 larvae of Pantala flavescens, distributed in 24 aquariums with useful volume for 2 L, being placed one Odonate for aquarium. The treatments differed as regard to the prey species and the predator size, being kept a control treatment. An aquarium (2 L containing one larvae of Odonate and 10 larvae of fish were considered an experimental unit. After the beginning, each three hours (18:00, 21:00, 0:00, 3:00, 6:00, 9:00, 12:00, 15:00 and 18:00h, the remnant larvae of fish (alive in each experimental unit was quantified, and we replaced the consumed larvae

  11. Effects of parsley and camphor oils on mortality and trace elements of Chrysomyia albiceps larvae

    International Nuclear Information System (INIS)

    Rizk, S.A.; El- Sebaay, S.S.; Amin, M.M.

    2010-01-01

    The use of plant oils to protect sheep and other animals from infestation and myiasis of medical and veterinary pests are limited. This study aimed to evaluate the effect of parsley oil (Petroselimum crispum) and camphor oil (Cinnamomum camphora) on mortality of Chrysomayia albiceps larvae and their effects on metal contents of the larvae. When the parsley oil used at the concentrations of 25, 50 and 100%, the larval mortality percent was increased with the decrease of the concentration and it reached 100% when the solvent used alone without oil. The pupation and the emergence percents decreased with the decrease of the concentration. The sex ratio was in favor of males at all concentrations except at the concentration of 100% where it was in favor of females. When camphor oil was used at concentrations of 25, 50, and 100%, the larval mortality percent was decreased with the decrease of the concentration and it reached 100% when the solvent was used alone without oil. The pupation percent increased with the decrease of the concentration. The emergence percent were similar in different treatments. The sex ratio was in favor of males at all concentrations except in the concentration of 50% it was in favor of females. In addition, the present study investigated the effect of parsley and camphor oils on the trace elements in the larval whole body. Eleven elements in C. albiceps larvae (untreated and treated with solvent (ethyl alcohol) and different concentrations of parsley oil) were detected. In untreated larvae Phosphorous was the most abundant element followed by magnesium and the least abundant element was ferric. In larvae treated with the solvent only (ethyl alcohol) potassium was the most abundant element followed by phosphorous and the least abundant element was ferric. In larvae treated with parsley oil at concentration of 25%, the elemental arrangement appeared to be similar to that of larvae treated with the solvent only. On the other hand, at the

  12. Predation efficiency of Anopheles gambiae larvae by aquatic predators in western Kenya highlands

    Directory of Open Access Journals (Sweden)

    Nyindo Mramba

    2011-07-01

    Full Text Available Abstract Background The current status of insecticide resistance in mosquitoes and the effects of insecticides on non-target insect species have raised the need for alternative control methods for malaria vectors. Predation has been suggested as one of the important regulation mechanisms for malaria vectors in long-lasting aquatic habitats, but the predation efficiency of the potential predators is largely unknown in the highlands of western Kenya. In the current study, we examined the predation efficiency of five predators on Anopheles gambiae s.s larvae in 24 hour and semi- field evaluations. Methods Predators were collected from natural habitats and starved for 12 hours prior to starting experiments. Preliminary experiments were conducted to ascertain the larval stage most predated by each predator species. When each larval instar was subjected to predation, third instar larvae were predated at the highest rate. Third instar larvae of An. gambiae were introduced into artificial habitats with and without refugia at various larval densities. The numbers of surviving larvae were counted after 24 hours in 24. In semi-field experiments, the larvae were counted daily until they were all either consumed or had developed to the pupal stage. Polymerase chain reaction was used to confirm the presence of An. gambiae DNA in predator guts. Results Experiments found that habitat type (P P P P An. gambiae DNA was found in at least three out of ten midguts for all predator species. Gambusia affins was the most efficient, being three times more efficient than tadpoles. Conclusion These experiments provide insight into the efficiency of specific natural predators against mosquito larvae. These naturally occurring predators may be useful in biocontrol strategies for aquatic stage An. gambiae mosquitoes. Further investigations should be done in complex natural habitats for these predators.

  13. Evaluation of culture media for Paenibacillus larvae applied to studies of antimicrobial activity Evaluación de medios de cultivo para el crecimiento de Paenibacillus larvae aplicables en estudios de actividad antimicrobiana

    Directory of Open Access Journals (Sweden)

    L. B. Gende

    2008-09-01

    Full Text Available This study was conducted to compare different liquid culture media for Paenibacillus larvae growth in order to find the best one to be used in studies on activity of antimicrobial substances, such as essential oils. P. larvae presented poor growth in usual broths such as Mueller-Hinton, commonly employed in antimicrobial activity assays. Growth in liquid media was evaluated using Paenibacillus larvae strains isolated from hives located in different geographical zones. The MYT medium (Mueller-Hinton broth, yeast extract and thiamine was selected out of the eight liquid media analyzed, as it proved to be the most adequate due to its higher absorbance at 620 nm. The following mean values were obtained from the four P. larvae strains: 0.227 ± 0.016 for the Cobo strain, 0.279 ± 0.015 for La Plata strain, 0.758 ± 0.020 for Mechongué strain and 0.244 ± 0.0079 for Sierra de los Padres strain, respectively.Este trabajo está orientado a comparar diferentes medios de cultivo líquidos para el crecimiento de Paenibacillus larvae. El objetivo fue encontrar el más apropiado para utilizar en estudios de actividad antimicrobiana de diferentes sustancias, tales como aceites esenciales. P. larvae presenta un crecimiento débil en medios de cultivo como el Mueller-Hinton, comúnmente usado en ensayos de actividad antimicrobiana. Se evaluó el crecimiento en caldos de cultivo de cepas aisladas de colmenas ubicadas en diferentes zonas geográficas. De los ocho medios analizados, el MYT (Mueller-Hinton, extracto de levadura y tiamina mostró ser el más apropiado, en éste se observó el mayor valor de absorbancia a 620 nm. Los valores obtenidos en promedio para los cuatro aislamientos de P. larvae evaluados fueron 0,227 ± 0,016 (cepa de Cobo; 0,279 ± 0,015 (cepa de La Plata; 0,758 ± 0,020 (cepa de Mechongué y 0,244 ± 0,0079 (cepa de Sierra de los Padres.

  14. Effectiveness of Metarhizium anisopliae and Entomopathogenic Nematodes to Control Oryctes rhinoceros Larvae in the Rainy Season.

    Science.gov (United States)

    Indriyanti, Dyah Rini; Widiyaningrum, Priyantini; Haryuni; Slamet, Muji; Maretta, Yoris Adi

    2017-01-01

    Metarhizium anisopliae (MET) and entomopathogenic nematodes (EPN) are microorganisms that attack the larvae of Oryctes rhinoceros. The effects of MET, EPN and the combination of both on the O. rhinoceros larvae were studied during the rainy season in Jepara Indonesia. This study aimed to determine the effectiveness of Metarhizium anisopliae and entomopathogenic nematodes to control Oryctes rhinoceros larvae in the rainy season. There were four level doses of MET, four level doses of EPN and four mixture of MET and EPN. The experiment used 72 containers that were placed in the garden with coconut palm shade. Five kilograms of organic soil that was mixed with biological control agents (MET, EPN and MET+EPN) and ten O. rhinoceros larvae 3rd instar were put in each other container. The data were analyzed by descriptive analysis. Every larvae mortality was observed once a week and observations are for 8 weeks. The result showed that the larval mortality due to MET treatment occurred on 2nd-7th week. Meanwhile, the larval mortality due to EPN treatment took place on 2nd-8th weeks and the larval mortality due to MET+EPN treatment occurred on 1st-5th weeks. The combination of MET and EPN was simultaneously effective to control O. rhinoceros larvae than separate use of MET or EPN. Result of this study showed that using two agents of biocontrol was more effective, so that it can be beneficial for controlling O. rhinoceros larvae in the field.

  15. Resistance Detection of Aedes aegypti Larvae to Cypermethrin from Endemic Area in Cimahi City West Java

    Directory of Open Access Journals (Sweden)

    Endang Puji Astuti

    2014-06-01

    Full Text Available Vector control programs using chemical insecticide e.g organochlorin, organophosphate, carbamate, and pyrethroid (cypermethrin. When those insecticides were applied continuously, it may lead to vector resistance. The aim of this research was to detect any resistance of Ae. aegypti to cypermethrin in endemic areas of Cimahi. This research is a laboratory study that used biochemical test which referred to Lee’s method. Larva samples were collected from 8 villages, which are endemic area. Samples of larvae were collected from 15 villages belonged to dengue endemic areas in town of Cimahi, however, villages that meet the availability of larvae were only 8 villages. To detect the activity of monooxygenase enzyme, a biochemical assay was used in this research by created a reaction between larvae homogenate and sodium acetate substrate. The results of reaction were read using ELISA reader with spectrophotometer wave length of 595 nm. Overall, the results showed that most of the larvae in eight villages of Cimahi is still susceptible to cypermethrin. However, larvae from Cibabat village were 4% resistant, 2% tolerant, and 94% susceptible. On the other hand, Cigugur village showed that 12.7% larvae were tolerant and 87.3% still susceptible. Other villages like Cimahi, Cibeureum, Melong, Baros, Cipageran, and Pasirkaliki still remains susceptible. Resistance detection using biochemical assay of cypermethrin insecticide for Ae.aegypti resulting data stated that in 6 villages were still susceptible but in 3 other villages were already tolerant and 1 village was already resistance.

  16. Effects of irradiation on the biology of the infective larvae of Toxocara canis in the mouse

    Energy Technology Data Exchange (ETDEWEB)

    Barriga, O.O.; Myser, W.C.

    1987-02-01

    Mice were infected with either 2000 normal or irradiated embryonated eggs of Toxocara canis and the number of larvae in their livers, lungs, brains, and carcasses investigated at 5, 20, and 33 days of infection. Mortality of mice infected with normal eggs was 33% between day 4 and 8 postinfection but there was no mortality among mice infected with irradiated eggs. Irradiation with 60, 90, or 150 kr of X-rays inhibited the migration of larvae from the livers and lungs and their accumulation in brain and carcass in proportion to the irradiation dose. By day 33 of infection, the ratio of larvae in liver and lungs to larvae in brain and carcass was 0.16 in normal mice, 0.42 in 60-kr mice, 0.98 in 90-kr mice, and 23.3 in 150-kr mice. Irradiated larvae, particularly those migrating through the peritoneal cavity, died faster than normal larvae until day 20. Irradiation favored survival after day 20. By days 20 and 33 postinfection the total parasite load was 29% and 8%, respectively, of the administered dose in control mice, 18% and 12% in 60-kr mice, 8% and 4% in 90-kr mice, and 0.9% and 0.3% in 150-kr mice. Irradiation of infective T. canis larvae, then, reduces their pathogenicity, inhibits their migration from liver and lungs, kills some of the parasites during the first 3 weeks of infection, but favors their late survival in the host.

  17. Comparison of three artificial digestion methods for detection of non-encapsulated Trichinella pseudospiralis larvae in pork.

    Science.gov (United States)

    Nöckler, K; Reckinger, S; Szabó, I; Maddox-Hyttel, C; Pozio, E; van der Giessen, J; Vallée, I; Boireau, P

    2009-02-23

    In a ring trial involving five laboratories (A, B, C, D, and E), three different methods of artificial digestion were compared for the detection of non-encapsulated Trichinella pseudospiralis larvae in minced meat. Each sample panel consisted of ten 1g minced pork samples. All samples in each panel were derived from a bulk meat preparation with a nominal value of either 7 or 17 larvae per g (lpg). Samples were tested for the number of muscle larvae using the magnetic stirrer method (labs A, B, and E), stomacher method (lab B), and Trichomatic 35 (labs C and D). T. pseudospiralis larvae were found in all 120 samples tested. For samples with 7 lpg, larval recoveries were significantly higher using the stomacher method versus the magnetic stirrer method, but there were no significant differences for samples with 17 lpg. In comparing laboratory results irrespective of the method used, lab B detected a significantly higher number of larvae than lab E for samples with 7 lpg, and lab E detected significantly less larvae than labs A, B, and D in samples with 17 lpg. The lowest overall variation for quantitative results (i.e. larval recoveries which were outside the tolerance range) was achieved by using the magnetic stirrer method (22%), followed by the stomacher method (25%), and Trichomatic 35 (30%). Results revealed that T. pseudospiralis larvae in samples with a nominal value of 7 and 17 lpg can be detected by all three methods of artificial digestion.

  18. Initial characterization of receptors for molecules that induce the settlement and metamorphosis of Haliotis rufescens larvae

    International Nuclear Information System (INIS)

    Trapido-Rosenthal, H.G.

    1985-01-01

    Larvae of the marine gastropod mollusc Haliotis refescens are induced to undergo metamorphosis by γ-aminobutyric acid (GABA) and stereochemically related compounds. The most potent of these inducers is (-)-β-(parachlorophenyl)-GABA (baclofen). The inductive response exhibits positive cooperatively, and is subject to both facilitation (up-regulation) and habituation (down-regulation). Facilitation is brought about by diamino acids such as L-diaminopropionic acid (L-DAPA), and is characterized by decreased Hill coefficients (n/sub H/) and concentration requirements (EC 50 ) for inducers. Facilitation does not require the simultaneous presence of facilitating and inducing compounds, and the facilitated state is persistent. Larvae are capable of being up-regulated 2 days before they are capable of undergoing settlement and metamorphosis. Habituation can be brought about by exposure of pre-competent larvae to GABA 4 days prior to the attainment of competence; it is then slowly reversible. Larvae specifically bind tritiated (-)-baclofen in a manner that is saturable with both increasing time of exposure of larvae to, and with increasing concentration of, this compound. Specific binding can be competed for by unlabeled GABA-mimetic inducing molecules; the order of effectiveness of these molecules as competitors for specific binding correlates well with their effectiveness as inducers of metamorphosis. Facilitation of larvae by exposure to diamino acids does not alter their specific binding of tritiated (-)-baclofen. It is concluded from these findings that Haliotis larvae possess receptors for GABA-mimetic compounds

  19. A comparison of honeybee (Apis mellifera) queen, worker and drone larvae by RNA-Seq.

    Science.gov (United States)

    He, Xu-Jiang; Jiang, Wu-Jun; Zhou, Mi; Barron, Andrew B; Zeng, Zhi-Jiang

    2017-11-06

    Honeybees (Apis mellifera) have haplodiploid sex determination: males develop from unfertilized eggs and females develop from fertilized ones. The differences in larval food also determine the development of females. Here we compared the total somatic gene expression profiles of 2-day and 4-day-old drone, queen and worker larvae by RNA-Seq. The results from a co-expression network analysis on all expressed genes showed that 2-day-old drone and worker larvae were closer in gene expression profiles than 2-day-old queen larvae. This indicated that for young larvae (2-day-old) environmental factors such as larval diet have a greater effect on gene expression profiles than ploidy or sex determination. Drones had the most distinct gene expression profiles at the 4-day larval stage, suggesting that haploidy, or sex dramatically affects the gene expression of honeybee larvae. Drone larvae showed fewer differences in gene expression profiles at the 2-day and 4-day time points than the worker and queen larval comparisons (598 against 1190 and 1181), suggesting a different pattern of gene expression regulation during the larval development of haploid males compared to diploid females. This study indicates that early in development the queen caste has the most distinct gene expression profile, perhaps reflecting the very rapid growth and morphological specialization of this caste compared to workers and drones. Later in development the haploid male drones have the most distinct gene expression profile, perhaps reflecting the influence of ploidy or sex determination on gene expression. © 2017 Institute of Zoology, Chinese Academy of Sciences.

  20. A Determination of Metallothionein in Larvae of Freshwater Midges (Chironomus riparius Using Brdicka Reaction

    Directory of Open Access Journals (Sweden)

    Rene Kizek

    2008-07-01

    Full Text Available Among wide spectrum of biomolecules induced by various stress factors low molecular mass protein called metallothionein (MT is suitable for assessment of the heavy metal environmental pollution. The aim of this work was to determine the metallothionein and total thiols content in larvae of freshwater midges (Chironomus riparius sampled from laboratory exposure to cadmium(II ions and from field studies using differential pulse voltammetry Brdicka reaction. Unique electrochemical instrument, stationary electrochemical analyser Autolab coupled with autosampler, was utilized for the analysis of the samples. The detection limit for MT was evaluated as 5 nM. The larvae exposed to two doses (50 ng/g or 50 μg/g of cadmium(II ions for fifteen days under laboratory controlled conditions were at the end of the exposure killed, homogenized and analysed. MT content in control samples was 1.2 μM, in larvae exposed to 50 ng Cd/g it was 2.0 μM and in larvae exposed to 50 μg Cd/g 2.9 μM. Moreover at field study chironomid larvae as well as sediment samples have been collected from eight field sites with different levels of pollution by heavy. The metals content (chromium, nickel, copper, zinc, arsenic, molybdenum, cadmium, tin and lead in the sediment and or MT content in the chironomid larvae were determined by inductively coupled plasma mass spectrometry or Brdicka reaction, respectively.