
Sample records for brown widow spider

  1. Establishment of the Brown Widow Spider (Araneae: Theridiidae) and Infestation of its Egg Sacs by a Parasitoid, Philolema latrodecti (Hymenoptera: Eurytomidae), in French Polynesia and the Cook Islands. (United States)

    Marie, Jérôme; Vetter, Richard S


    This paper presents two newly established species for French Polynesia: the invasive brown widow spider, Latrodectus geometricus C. L. Koch, and its potential biocontrol agent, the parasitoid wasp, Philolema latrodecti (Fullaway). The brown widow spider was recorded from the island of Moorea in 2006 and, since that discovery, the occurrence of this species has expanded to two of the five archipelagos of French Polynesia including the main island of Tahiti and four of the Cook Islands. Although the tropical climate contributes to the establishment of L. geometricus, a biotic factor, P. latrodecti, may restrain population from demographic explosion. This eurytomid wasp is present in French Polynesia and is a parasitoid that has been used in biological control of the southern black widow Latrodectus mactans (F.) in Hawaii. This wasp could become a significant limiting factor for L. geometricus distribution on these islands, as it was found in 31% of the Tahitian brown widow spider egg sacs that were dissected. However, thus far, the wasp was only found on Tahiti in association with the brown widow spider. Although the brown widow is generally considered to be less toxic than its black widow relatives, it remains of medical concern in French Polynesia because reactions to its bites can, at times, be severe. The spider remains of public concern because it is a novel species; it has the word widow in its name and dark morphs are mistaken as black widows. PMID:26336266

  2. Establishment of the Brown Widow Spider (Araneae: Theridiidae) and Infestation of its Egg Sacs by a Parasitoid, Philolema latrodecti (Hymenoptera: Eurytomidae), in French Polynesia and the Cook Islands. (United States)

    Marie, Jérôme; Vetter, Richard S


    This paper presents two newly established species for French Polynesia: the invasive brown widow spider, Latrodectus geometricus C. L. Koch, and its potential biocontrol agent, the parasitoid wasp, Philolema latrodecti (Fullaway). The brown widow spider was recorded from the island of Moorea in 2006 and, since that discovery, the occurrence of this species has expanded to two of the five archipelagos of French Polynesia including the main island of Tahiti and four of the Cook Islands. Although the tropical climate contributes to the establishment of L. geometricus, a biotic factor, P. latrodecti, may restrain population from demographic explosion. This eurytomid wasp is present in French Polynesia and is a parasitoid that has been used in biological control of the southern black widow Latrodectus mactans (F.) in Hawaii. This wasp could become a significant limiting factor for L. geometricus distribution on these islands, as it was found in 31% of the Tahitian brown widow spider egg sacs that were dissected. However, thus far, the wasp was only found on Tahiti in association with the brown widow spider. Although the brown widow is generally considered to be less toxic than its black widow relatives, it remains of medical concern in French Polynesia because reactions to its bites can, at times, be severe. The spider remains of public concern because it is a novel species; it has the word widow in its name and dark morphs are mistaken as black widows.

  3. Activities against hemostatic proteins and adrenal gland ultrastructural changes caused by the brown widow spider Latrodectus geometricus (Araneae: Theridiidae) venom. (United States)

    Guerrero, Belsy; Finol, Hector J; Reyes-Lugo, Matias; Salazar, Ana M; Sánchez, Elda E; Estrella, Amalid; Roschman-González, Antonio; Ibarra, Carlos; Salvi, Ivan; Rodríguez-Acosta, Alexis


    Brown widow spider (BrWS) (Latrodectus geometricus) venom produces intense systemic reactions such as cramps, harsh muscle nociceptive, nauseas, vomiting and hypertension. The proposed pathogenic mechanisms resulting in these accidents have principally been damages occurring at the nervous system. However, it is suspected that there is also damage of the adrenal glands, as a result of the experimental animal's clinical manifestations, which developed symptoms compatible with acute adrenal insufficiency. We have currently found that the adrenal gland is damaged by this venom gland homogenates (VGH) producing severe alterations on cortex cells resulting in death by acute adrenal insufficiency. In general, the ultrastructural study on the glands of mice under transmission electronic microscopy observations showed alterations in the majority of the intracellular membranes within 3 to 24h. BrWSVGH also showed specific actions on extracellular matrix proteins such as fibronectin, laminin and fibrinogen. In addition, zymogram experiments using gelatin as substrates detected gelatinolytic activity. The molecular exclusion fractionation of crude BrWSVGH resulted in 15 fractions, of which F1 and F2 presented alpha/beta-fibrinogenase and fibronectinolytic activities. Fractions F6, F14 and F15 showed only alpha-fibrinogenase activity; in contrast, the gelatinolytic action was only observed in fraction F11. Only metalloproteinase inhibitors abolished all these proteolytic activities. Our results suggest that adrenal cortex lesions may be relevant in the etiopathogenesis of severe brown widow spider envenoming. To our knowledge, this is the first report on adrenal gland damages, fibrinogenolytic activity and interrelations with cell-matrix adhesion proteins caused by L.geometricus VGH. The venom of this spider could be inducing hemostatic system damages on envenomed patients.

  4. Black Widow Spider (United States)

    ... dling boxes, firewood, lumber, and rocks, etc. The black widow is commonly found in the following places: • Outdoors - woodpiles, rubble piles, under stones, in hol- low stumps, and in rodent burrows, privies, sheds ...

  5. Efficacy of Several Pesticide Products on Brown Widow Spider (Araneae: Theridiidae) Egg Sacs and Their Penetration Through the Egg Sac Silk. (United States)

    Vetter, Richard S; Tarango, Jacob; Campbell, Kathleen A; Tham, Christine; Hayashi, Cheryl Y; Choe, Dong-Hwan


    Information on pesticide effects on spiders is less common than for insects; similar information for spider egg sacs is scarcer in the open literature. Spider egg sacs are typically covered with a protective silk layer. When pesticides are directly applied to egg sacs, the silk might prevent active ingredients from reaching the eggs, blocking their insecticidal effect. We investigated the impact of six water-based pesticide sprays and four oil-based aerosol products against egg sacs of brown widow spiders, Latrodectus geometricus C. L. Koch. All water-based spray products except one failed to provide significant mortality to egg sacs, resulting in successful spiderling emergence from treated egg sacs at a similar rate to untreated egg sacs. In contrast to water-based sprays, oil-based aerosols provided almost complete control, with 94-100% prevention of spiderling emergence. Penetration studies using colored pesticide products indicated that oil-based aerosols were significantly more effective in penetrating egg sac silk than were the water-based sprays, delivering the active ingredients on most (>99%) of the eggs inside the sac. The ability of pesticides to penetrate spider egg sac silk and deliver lethal doses of active ingredients to the eggs is discussed in relation to the chemical nature of egg sac silk proteins. Our study suggests that pest management procedures primarily relying on perimeter application of water-based sprays might not provide satisfactory control of brown widow spider eggs. Determination of the most effective active ingredients and carrier characteristics warrant further research to provide more effective control options for spider egg sacs.

  6. Efficacy of Several Pesticide Products on Brown Widow Spider (Araneae: Theridiidae) Egg Sacs and Their Penetration Through the Egg Sac Silk. (United States)

    Vetter, Richard S; Tarango, Jacob; Campbell, Kathleen A; Tham, Christine; Hayashi, Cheryl Y; Choe, Dong-Hwan


    Information on pesticide effects on spiders is less common than for insects; similar information for spider egg sacs is scarcer in the open literature. Spider egg sacs are typically covered with a protective silk layer. When pesticides are directly applied to egg sacs, the silk might prevent active ingredients from reaching the eggs, blocking their insecticidal effect. We investigated the impact of six water-based pesticide sprays and four oil-based aerosol products against egg sacs of brown widow spiders, Latrodectus geometricus C. L. Koch. All water-based spray products except one failed to provide significant mortality to egg sacs, resulting in successful spiderling emergence from treated egg sacs at a similar rate to untreated egg sacs. In contrast to water-based sprays, oil-based aerosols provided almost complete control, with 94-100% prevention of spiderling emergence. Penetration studies using colored pesticide products indicated that oil-based aerosols were significantly more effective in penetrating egg sac silk than were the water-based sprays, delivering the active ingredients on most (>99%) of the eggs inside the sac. The ability of pesticides to penetrate spider egg sac silk and deliver lethal doses of active ingredients to the eggs is discussed in relation to the chemical nature of egg sac silk proteins. Our study suggests that pest management procedures primarily relying on perimeter application of water-based sprays might not provide satisfactory control of brown widow spider eggs. Determination of the most effective active ingredients and carrier characteristics warrant further research to provide more effective control options for spider egg sacs. PMID:26530954

  7. Recent Advances in Research on Widow Spider Venoms and Toxins


    Shuai Yan; Xianchun Wang


    Widow spiders have received much attention due to the frequently reported human and animal injures caused by them. Elucidation of the molecular composition and action mechanism of the venoms and toxins has vast implications in the treatment of latrodectism and in the neurobiology and pharmaceutical research. In recent years, the studies of the widow spider venoms and the venom toxins, particularly the α-latrotoxin, have achieved many new advances; however, the mechanism of action of the venom...

  8. Recruitment and diversification of an ecdysozoan family of neuropeptide hormones for black widow spider venom expression. (United States)

    McCowan, Caryn; Garb, Jessica E


    Venoms have attracted enormous attention because of their potent physiological effects and dynamic evolution, including the convergent recruitment of homologous genes for venom expression. Here we provide novel evidence for the recruitment of genes from the Crustacean Hyperglycemic Hormone (CHH) and arthropod Ion Transport Peptide (ITP) superfamily for venom expression in black widow spiders. We characterized latrodectin peptides from venom gland cDNAs from the Western black widow spider (Latrodectus hesperus), the brown widow (Latrodectus geometricus) and cupboard spider (Steatoda grossa). Phylogenetic analyses of these sequences with homologs from other spider, scorpion and wasp venom cDNAs, as well as CHH/ITP neuropeptides, show latrodectins as derived members of the CHH/ITP superfamily. These analyses suggest that CHH/ITP homologs are more widespread in spider venoms, and were recruited for venom expression in two additional arthropod lineages. We also found that the latrodectin 2 gene and nearly all CHH/ITP genes include a phase 2 intron in the same position, supporting latrodectin's placement within the CHH/ITP superfamily. Evolutionary analyses of latrodectins suggest episodes of positive selection along some sequence lineages, and positive and purifying selection on specific codons, supporting its functional importance in widow venom. We consider how this improved understanding of latrodectin evolution informs functional hypotheses regarding its role in black widow venom as well as its potential convergent recruitment for venom expression across arthropods.

  9. Recent Advances in Research on Widow Spider Venoms and Toxins. (United States)

    Yan, Shuai; Wang, Xianchun


    Widow spiders have received much attention due to the frequently reported human and animal injures caused by them. Elucidation of the molecular composition and action mechanism of the venoms and toxins has vast implications in the treatment of latrodectism and in the neurobiology and pharmaceutical research. In recent years, the studies of the widow spider venoms and the venom toxins, particularly the α-latrotoxin, have achieved many new advances; however, the mechanism of action of the venom toxins has not been completely clear. The widow spider is different from many other venomous animals in that it has toxic components not only in the venom glands but also in other parts of the adult spider body, newborn spiderlings, and even the eggs. More recently, the molecular basis for the toxicity outside the venom glands has been systematically investigated, with four proteinaceous toxic components being purified and preliminarily characterized, which has expanded our understanding of the widow spider toxins. This review presents a glance at the recent advances in the study on the venoms and toxins from the Latrodectus species. PMID:26633495

  10. Recent Advances in Research on Widow Spider Venoms and Toxins

    Directory of Open Access Journals (Sweden)

    Shuai Yan


    Full Text Available Widow spiders have received much attention due to the frequently reported human and animal injures caused by them. Elucidation of the molecular composition and action mechanism of the venoms and toxins has vast implications in the treatment of latrodectism and in the neurobiology and pharmaceutical research. In recent years, the studies of the widow spider venoms and the venom toxins, particularly the α-latrotoxin, have achieved many new advances; however, the mechanism of action of the venom toxins has not been completely clear. The widow spider is different from many other venomous animals in that it has toxic components not only in the venom glands but also in other parts of the adult spider body, newborn spiderlings, and even the eggs. More recently, the molecular basis for the toxicity outside the venom glands has been systematically investigated, with four proteinaceous toxic components being purified and preliminarily characterized, which has expanded our understanding of the widow spider toxins. This review presents a glance at the recent advances in the study on the venoms and toxins from the Latrodectus species.

  11. Recent Advances in Research on Widow Spider Venoms and Toxins. (United States)

    Yan, Shuai; Wang, Xianchun


    Widow spiders have received much attention due to the frequently reported human and animal injures caused by them. Elucidation of the molecular composition and action mechanism of the venoms and toxins has vast implications in the treatment of latrodectism and in the neurobiology and pharmaceutical research. In recent years, the studies of the widow spider venoms and the venom toxins, particularly the α-latrotoxin, have achieved many new advances; however, the mechanism of action of the venom toxins has not been completely clear. The widow spider is different from many other venomous animals in that it has toxic components not only in the venom glands but also in other parts of the adult spider body, newborn spiderlings, and even the eggs. More recently, the molecular basis for the toxicity outside the venom glands has been systematically investigated, with four proteinaceous toxic components being purified and preliminarily characterized, which has expanded our understanding of the widow spider toxins. This review presents a glance at the recent advances in the study on the venoms and toxins from the Latrodectus species.

  12. Postharvest fumigation of California table grapes with ozone to control Western black widow spider (Araneae: Theridiidae) (United States)

    Ozone fumigations were evaluated for postharvest control of Western black widow spider (BWS), Latrodectus hesperus (Chamberlin and Ivie), in fresh table grapes destined for export from California USA. Mature adult female black widow spiders were contained in separate gas-permeable cages within a flo...

  13. Reversible Myocarditis and Pericarditis after Black Widow Spider Bite or Kounis Syndrome?


    Mehmet Yaman; Turkan Mete; Ismail Ozer; Elif Yaman; Osman Beton


    Clinical manifestation of black widow spider bite is variable and occasionally leads to death in rural areas. Cases of myocarditis and pericarditis after black widow spider bite are rare and the associated prognostic significance is unknown. Kounis syndrome has been defined as an acute coronary syndrome in the setting of allergic or hypersensitivity and anaphylactic or anaphylactoid insults that manifests as vasospastic angina or acute myocardial infarction or stent thrombosis. Allergic myoca...

  14. Insights into brown spider and loxoscelism

    Directory of Open Access Journals (Sweden)

    MH Appel


    Full Text Available Loxosceles is a genus of cosmopolitan spiders comprising several species, and popularly knownas brown spiders or brown recluses. Brown spider bites can cause dermonecrotic lesions andsystemic reactions known as loxoscelism. Systemic effects are less common but may be severe oreven fatal in some patients. Systemic manifestations include intravascular hemolysis, disseminatedintravascular coagulation and acute renal failure. A rapid diagnosis and an understanding of thevenom’s molecular activity are crucial for satisfactory treatment. Mechanisms by which venoms exerttheir deleterious effects are under investigation, and searches are underway for diagnosticenvenomation assays. Molecular biology is being used to produce quantities of several of the mostimportant venom molecules and has contributed to the study and understanding of their mechanismsof action.

  15. Reversible Myocarditis and Pericarditis after Black Widow Spider Bite or Kounis Syndrome? (United States)

    Yaman, Mehmet; Mete, Turkan; Ozer, Ismail; Yaman, Elif; Beton, Osman


    Clinical manifestation of black widow spider bite is variable and occasionally leads to death in rural areas. Cases of myocarditis and pericarditis after black widow spider bite are rare and the associated prognostic significance is unknown. Kounis syndrome has been defined as an acute coronary syndrome in the setting of allergic or hypersensitivity and anaphylactic or anaphylactoid insults that manifests as vasospastic angina or acute myocardial infarction or stent thrombosis. Allergic myocarditis is caused by myocardial inflammation triggered by infectious pathogens, toxic, ischemic, or mechanical injuries, such as drug-related inflammation and other immune reactions. A 15-year-old child was admitted to the emergency department with pulmonary edema after spider bite. ST segment depression on ECG, elevated cardiac enzymes and global left ventricular hypokinesia (with ejection fraction of 22%), and local pericardial effusion findings confirmed the diagnosis of myopericarditis. After heart failure and pulmonary edema oriented medical therapy, clinical status improved. Patient showed a progressive improvement and LV functions returned to normal on the sixth day. Myopericarditis complicating spider bite is rare and sometimes fatal. The mechanism is not clearly known. Alpha-latrotoxin of the black widow spider is mostly convicted in these cases. But allergy or hypersensitivity may play a role in myocardial damage. PMID:26509087

  16. Reversible Myocarditis and Pericarditis after Black Widow Spider Bite or Kounis Syndrome? (United States)

    Yaman, Mehmet; Mete, Turkan; Ozer, Ismail; Yaman, Elif; Beton, Osman


    Clinical manifestation of black widow spider bite is variable and occasionally leads to death in rural areas. Cases of myocarditis and pericarditis after black widow spider bite are rare and the associated prognostic significance is unknown. Kounis syndrome has been defined as an acute coronary syndrome in the setting of allergic or hypersensitivity and anaphylactic or anaphylactoid insults that manifests as vasospastic angina or acute myocardial infarction or stent thrombosis. Allergic myocarditis is caused by myocardial inflammation triggered by infectious pathogens, toxic, ischemic, or mechanical injuries, such as drug-related inflammation and other immune reactions. A 15-year-old child was admitted to the emergency department with pulmonary edema after spider bite. ST segment depression on ECG, elevated cardiac enzymes and global left ventricular hypokinesia (with ejection fraction of 22%), and local pericardial effusion findings confirmed the diagnosis of myopericarditis. After heart failure and pulmonary edema oriented medical therapy, clinical status improved. Patient showed a progressive improvement and LV functions returned to normal on the sixth day. Myopericarditis complicating spider bite is rare and sometimes fatal. The mechanism is not clearly known. Alpha-latrotoxin of the black widow spider is mostly convicted in these cases. But allergy or hypersensitivity may play a role in myocardial damage.

  17. Reversible Myocarditis and Pericarditis after Black Widow Spider Bite or Kounis Syndrome?

    Directory of Open Access Journals (Sweden)

    Mehmet Yaman


    Full Text Available Clinical manifestation of black widow spider bite is variable and occasionally leads to death in rural areas. Cases of myocarditis and pericarditis after black widow spider bite are rare and the associated prognostic significance is unknown. Kounis syndrome has been defined as an acute coronary syndrome in the setting of allergic or hypersensitivity and anaphylactic or anaphylactoid insults that manifests as vasospastic angina or acute myocardial infarction or stent thrombosis. Allergic myocarditis is caused by myocardial inflammation triggered by infectious pathogens, toxic, ischemic, or mechanical injuries, such as drug-related inflammation and other immune reactions. A 15-year-old child was admitted to the emergency department with pulmonary edema after spider bite. ST segment depression on ECG, elevated cardiac enzymes and global left ventricular hypokinesia (with ejection fraction of 22%, and local pericardial effusion findings confirmed the diagnosis of myopericarditis. After heart failure and pulmonary edema oriented medical therapy, clinical status improved. Patient showed a progressive improvement and LV functions returned to normal on the sixth day. Myopericarditis complicating spider bite is rare and sometimes fatal. The mechanism is not clearly known. Alpha-latrotoxin of the black widow spider is mostly convicted in these cases. But allergy or hypersensitivity may play a role in myocardial damage.

  18. Molecular evolution of α-latrotoxin, the exceptionally potent vertebrate neurotoxin in black widow spider venom. (United States)

    Garb, Jessica E; Hayashi, Cheryl Y


    Black widow spiders (members of the genus Latrodectus) are widely feared because of their potent neurotoxic venom. α-Latrotoxin is the vertebrate-specific toxin responsible for the dramatic effects of black widow envenomation. The evolution of this toxin is enigmatic because only two α-latrotoxin sequences are known. In this study, ~4 kb α-latrotoxin sequences and their homologs were characterized from a diversity of Latrodectus species, and representatives of Steatoda and Parasteatoda, establishing the wide distribution of latrotoxins across the mega-diverse spider family Theridiidae. Across black widow species, α-latrotoxin shows ≥ 94% nucleotide identity and variability consistent with purifying selection. Multiple codon and branch-specific estimates of the nonsynonymous/synonymous substitution rate ratio also suggest a long history of purifying selection has acted on α-latrotoxin across Latrodectus and Steatoda. However, α-latrotoxin is highly divergent in amino acid sequence between these genera, with 68.7% of protein differences involving non-conservative substitutions, evidence for positive selection on its physiochemical properties and particular codons, and an elevated rate of nonsynonymous substitutions along α-latrotoxin's Latrodectus branch. Such variation likely explains the efficacy of red-back spider, L. hasselti, antivenom in treating bites from other Latrodectus species, and the weaker neurotoxic symptoms associated with Steatoda and Parasteatoda bites. Long-term purifying selection on α-latrotoxin indicates its functional importance in black widow venom, even though vertebrates are a small fraction of their diet. The greater differences between Latrodectus and Steatoda α-latrotoxin, and their relationships to invertebrate-specific latrotoxins, suggest a shift in α-latrotoxin toward increased vertebrate toxicity coincident with the evolution of widow spiders.

  19. Chromosome mapping of dragline silk genes in the genomes of widow spiders (Araneae, Theridiidae.

    Directory of Open Access Journals (Sweden)

    Yonghui Zhao

    Full Text Available With its incredible strength and toughness, spider dragline silk is widely lauded for its impressive material properties. Dragline silk is composed of two structural proteins, MaSp1 and MaSp2, which are encoded by members of the spidroin gene family. While previous studies have characterized the genes that encode the constituent proteins of spider silks, nothing is known about the physical location of these genes. We determined karyotypes and sex chromosome organization for the widow spiders, Latrodectus hesperus and L. geometricus (Araneae, Theridiidae. We then used fluorescence in situ hybridization to map the genomic locations of the genes for the silk proteins that compose the remarkable spider dragline. These genes included three loci for the MaSp1 protein and the single locus for the MaSp2 protein. In addition, we mapped a MaSp1 pseudogene. All the MaSp1 gene copies and pseudogene localized to a single chromosomal region while MaSp2 was located on a different chromosome of L. hesperus. Using probes derived from L. hesperus, we comparatively mapped all three MaSp1 loci to a single region of a L. geometricus chromosome. As with L. hesperus, MaSp2 was found on a separate L. geometricus chromosome, thus again unlinked to the MaSp1 loci. These results indicate orthology of the corresponding chromosomal regions in the two widow genomes. Moreover, the occurrence of multiple MaSp1 loci in a conserved gene cluster across species suggests that MaSp1 proliferated by tandem duplication in a common ancestor of L. geometricus and L. hesperus. Unequal crossover events during recombination could have given rise to the gene copies and could also maintain sequence similarity among gene copies over time. Further comparative mapping with taxa of increasing divergence from Latrodectus will pinpoint when the MaSp1 duplication events occurred and the phylogenetic distribution of silk gene linkage patterns.

  20. Systematics, Bioecology, and Medical Importance of Widow Spiders (Lathrodectus spp. in Khorasan Province, Iran

    Directory of Open Access Journals (Sweden)

    J Rafijenad


    Full Text Available Following the hospitalization of 195 individuals due to the spider bite in 1995 and three cases of recorded death in the year of 1993 which were referred to Emam Reza Hospital in Mashad, the present study was undertaken on bionomics and medical importance of Lathrodectus spp in Khorasan Province, during 1995-2005. A total cases of 195 bites were studied composing of 70.8 % males and 29.2% females. The most prevalence cases were observed in mid age (20-55 years old and par¬ticularly among farmers (36.4%. A total number of 216 adult widow spiders and 258 egg sacs were collected from their habitats in different localities of 15 counties in the province. The following species have been recognized: Lathrodectus tredecimgottatus (62%, L. dahli (32%, L. geometricus (5% and L. pallidus (1%. Here is the first report on the occurrence of males of L. pallidus as well as both sexes of L. trdecimgottatus and L. geometricus in the country. The sex ratio among collected specimens was 88% and 12% female and male, respectively. Summer provides the most suitable and favorable climatic condition for the activities of these spiders. However 65% of spiders were collected in this season. Among different cit¬ies, Mashad had (60% the most reported cases in the study area. Foot was more injured than other parts. 96.5% of pa¬tients exhib¬ited localized pain from which only 2% had no pain in the bitten part and 87% had a generalized pain in whole body.

  1. Neurotoxic activity and ultrastructural changes in muscles caused by the brown widow spider Latrodectus geometricus venom Actividad neurotóxica y cambios ultraestructurales en musculos causados por el veneno de la araña viuda marrón Latrodectus geometricus

    Directory of Open Access Journals (Sweden)

    Matias Reyes-Lugo


    Full Text Available Brown widow spider (Latrodectus geometricus venom (BrWSV produces few local lesions and intense systemic reactions such as cramps, harsh muscle pains, nausea, vomiting and hypertension. Approximately 16 protein bands under reducing conditions and ~ 14 bands under non-reducing conditions on a 12.5% sodium dodecyl sulfate-polyacrylamide gel electrophoresis were observed. Neurotoxic clinical manifestations were confirmed in vivo, while proteolytic activity was demonstrated on gelatine film. Severe ultrastructural damages in mice skeletal muscles were observed at 3, 6, 12 and 24 h postinjection with at total of 45 µg of venom protein. Infiltration of eosinophils and ruptures of the cellular membranes were observed in the muscles along with swelling of the nuclear cover and interruption of the collagen periodicity. Altered mitochondrias and autophage vacuoles, nuclear indentation and mitochondria without cristae, slight increment of intermyofibrillar and subsarcolemic spaces and myelinic figures formation were also observed. In the capillary, endothelial membrane unfolding into the lumen was noticed; along with myelinic figures compatible with a toxic myopathy. Swollen sarcotubular systems with lysis of membrane, intense mitochondria autophagia and areas without pinocytic vesicles were observed. Swollen mitochondria surrounded by necrotic areas, myofibrillar disorganization and big vacuolas of the sarcotubular system, degenerated mitochondrium with formation of myelinic figure was seen. Glycogenosomes with small particulate, muscle type glycogen was noticed. Autophagic vacuole (autophagolysosomes and necrotic areas were also noticed. These damages may be due to interactive effects of the multifactorial action of venom components. However, Latrodectus geometricus venom molecules may also be utilized as neuro therapeutic tools, as they affect neuronal activities with high affinity and selectivity. To our knowledge, the present study is the first

  2. Copulation with immature females increases male fitness in cannibalistic widow spiders. (United States)

    Biaggio, M Daniela; Sandomirsky, Iara; Lubin, Yael; Harari, Ally R; Andrade, Maydianne C B


    Copulatory cannibalism of male 'widow' spiders (genus Latrodectus) is a model example of the extreme effects of sexual selection, particularly in L. hasselti and L. geometricus where males typically facilitate cannibalism by females and mate only once. We show that these males can increase their reproductive success by copulating with final-instar, immature females after piercing the female's exoskeleton to access her newly developed sperm storage organs. Females retain sperm through their final moult and have similar fecundity to adult-mated females. This is an adaptive male tactic because immature mating increases insemination success relative to adult mating (which predicts higher paternity) and moreover, rarely ends in cannibalism, so males can mate again. Although successful only during a brief period before the female's final moult, males may employ this tactic when they associate with final-instar females in nature. Consistent with this, one-third of L. hasselti females collected as immatures in nature were already mated. Immature mating alters sexual selection on these otherwise monogynous males, and may explain male traits allowing facultative polygyny in Latrodectus Since male cohabitation with immature females is common among invertebrates, immature mating may be a widespread, previously unrecognized mating tactic, particularly when unmated females are of high reproductive value. PMID:27651535

  3. Recent advances in the understanding of brown spider venoms: From the biology of spiders to the molecular mechanisms of toxins. (United States)

    Gremski, Luiza Helena; Trevisan-Silva, Dilza; Ferrer, Valéria Pereira; Matsubara, Fernando Hitomi; Meissner, Gabriel Otto; Wille, Ana Carolina Martins; Vuitika, Larissa; Dias-Lopes, Camila; Ullah, Anwar; de Moraes, Fábio Rogério; Chávez-Olórtegui, Carlos; Barbaro, Katia Cristina; Murakami, Mario Tyago; Arni, Raghuvir Krishnaswamy; Senff-Ribeiro, Andrea; Chaim, Olga Meiri; Veiga, Silvio Sanches


    The Loxosceles genus spiders (the brown spiders) are encountered in all the continents, and the clinical manifestations following spider bites include skin necrosis with gravitational lesion spreading and occasional systemic manifestations, such as intravascular hemolysis, thrombocytopenia and acute renal failure. Brown spider venoms are complex mixtures of toxins especially enriched in three molecular families: the phospholipases D, astacin-like metalloproteases and Inhibitor Cystine Knot (ICK) peptides. Other toxins with low level of expression also present in the venom include the serine proteases, serine protease inhibitors, hyaluronidases, allergen factors and translationally controlled tumor protein (TCTP). The mechanisms by which the Loxosceles venoms act and exert their noxious effects are not fully understood. Except for the brown spider venom phospholipase D, which causes dermonecrosis, hemolysis, thrombocytopenia and renal failure, the pathological activities of the other venom toxins remain unclear. The objective of the present review is to provide insights into the brown spider venoms and loxoscelism based on recent results. These insights include the biology of brown spiders, the clinical features of loxoscelism and the diagnosis and therapy of brown spider bites. Regarding the brown spider venom, this review includes a description of the novel toxins revealed by molecular biology and proteomics techniques, the data regarding three-dimensional toxin structures, and the mechanism of action of these molecules. Finally, the biotechnological applications of the venom components, especially for those toxins reported as recombinant molecules, and the challenges for future study are discussed.

  4. Isolation and Preliminary Characterization of Proteinaceous Toxins with Insecticidal and Antibacterial Activities from Black Widow Spider (L. tredecimguttatus Eggs

    Directory of Open Access Journals (Sweden)

    Qian Lei


    Full Text Available The eggs of black widow spider (L. tredecimguttatus have been demonstrated to be rich in toxic proteinaceous components. The study on such active components is of theoretical and practical importance. In the present work, using a combination of multiple biochemical and biological strategies, we isolated and characterized the proteinaceous components from the aqueous extract of the black widow spider eggs. After gel filtration of the egg extract, the resulting main protein and peptide peaks were further fractionated by ion exchange chromatography and reversed-phase high performance liquid chromatography. Two proteinaceous components, named latroeggtoxin-III and latroeggtoxin-IV, respectively, were purified to homogeneity. Latroeggtoxin-III was demonstrated to have a molecular weight of about 36 kDa. Activity analysis indicated that latroeggtoxin-III exhibited neurotoxicity against cockroaches but had no obvious effect on mice, suggesting that it is an insect-specific toxin. Latroeggtoxin-IV, with a molecular weight of 3.6 kDa, was shown to be a broad-spectrum antibacterial peptide, showing inhibitory activity against all five species of bacteria tested, with the highest activity against Staphylococcus aureus. Finally, the implications of the proteinaceous toxins in egg protection and their potential applications were analyzed and discussed.

  5. Brown spider (Loxosceles genus) venom toxins: tools for biological purposes. (United States)

    Chaim, Olga Meiri; Trevisan-Silva, Dilza; Chaves-Moreira, Daniele; Wille, Ana Carolina M; Ferrer, Valéria Pereira; Matsubara, Fernando Hitomi; Mangili, Oldemir Carlos; da Silveira, Rafael Bertoni; Gremski, Luiza Helena; Gremski, Waldemiro; Senff-Ribeiro, Andrea; Veiga, Silvio Sanches


    Venomous animals use their venoms as tools for defense or predation. These venoms are complex mixtures, mainly enriched of proteic toxins or peptides with several, and different, biological activities. In general, spider venom is rich in biologically active molecules that are useful in experimental protocols for pharmacology, biochemistry, cell biology and immunology, as well as putative tools for biotechnology and industries. Spider venoms have recently garnered much attention from several research groups worldwide. Brown spider (Loxosceles genus) venom is enriched in low molecular mass proteins (5-40 kDa). Although their venom is produced in minute volumes (a few microliters), and contain only tens of micrograms of protein, the use of techniques based on molecular biology and proteomic analysis has afforded rational projects in the area and permitted the discovery and identification of a great number of novel toxins. The brown spider phospholipase-D family is undoubtedly the most investigated and characterized, although other important toxins, such as low molecular mass insecticidal peptides, metalloproteases and hyaluronidases have also been identified and featured in literature. The molecular pathways of the action of these toxins have been reported and brought new insights in the field of biotechnology. Herein, we shall see how recent reports describing discoveries in the area of brown spider venom have expanded biotechnological uses of molecules identified in these venoms, with special emphasis on the construction of a cDNA library for venom glands, transcriptome analysis, proteomic projects, recombinant expression of different proteic toxins, and finally structural descriptions based on crystallography of toxins.

  6. Brown Spider (Loxosceles genus Venom Toxins: Tools for Biological Purposes

    Directory of Open Access Journals (Sweden)

    Andrea Senff-Ribeiro


    Full Text Available Venomous animals use their venoms as tools for defense or predation. These venoms are complex mixtures, mainly enriched of proteic toxins or peptides with several, and different, biological activities. In general, spider venom is rich in biologically active molecules that are useful in experimental protocols for pharmacology, biochemistry, cell biology and immunology, as well as putative tools for biotechnology and industries. Spider venoms have recently garnered much attention from several research groups worldwide. Brown spider (Loxosceles genus venom is enriched in low molecular mass proteins (5–40 kDa. Although their venom is produced in minute volumes (a few microliters, and contain only tens of micrograms of protein, the use of techniques based on molecular biology and proteomic analysis has afforded rational projects in the area and permitted the discovery and identification of a great number of novel toxins. The brown spider phospholipase-D family is undoubtedly the most investigated and characterized, although other important toxins, such as low molecular mass insecticidal peptides, metalloproteases and hyaluronidases have also been identified and featured in literature. The molecular pathways of the action of these toxins have been reported and brought new insights in the field of biotechnology. Herein, we shall see how recent reports describing discoveries in the area of brown spider venom have expanded biotechnological uses of molecules identified in these venoms, with special emphasis on the construction of a cDNA library for venom glands, transcriptome analysis, proteomic projects, recombinant expression of different proteic toxins, and finally structural descriptions based on crystallography of toxins.

  7. Biotechnological applications of brown spider (Loxosceles genus) venom toxins. (United States)

    Senff-Ribeiro, Andrea; Henrique da Silva, Paulo; Chaim, Olga Meiri; Gremski, Luiza Helena; Paludo, Kátia Sabrina; Bertoni da Silveira, Rafael; Gremski, Waldemiro; Mangili, Oldemir Carlos; Veiga, Silvio Sanches


    Loxoscelism (the term used to define accidents by the bite of brown spiders) has been reported worldwide. Clinical manifestations following brown spider bites are frequently associated with skin degeneration, a massive inflammatory response at the injured region, intravascular hemolysis, platelet aggregation causing thrombocytopenia and renal disturbances. The mechanisms by which the venom exerts its noxious effects are currently under investigation. The whole venom is a complex mixture of toxins enriched with low molecular mass proteins in the range of 5-40 kDa. Toxins including alkaline phosphatase, hyaluronidase, metalloproteases (astacin-like proteases), low molecular mass (5.6-7.9 kDa) insecticidal peptides and phospholipases-D (dermonecrotic toxins) have been identified in the venom. The purpose of the present review is to describe biotechnological applications of whole venom or some toxins, with especial emphasis upon molecular biology findings obtained in the last years.

  8. Osteomyelitis of the Mandibular Symphysis Caused by Brown Recluse Spider Bite


    Naidu, Deepak K.; Ghurani, Rami; Salas, R. Emerick; Mannari, Rudolph J.; Robson, Martin C.; Payne, Wyatt G.


    Background: Brown recluse spider bites cause significant trauma via their tissue toxic venom. Diagnosis of these injuries and envenomation is difficult and many times presumptive. Treatment is varied and dependent upon presentation and course of injury. Materials and Methods: We present a case of a previously unreported incidence of osteomyelitis of the mandible as a result of a brown recluse spider bite. A review of the literature and discussion of diagnosis and treatment of brown recluse sp...

  9. Extracellular matrix molecules as targets for brown spider venom toxins

    Directory of Open Access Journals (Sweden)

    Veiga S.S.


    Full Text Available Loxoscelism, the term used to describe lesions and clinical manifestations induced by brown spider's venom (Loxosceles genus, has attracted much attention over the last years. Brown spider bites have been reported to cause a local and acute inflammatory reaction that may evolve to dermonecrosis (a hallmark of envenomation and hemorrhage at the bite site, besides systemic manifestations such as thrombocytopenia, disseminated intravascular coagulation, hemolysis, and renal failure. The molecular mechanisms by which Loxosceles venoms induce injury are currently under investigation. In this review, we focused on the latest reports describing the biological and physiopathological aspects of loxoscelism, with reference mainly to the proteases recently described as metalloproteases and serine proteases, as well as on the proteolytic effects triggered by L. intermedia venom upon extracellular matrix constituents such as fibronectin, fibrinogen, entactin and heparan sulfate proteoglycan, besides the disruptive activity of the venom on Engelbreth-Holm-Swarm basement membranes. Degradation of these extracellular matrix molecules and the observed disruption of basement membranes could be related to deleterious activities of the venom such as loss of vessel and glomerular integrity and spreading of the venom toxins to underlying tissues.

  10. Surrounded by Spiders! New Black Widows and Redbacks in the Galactic Field

    CERN Document Server

    Roberts, Mallory S E


    Over the last few years, the number of known eclipsing radio millisecond pulsar systems in the Galactic field has dramatically increased, with many being associated with Fermi gamma-ray sources. All are in tight binaries (orbital period < 24 hr) with many being classical "black widows" which have very low mass companions (companion mass Mc << 0.1 Msol) but some are "redbacks" with low mass (Mc ~ 0.2 - 0.4Msol) companions which are probably non-degenerate. These latter are systems where the mass transfer process may have only temporarily halted, and so are transitional systems between low mass X-ray binaries and ordinary binary millisecond pulsars. Here we review the new discoveries and their multi-wavelength properties, and briefly discuss models of shock emission, mass determinations, and evolutionary scenarios.

  11. A Novel Hyaluronidase from Brown Spider (Loxosceles intermedia) Venom (Dietrich's Hyaluronidase): From Cloning to Functional Characterization


    Valéria Pereira Ferrer; Thiago Lopes de Mari; Luiza Helena Gremski; Dilza Trevisan Silva; Rafael Bertoni da Silveira; Waldemiro Gremski; Olga Meiri Chaim; Andrea Senff-Ribeiro; Helena Bonciani Nader; Silvio Sanches Veiga


    Loxoscelism is the designation given to clinical symptoms evoked by Loxosceles spider's bites. Clinical manifestations include skin necrosis with gravitational spreading and systemic disturbs. The venom contains several enzymatic toxins. Herein, we describe the cloning, expression, refolding and biological evaluation of a novel brown spider protein characterized as a hyaluronidase. Employing a venom gland cDNA library, we cloned a hyaluronidase (1200 bp cDNA) that encodes for a signal peptide...

  12. Tracking a medically important spider: climate change, ecological niche modeling, and the brown recluse (Loxosceles reclusa.

    Directory of Open Access Journals (Sweden)

    Erin E Saupe

    Full Text Available Most spiders use venom to paralyze their prey and are commonly feared for their potential to cause injury to humans. In North America, one species in particular, Loxosceles reclusa (brown recluse spider, Sicariidae, causes the majority of necrotic wounds induced by the Araneae. However, its distributional limitations are poorly understood and, as a result, medical professionals routinely misdiagnose brown recluse bites outside endemic areas, confusing putative spider bites for other serious conditions. To address the issue of brown recluse distribution, we employ ecological niche modeling to investigate the present and future distributional potential of this species. We delineate range boundaries and demonstrate that under future climate change scenarios, the spider's distribution may expand northward, invading previously unaffected regions of the USA. At present, the spider's range is centered in the USA, from Kansas east to Kentucky and from southern Iowa south to Louisiana. Newly influenced areas may include parts of Nebraska, Minnesota, Wisconsin, Michigan, South Dakota, Ohio, and Pennsylvania. These results illustrate a potential negative consequence of climate change on humans and will aid medical professionals in proper bite identification/treatment, potentially reducing bite misdiagnoses.

  13. Tracking a medically important spider: climate change, ecological niche modeling, and the brown recluse (Loxosceles reclusa). (United States)

    Saupe, Erin E; Papes, Monica; Selden, Paul A; Vetter, Richard S


    Most spiders use venom to paralyze their prey and are commonly feared for their potential to cause injury to humans. In North America, one species in particular, Loxosceles reclusa (brown recluse spider, Sicariidae), causes the majority of necrotic wounds induced by the Araneae. However, its distributional limitations are poorly understood and, as a result, medical professionals routinely misdiagnose brown recluse bites outside endemic areas, confusing putative spider bites for other serious conditions. To address the issue of brown recluse distribution, we employ ecological niche modeling to investigate the present and future distributional potential of this species. We delineate range boundaries and demonstrate that under future climate change scenarios, the spider's distribution may expand northward, invading previously unaffected regions of the USA. At present, the spider's range is centered in the USA, from Kansas east to Kentucky and from southern Iowa south to Louisiana. Newly influenced areas may include parts of Nebraska, Minnesota, Wisconsin, Michigan, South Dakota, Ohio, and Pennsylvania. These results illustrate a potential negative consequence of climate change on humans and will aid medical professionals in proper bite identification/treatment, potentially reducing bite misdiagnoses. PMID:21464985

  14. Geophagy in brown spider monkeys (Ateles hybridus) in a lowland tropical rainforest in Colombia. (United States)

    Link, Andres; de Luna, Ana Gabriela; Arango, Ricardo; Diaz, Maria Clara


    Spider monkeys and howler monkeys are the only Neotropical primates that eat soil from mineral licks. Not all species within these genera visit mineral licks, and geophagy has been restricted to populations of Ateles belzebuth belzebuth,Ateles belzebuth chamek and Alouatta seniculus in western Amazonian rainforests. With the aid of a camera trap we studied the visitation patterns of a group of brown spider monkeys (Ateles hybridus) to a mineral lick at Serrania de Las Quinchas, in Colombia. Spider monkeys visited the lick frequently throughout the year, with a monthly average of 21.7 ± 7.2 visits per 100 days of camera trapping (n = 14 months). Spider monkeys visited the mineral lick almost always on days with no rain, or very little (<3 mm) rain, suggesting that proximate environmental variables might determine spider monkeys' decisions to come to the ground at the licks. This study expands the geographical occurrence of mineral lick use by spider monkeys providing additional data for future assessments on the biogeographical correlates of mineral lick use by platyrrhines. PMID:21494049

  15. Phospholipase D toxins of brown spider venom convert lysophosphatidylcholine and sphingomyelin to cyclic phosphates.

    Directory of Open Access Journals (Sweden)

    Daniel M Lajoie

    Full Text Available Venoms of brown spiders in the genus Loxosceles contain phospholipase D enzyme toxins that can cause severe dermonecrosis and even death in humans. These toxins cleave the substrates sphingomyelin and lysophosphatidylcholine in mammalian tissues, releasing the choline head group. The other products of substrate cleavage have previously been reported to be monoester phospholipids, which would result from substrate hydrolysis. Using (31P NMR and mass spectrometry we demonstrate that recombinant toxins, as well as whole venoms from diverse Loxosceles species, exclusively catalyze transphosphatidylation rather than hydrolysis, forming cyclic phosphate products from both major substrates. Cyclic phosphates have vastly different biological properties from their monoester counterparts, and they may be relevant to the pathology of brown spider envenomation.

  16. Effects of Gene Duplication, Positive Selection, and Shifts in Gene Expression on the Evolution of the Venom Gland Transcriptome in Widow Spiders. (United States)

    Haney, Robert A; Clarke, Thomas H; Gadgil, Rujuta; Fitzpatrick, Ryan; Hayashi, Cheryl Y; Ayoub, Nadia A; Garb, Jessica E


    Gene duplication and positive selection can be important determinants of the evolution of venom, a protein-rich secretion used in prey capture and defense. In a typical model of venom evolution, gene duplicates switch to venom gland expression and change function under the action of positive selection, which together with further duplication produces large gene families encoding diverse toxins. Although these processes have been demonstrated for individual toxin families, high-throughput multitissue sequencing of closely related venomous species can provide insights into evolutionary dynamics at the scale of the entire venom gland transcriptome. By assembling and analyzing multitissue transcriptomes from the Western black widow spider and two closely related species with distinct venom toxicity phenotypes, we do not find that gene duplication and duplicate retention is greater in gene families with venom gland biased expression in comparison with broadly expressed families. Positive selection has acted on some venom toxin families, but does not appear to be in excess for families with venom gland biased expression. Moreover, we find 309 distinct gene families that have single transcripts with venom gland biased expression, suggesting that the switching of genes to venom gland expression in numerous unrelated gene families has been a dominant mode of evolution. We also find ample variation in protein sequences of venom gland-specific transcripts, lineage-specific family sizes, and ortholog expression among species. This variation might contribute to the variable venom toxicity of these species.

  17. Necrotic skin lesion in a dog attributed to Loxosceles (brown spider bite: a case report

    Directory of Open Access Journals (Sweden)

    LHA Machado


    Full Text Available Envenomations caused by Loxosceles (brown spider have been reported throughout the world. Clinical signs associated to bites of these spiders involve dermonecrotic lesions and intense local inflammatory response, besides systemic manifestations such as intravascular hemolysis, thrombocytopenia, disseminated intravascular coagulation and acute renal failure. The present study aimed to report and to describe dermonecrotic lesions probably caused by a Loxosceles envenomation in a four year-old poodle female dog, treated at the Dermatology Service of the Veterinary Hospital of the Veterinary Medicine and Animal Husbandry School, São Paulo State University, Botucatu, Brazil. Initially, the animal presented two skin lesions with blackish aspect that evolved into ulcerative crusts. The owner reported the presence of a brown spider near the place where the animal spent most of the time. Histological examination of lesions revealed necrosis of the epidermis extending to adnexa and panniculi, which is compatible with Loxosceles bite reaction. The animal was treated with systemic antibiotic and local curatives. Lesions healed by second intention in two months.

  18. Brown spider (Loxosceles genus) venom toxins: Evaluation of biological conservation by immune cross-reactivity. (United States)

    Buch, Daniela Regina; Souza, Fernanda Nunes; Meissner, Gabriel Otto; Morgon, Adriano Marcelo; Gremski, Luiza Helena; Ferrer, Valéria Pereira; Trevisan-Silva, Dilza; Matsubara, Fernando Hitomi; Boia-Ferreira, Mariana; Sade, Youssef Bacila; Chaves-Moreira, Daniele; Gremski, Waldemiro; Veiga, Silvio Sanches; Chaim, Olga Meiri; Senff-Ribeiro, Andrea


    Loxosceles spiders are responsible for serious human envenomations worldwide. The collection of symptoms found in victims after accidents is called loxoscelism and is characterized by two clinical conditions: cutaneous loxoscelism and systemic loxocelism. The only specific treatment is serum therapy, in which an antiserum produced with Loxosceles venom is administered to the victims after spider accidents. Our aim was to improve our knowledge, regarding the immunological relationship among toxins from the most epidemiologic important species in Brazil (Loxosceles intermedia, Loxosceles gaucho and Loxosceles laeta). Immunoassays using spider venoms and L. intermedia recombinant toxins were performed and their cross-reactivity assessed. The biological conservation of the main Loxosceles toxins (Phospholipases-D, Astacin-like metalloproteases, Hyaluronidase, ICK-insecticide peptide and TCTP-histamine releasing factor) were investigated. An in silico analysis of the putative epitopes was performed and is discussed on the basis of the experimental results. Our data is an immunological investigation in light of biological conservation throughout the Loxosceles genus. The results bring out new insights on brown spider venom toxins for study, diagnosis and treatment of loxoscelism and putative biotechnological applications concerning immune conserved features in the toxins.

  19. Structural Insights into Substrate Binding of Brown Spider Venom Class II Phospholipases D. (United States)

    Coronado, M A; Ullah, A; da Silva, L S; Chaves-Moreira, D; Vuitika, L; Chaim, O M; Veiga, S S; Chahine, J; Murakami, M T; Arni, R K


    Phospholipases D (PLDs), the major dermonecrotic factors from brown spider venoms, trigger a range of biological reactions both in vitro and in vivo. Despite their clinical relevance in loxoscelism, structural data is restricted to the apo-form of these enzymes, which has been instrumental in understanding the functional differences between the class I and II spider PLDs. The crystal structures of the native class II PLD from Loxosceles intermedia complexed with myo-inositol 1-phosphate and the inactive mutant H12A complexed with fatty acids indicate the existence of a strong ligand-dependent conformation change of the highly conserved aromatic residues, Tyr 223 and Trp225 indicating their roles in substrate binding. These results provided insights into the structural determinants for substrate recognition and binding by class II PLDs.

  20. Characterization of the venom from the Brazilian Brown Spider Loxosceles similis Moenkhaus, 1898 (Araneae, Sicariidae). (United States)

    Silvestre, F G; de Castro, C S; de Moura, J F; Giusta, M S; De Maria, M; Alvares, E S S; Lobato, F C F; Assis, R A; Gonçalves, L A; Gubert, I C; Chávez-Olórtegui, C; Kalapothakis, E


    Accidents caused by brown spiders (Loxosceles genus) are frequent in Brazil and are associated with dermonecrotic lesions and, eventually, systemic reactions that may be lethal. The major species implicated with human envenoming have been: L. intermedia, L. gaucho and L. laeta. In this study we characterized the venom from Loxosceles similis, a species of spider normally found inside caves. L. similis venom was characterized by two-dimensional gel electrophoresis and enzymatic activity (dermonecrosis and haemolysis). The lethal dose to mice and the capacity of commercial anti-serum to neutralize this venom were also analysed. The cross-reactivity with anti-venoms against L. intermedia, L. laeta and L. gaucho were studied. Our results showed that this venom was able to induce severe dermonecrotic lesions and showed the presence of the bacteria Clostridium septicum in association with the fangs. In addition, we have cloned the DNA coding for a dermonecrotic protein (LsD1), using the genomic DNA of L. similis. The deduced amino acid sequence showed a toxin of approximately 31.2 kDa with an estimated pI of 7.37 and sequence similar to LiD1, a protein from the dermonecrotic family of Loxosceles intermedia spider venom, a synanthropic species of medical importance.

  1. Comprehensive Proteomic Analysis of Spider Dragline Silk from Black Widows: A Recipe to Build Synthetic Silk Fibers (United States)

    Larracas, Camille; Hekman, Ryan; Dyrness, Simmone; Arata, Alisa; Williams, Caroline; Crawford, Taylor; Vierra, Craig A.


    The outstanding material properties of spider dragline silk fibers have been attributed to two spidroins, major ampullate spidroins 1 and 2 (MaSp1 and MaSp2). Although dragline silk fibers have been treated with different chemical solvents to elucidate the relationship between protein structure and fiber mechanics, there has not been a comprehensive proteomic analysis of the major ampullate (MA) gland, its spinning dope, and dragline silk using a wide range of chaotropic agents, inorganic salts, and fluorinated alcohols to elucidate their complete molecular constituents. In these studies, we perform in-solution tryptic digestions of solubilized MA glands, spinning dope and dragline silk fibers using five different solvents, followed by nano liquid chromatography coupled to tandem mass spectrometry (LC-MS/MS) analysis with an Orbitrap Fusion™ Tribrid™. To improve protein identification, we employed three different tryptic peptide fragmentation modes, which included collision-induced dissociation (CID), electron transfer dissociation (ETD), and high energy collision dissociation (HCD) to discover proteins involved in the silk assembly pathway and silk fiber. In addition to MaSp1 and MaSp2, we confirmed the presence of a third spidroin, aciniform spidroin 1 (AcSp1), widely recognized as the major constituent of wrapping silk, as a product of dragline silk. Our findings also reveal that MA glands, spinning dope, and dragline silk contain at least seven common proteins: three members of the Cysteine-Rich Protein Family (CRP1, CRP2 and CRP4), cysteine-rich secretory protein 3 (CRISP3), fasciclin and two uncharacterized proteins. In summary, this study provides a proteomic blueprint to construct synthetic silk fibers that most closely mimic natural fibers. PMID:27649139

  2. Comprehensive Proteomic Analysis of Spider Dragline Silk from Black Widows: A Recipe to Build Synthetic Silk Fibers

    Directory of Open Access Journals (Sweden)

    Camille Larracas


    Full Text Available The outstanding material properties of spider dragline silk fibers have been attributed to two spidroins, major ampullate spidroins 1 and 2 (MaSp1 and MaSp2. Although dragline silk fibers have been treated with different chemical solvents to elucidate the relationship between protein structure and fiber mechanics, there has not been a comprehensive proteomic analysis of the major ampullate (MA gland, its spinning dope, and dragline silk using a wide range of chaotropic agents, inorganic salts, and fluorinated alcohols to elucidate their complete molecular constituents. In these studies, we perform in-solution tryptic digestions of solubilized MA glands, spinning dope and dragline silk fibers using five different solvents, followed by nano liquid chromatography coupled to tandem mass spectrometry (LC-MS/MS analysis with an Orbitrap Fusion™ Tribrid™. To improve protein identification, we employed three different tryptic peptide fragmentation modes, which included collision-induced dissociation (CID, electron transfer dissociation (ETD, and high energy collision dissociation (HCD to discover proteins involved in the silk assembly pathway and silk fiber. In addition to MaSp1 and MaSp2, we confirmed the presence of a third spidroin, aciniform spidroin 1 (AcSp1, widely recognized as the major constituent of wrapping silk, as a product of dragline silk. Our findings also reveal that MA glands, spinning dope, and dragline silk contain at least seven common proteins: three members of the Cysteine-Rich Protein Family (CRP1, CRP2 and CRP4, cysteine-rich secretory protein 3 (CRISP3, fasciclin and two uncharacterized proteins. In summary, this study provides a proteomic blueprint to construct synthetic silk fibers that most closely mimic natural fibers.

  3. A novel hyaluronidase from brown spider (Loxosceles intermedia venom (Dietrich's Hyaluronidase: from cloning to functional characterization.

    Directory of Open Access Journals (Sweden)

    Valéria Pereira Ferrer

    Full Text Available Loxoscelism is the designation given to clinical symptoms evoked by Loxosceles spider's bites. Clinical manifestations include skin necrosis with gravitational spreading and systemic disturbs. The venom contains several enzymatic toxins. Herein, we describe the cloning, expression, refolding and biological evaluation of a novel brown spider protein characterized as a hyaluronidase. Employing a venom gland cDNA library, we cloned a hyaluronidase (1200 bp cDNA that encodes for a signal peptide and a mature protein. Amino acid alignment revealed a structural relationship with members of hyaluronidase family, such as scorpion and snake species. Recombinant hyaluronidase was expressed as N-terminal His-tag fusion protein (∼45 kDa in inclusion bodies and activity was achieved using refolding. Immunoblot analysis showed that antibodies that recognize the recombinant protein cross-reacted with hyaluronidase from whole venom as well as an anti-venom serum reacted with recombinant protein. Recombinant hyaluronidase was able to degrade purified hyaluronic acid (HA and chondroitin sulfate (CS, while dermatan sulfate (DS and heparan sulfate (HS were not affected. Zymograph experiments resulted in ∼45 kDa lytic zones in hyaluronic acid (HA and chondroitin sulfate (CS substrates. Through in vivo experiments of dermonecrosis using rabbit skin, the recombinant hyaluronidase was shown to increase the dermonecrotic effect produced by recombinant dermonecrotic toxin from L. intermedia venom (LiRecDT1. These data support the hypothesis that hyaluronidase is a "spreading factor". Recombinant hyaluronidase provides a useful tool for biotechnological ends. We propose the name Dietrich's Hyaluronidase for this enzyme, in honor of Professor Carl Peter von Dietrich, who dedicated his life to studying proteoglycans and glycosaminoglycans.

  4. Inflammatory events induced by brown spider venom and its recombinant dermonecrotic toxin: a pharmacological investigation. (United States)

    Paludo, Katia Sabrina; Biscaia, Stellee Marcela Petris; Chaim, Olga Meiri; Otuki, Michel Fleith; Naliwaiko, Katya; Dombrowski, Patrícia Andréia; Franco, Célia Regina Cavichiolo; Veiga, Silvio Sanches


    Accidents involving Brown spider (Loxosceles sp.) venom produce a massive inflammatory response in injured region. This venom has a complex mixture of different toxins, and the dermonecrotic toxin is the major contributor to toxic effects. The ability of Loxosceles intermedia venom and a recombinant isoform of dermonecrotic toxin to induce edema and increase in vascular permeability was investigated. These toxins were injected into hind paws and caused a marked dose and time-dependent edema and increase in vascular permeability in mice. Furthermore, the enzymatic activity of venom toxins may be primal for these effects. A mutated recombinant isoform of dermonecrotic toxin, that has only residual enzymatic activity, was not able to induce these inflammatory events. Besides the previous heating of toxins markedly reduced the paw edema and vascular permeability showing that thermolabile constituents can trigger these effects. In addition, the ability of these venom toxins to evoke inflammatory events was partially reduced in compound 48/80-pretreated animals, suggesting that mast cells may be involved in these responses. Pretreating mice with histamine (prometazine and cetirizine) and serotonin (methysergide) receptor antagonists significantly attenuated toxins induced edema and vascular permeability. Moreover, HPLC analysis of whole venom showed the presence of histamine sufficient to induce inflammatory responses. In conclusion, these inflammatory events may result from the activation of mast cells, which in turn release bioamines and may be related to intrinsic histamine content of venom.

  5. Brown spider venom toxins interact with cell surface and are endocytosed by rabbit endothelial cells. (United States)

    Nowatzki, Jenifer; de Sene, Reginaldo Vieira; Paludo, Katia Sabrina; Veiga, Silvio Sanches; Oliver, Constance; Jamur, Maria Célia; Nader, Helena Bonciani; Trindade, Edvaldo S; Franco, Célia Regina C


    Bites from the Loxosceles genus (brown spiders) cause severe clinical symptoms, including dermonecrotic injury, hemorrhage, hemolysis, platelet aggregation and renal failure. Histological findings of dermonecrotic lesions in animals exposed to Loxosceles intermedia venom show numerous vascular alterations. Study of the hemorrhagic consequences of the venom in endothelial cells has demonstrated that the degeneration of blood vessels results not only from degradation of the extracellular matrix molecule or massive leukocyte infiltration, but also from a direct and primary activity of the venom on endothelial cells. Exposure of an endothelial cell line in vitro to L. intermedia venom induce morphological alterations, such as cell retraction and disadhesion to the extracellular matrix. The aim of the present study was to investigate the interaction between the venom toxins and the endothelial cell surface and their possible internalization, in order to illuminate the information about the deleterious effect triggered by venom. After treating endothelial cells with venom toxins, we observed that the venom interacts with cell surface. Venom treatment also can cause a reduction of cell surface glycoconjugates. When cells were permeabilized, it was possible to verify that some venom toxins were internalized by the endothelial cells. The venom internalization involves endocytic vesicles and the venom was detected in the lysosomes. However, no damage to lysosomal integrity was observed, suggesting that the cytotoxic effect evoked by L. intermedia venom on endothelial cells is not mediated by venom internalization.

  6. Brown spider (Loxosceles intermedia) venom triggers endothelial cells death by anoikis. (United States)

    Nowatzki, Jenifer; Sene, Reginaldo Vieira; Paludo, Katia Sabrina; Rizzo, Luiz Eduardo; Souza-Fonseca-Guimarães, Fernando; Veiga, Silvio Sanches; Nader, Helena Bonciani; Franco, Célia Regina C; Trindade, Edvaldo S


    Brown spider (Loxosceles sp.) venom affects the endothelium of vessels and triggers disruptive activity in the subendothelial matrix. The vascular disorders observed after venom exposure include leukocyte and platelet activation, disseminated intravascular coagulation, an increase in vessel permeability and hemorrhage into the dermis. In this study, we report additional evidence regarding the mechanism of endothelial cell cytotoxicity induced by Loxosceles intermedia venom. Exposure to venom led to endothelial cell detachment in a time-dependent manner. Loss of cell anchorage and cell-cell adhesion following venom exposure was accompanied by changes in the distribution of the α₅β₁ integrin and VE-cadherin. An ultrastructural analysis of cells treated with venom revealed morphological alterations characteristic of apoptosis. Moreover, after venom exposure, the ratio between Bax and Bcl-2 proteins was disturbed in favor of Bax. In addition, late apoptosis was only observed in cells detached by the action of venom. Accordingly, there was no increase in apoptosis when cells were exposed to L. intermedia venom in suspension, suggesting that the loss of cell anchorage provides the signal to initiate apoptosis. Thus, L. intermedia venom likely triggers endothelial cell death indirectly through an apoptotic mechanism known as anoikis.

  7. 20 CFR 216.68 - Disability period for widow(er), surviving divorced spouse, or remarried widow(er). (United States)


    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Disability period for widow(er), surviving... BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT ELIGIBILITY FOR AN ANNUITY Widow(er), Surviving Divorced Spouse, and Remarried Widow(er) Annuities § 216.68 Disability period for widow(er),...

  8. Evaluation of the efficacy of vacuum cleaners for the integrated control of brown spider Loxosceles intermedia

    Directory of Open Access Journals (Sweden)

    E. N. Ramires


    Full Text Available Some venomous spiders of the genus Loxosceles can reach high population densities inside and around houses. In Brazil, most spider accidents are related to Loxosceles intermedia. Control of loxoscelism should utilize integrated pest management tools, such as vacuum cleaners, to eliminate egg sacs, webs and spiders. The present study tested the efficacy of one type of vacuum cleaner (for professional and domestic use in the control of L. intermedia populations. Cockroaches (Pycnoscelus surinamensis were used in some tests for comparison. Vacuuming using standard accessories or a paper tube resulted in the death of all female (n=60, male (n=60, young (n=60 and just-hatched (n=60 L. intermedia, and all egg sacs (n=5 were destroyed. The removal of the plastic plate present at the bottom of the vacuuming tube inside the machine allowed some spiders to survive the vacuuming process. When kept inside a vacuum bag full of dust and debris, adult females (n=10 survived for 10 days; however, significant mortality was observed among male (n=10 and young individuals (n=10. Addition of cornstarch to the vacuum bag did not affect the spiders (n=20. Vacuum cleaners, such as the one used in the present investigation, are promising tools for integrated management of L. intermedia and other spiders in domestic environments.

  9. Coagulopathy after spider bites in a six-year-old boy

    Directory of Open Access Journals (Sweden)

    Ansari SH.


    Full Text Available Background: Spider bites are common in most parts of the world. In some areas, where snake or scorpion bites are common, spider bites may not be considered a significant problem by the general public and those who have been bitten by spiders may not go to a hospital. However, significant problems are observed in the victims of certain species of spiders including: widow spider (of the genus Latrodectus, including the black widow and brown spiders (of the genus Loxosceles, such as the brown recluse. Case: We report a six-year-old boy, admitted to the hospital two weeks after suffering a spider bite. The patient presented with a severe nose bleed, ecchymosis and purpura, as well as anemia, indicating a clotting disorder. Laboratory results revealed abnormal values for prothrombin time (PT >50 sec, partial thromboplastin time (PTT >120 min and fibrinogen = 0 mg/dl, whereas factor VIII was normal according to a mixing study, with a normal platelet count of 350,000/µl. The patient was managed with fresh frozen plasma every 12 h, and was discharged one week after hospital admission. At present, the patient is well with more normal laboratory results one month after treatment: PT=13.4 sec, PTT= 34 sec, fibrinogen=105 mg/dl.         Conclusions: Although spider bites are uncommon in Iran, severe systemic reactions may occur in the pediatric population requiring admission to the pediatric intensive care unit. These systemic reactions may include hemolytic anemia coagulopathy and renal failure.

  10. Brown Recluse spider bite mediated hemolysis: clinical features, a possible role for complement inhibitor therapy, and reduced RBC surface glycophorin A as a potential biomarker of venom exposure.

    Directory of Open Access Journals (Sweden)

    Eric A Gehrie

    Full Text Available BACKGROUND: The venom of Loxosceles reclusa (Brown Recluse spider can cause a severe, life-threatening hemolysis in humans for which no therapy is currently available in the USA beyond supportive measures. Because this hemolysis is uncommon, relatively little is known about its clinical manifestation, diagnosis, or management. Here, we aimed to clarify the clinical details of envenomation, to determine the efficacy of the complement inhibitor eculizumab to prevent the hemolysis in vitro, and to investigate markers of exposure to Brown Recluse venom. STUDY DESIGN AND METHODS: We performed a 10-year chart review of cases of Brown Recluse spider bite-mediated hemolysis at our institution. We also designed an in vitro assay to test the efficacy of eculizumab to inhibit hemolysis of venom exposed red blood cells. Finally, we compared levels of CD55, CD59 and glycophorin A on venom exposed versus venom-naïve cells. RESULTS: Most victims of severe Brown Recluse spider mediated hemolysis at our institution are children and follow an unpredictable clinical course. Brown Recluse spider bite mediated hemolysis is reduced by 79.2% (SD=18.8% by eculizumab in vitro. Erythrocyte glycophorin A, but not CD55 or CD59, is reduced after red blood cells are incubated with venom in vitro. CONCLUSION: Taken together, our laboratory data and clinical observations indicate that L. reclusa venom exposure results in non-specific antibody and complement fixation on red blood cells, resulting in complement mediated hemolysis that is curtailed by the complement inhibitor eculizumab in vitro. Glycophorin A measurement by flow cytometry may help to identify victims of L. reclusa envenomation.

  11. 20 CFR 228.17 - Adjustments to the widow(er)'s, disabled widow(er)'s, surviving divorced spouse's, and remarried... (United States)


    ... widow(er)'s, surviving divorced spouse's, and remarried widow(er)'s tier I annuity amount. 228.17..., disabled widow(er)'s, surviving divorced spouse's, and remarried widow(er)'s tier I annuity amount. (a) If...), remarried widow(er), or surviving divorced spouse is first eligible after 1984, the Board will compute...


    Al-Agroudi, Mahfouz Ahmad; Ahmed, Salwa Abdalla Mohammad; Morsy, Tosson A


    Spider bites are uncommon medical events, since there are limited number of spiders world-wide with fangs strong enough to pierce human skin, and most spiders bite humans only as a final defense when being crushed between skin and another object. Thus, most lesions attributed to spider bites are caused by some other etiology. The spiders that can cause medically significant bites include widow and false widow spiders (worldwide), recluse spiders (mostly North and South America), Australian funnel web spiders (eastern coastal Australia) and Phoneutria spiders (Brazil). Acute spider bites most commonly result in a solitary papule, pustule, or wheal. Systemic symptoms can accompany envenomation of widow; funnel web, and Phoneutria spiders, and less often, those of recluse spiders.

  13. Toxicity of two North American Loxosceles (brown recluse spiders) venoms and their neutralization by antivenoms. (United States)

    de Roodt, Adolfo Rafael; Estevez-Ramírez, Judith; Litwin, Silvana; Magaña, Penélope; Olvera, Alejandro; Alagón, Alejandro


    The toxic, biochemical, and immunological characteristics of L. boneti and L. reclusa venoms and its neutralization by anti-L. boneti and anti-L. reclusa antivenoms were studied. The electrophoretic profile showed very similar patterns and the toxic activities were very close. Immunological studies showed cross-reactivity among L. boneti and L. reclusa venoms, with L. boneti and L. reclusa experimental antivenoms, and anti-L. gaucho and anti-L. laeta antivenoms. The venom of L. laeta showed low immunological reactivity with the North American Loxosceles antivenoms. Experimental anti-North American Loxosceles antivenoms protected mice of the systemic toxicity and were able to prevent necrosis in rabbit skin after the injection of the venom. Both antivenoms displayed cross neutralization. The results showed that both Loxosceles venoms have very close toxic, biochemical, and immunological characteristics, and that either monospecific antivenoms or an antivenom raised with L. boneti and L. reclusa venoms as immunogens could be useful for treating bites by North American Loxosceles spiders.

  14. Identification, cloning, expression and functional characterization of an astacin-like metalloprotease toxin from Loxosceles intermedia (brown spider) venom. (United States)

    da Silveira, Rafael B; Wille, Ana C M; Chaim, Olga M; Appel, Marcia H; Silva, Dilza T; Franco, Célia R C; Toma, Leny; Mangili, Oldemir C; Gremski, Waldemiro; Dietrich, Carl P; Nader, Helena B; Veiga, Silvio S


    Injuries caused by brown spiders (Loxosceles genus) are associated with dermonecrotic lesions with gravitational spreading and systemic manifestations. The venom has a complex composition containing many different toxins, of which metalloproteases have been described in many different species of this genus. These toxins may degrade extracellular matrix constituents acting as a spreading factor. By using a cDNA library from an Loxosceles intermedia venom gland, we cloned and expressed a 900 bp cDNA, which encoded a signal peptide and a propeptide, which corresponded to a 30 kDa metalloprotease, now named LALP (Loxosceles astacin-like protease). Recombinant LALP was refolded and used to produce a polyclonal antiserum, which showed cross-reactivity with a 29 kDa native venom protein. CD analysis provided evidence that the recombinant LALP toxin was folded correctly, was still in a native conformation and had not aggregated. LALP addition to endothelial cell cultures resulted in de-adhesion of the cells, and also in the degradation of fibronectin and fibrinogen (this could be inhibited by the presence of the bivalent chelator 1,10-phenanthroline) and of gelatin in vitro. Sequence comparison (nucleotide and deduced amino acid), phylogenetic analysis and analysis of the functional recombinant toxin revealed that LALP is related in both structure and function to the astacin family of metalloproteases. This suggests that an astacin-like toxin is present in a animal venom secretion and indicates that recombinant LALP will be a useful tool for future structural and functional studies on venom and the astacin family.

  15. Molecular cloning, heterologous expression and functional characterization of a novel translationally-controlled tumor protein (TCTP) family member from Loxosceles intermedia (brown spider) venom. (United States)

    Sade, Youssef B; Bóia-Ferreira, Marianna; Gremski, Luiza H; da Silveira, Rafael B; Gremski, Waldemiro; Senff-Ribeiro, Andrea; Chaim, Olga M; Veiga, Silvio S


    Envenoming with brown spiders (Loxosceles genus) is common throughout the world. Cutaneous symptoms following spider bite accidents include dermonecrosis, erythema, itching and pain. In some cases, accidents can cause hypersensibility or even allergic reactions. These responses could be associated with histaminergic events, such as an increase in vascular permeability and vasodilatation. A protein that may be related to the effects of spider venom was identified from a previously obtained cDNA library of the L. intermedia venom gland. The amino acid sequence of this protein is homologous to proteins from the TCTP (translationally-controlled tumor protein) family, which are extracellular histamine-releasing factors (HRF) that are associated with the allergic reactions to parasites. Herein, we described the cloning, heterologous expression, purification and functional characterization of a novel member of the TCTP family from the Loxosceles intermedia venom gland. This recombinant protein, named LiRecTCTP, causes edema, enhances vascular permeability and is likely related to the inflammatory activity of the venom. Moreover, LiRecTCTP presents an immunological relationship with mammalian TCTPs. PMID:22051631

  16. Molecular cloning, heterologous expression and functional characterization of a novel translationally-controlled tumor protein (TCTP) family member from Loxosceles intermedia (brown spider) venom. (United States)

    Sade, Youssef B; Bóia-Ferreira, Marianna; Gremski, Luiza H; da Silveira, Rafael B; Gremski, Waldemiro; Senff-Ribeiro, Andrea; Chaim, Olga M; Veiga, Silvio S


    Envenoming with brown spiders (Loxosceles genus) is common throughout the world. Cutaneous symptoms following spider bite accidents include dermonecrosis, erythema, itching and pain. In some cases, accidents can cause hypersensibility or even allergic reactions. These responses could be associated with histaminergic events, such as an increase in vascular permeability and vasodilatation. A protein that may be related to the effects of spider venom was identified from a previously obtained cDNA library of the L. intermedia venom gland. The amino acid sequence of this protein is homologous to proteins from the TCTP (translationally-controlled tumor protein) family, which are extracellular histamine-releasing factors (HRF) that are associated with the allergic reactions to parasites. Herein, we described the cloning, heterologous expression, purification and functional characterization of a novel member of the TCTP family from the Loxosceles intermedia venom gland. This recombinant protein, named LiRecTCTP, causes edema, enhances vascular permeability and is likely related to the inflammatory activity of the venom. Moreover, LiRecTCTP presents an immunological relationship with mammalian TCTPs.

  17. The relationship between calcium and the metabolism of plasma membrane phospholipids in hemolysis induced by brown spider venom phospholipase-D toxin. (United States)

    Chaves-Moreira, Daniele; Souza, Fernanda N; Fogaça, Rosalvo T H; Mangili, Oldemir C; Gremski, Waldemiro; Senff-Ribeiro, Andrea; Chaim, Olga M; Veiga, Silvio S


    Brown spider venom phospholipase-D belongs to a family of toxins characterized as potent bioactive agents. These toxins have been involved in numerous aspects of cell pathophysiology including inflammatory response, platelet aggregation, endothelial cell hyperactivation, renal disorders, and hemolysis. The molecular mechanism by which these toxins cause hemolysis is under investigation; literature data have suggested that enzyme catalysis is necessary for the biological activities triggered by the toxin. However, the way by which phospholipase-D activity is directly related with human hemolysis has not been determined. To evaluate how brown spider venom phospholipase-D activity causes hemolysis, we examined the impact of recombinant phospholipase-D on human red blood cells. Using six different purified recombinant phospholipase-D molecules obtained from a cDNA venom gland library, we demonstrated that there is a correlation of hemolytic effect and phospholipase-D activity. Studying recombinant phospholipase-D, a potent hemolytic and phospholipase-D recombinant toxin (LiRecDT1), we determined that the toxin degrades synthetic sphingomyelin (SM), lysophosphatidylcholine (LPC), and lyso-platelet-activating factor. Additionally, we determined that the toxin degrades phospholipids in a detergent extract of human erythrocytes, as well as phospholipids from ghosts of human red blood cells. The products of the degradation of synthetic SM and LPC following recombinant phospholipase-D treatments caused hemolysis of human erythrocytes. This hemolysis, dependent on products of metabolism of phospholipids, is also dependent on calcium ion concentration because the percentage of hemolysis increased with an increase in the dose of calcium in the medium. Recombinant phospholipase-D treatment of human erythrocytes stimulated an influx of calcium into the cells that was detected by a calcium-sensitive fluorescent probe (Fluo-4). This calcium influx was shown to be channel

  18. Physiotherapeutic attendance after repairing surgeries of lesions by brown spider: a case report - doi:10.5020/18061230.2007.p133

    Directory of Open Access Journals (Sweden)

    Ricardo Marques Frezza


    Full Text Available The loxoscelism is the most serious form of arachnidism in Brazil. The genus Loxosceles comprises more than 100 species of spiders in African and American continents. In Brazil, they are known as brown spiders. Nevertheless the great incidence of occurrence, few are the reports about repairing procedures, specially related to Physiotherapy after surgeries due to dermonecrosis. The aim of this case report was to register the Physiotherapeutic attendance of a female patient, 29 years old, victim of loxoscelism and who underwent debridement and skin transplantation for repairing right forearm lesions while she was interned at a hospital. Afterwards, data were confronted with the literature about loxoscelism, burns and Physiotherapy after skin transplantation. It is concluded that the patients with lesions caused by loxoscelism, who need repairing surgeries, may benefit a lot from Physiotherapeutic attendance while still at hospital. Although, factors such as: the lesion’s location, the cicatrization period, the number and complexity of surgeries, may be decisive for this indication.

  19. Astacin-like metalloproteases are a gene family of toxins present in the venom of different species of the brown spider (genus Loxosceles). (United States)

    Trevisan-Silva, Dilza; Gremski, Luiza H; Chaim, Olga M; da Silveira, Rafael B; Meissner, Gabriel O; Mangili, Oldemir C; Barbaro, Katia C; Gremski, Waldemiro; Veiga, Silvio S; Senff-Ribeiro, Andrea


    Brown spiders have a worldwide distribution, and their venom has a complex composition containing many different molecules. Herein, we report the existence of a family of astacin-like metalloprotease toxins in Loxosceles intermedia venom, as well as in the venom of different species of Loxosceles. Using a cDNA library from the L. intermedia venom gland, we cloned two novel cDNAs encoding astacin-like metalloprotease toxins, LALP2 and LALP3. Using an anti-serum against the previously described astacin-like toxin in L. intermedia venom (LALP1), we detected the presence of immunologically-related toxins in the venoms of L. intermedia, Loxosceles laeta, and Loxosceles gaucho. Zymographic experiments showed gelatinolytic activity of crude venoms of L. intermedia, L. laeta, and L. gaucho (which could be inhibited by the divalent metal chelator 1,10-phenanthroline) at electrophoretic mobilities identical to those reported for immunological cross-reactivity. Moreover, mRNAs extracted from L. laeta and L. gaucho venom glands were screened for astacin-like metalloproteases, and cDNAs obtained using LALP1-specific primers were sequenced, and their deduced amino acid sequences confirmed they were members of the astacin family with the family signatures (HEXXHXXGXXHE and MXY), LALP4 and LALP5, respectively. Sequence comparison of deduced amino acid sequences revealed that LALP2, LALP3, LALP4, and LALP5 are related to the astacin family. This study identified the existence of gene family of astacin-like toxins in the venoms of brown spiders and raises the possibility that these molecules are involved in the deleterious effects triggered by the venom.

  20. 20 CFR 222.24 - Relationship as remarried widow(er). (United States)


    ... FAMILY RELATIONSHIPS Relationship as Divorced Spouse, Surviving Divorced Spouse, or Remarried Widow(er) § 222.24 Relationship as remarried widow(er). (a) New eligibility. A claimant will have the relationship... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Relationship as remarried widow(er)....

  1. Spider Bites (For Parents) (United States)

    ... brown recluse spider bite: red blister in the center with surrounding bluish discoloration around the bite swelling or redness around the bite development of pain around the bite within 2 to 8 hours joint stiffness or pain nausea, vomiting body rash fever and ...

  2. Species status and conservation issues of New Zealand's endemic Latrodectus spider species (Araneae: Theridiidae)

    DEFF Research Database (Denmark)

    Vink, Cor J; Sirvid, Phillip J; Malumbres-Olarte, Jagoba;


    New Zealand has two endemic widow spiders, Latrodectus katipo Powell, 1871 and L. atritus Urquhart, 1890. Both species face many conservation threats and are actively managed. The species status of the Latrodectus spiders of New Zealand was assessed using molecular (COI, ITS1, ITS2...

  3. Tarantula spider (United States)

    ... this page: // Tarantula spider bite To use the sharing features on ... JavaScript. This article describes the effects of a tarantula spider bite. This article is for information only. ...

  4. Modulation of membrane phospholipids, the cytosolic calcium influx and cell proliferation following treatment of B16-F10 cells with recombinant phospholipase-D from Loxosceles intermedia (brown spider) venom. (United States)

    Wille, Ana Carolina Martins; Chaves-Moreira, Daniele; Trevisan-Silva, Dilza; Magnoni, Mariana Gabriel; Boia-Ferreira, Marianna; Gremski, Luiza Helena; Gremski, Waldemiro; Chaim, Olga Meiri; Senff-Ribeiro, Andrea; Veiga, Silvio Sanches


    The mechanism through which brown spiders (Loxosceles genus) cause dermonecrosis, dysregulated inflammatory responses, hemolysis and platelet aggregation, which are effects reported following spider bites, is currently attributed to the presence of phospholipase-D in the venom. In the present investigation, through two-dimensional immunoblotting, we observed immunological cross-reactivity for at least 25 spots in crude Loxosceles intermedia venom, indicating high expression levels for different isoforms of phospholipase-D. Using a recombinant phospholipase-D from the venom gland of L. intermedia (LiRecDT1) in phospholipid-degrading kinetic experiments, we determined that this phospholipase-D mainly hydrolyzes synthetic sphingomyelin in a time-dependent manner, generating ceramide 1-phosphate plus choline, as well as lysophosphatidylcholine, generating lysophosphatidic acid plus choline, but exhibits little activity against phosphatidylcholine. Through immunofluorescence assays with antibodies against LiRecDT1 and using a recombinant GFP-LiRecDT1 fusion protein, we observed direct binding of LiRecDT1 to the membrane of B16-F10 cells. We determined that LiRecDT1 hydrolyzes phospholipids in detergent extracts and from ghosts of B16-F10 cells, generating choline, indicating that the enzyme can access and modulate and has activity against membrane phospholipids. Additionally, using Fluo-4, a calcium-sensitive fluorophore, it was shown that treatment of cells with phospholipase-D induced an increase in the calcium concentration in the cytoplasm, but without altering viability or causing damage to cells. Finally, based on the known endogenous activity of phospholipase-D as an inducer of cell proliferation and the fact that LiRecDT1 binds to the cell surface, hydrolyzing phospholipids to generate bioactive lipids, we employed LiRecDT1 as an exogenous source of phospholipase-D in B16-F10 cells. Treatment of the cells was effective in increasing their proliferation in a

  5. 20 CFR 404.336 - How do I become entitled to widow's or widower's benefits as a surviving divorced spouse? (United States)


    ... widower's benefits as a surviving divorced spouse? 404.336 Section 404.336 Employees' Benefits SOCIAL... § 404.336 How do I become entitled to widow's or widower's benefits as a surviving divorced spouse? We will find you entitled to widow's or widower's benefits as the surviving divorced wife or the...

  6. 20 CFR 404.1578 - How we determine disability for widows, widowers, and surviving divorced spouses for monthly... (United States)


    ..., widowers, and surviving divorced spouses for monthly benefits payable for months prior to January 1991. 404... DISABILITY INSURANCE (1950- ) Determining Disability and Blindness Widows, Widowers, and Surviving Divorced Spouses § 404.1578 How we determine disability for widows, widowers, and surviving divorced spouses...

  7. Spider Invasion Across the Galaxy (United States)

    Hui, Chung-Yue


    The nature of the exotic stellar corpses which reincarnate by consuming their companion is reviewed. Apart from sucking life from their partners, they are actually eating the doomed companions away by their deadly and powerful particle/radiation beams. Such situation resembles that a female ¡°black widow¡± spider that eats its mate after mating. These celestial zombies are called - Millisecond pulsars (MSPs). In this review article, I will focus on the effort of Fermi Asian Network (FAN) in exploring these intricating objects over the last five years. Two special classes of MSPs are particularly striking. Since Fermi Gamma-ray Space Telescope has started surveying the gamma?ray sky, the population of ¡°black widows¡± has been boosted. Another dramatic class is so-called ¡°redbacks¡± (Australian cousin of ¡°black widows¡±) which has just emerged in the last few years. These MSPs provide us with a long-sought missing link in understanding the transition between accretion-powered and rotation-powered systems. The strategy of hunting MSPs through mulitwavelength observations of the unidentified Fermi objects is also reviewed.

  8. Dramatic expansion of the black widow toxin arsenal uncovered by multi-tissue transcriptomics and venom proteomics


    Haney, Robert A.; Ayoub, Nadia A; Clarke, Thomas H; Cheryl Y Hayashi; Garb, Jessica E.


    Background Animal venoms attract enormous interest given their potential for pharmacological discovery and understanding the evolution of natural chemistries. Next-generation transcriptomics and proteomics provide unparalleled, but underexploited, capabilities for venom characterization. We combined multi-tissue RNA-Seq with mass spectrometry and bioinformatic analyses to determine venom gland specific transcripts and venom proteins from the Western black widow spider (Latrodectus hesperus) a...

  9. Molecular cloning and in silico characterization of knottin peptide, U2-SCRTX-Lit2, from brown spider (Loxosceles intermedia) venom glands. (United States)

    Meissner, Gabriel Otto; de Resende Lara, Pedro Túlio; Scott, Luis Paulo Barbour; Braz, Antônio Sérgio Kimus; Chaves-Moreira, Daniele; Matsubara, Fernando Hitomi; Soares, Eduardo Mendonça; Trevisan-Silva, Dilza; Gremski, Luiza Helena; Veiga, Silvio Sanches; Chaim, Olga Meiri


    Inhibitor cystine knots (ICKs) are a family of structural peptides with a large number of cysteine residues that form intramolecular disulfide bonds, resulting in a knot. These peptides are involved in a variety of biological functions including predation and defense, and are found in various species, such as spiders, scorpions, sea anemones, and plants. The Loxosceles intermedia venom gland transcriptome identified five groups of ICK peptides that represent more than 50 % of toxin-coding transcripts. Here, we describe the molecular cloning of U2-Sicaritoxin-Lit2 (U2-SCRTX-Lit2), bioinformatic characterization, structure prediction, and molecular dynamic analysis. The sequence of U2-SCRTX-Lit2 obtained from the transcriptome is similar to that of μ-Hexatoxin-Mg2, a peptide that inhibits the insect Nav channel. Bioinformatic analysis of sequences classified as ICK family members also showed a conservation of cysteine residues among ICKs from different spiders, with the three dimensional molecular model of U2-SCRTX-Lit2 similar in structure to the hexatoxin from μ-hexatoxin-Mg2a. Molecular docking experiments showed the interaction of U2-SCRTX-Lit2 to its predictable target-the Spodoptera litura voltage-gated sodium channel (SlNaVSC). After 200 ns of molecular dynamic simulation, the final structure of the complex showed stability in agreement with the experimental data. The above analysis corroborates the existence of a peptide toxin with insecticidal activity from a novel ICK family in L. intermedia venom and demonstrates that this peptide targets Nav channels. PMID:27488102

  10. Insecticidal spider venom toxin fused to snowdrop lectin is toxic to the peach-potato aphid, Myzus persicae (Hemiptera: Aphididae) and the rice brown planthopper, Nilaparvata lugens (Hemiptera: Delphacidae). (United States)

    Down, Rachel E; Fitches, Elaine C; Wiles, Duncan P; Corti, Paola; Bell, Howard A; Gatehouse, John A; Edwards, John P


    The SFI1/GNA fusion protein, comprising of snowdrop lectin (Galanthus nivalis agglutinin, GNA) fused to an insecticidal spider venom neurotoxin (Segestria florentina toxin 1, SFI1) was tested for toxicity against the rice brown planthopper Nilaparvata lugens (Stål) and the peach-potato aphid Myzus persicae (Sulzer) by incorporation into artificial diets. Significant effects on the mortality of N. lugens were observed, with 100% of the insects fed on the SFI1/GNA fusion protein diet dead by day 7. The survival of the aphid M. persicae was also reduced when fed on the SFI1/GNA fusion protein. After 14 days, only 49% of the aphids that were fed on the fusion protein were still alive compared with approximately 90% of the aphids fed on the control diet or on diet containing GNA only. The SFI1/GNA fusion protein also slowed the development of M. persicae, and the reproductive capacity of the aphids fed on the SFI1/GNA fusion protein was severely reduced. The ability of GNA to act as a carrier protein, and deliver the SFI1 neurotoxin to the haemolymph of N. lugens, following oral ingestion, was investigated. The successful delivery of intact SFI1/GNA fusion protein to the haemolymph of these insects was shown by western blotting. Haemolymph taken from the insects that were fed on the fusion protein contained two GNA-immunoreactive proteins of molecular weights corresponding to GNA and to the SFI1/GNA fusion protein.

  11. Insecticidal spider venom toxin fused to snowdrop lectin is toxic to the peach-potato aphid, Myzus persicae (Hemiptera: Aphididae) and the rice brown planthopper, Nilaparvata lugens (Hemiptera: Delphacidae). (United States)

    Down, Rachel E; Fitches, Elaine C; Wiles, Duncan P; Corti, Paola; Bell, Howard A; Gatehouse, John A; Edwards, John P


    The SFI1/GNA fusion protein, comprising of snowdrop lectin (Galanthus nivalis agglutinin, GNA) fused to an insecticidal spider venom neurotoxin (Segestria florentina toxin 1, SFI1) was tested for toxicity against the rice brown planthopper Nilaparvata lugens (Stål) and the peach-potato aphid Myzus persicae (Sulzer) by incorporation into artificial diets. Significant effects on the mortality of N. lugens were observed, with 100% of the insects fed on the SFI1/GNA fusion protein diet dead by day 7. The survival of the aphid M. persicae was also reduced when fed on the SFI1/GNA fusion protein. After 14 days, only 49% of the aphids that were fed on the fusion protein were still alive compared with approximately 90% of the aphids fed on the control diet or on diet containing GNA only. The SFI1/GNA fusion protein also slowed the development of M. persicae, and the reproductive capacity of the aphids fed on the SFI1/GNA fusion protein was severely reduced. The ability of GNA to act as a carrier protein, and deliver the SFI1 neurotoxin to the haemolymph of N. lugens, following oral ingestion, was investigated. The successful delivery of intact SFI1/GNA fusion protein to the haemolymph of these insects was shown by western blotting. Haemolymph taken from the insects that were fed on the fusion protein contained two GNA-immunoreactive proteins of molecular weights corresponding to GNA and to the SFI1/GNA fusion protein. PMID:16206236

  12. 20 CFR 222.10 - When determinations of relationship as wife, husband, widow or widower of employee are made. (United States)


    ... RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT FAMILY RELATIONSHIPS Relationship as Wife, Husband, or Widow(er) § 222.10 When determinations of relationship as wife, husband, widow or widower of... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false When determinations of relationship as...

  13. 20 CFR 404.1577 - Disability defined for widows, widowers, and surviving divorced spouses for monthly benefits... (United States)


    ... surviving divorced spouses for monthly benefits payable for months prior to January 1991. 404.1577 Section... INSURANCE (1950- ) Determining Disability and Blindness Widows, Widowers, and Surviving Divorced Spouses § 404.1577 Disability defined for widows, widowers, and surviving divorced spouses for monthly...

  14. 20 CFR 220.39 - Disability determination for a surviving divorced spouse or remarried widow(er). (United States)


    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Disability determination for a surviving... Regulations of the Social Security Administration § 220.39 Disability determination for a surviving divorced spouse or remarried widow(er). A surviving divorced spouse or a remarried widow(er) must be...


    Directory of Open Access Journals (Sweden)

    PORAV Viorica


    Full Text Available The strengthness and toughness of spider fiber and its multifunctional nature is only surpassed in some cases by synthetic high performance fibers. In the world of natural fibers, spider silk has been long time recognized as a wonder fiber for its unique combination of high strength and rupture elongation. Scientists in civil military engineering reveal that the power of biological material (spider silk lies in the geometric configuration of structural protein, and the small cluster of week hydrogen bonds that works together to resist force and dissipate energy. Each spider and each type of silk has a set of mechanical properties optimized for their biological function. Most silks, in particular deagline silk, have exceptional mechanical properties. They exhibit a unique combination of high tensile strength and extensibility (ductility. This enables a silk fiber to absorb a lot of energy before breaking (toughness, the area under a stress- strain curve. A frequent mistake made in the mainstream media is to confuse strength and toughness when comparing silk to other materials. As shown below in detail, weight for weight, silk is stronger than steel, but not as strong as Kevlar. Silk is,however, tougher than both.This paper inform about overview on the today trend in the world of spider silk.

  16. Expression and immunological cross-reactivity of LALP3, a novel astacin-like metalloprotease from brown spider (Loxosceles intermedia) venom. (United States)

    Morgon, Adriano M; Belisario-Ferrari, Matheus R; Trevisan-Silva, Dilza; Meissner, Gabriel O; Vuitika, Larissa; Marin, Brenda; Tashima, Alexandre K; Gremski, Luiza H; Gremski, Waldemiro; Senff-Ribeiro, Andrea; Veiga, Silvio S; Chaim, Olga M


    Loxosceles spiders' venom comprises a complex mixture of biologically active toxins, mostly consisting of low molecular mass components (2-40 kDa). Amongst, isoforms of astacin-like metalloproteases were identified through transcriptome and proteome analyses. Only LALP1 (Loxosceles Astacin-Like protease 1) has been characterized. Herein, we characterized LALP3 as a novel recombinant astacin-like metalloprotease isoform from Loxosceles intermedia venom. LALP3 cDNA was cloned in pET-SUMO vector, and its soluble heterologous expression was performed using a SUMO tag added to LALP3 to achieve solubility in Escherichia coli SHuffle T7 Express LysY cells, which express the disulfide bond isomerase DsbC. Protein purification was conducted by Ni-NTA Agarose resin and assayed for purity by SDS-PAGE under reducing conditions. Immunoblotting analyses were performed with specific antibodies recognizing LALP1 and whole venom. Western blotting showed linear epitopes from recombinant LALP3 that cross-reacted with LALP1, and dot blotting revealed conformational epitopes with native venom astacins. Mass spectrometry analysis revealed that the recombinant expressed protein is an astacin-like metalloprotease from L. intermedia venom. Furthermore, molecular modeling of LALP3 revealed that this isoform contains the zinc binding and Met-turn motifs, forming the active site, as has been observed in astacins. These data confirmed that LALP3, which was successfully obtained by heterologous expression using a prokaryote system, is a new astacin-like metalloprotease isoform present in L. intermedia venom. PMID:27343628

  17. A novel ICK peptide from the Loxosceles intermedia (brown spider) venom gland: cloning, heterologous expression and immunological cross-reactivity approaches. (United States)

    Matsubara, Fernando Hitomi; Gremski, Luiza Helena; Meissner, Gabriel Otto; Constantino Lopes, Eduardo Soares; Gremski, Waldemiro; Senff-Ribeiro, Andrea; Chaim, Olga Meiri; Veiga, Silvio Sanches


    The venom of a Loxosceles spider is composed of a complex mixture of biologically active components, consisting predominantly of low molecular mass molecules (3-45 kDa). Transcriptome analysis of the Loxosceles intermedia venom gland revealed ESTs with similarity to the previously described LiTx peptides. Sequences similar to the LiTx3 isoform were the most abundant, representing approximately 13.9% of all ESTs and 32% of the toxin-encoding messengers. These peptides are grouped in the ICK (Inhibitor Cystine Knot) family, which contains single chain molecules with low molecular mass (3-10 kDa). Due to their high number of cysteine residues, ICK peptides form intramolecular disulfide bridges. The aims of this study were to clone and express a novel ICK peptide isoform, as well as produce specific hyperimmune serum for immunoassays. The corresponding cDNA was amplified by PCR using specific primers containing restriction sites for the XhoI and BamHI enzymes; this PCR product was then ligated in the pET-14b vector and transformed into E. coli AD494 (DE3) cells. The peptide was expressed by IPTG induction for 4 h at 30 °C and purified by affinity chromatography with Ni-NTA resin. Hyperimmune serum to the recombinant peptide was produced in rabbits and was able to specifically recognize both the purified recombinant peptide and the native form present in the venom. Furthermore, the recombinant peptide was recognized by antisera raised against L. intermedia, L. gaucho and L. laeta whole venoms. The recombinant peptide obtained will enable future studies to characterize its biological activity, as well as investigations regarding possible biotechnological applications.

  18. 20 CFR 404.346 - Your relationship as wife, husband, widow, or widower based upon a deemed valid marriage. (United States)


    ... widower based upon a deemed valid marriage. 404.346 Section 404.346 Employees' Benefits SOCIAL SECURITY... relationship as wife, husband, widow, or widower based upon a deemed valid marriage. (a) General. If your... explained in § 404.345, you may be eligible for benefits based upon a deemed valid marriage. You will...

  19. Widow remarriage in Haryana. Law strengthens repressiveness of popular culture. (United States)

    Chowdhry, P


    Widow remarriage practices in the Punjab-Haryana region of northern India are described as frequently mismatched and undesirable alliances, without widow choice, which serve to support the practice of polygamy. The average spacing between arranged spouses could be 10 years, with the younger spouse being the brother-in-law (this customary practice of remarriage within the husbands' family is called "karewa"). Karewa could involve a minor aged 3 years or 13-14 years of age. Usually the village and family elders will support the practice of remarriage to a minor. The widow may be forced to stay with parents-in-law until the minor comes of age. Sometimes widows run away with older men or form a polygamous union. Remarriage in a polygamous union is socially acceptable because the first wife may have been barren or produced only daughters; the practice is desirable because it assures one more worker in the family. Karewa is desirable as a means to control a widow's sexuality and to control landed property and government pensions. Laws such as the Hindu Succession Act of 1956 act as an incentive to karewa by granting absolute right of inheritance to widows. The financial benefits to a family can be considerable. Pensions can be withdrawn if the widow remarries outside her deceased husband's family. The motivation for karewa can be fear and apprehension as well as greed. Marriage may be arranged within two weeks of a husband's funeral, instead of the customary year, out of fear that the widow may settle elsewhere. The War Widows Guild has recorded the exploitation and suffering of widows under this system. Widows who object to karewa have few options. In 1981, under 1% of rural widows in Haryana were of marriageable age (16-44 years) and unmarried. A widow with children has, with almost 100% certainty, a karewa marriage. The threat of economic hardship reinforces the practice as does the force of custom, patriarchy, and the state of India.

  20. Bird-eating Spiders

    Institute of Scientific and Technical Information of China (English)



    Many people are frightened by spiders (蜘蛛). They are especially afraid of large, hairyones. The largest and most frightening of all is thebird-eating spider, which lives in the hot, thickrain forests of northern South America.

  1. The population of black widow pulsars

    CERN Document Server

    King, A R; Rolfe, D J; Schenker, K; Skipp, J M


    We consider the population of black widow pulsars (BWPs). The large majority of these are members of globular clusters. For minimum companion masses 0.1 Msun are systems relaxing to equilibrium after a relatively recent capture event. We point out that all binary millisecond pulsars (MSPs) with orbital periods P < 10 h are BWPs (our line of sight allows us to see the eclipses in 10 out of 16 cases). This implies that recycled MSPs emit either in a wide fan beam or a pencil beam close to the spin plane. Simple evolutionary ideas favour a fan beam.

  2. The Spiders of China

    Institute of Scientific and Technical Information of China (English)


    @@ Sevaral books about Chinese spider systematics and biology have been published,mostly since the later 1970s and the majority of then are designed as classification guides to the spider fauna of a particular area of China,or focused on a particular group ,for example Fauna of Zhejiang Province ,Araneida and Salticids of China. The newly published book "The Spiders of China",in English,differs from all others by including all 2361 described Chinese spider species and by reviewing literature of over 200 years of work on Chinese spider classification.

  3. Financial Planners: Educating Widows in Personal Financial Planning (United States)

    Korb, Brian R.


    Widows constitute a growing segment of the U.S. population; however, very little has been done to educate them on the basics of personal financial planning. The creation and implementation of financial planning education programs for widows can help them become more financially literate and free them from anxiety and fear. Interviews with eight…

  4. Recent Widows' Kin Support and Orientations to Self-Sufficiency. (United States)

    O'Bryant, Shirley L.; Morgan, Leslie A.


    Data on recently widowed women suggest that many are quite self-sufficient; however, in areas where support is needed, they largely rely on children. Widows' past experiences and attitudes toward independence influenced amount of overall help they received, whereas income, number of children, and perceived willingness of children to help affected…

  5. Young widows, tragic voices. Voices of girls 2: Africa. (United States)

    Owen, M


    The tragic consequences for young girls of becoming widows or being the daughters of widows have not yet been addressed. In Africa, girls are sometimes given in marriage to old men. When the girls are widowed while still young, their chances for remarriage are slim. The marriages of girl children continue unabated in Africa and may be on the increase because of the AIDS epidemic. Modern legislation that complies with marriage age obligations created by the Convention for the Elimination of Discrimination Against Women simply creates statutory limits to marriage without parental consent and fails to regulate child marriages arranged by parents. Being the daughter of a widow is almost as bad as being a widow, because widows routinely withdraw their daughters from school to protect them from unwanted sexual approaches or marrying them off at a young age. Widows and their daughters are often considered chattel by male relatives who feel no compulsion to seek their consent before arranging marriages for them. Child widowhood is not addressed in the Platform for Action of the Fourth World Conference on Women, but during the 1998 UN Commission on the Status of Women, the European Union countries agreed to pay special attention to widows. It is time for international agencies to begin to collect data on this issue. PMID:12321766

  6. Young widows, tragic voices. Voices of girls 2: Africa. (United States)

    Owen, M


    The tragic consequences for young girls of becoming widows or being the daughters of widows have not yet been addressed. In Africa, girls are sometimes given in marriage to old men. When the girls are widowed while still young, their chances for remarriage are slim. The marriages of girl children continue unabated in Africa and may be on the increase because of the AIDS epidemic. Modern legislation that complies with marriage age obligations created by the Convention for the Elimination of Discrimination Against Women simply creates statutory limits to marriage without parental consent and fails to regulate child marriages arranged by parents. Being the daughter of a widow is almost as bad as being a widow, because widows routinely withdraw their daughters from school to protect them from unwanted sexual approaches or marrying them off at a young age. Widows and their daughters are often considered chattel by male relatives who feel no compulsion to seek their consent before arranging marriages for them. Child widowhood is not addressed in the Platform for Action of the Fourth World Conference on Women, but during the 1998 UN Commission on the Status of Women, the European Union countries agreed to pay special attention to widows. It is time for international agencies to begin to collect data on this issue.

  7. Poverty among widows of Kinshasa, Congo. (United States)

    D'Souza, S


    The linkages between poverty and death in the family in a sector of the city of Kinshasa, capital of the Democratic Republic of Congo (previously Zaire) were studied. The poor people have been identified using 3 convergent norms, described in the Methods of Materials section, based on total expenditure, calorie consumption in food, and proportion of expenditure for food. Family histories were recorded to understand the difficult situation of widow-headed households identified within the sample area. The relationship between death in the family and poverty was bi-directional: on the one hand, death of the breadwinner can accelerate the level of poverty; and on the other, poverty conditions can result in further deaths in the family. PMID:11057062

  8. Older widows' experience of living alone at home. (United States)

    Porter, E J


    Older widows' experience of living alone is described in this research. Based on Husserl's (1913/1962) philosophy, a phenomenological method was used. Prior to data-gathering, knowledge pertaining to older widows' experience was bracketed. During semi-structured, tape-recorded conversations, seven older widows described how they lived at home alone. From data pertaining to their actions, intentions and perceptions, four phenomena of the lived experience were developed: (a) making aloneness acceptable; (b) going my own way; (c) reducing my risks; and (d) sustaining myself. PMID:8200675

  9. Widow remarriages in some rural areas of Northern India. (United States)

    Agarwala, S N


    It is commonly believed thai widows belonging to high-caste Hindus in India do not remarry because of various social restrictions imposed on their remarriage. Though some information on widowhood and widow remarriages is available, there is need for more detailed information. A study, carried out by the author, of 1 percent of the rural households in Mathura and Saharanpur districts in Uttar Pradesh and in Rohtak district in Panjab has brought out that nearly SO percent of the ever-widowed are remarried. The survey covered 6,211 households, of which 887 were Muslim and the remaining were Hindu.Of the ever-widowed females, 84 percent in Saharanpur, 25 percent in Rohtak, and 19 percent in Mathura were found to have remarried. With a view to finding out whether differences in widow remarriage percentages by districts were real or were due to variations in the distribution of the ever-widowed females by age, occupation, caste, and the number of living children, the standardized widow remarriage rates were obtained. The population of Saharanpur district was taken to be the standard population. As a result of standardization for age, number of living children, and caste, the difference narrowed down considerably; and, while the widow remarriage percentage was 34.2 in Saharanpur. it was found to be 334 in Rohtak and 31.1 in Mathura. A 3 percent lower figure for Mathura district could be a result of the Brahminic influence.Widow remarriages were found to be very common among younger widows, since nearly 90 percent of those below age 16 and 80 percent of those in the age group 15-19 were remarried. Also, roughly 80 percent of those who did not have a child at the time of their widowhood were remarried. But the per-centage of remarried widows declined with an increase in age and in the number of living children. The percentage of widow remarriages was highest among the Muslims-between 35 and 37-because they put no restrictions on such remarriages. Among the Hindus, the lower

  10. Spider-man

    Institute of Scientific and Technical Information of China (English)



    Spider-Man was first introduced in the comic(连环画) Amazing Fantasy #15(August 1962).Peter Parker,a Senior at Midtown High School,receives his powers when bitten by a exhibition(转基因) spider in a science demonstration(展览).This bite endowed(赋予) him with the proportional(相应的) strength and agility(敏捷) of a spider along with a keen “spider sense”.

  11. Factors related to alcohol and drug consumption in Swedish widows. (United States)

    Grimby, Agneta; Johansson, Asa K


    The use of alcohol and medications among Swedish widows was analyzed in relation to various background variables. In Total, 1053 widows (640 widows younger than 65 years and 413 widows older than 65 years) answered the questionnaire. Many reported increased fatigue and sleeping problems. Around one-third of the widows reported drinking alcohol for relief of grief and inadequate support. Association existed between grief and increased intake of sedatives and sleeping pills, and between grief and drinking for relief of grief, as well as increase in intake of sedatives. In widows older than 65 years, perception of bad health, negative outlook for the future, and insufficient support seemed to increase the risk of more sedatives and sleeping pills. Negative outlook for the future also tended to lead to a heightened risk for increased intake of alcohol. There seems to be remaining health problems a long time after bereavement, and counseling may be needed especially when drugs and alcohol are extensively used. PMID:18550778

  12. Disgust and spider phobia

    NARCIS (Netherlands)

    Mulkens, SAN; de Jong, Peter; Merckelbach, H


    Twenty-four women with spider phobia and 45 nonphobic women completed the Disgust Questionnaire(DQ; P. Rozin, A. E. Fallen, & R. Mandell, 1984) and the Spider Phobia Questionnaire (SPQ; R. Klorman, T. C. Weerts, J. E. Hastings, B. G. Melamed, gr P. J. Lang, 1974). Participants also underwent behavio

  13. Respiration in spiders (Araneae). (United States)

    Schmitz, Anke


    Spiders (Araneae) are unique regarding their respiratory system: they are the only animal group that breathe simultaneously with lungs and tracheae. Looking at the physiology of respiration the existence of tracheae plays an important role in spiders with a well-developed tracheal system. Other factors as sex, life time, type of prey capture and the high ability to gain energy anaerobically influence the resting and the active metabolic rate intensely. Most spiders have metabolic rates that are much lower than expected from body mass; but especially those with two pairs of lungs. Males normally have higher resting rates than females; spiders that are less evolved and possess a cribellum have lower metabolic rates than higher evolved species. Freely hunting spiders show a higher energy turnover than spiders hunting with a web. Spiders that live longer than 1 year will have lower metabolic rates than those species that die after 1 year in which development and reproduction must be completed. Lower temperatures and starvation, which most spiders can cope with, will decrease the metabolic rate as well. PMID:26820263

  14. Spiders and Silk

    Institute of Scientific and Technical Information of China (English)



    Spiders are very small, so it is easy to think that they do not make anything strong. However, a scientist at Oxford University in Britain has discovered this is not true. David Knight says that eight-legged spiders create a material called silk that could be as strong as rope.

  15. Becoming a Spider Scientist (United States)

    Patrick, Patricia; Getz, Angela


    In this integrated unit, third grade students become spider scientists as they observe spiders in their classroom to debunk some common misconceptions about these intimidating creatures. "Charlotte's Web" is used to capture students' interest. In addition to addressing philosophical topics such as growing-up, death, and friendship; E.B. White's…

  16. Sexuality of widows: a study of the sexual practices of widows during the first fourteen months of bereavement. (United States)

    Kansky, J


    The sexual adjustment of 31 Caucasian women, ages 30-62, widowed less than 14 months was assessed using a structural interview. The relationship between the frequencies of autostimulation, coitus, sexual desire and other selected variables was analyzed. Results showed that the sexual identity and experience of each individual widow; circumstances surrounding the death of the husband, particularly whether the death was sudden or delayed; the widow's age; overall sexual satisfaction and intimacy within the marriage, as opposed to ambivalence toward the relationship; and the degree and kind of attachment to the deceased spouse; seem to be significantly associated with the sexual desires and activities of widows during the first 14 months of bereavement.

  17. Composition and Function of Spider Glues Maintained During the Evolution of Cobwebs. (United States)

    Jain, Dharamdeep; Zhang, Ci; Cool, Lydia Rose; Blackledge, Todd A; Wesdemiotis, Chrys; Miyoshi, Toshikazu; Dhinojwala, Ali


    Capture silks are an interesting class of biological glues that help spiders subdue their prey. Viscid capture silk produced by the orb web spiders is a combination of hygroscopic salts that aid in water uptake and interact with adhesive glycoproteins to make them soft and sticky. The orb was a stepping stone to the evolution of new web types, but little is known about the adhesives in these webs. For instance, cobweb spiders evolved from orb-weaving ancestors and utilize glue in specialized sticky gumfoot threads rather than an elastic spiral. Early investigation suggests that gumfoot adhesives are quite different viscid glues because they lack a visible glycoprotein core, act as viscoelastic fluids rather than solids, and are largely invariant to humidity. Here, we use spectroscopic and staining methods to show that the gumfoot silk produced by Latrodectus hesperus (western black widow) is composed of hygroscopic organic salts and water insoluble glycoproteins, similar to viscid silk, in addition to a low concentration of spider coating peptides reported before. Our adhesion studies reveal that the organic salts play an important role in adhesion, similar to that seen in orb web spiders, but modulating function at much lower humidity. Our work shows more similarities in the viscid silk produced by orb web and cobweb spiders than previously anticipated and provide guidelines for developing synthetic adhesives that can work in dry to humid environments.

  18. Spiders in random environment

    CERN Document Server

    Gallesco, Christophe; Popov, Serguei; Vachkovskaia, Marina


    A spider consists of several, say $N$, particles. Particles can jump independently according to a random walk if the movement does not violate some given restriction rules. If the movement violates a rule it is not carried out. We consider random walk in random environment (RWRE) on $\\Z$ as underlying random walk. We suppose the environment $\\omega=(\\omega_x)_{x \\in \\Z}$ to be elliptic, with positive drift and nestling, so that there exists a unique positive constant $\\kappa$ such that $\\E[((1-\\omega_0)/\\omega_0)^{\\kappa}]=1$. The restriction rules are kept very general; we only assume transitivity and irreducibility of the spider. The main result is that the speed of a spider is positive if $\\kappa/N>1$ and null if $\\kappa/N<1$. In particular, if $\\kappa/N <1$ a spider has null speed but the speed of a (single) RWRE is positive.

  19. Attentional and behavioural responses of spider fearfuls to virtual spiders

    NARCIS (Netherlands)

    Rinck, M.; Kwakkenbos, C.M.C.; Dotsch, R.; Wigboldus, D.H.J.; Becker, E.S.


    This study employed an immersed virtual environment (IVE) in the Nijmegen RIVERlab to study spider fearfuls' attentional and motor reactions to virtual spiders. The participants were exposed to virtual spiders while completing an unrelated task, walking freely through a virtual museum. Compared to n

  20. Regulation of wolf spider populations


    Rickers, Silke


    Aim of this study was to identify major regulatory mechanisms for wolf spider populations. Field and laboratory experiments focussed on the importance of prey availability (autochthonous & allochthonous), food quality and habitat heterogeneity on performance of individual wolf spiders or whole populations and on intra- (cannibalism) and interspecific (intraguild predation) relationships in wolf spiders. Wolf spider populations on xeric grasslands near Darmstadt (Germany) are increased on graz...

  1. Divorced, separated and widowed female workers in rural Mozambique

    NARCIS (Netherlands)

    Sender, J.; Oya, C.


    Compared to other rural women, a high proportion of female wageworkers in rural Mozambique are divorced, separated or widowed. The paper explores the factors underlying this difference and establishes a significant relationship between labour market participation and female divorce or widowhood. The

  2. 20 CFR 410.211 - Duration of entitlement; widow or surviving divorced wife. (United States)


    ... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Duration of entitlement; widow or surviving... surviving divorced wife. (a) An individual is entitled to benefits as a widow, or as a surviving divorced... first occurs: (1) The widow or surviving divorced wife dies; or (2) Where the individual has...

  3. 智能搜索蜘蛛%Intelligent Search Spiders

    Institute of Scientific and Technical Information of China (English)

    武海燕; 甘利人


    The search mechanism and the search process of the intelligent search spiders developed by the University of Arizona, which include Competitive Intelligence (CI) Spider, Meta Spider and Cancer Spider, are introduced. The characteristics of these spiders are summarized.


    NARCIS (Netherlands)



    Using a revised version of the Phobic Origin Questionnaire (POQ; Ost, L. G. & Hugdahl, K. Behaviour Research and Therapy, 19,439-477; 1981), the present study examined whether conditioning experiences, modeling experiences, and/or informational learning experiences were more often reported by spider

  5. The Spider Files (United States)

    McDonald, James; Dominguez, Lynn


    As children develop misconceptions about animals they believe are dangerous, they also adopt attitudes that are difficult to change. Changing these attitudes is challenging for teachers. One animal that is easy to find but difficult for children to understand is a spider. As with most wild animals, they are difficult to teach about because…

  6. Spiders in a hostile world (Arachnoidea, Araneae)


    Helsdingen, Peter J. van


    Spiders are powerful predators, but the threats confronting them are numerous. A survey is presented of the many different arthropods which waylay spiders in various ways. Some food-specialists among spiders feed exclusively on spiders. Kleptoparasites are found among spiders as well as among Mecoptera, Diptera, Lepidoptera, and Heteroptera. Predators are found within spiders’ own population (cannibalism), among other spider species (araneophagy), and among different species of Heteroptera, O...

  7. 42 CFR 435.137 - Disabled widows and widowers who would be eligible for SSI except for the increase in disability... (United States)


    ... for SSI except for the increase in disability benefits resulting from elimination of the reduction... widows and widowers who would be eligible for SSI except for the increase in disability benefits... to aged, blind, or disabled individuals receiving SSI or State supplements, the agency much...

  8. Spider-Ant Associations: An Updated Review of Myrmecomorphy, Myrmecophily, and Myrmecophagy in Spiders

    Directory of Open Access Journals (Sweden)

    Paula E. Cushing


    Full Text Available This paper provides a summary of the extensive theoretical and empirical work that has been carried out in recent years testing the adaptational significance of various spider-ant associations. Hundreds of species of spiders have evolved close relationships with ants and can be classified as myrmecomorphs, myrmecophiles, or myrmecophages. Myrmecomorphs are Batesian mimics. Their close morphological and behavioral resemblance to ants confers strong survival advantages against visually hunting predators. Some species of spiders have become integrated into the ant society as myrmecophiles or symbionts. These spider myrmecophiles gain protection against their own predators, live in an environment with a stable climate, and are typically surrounded by abundant food resources. The adaptations by which this integration is made possible are poorly known, although it is hypothesized that most spider myrmecophiles are chemical mimics and some are even phoretic on their hosts. The third type of spider-ant association discussed is myrmecophagy—or predatory specialization on ants. A table of known spider myrmecophages is provided as is information on their biology and hunting strategies. Myrmecophagy provides these predators with an essentially unlimited food supply and may even confer other protections to the spiders.

  9. Evidence from Multiple Species that Spider Silk Glue Component ASG2 is a Spidroin (United States)

    Collin, Matthew A.; Clarke, Thomas H.; Ayoub, Nadia A.; Hayashi, Cheryl Y.


    Spiders in the superfamily Araneoidea produce viscous glue from aggregate silk glands. Aggregate glue coats prey-capture threads and hampers the escape of prey from webs, thereby increasing the foraging success of spiders. cDNAs for Aggregate Spider Glue 1 (ASG1) and 2 (ASG2) have been previously described from the golden orb-weaver, Nephila clavipes, and Western black widow, Latrodectus hesperus. To further investigate aggregate glues, we assembled ASG1 and ASG2 from genomic target capture libraries constructed from three species of cob-web weavers and three species of orb-web weavers, all araneoids. We show that ASG1 is unlikely to be a glue, but rather is part of a widespread arthropod gene family, the peritrophic matrix proteins. For ASG2, we demonstrate its remarkable architectural and sequence similarities to spider silk fibroins, indicating that ASG2 is a member of the spidroin gene family. Thus, spidroins have diversified into glues in addition to task-specific, high performance fibers. PMID:26875681

  10. Molecular spiders on a plane (United States)

    Antal, Tibor; Krapivsky, P. L.


    Synthetic biomolecular spiders with “legs” made of single-stranded segments of DNA can move on a surface covered by single-stranded segments of DNA called substrates when the substrate DNA is complementary to the leg DNA. If the motion of a spider does not affect the substrates, the spider behaves asymptotically as a random walk. We study the diffusion coefficient and the number of visited sites for spiders moving on the square lattice with a substrate in each lattice site. The spider's legs hop to nearest-neighbor sites with the constraint that the distance between any two legs cannot exceed a maximal span. We establish analytic results for bipedal spiders, and investigate multileg spiders numerically. In experimental realizations legs usually convert substrates into products (visited sites). The binding of legs to products is weaker, so the hopping rate from the substrates is smaller. This makes the problem non-Markovian and we investigate it numerically. We demonstrate the emergence of a counterintuitive behavior—the more spiders are slowed down on unvisited sites, the more motile they become.

  11. Economic analysis of spider web airline networks

    Institute of Scientific and Technical Information of China (English)


    The distinct network organization, management, service and operating characteristics of US Southwest Airlines are key elements of its success compared with other airlines. As a network organization type, the spider web airline network has received more attention. In this paper, we analyzed the relation between the spider web airline network and spider web, and the structure of spider web airline network, built the assignment model of the spider web airline network,and investigated the economics concerned.

  12. Intra-Binary Shock Heating of Black Widow Companions

    CERN Document Server

    Romani, Roger W


    The low mass companions of evaporating binary pulsars (black widows and their ilk) are strongly heated on the side facing the pulsar. However in high-quality photometric and spectroscopic data the heating pattern does not match that expected for direct pulsar illumination. Here we explore heating mediated by an intra-binary shock (IBS). We develop a simple analytic model and implement it in the popular `ICARUS' light curve code. The model is parameterized by the wind momentum ratio beta and velocity v_Rel v_orb and assumes that the reprocessed pulsar wind emits prompt particles or radiation to heat the companion surface. We illustrate an interesting range of light curve asymmetries controlled by these parameters. The code also computes the IBS synchrotron emission pattern, and thus can model black widow X-ray light curves. As a test we apply the results to the high quality asymmetric optical light curves of PSR J2215+5135; the resulting fit gives a substantial improvement upon direct heating models and produc...

  13. Intra-binary Shock Heating of Black Widow Companions (United States)

    Romani, Roger W.; Sanchez, Nicolas


    The low-mass companions of evaporating binary pulsars (black widows and similar) are strongly heated on the side facing the pulsar. However, in high-quality photometric and spectroscopic data, the heating pattern does not match that expected for direct pulsar illumination. Here we explore a model where the pulsar power is intercepted by an intra-binary shock (IBS) before heating the low-mass companion. We develop a simple analytic model and implement it in the popular “ICARUS” light curve code. The model is parameterized by the wind momentum ratio β and the companion wind speed {f}v{v}{{orb}}, and assumes that the reprocessed pulsar wind emits prompt particles or radiation to heat the companion surface. We illustrate an interesting range of light curve asymmetries controlled by these parameters. The code also computes the IBS synchrotron emission pattern, and thus can model black widow X-ray light curves. As a test, we apply the results to the high-quality asymmetric optical light curves of PSR J2215+5135; the resulting fit gives a substantial improvement upon direct heating models and produces an X-ray light curve consistent with that seen. The IBS model parameters imply that at the present loss rate, the companion evaporation has a characteristic timescale of {τ }{{evap}}≈ 150 Myr. Still, the model is not fully satisfactory, indicating that there are additional unmodeled physical effects.

  14. Correlates of the Economic Status of Widowed and Divorced Elderly Women. (United States)

    Choi, Namkee G.


    Performed ordinary least squares regression analysis on data from National Beneficiary Survey concerning elderly divorced and widowed women. Found that women's economic status was commonly associated with such factors as level of education, work history, and Social Security primary insurance amount. Also analyzed differences between widows and…

  15. Violence Against Widows in Nepal: Experiences, Coping Behaviors, and Barriers in Seeking Help. (United States)

    Sabri, Bushra; Sabarwal, Shrutika; Decker, Michele R; Shrestha, Abina; Sharma, Kunda; Thapa, Lily; Surkan, Pamela J


    Widows are a vulnerable population in Nepal. This study examined Nepalese widows' experiences of violence, their coping strategies, and barriers faced in seeking help. Study participants were recruited from Women for Human Rights, an NGO in Nepal. A stratified purposive sampling approach was used to select 51 widows and 5 staff members for in-depth interviews. Twenty-seven women who experienced violence were included in this analysis. Data were analyzed and synthesized using a thematic analysis procedure. Widows reported a range of violent experiences perpetrated by family and community members that spanned psychological, physical, and sexual abuse. Women dealt with abusive experiences using both adaptive (e.g., attempting to move ahead, seeking social support, using verbal confrontation) and maladaptive coping strategies (e.g., suicidal thoughts or self-medication). However, they faced barriers to seeking help such as insensitivity of the police, perceived discrimination, and general lack of awareness of widows' problems and needs. Findings highlight the need for interventions across the individual, family, community, and policy levels. Avenues for intervention include creating awareness about widows' issues and addressing cultural beliefs affecting widows' lives. Furthermore, efforts should focus on empowering widows, promoting healthy coping, and addressing their individual needs. PMID:25657102

  16. 20 CFR 410.210 - Conditions of entitlement; widow or surviving divorced wife. (United States)


    ... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Conditions of entitlement; widow or surviving... surviving divorced wife. An individual is entitled to benefits if such individual: (a) Is the widow (see § 410.320) or surviving divorced wife (see § 410.321) of a miner (see § 410.110(j)); (b) Is not...

  17. 38 CFR 10.37 - Claim of widow not living with veteran at time of veteran's death. (United States)


    ... by the widow involving desertion or moral turpitude will be construed as the willful act of the widow. Cause of separation and time and duration of separation at the time of the death of the veteran shall...

  18. Debt, shame, and survival: becoming and living as widows in rural Kerala, India

    Directory of Open Access Journals (Sweden)

    Mohindra Katia


    Full Text Available Abstract Background The health and well-being of widows in India is an important but neglected issue of public health and women’s rights. We investigate the lives of Indian women as they become widows, focussing on the causes of their husband’s mortality and the ensuing consequences of these causes on their own lives and identify the opportunities and challenges that widows face in living healthy and fulfilling lives. Methods Data were collected in a Gram Panchayat (lowest level territorial decentralised unit in the south Indian state of Kerala. Interviews were undertaken with key informants in order to gain an understanding of local constructions of ‘widowhood’ and the welfare and social opportunities for widows. Then we conducted semi-structured interviews with widows in the community on issues related to health and vulnerability, enabling us to hear perspectives from widows. Data were analysed for thematic content and emerging patterns. We synthesized our findings with theoretical understandings of vulnerability and Amartya Sen’s entitlements theory to develop a conceptual framework. Results Two salient findings of the study are: first, becoming a widow can be viewed as a type of ‘shock’ that operates similarly to other ‘economic shocks’ or ‘health shocks’ in poor countries except that the burden falls disproportionately on women. Second, widowhood is not a static phenomenon, but rather can be viewed as a multi-phased process with different public health implications at each stage. Conclusion More research on widows in India and other countries will help to both elucidate the challenges faced by widows and encourage potential solutions. The framework developed in this paper could be used to guide future research on widows.

  19. Cell culture's spider silk road. (United States)

    Perkel, Jeffrey


    A number of synthetic and natural materials have been tried in cell culture and tissue engineering applications in recent years. Now Jeffrey Perkel takes a look at one new culture component that might surprise you-spider silk.

  20. Extraction of venom and venom gland microdissections from spiders for proteomic and transcriptomic analyses. (United States)

    Garb, Jessica E


    Venoms are chemically complex secretions typically comprising numerous proteins and peptides with varied physiological activities. Functional characterization of venom proteins has important biomedical applications, including the identification of drug leads or probes for cellular receptors. Spiders are the most species rich clade of venomous organisms, but the venoms of only a few species are well-understood, in part due to the difficulty associated with collecting minute quantities of venom from small animals. This paper presents a protocol for the collection of venom from spiders using electrical stimulation, demonstrating the procedure on the Western black widow (Latrodectus hesperus). The collected venom is useful for varied downstream analyses including direct protein identification via mass spectrometry, functional assays, and stimulation of venom gene expression for transcriptomic studies. This technique has the advantage over protocols that isolate venom from whole gland homogenates, which do not separate genuine venom components from cellular proteins that are not secreted as part of the venom. Representative results demonstrate the detection of known venom peptides from the collected sample using mass spectrometry. The venom collection procedure is followed by a protocol for dissecting spider venom glands, with results demonstrating that this leads to the characterization of venom-expressed proteins and peptides at the sequence level.

  1. Spider phylogenomics: untangling the Spider Tree of Life. (United States)

    Garrison, Nicole L; Rodriguez, Juanita; Agnarsson, Ingi; Coddington, Jonathan A; Griswold, Charles E; Hamilton, Christopher A; Hedin, Marshal; Kocot, Kevin M; Ledford, Joel M; Bond, Jason E


    Spiders (Order Araneae) are massively abundant generalist arthropod predators that are found in nearly every ecosystem on the planet and have persisted for over 380 million years. Spiders have long served as evolutionary models for studying complex mating and web spinning behaviors, key innovation and adaptive radiation hypotheses, and have been inspiration for important theories like sexual selection by female choice. Unfortunately, past major attempts to reconstruct spider phylogeny typically employing the "usual suspect" genes have been unable to produce a well-supported phylogenetic framework for the entire order. To further resolve spider evolutionary relationships we have assembled a transcriptome-based data set comprising 70 ingroup spider taxa. Using maximum likelihood and shortcut coalescence-based approaches, we analyze eight data sets, the largest of which contains 3,398 gene regions and 696,652 amino acid sites forming the largest phylogenomic analysis of spider relationships produced to date. Contrary to long held beliefs that the orb web is the crowning achievement of spider evolution, ancestral state reconstructions of web type support a phylogenetically ancient origin of the orb web, and diversification analyses show that the mostly ground-dwelling, web-less RTA clade diversified faster than orb weavers. Consistent with molecular dating estimates we report herein, this may reflect a major increase in biomass of non-flying insects during the Cretaceous Terrestrial Revolution 125-90 million years ago favoring diversification of spiders that feed on cursorial rather than flying prey. Our results also have major implications for our understanding of spider systematics. Phylogenomic analyses corroborate several well-accepted high level groupings: Opisthothele, Mygalomorphae, Atypoidina, Avicularoidea, Theraphosoidina, Araneomorphae, Entelegynae, Araneoidea, the RTA clade, Dionycha and the Lycosoidea. Alternatively, our results challenge the monophyly of

  2. Spider phylogenomics: untangling the Spider Tree of Life. (United States)

    Garrison, Nicole L; Rodriguez, Juanita; Agnarsson, Ingi; Coddington, Jonathan A; Griswold, Charles E; Hamilton, Christopher A; Hedin, Marshal; Kocot, Kevin M; Ledford, Joel M; Bond, Jason E


    Spiders (Order Araneae) are massively abundant generalist arthropod predators that are found in nearly every ecosystem on the planet and have persisted for over 380 million years. Spiders have long served as evolutionary models for studying complex mating and web spinning behaviors, key innovation and adaptive radiation hypotheses, and have been inspiration for important theories like sexual selection by female choice. Unfortunately, past major attempts to reconstruct spider phylogeny typically employing the "usual suspect" genes have been unable to produce a well-supported phylogenetic framework for the entire order. To further resolve spider evolutionary relationships we have assembled a transcriptome-based data set comprising 70 ingroup spider taxa. Using maximum likelihood and shortcut coalescence-based approaches, we analyze eight data sets, the largest of which contains 3,398 gene regions and 696,652 amino acid sites forming the largest phylogenomic analysis of spider relationships produced to date. Contrary to long held beliefs that the orb web is the crowning achievement of spider evolution, ancestral state reconstructions of web type support a phylogenetically ancient origin of the orb web, and diversification analyses show that the mostly ground-dwelling, web-less RTA clade diversified faster than orb weavers. Consistent with molecular dating estimates we report herein, this may reflect a major increase in biomass of non-flying insects during the Cretaceous Terrestrial Revolution 125-90 million years ago favoring diversification of spiders that feed on cursorial rather than flying prey. Our results also have major implications for our understanding of spider systematics. Phylogenomic analyses corroborate several well-accepted high level groupings: Opisthothele, Mygalomorphae, Atypoidina, Avicularoidea, Theraphosoidina, Araneomorphae, Entelegynae, Araneoidea, the RTA clade, Dionycha and the Lycosoidea. Alternatively, our results challenge the monophyly of

  3. 'Natural experiment' demonstrates top-down control of spiders by birds on a landscape level.

    Directory of Open Access Journals (Sweden)

    Haldre Rogers

    Full Text Available The combination of small-scale manipulative experiments and large-scale natural experiments provides a powerful approach for demonstrating the importance of top-down trophic control on the ecosystem scale. The most compelling natural experiments have come from studies examining the landscape-scale loss of apex predators like sea otters, wolves, fish and land crabs. Birds are dominant apex predators in terrestrial systems around the world, yet all studies on their role as predators have come from small-scale experiments; the top-down impact of bird loss on their arthropod prey has yet to be examined at a landscape scale. Here, we use a unique natural experiment, the extirpation of insectivorous birds from nearly all forests on the island of Guam by the invasive brown tree snake, to produce the first assessment of the impacts of bird loss on their prey. We focused on spiders because experimental studies showed a consistent top-down effect of birds on spiders. We conducted spider web surveys in native forest on Guam and three nearby islands with healthy bird populations. Spider web densities on the island of Guam were 40 times greater than densities on islands with birds during the wet season, and 2.3 times greater during the dry season. These results confirm the general trend from manipulative experiments conducted in other systems however, the effect size was much greater in this natural experiment than in most manipulative experiments. In addition, bird loss appears to have removed the seasonality of spider webs and led to larger webs in at least one spider species in the forests of Guam than on nearby islands with birds. We discuss several possible mechanisms for the observed changes. Overall, our results suggest that effect sizes from smaller-scale experimental studies may significantly underestimate the impact of bird loss on spider density as demonstrated by this large-scale natural experiment.

  4. The evolution of sociality in spiders

    DEFF Research Database (Denmark)

    Lubin, Yael; Bilde, T.


    I. Introducing Social Spiders II. Social and Subsocial Species: A Survey of Behavioral Traits III. Inbred Sociality in Spiders A. Cooperation Versus Competition: A Balancing Act B. Do Social Spiders Have Division of Labor? C. Colony Foundation: Propagule Dispersal Versus Fission D. Female...





    Eroticism has a wider definition. Martin Amis is the most successful postmodern British fiction writer in defining this. The Pregnant Widow is a demi-bible of polished eroticism. Every psalm of this bible beats post feministic pulse. This small excerpt will be an endeavour to conceptualize post feminism and how it is defined by Amis in his novel The Pregnant Widow. Feminism is often defined as a movement and revolution for the liberation of women. This research paper will focu...

  6. Ballooning Spiders: The Case for Electrostatic Flight

    CERN Document Server

    Gorham, Peter W


    We consider general aspects of the physics underlying the flight of Gossamer spiders, also known as ballooning spiders. We show that existing observations and the physics of spider silk in the presence of the Earth's static atmospheric electric field indicate a potentially important role for electrostatic forces in the flight of Gossamer spiders. A compelling example is analyzed in detail, motivated by the observed "unaccountable rapidity" in the launching of such spiders from H.M.S. Beagle, recorded by Charles Darwin during his famous voyage.

  7. Vibration Propagation in Spider Webs (United States)

    Hatton, Ross; Otto, Andrew; Elias, Damian

    Due to their poor eyesight, spiders rely on web vibrations for situational awareness. Web-borne vibrations are used to determine the location of prey, predators, and potential mates. The influence of web geometry and composition on web vibrations is important for understanding spider's behavior and ecology. Past studies on web vibrations have experimentally measured the frequency response of web geometries by removing threads from existing webs. The full influence of web structure and tension distribution on vibration transmission; however, has not been addressed in prior work. We have constructed physical artificial webs and computer models to better understand the effect of web structure on vibration transmission. These models provide insight into the propagation of vibrations through the webs, the frequency response of the bare web, and the influence of the spider's mass and stiffness on the vibration transmission patterns. Funded by NSF-1504428.

  8. Stigma of tiger attack: Study of tiger-widows from Sundarban Delta, India* (United States)

    Chowdhury, Arabinda N.; Brahma, Arabinda; Mondal, Ranajit; Biswas, Mrinal K.


    Aims: Human-tiger conflict (HTC) is a serious public health issue in Sundarban Reserve Forest, India. HTC is a continued concern for significant mortality and morbidity of both human and tiger population. This study examined 49 widows, whose husbands were killed by tigers, in order to explore the cultural stigma related with tiger-killing and consequent discrimination and social rejection. Different psychosocial aspects of community stigma associated with tiger-killings is discussed in the context of local culture. Methods: A mix of both quantitative and qualitative methods was used in this ethnographic study in two mouzas of Sundarban adjacent to Reserve Forest, involving (1) Village Survey for Tiger-widows, (2) In-depth interview of the widows, (3) Focus Group discussions, (4) Participatory mapping and (5) Stigma assessment by using a 28 item stigma scale especially devised for this research. For comparison of stigma-burden snake-bite widows and normal widows were taken from the same community. Results: Tiger-widows showed significantly higher stigma scores on all the clusters (fear, negative feelings, disclosure, discrimination, community attitudes, and spiritual dimension) than from both normal and snake-bite widows. They also showed higher total stigma score (65.9 ± 9.8) than normal widows (35.8 ± 8.0) and snake-bite widows (40.1 ± 7.1) and this difference was highly significant (P < 0.001). IDIs and FGDs helped to unfold the cultural construct of stigma related to tiger-killing. This can be seen in how the tiger-widows’ quality of life has been negatively impacted with a multitude of post-trauma psychological scars, deprivation, abuse and exploitation. Conclusions: The study proposes that administrative strategy for sustainable alternative income generation and conservation policy with integrated participatory forest management may save both human and tiger. A community ecocultural mental health programme addressing to eradicate the cultural stigma

  9. A Cocoon Found Inside the Black Widow's Web (United States)


    NASA's Chandra X-ray Observatory image of the mysterious "Black Widow" pulsar reveals the first direct evidence of an elongated cocoon of high-energy particles. This discovery shows that this billion-year-old rejuvenated pulsar is an extremely efficient generator of a high-speed flow of matter and antimatter particles. Known officially as pulsar B1957+20, the Black Widow received its nickname because it is emitting intense high-energy radiation that is destroying its companion through evaporation. B1957+20, which completes one rotation every 1.6-thousandths of a second, belongs to a class of extremely rapidly rotating neutron stars called millisecond pulsars. The motion of B1957+20 through the galaxy -- at a high speed of almost a million kilometers per hour -- creates a bow shock wave visible to optical telescopes. The Chandra observation shows what cannot be seen in visible light: a second shock wave. This secondary shock wave is created from pressure that sweeps the wind back from the pulsar to form the cocoon of high-energy particles, visible for the first time in the Chandra data. "This is the first detection of a double-shock structure around a pulsar," said Benjamin Stappers, of the Dutch Organization for Research in Astronomy (ASTRON), lead author on a paper describing the research that will appear in the Feb. 28, 2003, issue of Science magazine. "It should enable astronomers to test theories of the dynamics of pulsar winds and their interaction with their environment." B1957+20 X-ray-only image of B1957+20 Scientists believe millisecond pulsars are very old neutron stars that have been spun up by accreting material from their companions. The steady push of the infalling matter on the neutron star spins it up in much the same way as pushing on a merry-go-round makes it rotate faster. The result is an object about 1.5 times as massive as the Sun and ten miles in diameter that rotates hundreds of times per second. The advanced age, very rapid rotation rate

  10. The Spider and the Fly (United States)

    Mellinger, Keith E.; Viglione, Raymond


    The Spider and the Fly puzzle, originally attributed to the great puzzler Henry Ernest Dudeney, and now over 100 years old, asks for the shortest path between two points on a particular square prism. We explore a generalization, find that the original solution only holds in certain cases, and suggest how this discovery might be used in the…

  11. Cultural care of older Greek Canadian widows within Leininger's theory of culture care. (United States)

    Rosenbaum, J N


    Cultural care themes were abstracted from a large scale study of older Greek Canadian widows conceptualized within Leininger's theory of Cultural Care Diversity and Universality. Ethnonursing, ethnographic, and life health-care history methods were used. Data were collected using observation-participation and interviews in three Greek Canadian communities with 12 widowed key informants and 30 general informants. Enabling tools used were interview inquiry guides, Leininger's Life History Health Care Protocol, Leininger's Acculturation Rating and Profile Scale of Traditional and Non-Traditional Lifeways, and field journal recordings. Data were analyzed using Leininger's phases of analysis for qualitative data. The two major cultural care themes which were abstracted from the raw data and patterns were: (1) Cultural care for Greek Canadian widows meant responsibility for, reciprocation, concern, love, companionship, family protection, hospitality, and helping, primarily derived from their kinship, religious, and cultural beliefs, and values, and (2) Cultural care continuity diminished the spousal care void and contributed to the health of Greek Canadian widows. These findings will stimulate future nursing research related to cultural care of diverse populations and guide nursing practice to provide culturally congruent care which will assist widows to reduce their spousal care void. The author thanks Dr. Madeleine Leininger, Dr. Judith Floyd, Dr. Marjorie Isenberg, and Dr. Bernice Kaplan for their guidance in completing the large scale study on which this article is based.

  12. Radio Timing and Analysis of Black Widow Pulsar J2256-1024 (United States)

    Crowter, Kathryn; Stairs, Ingrid H.; McPhee, Christie A.; Archibald, Anne M.; Boyles, Jason; Hessels, Jason; Kaspi, Victoria M.; Kondratiev, Vlad I.; Lorimer, Duncan; Lynch, Ryan S.; McLaughlin, Maura; Pennucci, Timothy; Ransom, Scott M.; Roberts, Mallory; Stovall, Kevin; van Leeuwen, Joeri


    Pulsar J2256-1024, discovered in a 350MHz GBT drift-scan survey and subsequently detected by Fermi-LAT, is a black widow millisecond pulsar in an eclipsing binary system. Black widow pulsars have a rather interesting history. They started life in a binary system, were then spun up by their companions into millisecond pulsars but at some point started ablating those companions, slowly destroying them - thus the moniker "black widow". They are characterized by relatively short orbital periods, in this case 5.1 hours, a low companion mass and, if the inclination angle is right, eclipses. For J2256-1024 we see very clear radio eclipses. Black widow systems used to be few and far between but are now more common with at least 18 currently known. Black widows are interesting for a variety of reasons. They provide potential insight into the formation of isolated millisecond pulsars which must have formed in a binary but are now seen alone, and in eclipsing systems pulses travel through the magnetosphere of the companion providing a probe of that region. Here we present timing and polarization results for J2256-1024 based on radio observations with the GBT.

  13. Levirate marriage amongst the Hebrews and widow's inheritance amongst the Yoruba: A comparative investigation

    Directory of Open Access Journals (Sweden)

    Samson O. Olanisebe


    Full Text Available In ancient Israel, even though widowhood was not something people were praying for, when it came, the people involved were protected by the legal and customary structures already in place. One of those structures in the Old Testament is the institution of the levirate marriage where the right and the possession due to a widow without a son for her late husband could be protected and appropriated. A similar custom was also found amongst the pre-colonial Yoruba people through the widow�s inheritance which guarantees the welfare of the widow after the demise of her husband. However, these structures have been dismantled by Christianity, thereby exposing the majority of present-day widows to untold hardship. This article, therefore, through historical, descriptive and comparative methods, examines the customs of the levirate marriage and widow�s inheritance in the two cultures, ascertains how effective they were in addressing the welfare and protection of the rights and privileges of widows and recommends how the church can better see to the welfare of the widows in the society.

  14. Cultural care of older Greek Canadian widows within Leininger's theory of culture care. (United States)

    Rosenbaum, J N


    Cultural care themes were abstracted from a large scale study of older Greek Canadian widows conceptualized within Leininger's theory of Cultural Care Diversity and Universality. Ethnonursing, ethnographic, and life health-care history methods were used. Data were collected using observation-participation and interviews in three Greek Canadian communities with 12 widowed key informants and 30 general informants. Enabling tools used were interview inquiry guides, Leininger's Life History Health Care Protocol, Leininger's Acculturation Rating and Profile Scale of Traditional and Non-Traditional Lifeways, and field journal recordings. Data were analyzed using Leininger's phases of analysis for qualitative data. The two major cultural care themes which were abstracted from the raw data and patterns were: (1) Cultural care for Greek Canadian widows meant responsibility for, reciprocation, concern, love, companionship, family protection, hospitality, and helping, primarily derived from their kinship, religious, and cultural beliefs, and values, and (2) Cultural care continuity diminished the spousal care void and contributed to the health of Greek Canadian widows. These findings will stimulate future nursing research related to cultural care of diverse populations and guide nursing practice to provide culturally congruent care which will assist widows to reduce their spousal care void. The author thanks Dr. Madeleine Leininger, Dr. Judith Floyd, Dr. Marjorie Isenberg, and Dr. Bernice Kaplan for their guidance in completing the large scale study on which this article is based. PMID:2264941

  15. Specialised use of working memory by Portia africana, a spider-eating salticid. (United States)

    Cross, Fiona R; Jackson, Robert R


    Using expectancy-violation methods, we investigated the role of working memory in the predatory strategy of Portia africana, a salticid spider from Kenya that preys by preference on other spiders. One of this predator's tactics is to launch opportunistic leaping attacks on to other spiders in their webs. Focussing on this particular tactic, our experiments began with a test spider on a ramp facing a lure (dead prey spider mounted on a cork disc) that could be reached by leaping. After the test spider faced the lure for 30 s, we blocked the test spider's view of the lure by lowering an opaque shutter before the spider leapt. When the shutter was raised 90 s later, either the same lure came into view again (control) or a different lure came into view (experimental: different prey type in same orientation or same prey type in different orientation). We recorded attack frequency (number of test spiders that leapt at the lure) and attack latency (time elapsing between shutter being raised and spiders initiating a leap). Attack latencies in control trials were not significantly different from attack latencies in experimental trials, regardless of whether it was prey type or prey orientation that changed in the experimental trials. However, compared with test spiders in the no-change control trials, significantly fewer test spiders leapt when prey type changed. There was no significant effect on attack frequency when prey orientation changed. These findings suggest that this predator represents prey type independently of prey orientation.

  16. Spider-Web Inspired Mechanical Metamaterials


    Miniaci, Marco; Krushynska, Anastasiia; Movchan, Alexander B.; Bosia, Federico; Pugno, Nicola M.


    Spider silk is a remarkable example of bio-material with superior mechanical characteristics. Its multilevel structural organization of dragline and viscid silk leads to unusual and tunable properties, extensively studied from a quasi-static point of view. In this study, inspired by the Nephila spider orb web architecture, we propose a novel design for mechanical metamaterials based on its periodic repetition. We demonstrate that spider-web metamaterial structure plays an important role in th...

  17. Spider-Venom Peptides as Therapeutics


    Glenn F King; Volker Herzig; Rash, Lachlan D; Jensen, Jonas E.; Sing Yan Er; Sebastian Senff; Saez, Natalie J.


    Spiders are the most successful venomous animals and the most abundant terrestrial predators. Their remarkable success is due in large part to their ingenious exploitation of silk and the evolution of pharmacologically complex venoms that ensure rapid subjugation of prey. Most spider venoms are dominated by disulfide-rich peptides that typically have high affinity and specificity for particular subtypes of ion channels and receptors. Spider venoms are conservatively predicted to contain more ...

  18. Carbon nanotubes on a spider silk scaffold (United States)

    Steven, Eden; Saleh, Wasan R.; Lebedev, Victor; Acquah, Steve F. A.; Laukhin, Vladimir; Alamo, Rufina G.; Brooks, James S.


    Understanding the compatibility between spider silk and conducting materials is essential to advance the use of spider silk in electronic applications. Spider silk is tough, but becomes soft when exposed to water. Here we report a strong affinity of amine-functionalised multi-walled carbon nanotubes for spider silk, with coating assisted by a water and mechanical shear method. The nanotubes adhere uniformly and bond to the silk fibre surface to produce tough, custom-shaped, flexible and electrically conducting fibres after drying and contraction. The conductivity of coated silk fibres is reversibly sensitive to strain and humidity, leading to proof-of-concept sensor and actuator demonstrations.

  19. Formation of black widows and redbacks -- two distinct populations of eclipsing binary millisecond pulsars

    CERN Document Server

    Chen, Hai-Liang; Tauris, Thomas M; Han, Zhanwen


    Eclipsing binary millisecond pulsars (the so-called black widows and redbacks) can provide important information about accretion history, pulsar irradiation of their companion stars and the evolutionary link between accreting X-ray pulsars and isolated millisecond pulsars. However, the formation of such systems is not well understood, nor the difference in progenitor evolution between the two populations of black widows and redbacks. Whereas both populations have orbital periods between $0.1-1.0\\;{\\rm days}$ their companion masses differ by an order of magnitude. In this paper, we investigate the formation of these systems via evolution of converging low-mass X-ray binaries by employing the MESA stellar evolution code. Our results confirm that one can explain the formation of most of these eclipsing binary millisecond pulsars using this scenario. More notably, we find that the determining factor for producing either black widows or redbacks is the efficiency of the irradiation process, such that the redbacks ...

  20. [Human brown adipose tissue]. (United States)

    Virtanen, Kirsi A; Nuutila, Pirjo


    Adult humans have heat-producing and energy-consuming brown adipose tissue in the clavicular region of the neck. There are two types of brown adipose cells, the so-called classic and beige adipose cells. Brown adipose cells produce heat by means of uncoupler protein 1 (UCP1) from fatty acids and sugar. By applying positron emission tomography (PET) measuring the utilization of sugar, the metabolism of brown fat has been shown to multiply in the cold, presumably influencing energy consumption. Active brown fat is most likely present in young adults, persons of normal weight and women, least likely in obese persons.

  1. Atmospheres of Brown Dwarfs

    CERN Document Server

    Helling, Christiane


    Brown Dwarfs are the coolest class of stellar objects known to date. Our present perception is that Brown Dwarfs follow the principles of star formation, and that Brown Dwarfs share many characteristics with planets. Being the darkest and lowest mass stars known makes Brown Dwarfs also the coolest stars known. This has profound implication for their spectral fingerprints. Brown Dwarfs cover a range of effective temperatures which cause brown dwarfs atmospheres to be a sequence that gradually changes from a M-dwarf-like spectrum into a planet-like spectrum. This further implies that below an effective temperature of < 2800K, clouds form already in atmospheres of objects marking the boundary between M-Dwarfs and brown dwarfs. Recent developments have sparked the interest in plasma processes in such very cool atmospheres: sporadic and quiescent radio emission has been observed in combination with decaying Xray-activity indicators across the fully convective boundary.

  2. Widows and Wenches: Single Women in Eighteenth-Century Urban Economies

    DEFF Research Database (Denmark)

    Simonton, Deborah Leigh


    and contemporaries understanding of it. Widows and singlewomen were at different points in the lifecycle and this chapter highlights the importance of lifecycle on urban activities and place. It is deliberately transnational in order to draw out a fuller and more nuanced picture of the role of these women...... and their relationships within the transnational urban economy. It is based on primary research as well as the number of micro studies which have touched on or addressed widows and singlewomen. It also links to the growing interest in singletons and recognizes the importance of lifecycle when exploring female agency....

  3. Intelligent spider for Internet searching


    Chung, YM; Ramsey, M; Yang, CC; Ma, PC; Yen, JCH; H Chen


    As World Wide Web (WWW) based Internet services become more popular, information overload also becomes a pressing research problem. Difficulties with searching on the Internet get worse as the amount of information that is available increases. A scalable approach to support Internet search is critical to the success of Internet services and other current or future national information infrastructure (NII) applications. A new approach to build an intelligent personal spider (agent), which is b...

  4. Rumination and avoidance as predictors of prolonged grief, depression, and posttraumatic stress in female widowed survivors of war

    NARCIS (Netherlands)

    N. Morina


    This study examined independent contributions of rumination and experiential avoidance in predicting symptoms of psychological distress among female widowed survivors of war. A decade after the war in Kosovo, 100 widowed survivors of war completed measures of rumination, experiential avoidance, depr

  5. Spider management in agroecosystems: Habitat manipulation (United States)

    Mansour, Fadel; Richman, David B.; Whitcomb, W. H.


    Based on the literature and on work conducted in Israel, the management of spider populations through habitat manipulation was found to be very helpful in controlling pest insects in various crops. Spiders were found to be reduced or eliminated by non-selective insecticides, although some resistance has been noted

  6. Insects and Spiders. Environmental Education Curriculum. (United States)

    Topeka Public Schools, KS.

    This unit is designed to provide information on insects and spiders that special education students are capable of understanding. The activities are aimed at level 2 and level 3 educable mentally retarded classes. There are four topics: (1) Characteristics and Life Cycles of Insects; (2) Characteristics of Spiders; (3) Habitats and Food Sources of…

  7. Effectiveness of "Primary Bereavement Care" for Widows: A Cluster Randomized Controlled Trial Involving Family Physicians (United States)

    García, Jesus A.; Landa, Victor; Grandes, Gonzalo; Pombo, Haizea; Mauriz, Amaia


    Thirty-one family physicians, from 19 primary care teams in Biscay (Spain), were randomly assigned to intervention or control group. The 15 intervention family physicians, after training in primary bereavement care, saw 43 widows for 7 sessions, from the 4th to 13th month after their loss. The 16 control family physicians, without primary…

  8. The Paradox of Cultural Self-Representation in Paule Marshall's "Praisesong for the Widow" (United States)

    Ibironke, Olabode


    In this paper, I examine how Paule Marshall's "Praisesong For The Widow", fictionalizes "migrations of the subject". I argue that "Praisesong" explores the threshold between displacement, exile and prodigality. The paradox elaborated in this analysis is located precisely in how self-questioning ends up in self-affirmation; how conceptualisations…

  9. Spider venomics: implications for drug discovery. (United States)

    Pineda, Sandy S; Undheim, Eivind A B; Rupasinghe, Darshani B; Ikonomopoulou, Maria P; King, Glenn F


    Over a period of more than 300 million years, spiders have evolved complex venoms containing an extraordinary array of toxins for prey capture and defense against predators. The major components of most spider venoms are small disulfide-bridged peptides that are highly stable and resistant to proteolytic degradation. Moreover, many of these peptides have high specificity and potency toward molecular targets of therapeutic importance. This unique combination of bioactivity and stability has made spider-venom peptides valuable both as pharmacological tools and as leads for drug development. This review describes recent advances in spider-venom-based drug discovery pipelines. We discuss spider-venom-derived peptides that are currently under investigation for treatment of a diverse range of pathologies including pain, stroke and cancer.

  10. The ecological consequences of temperament in spiders

    Institute of Scientific and Technical Information of China (English)

    Jonathan N.PRUITT; Susan E.RIECHERT


    Ecological and evolutionary studies on spiders have been featured prominently throughout the contemporary behavioral syndromes movement.Here we review the behavioral syndromes literature devoted to spiders,and identify some ways in which behavioral syndromes can impact the function of spiders in ecological communities.We further highlight three general themes within the behavioral syndromes literature for which spiders have served as front running model systems:(1) how trait correlations beget performance trade-offs,(2) the influence that behavioral trait variants have on interspecific interactions and (3)mechanisms that aid in maintaining behavioral variation within- and among-populations.Research on behavioral syndromes continues to grow at an impressive rate,and we feel the success of behavioral syndromes studies in spiders bodes well for their continued prominence.

  11. The ecological consequences of temperament in spiders

    Directory of Open Access Journals (Sweden)

    Jonathan N. PRUITT, Susan E. RIECHERT


    Full Text Available Ecological and evolutionary studies on spiders have been featured prominently throughout the contemporary behavio­ral syndromes movement. Here we review the behavioral syndromes literature devoted to spiders, and identify some ways in which behavioral syndromes can impact the function of spiders in ecological communities. We further highlight three general themes within the behavioral syndromes literature for which spiders have served as front running model systems: (1 how trait correlations beget performance trade-offs, (2 the influence that behavioral trait variants have on interspecific interactions and (3 mechanisms that aid in maintaining behavioral variation within- and among-populations. Research on behavioral syndromes continues to grow at an impressive rate, and we feel the success of behavioral syndromes studies in spiders bodes well for their continued prominence [Current Zoology 58 (4: 589–596, 2012].

  12. Brown Fat Cell Isolation




    Author: C.R. Kahn ### 1.) ISOLATION AND PRIMARY CULTURE OF BROWN FAT PREADIPOCYTES ### Rationale: To prepare primary brown preadipocytes for immortalization: useful for metabolic studies from knockout mice. This consists of the following five protocols. References: Fasshauer, M., J. Klein, K M. Kriauciunas, K. Ueki, M.Benito, and C.R. Kahn. 2001. Essential role of insulin substrate 1 in differentiation of brown adipocytes. *Mol Cell Biol* 21: 319-329. Fasshauer, M....

  13. Verified spider bites in Oregon (USA) with the intent to assess hobo spider venom toxicity. (United States)

    McKeown, Nathanael; Vetter, Richard S; Hendrickson, Robert G


    This study compiled 33 verified spider bites from the state of Oregon (USA). The initial goal was to amass a series of bites by the hobo spider to assess whether it possesses toxic venom, a supposition which is currently in a contested state. None of the 33 bites from several spider species developed significant medical symptoms nor did dermonecrosis occur. The most common biters were the yellow sac spider, Cheiracanthium mildei (N = 10) and orb-weavers of the genus Araneus (N = 6). There were 10 bites from three genera of funnel web spiders of the family Agelenidae including one hobo spider bite and one from the congeneric giant house spider which is readily confused as a hobo spider. The hobo spider bite resulted in pain, redness, twitching in the calf muscle and resolved in 12 h. Also generated from this study were possibly the first records of bites from spiders of the genera Callobius (Amaurobiidae) and Antrodiaetus (Antrodiaetidae), both with minor manifestations.

  14. Wilson, Spider oral history interview


    Interviewee: Wilson, Spider; Interviewer: Walliser, Andrea; Interviewer: La, Michelle; Principal Investigator: Hall, Peter V


    Spider Wilson is a tattoo artist who operated a tattoo parlour on Columbia Street for 17 years, and is a New Westminster native. He was born at St. Mary’s Hospital and attended John Robson Elementary and later Lord Kelvin Elementary. He believes his job as a tattoo artist is a mixture of being a social worker and a bartender. He reports feeling a strong connection to the business community on Columbia Street. Having grown up five minutes away from his current shop, he talks about the changes ...

  15. Spiders spinning electrically charged nano-fibres. (United States)

    Kronenberger, Katrin; Vollrath, Fritz


    Most spider threads are on the micrometre and sub-micrometre scale. Yet, there are some spiders that spin true nano-scale fibres such as the cribellate orb spider, Uloborus plumipes. Here, we analyse the highly specialized capture silk-spinning system of this spider and compare it with the silk extrusion systems of the more standard spider dragline threads. The cribellar silk extrusion system consists of tiny, morphologically basic glands each terminating through exceptionally long and narrow ducts in uniquely shaped silk outlets. Depending on spider size, hundreds to thousands of these outlet spigots cover the cribellum, a phylogenetically ancient spinning plate. We present details on the unique functional design of the cribellate gland-duct-spigot system and discuss design requirements for its specialist fibrils. The spinning of fibres on the nano-scale seems to have been facilitated by the evolution of a highly specialist way of direct spinning, which differs from the aqua-melt silk extrusion set-up more typical for other spiders.

  16. Proteome and peptidome profiling of spider venoms. (United States)

    Liang, Songping


    Spider venoms are an important source of novel molecules with different pharmacological properties. Recent technological developments of proteomics, especially mass spectrometry, have greatly promoted the systematic analysis of spider venom. The enormous diversity of venom components between spider species and the lack of complete genome sequence, and the limited database of protein and peptide sequences make spider venom profiling a challenging task and special considerations for technical strategies are required. This review highlights recently used methods for spider venom profiling. In general, spider venom profiling can be achieved in two parts: proteome profiling of the components with molecular weights above 10 kDa, and peptidome profiling of the components with a molecular weight of 10 kDa or under through the use of different methods. Venom proteomes are rich in various enzymes, hemocyanins, toxin-like proteins and many unknown proteins. Peptidomes are dominated by peptides with a mass of 3-6 kDa with three to five disulfide bonds. Although there are some similarities in peptide superfamily types of venoms from different spider species, the venom profile of each species is unique. The linkage of the peptidomic data with that of the cDNA approach is discussed briefly. Future challenges and perspectives are also highlighted in this review.

  17. Father Brown, Selected sories

    NARCIS (Netherlands)

    Chesterton, G.K.


    Father Brown, a small, round Catholic priest with a remarkable understanding of the criminal mind, is one of literature's most unusual and endearing detectives, able to solve the strangest crimes in a most fascinating manner. This collection draws from all five Father Brown books, and within their r

  18. Learned predation risk management by spider mites

    Directory of Open Access Journals (Sweden)

    Thomas eHackl


    Full Text Available Predation is a prime selective force shaping prey behavior. Investment in anti-predator behavior is traded-off against time and energy for other fitness-enhancing activities such as foraging or reproduction. To optimize this benefit/cost trade-off, prey should be able to innately and/or by experience modulate their behavior to the level of predation risk. Here, we assessed learned predation risk management in the herbivorous two-spotted spider mite Tetranychus urticae. We exposed spider mites coming from benign (naïve or high immediate predation risk (experienced environments to latent and/or no risk and assessed their site choice, activity and oviposition. Benign environments were characterized by the absence of any predator cues, high immediate risk environments by killed spider mites, physical presence of the predatory mite Phytoseiulus persimilis and associated chemosensory traces left on the surface, and latent risk environments by only predator traces. In the no-choice experiment both naïve and experienced spider mites laid their first egg later on leaves with than without predator traces. Irrespective of predator traces presence/absence, experienced mites laid their first egg earlier than naïve ones did. Naïve spider mites were more active, indicating higher restlessness, and laid fewer eggs on leaves with predator traces, whereas experienced mites were less active and laid similar numbers of eggs on leaves with and without predator traces. In the choice experiment both naïve and experienced spider mites preferentially resided and oviposited on leaves without predator traces but experienced mites were less active than naïve ones. Overall, our study suggests that spider mites experienced with high predation risk behave bolder under latent risk than naïve spider mites. Since predator traces alone do not indicate immediate risk, we argue that the attenuated anti-predator response of experienced spider mites represents adaptive learned

  19. Cloning and activity of a novel α-latrotoxin from red-back spider venom. (United States)

    Graudins, Andis; Little, Michelle J; Pineda, Sandy S; Hains, Peter G; King, Glenn F; Broady, Kevin W; Nicholson, Graham M


    The venom of the European black widow spider Latrodectus tredecimguttatus (Theridiidae) contains several high molecular mass (110-140 kDa) neurotoxins that induce neurotransmitter exocytosis. These include a vertebrate-specific α-latrotoxin (α-LTX-Lt1a) responsible for the clinical symptoms of latrodectism and numerous insect-specific latroinsectoxins (LITs). In contrast, little is known about the expression of these toxins in other Latrodectus species despite the fact that envenomation by these spiders induces a similar clinical syndrome. Here we report highly conserved α-LTX, α-LIT and δ-LIT sequence tags in Latrodectus mactans, Latrodectus hesperus and Latrodectus hasselti venoms using tandem mass spectrometry, following bioassay-guided separation of venoms by liquid chromatography. Despite this sequence similarity, we show that the anti-α-LTX monoclonal antibody 4C4.1, raised against α-LTX-Lt1a, fails to neutralize the neurotoxicity of all other Latrodectus venoms tested in an isolated chick biventer cervicis nerve-muscle bioassay. This suggests that there are important structural differences between α-LTXs in theridiid spider venoms. We therefore cloned and sequenced the α-LTX from the Australian red-back spider L. hasselti (α-LTX-Lh1a). The deduced amino acid sequence of the mature α-LTX-Lh1a comprises 1180 residues (∼132kDa) with ∼93% sequence identity with α-LTX-Lt1a. α-LTX-Lh1a is composed of an N-terminal domain and a central region containing 22 ankyrin-like repeats. The presence of two furin cleavage sites, conserved with α-LTX-Lt1a, indicates that α-LTX-Lh1a is derived from the proteolytic cleavage of an N-terminal signal peptide and C-terminal propeptide region. However, we show that α-LTX-Lh1a has key substitutions in the 4C4.1 epitope that explains the lack of binding of the monoclonal antibody.

  20. 21-year timing of the black-widow pulsar J2051-0827

    CERN Document Server

    Shaifullah, G; Freire, P C C; Tauris, T M; Wex, N; Osłowski, S; Stappers, B W; Bassa, C G; Caballero, R N; Champion, D J; Cognard, I; Desvignes, G; Graikou, E; Guillemot, L; Janssen, G H; Jessner, A; Jordan, C; Karuppusamy, R; Kramer, M; Lazaridis, K; Lazarus, P; Lyne, A G; McKee, J W; Perrodin, D; Possenti, A; Tiburzi, C


    Timing results for the black-widow pulsar J2051-0827 are presented, using a 21-year dataset from four European Pulsar Timing Array telescopes and the Parkes radio telescope. This dataset, which is the longest published to date for a black-widow system, allows for an improved analysis that addresses previously unknown biases. While secular variations, as identified in previous analyses, are recovered, short-term variations are detected for the first time. Concurrently, a significant decrease of approx. 2.5x10-3 cm-3 pc in the dispersion measure associated with PSR J2051-0827 is measured for the first time and improvements are also made to estimates of the proper motion. Finally, PSR J2051-0827 is shown to have entered a relatively stable state suggesting the possibility of its eventual inclusion in pulsar timing arrays.

  1. 21 year timing of the black-widow pulsar J2051-0827 (United States)

    Shaifullah, G.; Verbiest, J. P. W.; Freire, P. C. C.; Tauris, T. M.; Wex, N.; Osłowski, S.; Stappers, B. W.; Bassa, C. G.; Caballero, R. N.; Champion, D. J.; Cognard, I.; Desvignes, G.; Graikou, E.; Guillemot, L.; Janssen, G. H.; Jessner, A.; Jordan, C.; Karuppusamy, R.; Kramer, M.; Lazaridis, K.; Lazarus, P.; Lyne, A. G.; McKee, J. W.; Perrodin, D.; Possenti, A.; Tiburzi, C.


    Timing results for the black-widow pulsar J2051-0827 are presented, using a 21 year data set from four European Pulsar Timing Array telescopes and the Parkes radio telescope. This data set, which is the longest published to date for a black-widow system, allows for an improved analysis that addresses previously unknown biases. While secular variations, as identified in previous analyses, are recovered, short-term variations are detected for the first time. Concurrently, a significant decrease of ˜ 2.5 × 10- 3 cm- 3 pc in the dispersion measure associated with PSR J2051-0827 is measured for the first time and improvements are also made to estimates of the proper motion. Finally, PSR J2051-0827 is shown to have entered a relatively stable state suggesting the possibility of its eventual inclusion in pulsar timing arrays.

  2. [The social relegation of widows living with HIV in the time of ART in Senegal]. (United States)

    Desclaux, A; Boye, S; Taverne, B


    While prolonged widowhood is unusual in Senegalese society, some women living with HIV receiving antiretroviral therapy for ten years remained widows. Are they maintained in this situation for refusing or being unable to remarry? To understand the conditions and the reasons for this lack of "matrimonial normalization", a qualitative interview study was conducted in Dakar with 31 widows. Their living conditions are mostly marked by economic difficulties, dependence on host families, and responsibilities visà-vis their children. They refuse to remarry, regret not being able to, or wish to without success, despite the existence locally of social forms of marital union that would respond to their situation. The refusal to disclose their HIV status combined with self-stigma prevent them from improving their condition. This form of social vulnerability that remains beyond the restoration of health is ignored by public policy and HIV/AIDS community based organizations claims. It should be acknowledged and considered for defending PLWAs' rights.

  3. Almost a spider: a 305-million-year-old fossil arachnid and spider origins. (United States)

    Garwood, Russell J; Dunlop, Jason A; Selden, Paul A; Spencer, Alan R T; Atwood, Robert C; Vo, Nghia T; Drakopoulos, Michael


    Spiders are an important animal group, with a long history. Details of their origins remain limited, with little knowledge of their stem group, and no insights into the sequence of character acquisition during spider evolution. We describe a new fossil arachnid, Idmonarachne brasierigen. et sp. nov. from the Late Carboniferous (Stephanian,ca 305-299 Ma) of Montceau-les-Mines, France. It is three-dimensionally preserved within a siderite concretion, allowing both laboratory- and synchrotron-based phase-contrast computed tomography reconstruction. The latter is a first for siderite-hosted fossils and has allowed us to investigate fine anatomical details. Although distinctly spider-like in habitus, this remarkable fossil lacks a key diagnostic character of Araneae: spinnerets on the underside of the opisthosoma. It also lacks a flagelliform telson found in the recently recognized, spider-related, Devonian-Permian Uraraneida. Cladistic analysis resolves our new fossil as sister group to the spiders: the spider stem-group comprises the uraraneids and I. brasieri While we are unable to demonstrate the presence of spigots in this fossil, the recovered phylogeny suggests the earliest character to evolve on the spider stem-group is the secretion of silk. This would have been followed by the loss of a flagelliform telson, and then the ability to spin silk using spinnerets. This last innovation defines the true spiders, significantly post-dates the origins of silk, and may be a key to the group's success. The Montceau-les-Mines locality has previously yielded a mesothele spider (with spinnerets). Evidently, Late Palaeozoic spiders lived alongside Palaeozoic arachnid grades which approached the spider condition, but did not express the full suite of crown-group autapomorphies.

  4. Modelling Crop Biocontrol by Wanderer Spiders (United States)

    Venturino, Ezio; Ghersi, Andrea


    We study mathematically the effects some spiders populations have on insects living in and near agroecosystems, where woods and vineyards alternate in the landscape as in the Alta Langa, Piemonte, NW Italy.

  5. Spider behaviors include oral sexual encounters (United States)

    Gregorič, Matjaž; Šuen, Klavdija; Cheng, Ren-Chung; Kralj-Fišer, Simona; Kuntner, Matjaž


    Several clades of spiders whose females evolved giant sizes are known for extreme sexual behaviors such as sexual cannibalism, opportunistic mating, mate-binding, genital mutilation, plugging, and emasculation. However, these behaviors have only been tested in a handful of size dimorphic spiders. Here, we bring another lineage into the picture by reporting on sexual behavior of Darwin’s bark spider, Caerostris darwini. This sexually size dimorphic Madagascan species is known for extreme web gigantism and for producing the world’s toughest biomaterial. Our field and laboratory study uncovers a rich sexual repertoire that predictably involves cannibalism, genital mutilation, male preference for teneral females, and emasculation. Surprisingly, C. darwini males engage in oral sexual encounters, rarely reported outside mammals. Irrespective of female’s age or mating status males salivate onto female genitalia pre-, during, and post-copulation. While its adaptive significance is elusive, oral sexual contact in spiders may signal male quality or reduce sperm competition. PMID:27126507

  6. Spider-Venom Peptides as Therapeutics

    Directory of Open Access Journals (Sweden)

    Glenn F. King


    Full Text Available Spiders are the most successful venomous animals and the most abundant terrestrial predators. Their remarkable success is due in large part to their ingenious exploitation of silk and the evolution of pharmacologically complex venoms that ensure rapid subjugation of prey. Most spider venoms are dominated by disulfide-rich peptides that typically have high affinity and specificity for particular subtypes of ion channels and receptors. Spider venoms are conservatively predicted to contain more than 10 million bioactive peptides, making them a valuable resource for drug discovery. Here we review the structure and pharmacology of spider-venom peptides that are being used as leads for the development of therapeutics against a wide range of pathophysiological conditions including cardiovascular disorders, chronic pain, inflammation, and erectile dysfunction.

  7. [Diagnostic use of Internet: google the spider]. (United States)

    Soonawala, Darius; Brienen, Eric A T; Visser, Leo G


    A 23-year-old woman was working in a factory unpacking jars of Spanish olives when a spider bit her finger. She presented to the emergency outpatient department carrying the spider in a box. She was worried and wanted to know whether the spider, which may have originated from Spain, was poisonous. After a ten minute Internet search the spider was identified as Segestria florentina. It can inject neurotoxins causing temporary local numbness and pain. The patient was reassured and discharged without further treatment. Later, experts confirmed the species. Internet-based search engines can draw attention to unusual diagnoses which otherwise may easily be overlooked. A general search engine can also provide access to subjects that fall outside the scope of the more usual medical sources. PMID:19785819

  8. Spider behaviors include oral sexual encounters. (United States)

    Gregorič, Matjaž; Šuen, Klavdija; Cheng, Ren-Chung; Kralj-Fišer, Simona; Kuntner, Matjaž


    Several clades of spiders whose females evolved giant sizes are known for extreme sexual behaviors such as sexual cannibalism, opportunistic mating, mate-binding, genital mutilation, plugging, and emasculation. However, these behaviors have only been tested in a handful of size dimorphic spiders. Here, we bring another lineage into the picture by reporting on sexual behavior of Darwin's bark spider, Caerostris darwini. This sexually size dimorphic Madagascan species is known for extreme web gigantism and for producing the world's toughest biomaterial. Our field and laboratory study uncovers a rich sexual repertoire that predictably involves cannibalism, genital mutilation, male preference for teneral females, and emasculation. Surprisingly, C. darwini males engage in oral sexual encounters, rarely reported outside mammals. Irrespective of female's age or mating status males salivate onto female genitalia pre-, during, and post-copulation. While its adaptive significance is elusive, oral sexual contact in spiders may signal male quality or reduce sperm competition. PMID:27126507

  9. Two-step phase-shifting SPIDER (United States)

    Zheng, Shuiqin; Cai, Yi; Pan, Xinjian; Zeng, Xuanke; Li, Jingzhen; Li, Ying; Zhu, Tianlong; Lin, Qinggang; Xu, Shixiang


    Comprehensive characterization of ultrafast optical field is critical for ultrashort pulse generation and its application. This paper combines two-step phase-shifting (TSPS) into the spectral phase interferometry for direct electric-field reconstruction (SPIDER) to improve the reconstruction of ultrafast optical-fields. This novel SPIDER can remove experimentally the dc portion occurring in traditional SPIDER method by recording two spectral interferograms with π phase-shifting. As a result, the reconstructed results are much less disturbed by the time delay between the test pulse replicas and the temporal widths of the filter window, thus more reliable. What is more, this SPIDER can work efficiently even the time delay is so small or the measured bandwidth is so narrow that strong overlap happens between the dc and ac portions, which allows it to be able to characterize the test pulses with complicated temporal/spectral structures or narrow bandwidths. PMID:27666528

  10. First Passage Properties of Molecular Spiders

    CERN Document Server

    Semenov, Oleg; Stefanovic, Darko


    Molecular spiders are synthetic catalytic DNA-based nanoscale walkers. We study the mean first passage time for abstract models of spiders moving on a finite two-dimensional lattice with various boundary conditions, and compare it with the mean first passage time of spiders moving on a one-dimensional track. We evaluate by how much the slowdown on newly visited sites, owing to catalysis, can improve the mean first passage time of spiders and show that in one dimension, when both ends of the track are an absorbing boundary, the performance gain is lower than in two dimensions, when the absorbing boundary is a circle; this persists even when the absorbing boundary is a single site.

  11. Cost-utility of a visiting service for older widowed individuals: Randomised trial

    Directory of Open Access Journals (Sweden)

    Willemse Godelief


    Full Text Available Abstract Background Despite a growing understanding of the effectiveness of bereavement interventions and the groups that benefit most from them, we know little about the cost-effectiveness of bereavement interventions. Methods We conducted a cost-utility analysis alongside a randomized clinical trial on a visiting service for older widowed individuals (n = 110 versus care as usual (CAU; n = 106. The visiting service is a selective bereavement intervention that offers social support to lonely widows and widowers by a trained volunteer. Participants were contacted 6–9 months post-loss. Eleven percent of all contacted persons responded and eight percent participated in the trial. The primary outcome measure was quality adjusted life years (QALYs gained (assessed with the EQ-5D, which is a generic measure of health status. Costs were calculated from a societal perspective excluding costs arising from productivity losses. Using the bootstrap method, we obtained the incremental cost utility ratio (ICUR, projected these on a cost-utility plane and presented as an acceptability curve. Results Overall, the experimental group demonstrated slightly better results against slightly higher costs. Whether the visiting service is acceptable depends on the willingness to pay: at a willingness to pay equal to zero per QALY gained, the visiting service has a probability of 31% of being acceptable; beyond €20,000, the visiting service has a probability of 70% of being more acceptable than CAU. Conclusion Selective bereavement interventions like the visiting service will not produce large benefits from the health economic point of view, when targeted towards the entire population of all widowed individuals. We recommend that in depth analyses are conducted to identify who benefits most from this kind of interventions, and in what subgroups the incremental cost-utility is best. In the future bereavement interventions are then best directed to these groups. Trial

  12. Health transitions in recently widowed older women: a mixed methods study


    DiGiacomo, Michelle; Lewis, Joanne; Nolan, Marie T.; Phillips, Jane; Davidson, Patricia M


    Background Older recently widowed women are faced with increased health risks and chronic conditions associated not only with bereavement, but also, older age. Loss and grief, adjusting to living alone, decreased income, and managing multiple chronic conditions can impact on older women’s ability to transition following recent spousal bereavement. Providing appropriate, timely, and effective services to foster this life transition is of critical importance, yet few services directed towards t...



    H. S. FERNANDES; M. SAKATE; A. L. Cherubini; A. F. PADOVANI; A.M.C. Meneses


    This report refers to a female Pinscher treated at the Veterinary Hospital of the Botucatu School of Veterinary Medicine and Animal Husbandry (FMVZ)-São Paulo State University (UNESP), Botucatu, 14 hours after a suspected spider envenoming. The animal showed spastic limbs, dyspnea, salivation, hypothermia, muscular fasciculation, non-responsive mydriasis, and claudication of the right hindlimb. The spider was later identified by the Center for the Study of Venoms and Venomous Animals-CEVAP/UN...

  14. Edge effect on weevils and spiders


    Horváth, R; Magura, T.; G. Péter; B. Tóthmérész


    The edge effect on weevils and spiders was tested along oak forest – meadow transects using sweep-net samples at the Síkfökút Project in Hungary. For spiders the species richness was significantly higher in the forest edge than either in the meadow or the forest interior. For weevils the species richness of the forest edge was higher than that of the meadow, but the difference was not statistically significant whereas the species richness of the forest...

  15. Spider's web inspires fibres for industry (United States)

    Dacey, James


    Spiders may not be everybody's idea of natural beauty, but nobody can deny the artistry in the webs that they spin, especially when decorated with water baubles in the morning dew. Inspired by this spectacle, a group of researchers in China has mimicked the structural properties of the spider's web to create a fibre for industry that can manipulate water with the same skill and efficiency, writes James Dacey.

  16. ‘He wasn’t in that chair’: what loneliness means to widowed older people

    Directory of Open Access Journals (Sweden)

    Kate Mary Bennet


    Full Text Available We have little robust empirical evidence that articulates what being lonely means to older people and even less knowledge about what loneliness means to older widows and widowers; this article addresses that deficit. We undertook a re-analysis of 125 interviews with older people (aged 55-98 that explored their experiences of widowhood. In this article, we focus on those interviews in which participants described themselves as experiencing loneliness by the spontaneous use of terms such as ‘‘lonely’’, ‘‘loneliness’’ or ‘‘lonesome’’. Almost half of the participants (42% described themselves in that way without any prompting from the interviewer. In terms of understanding and describing the meaning of loneliness, 50% explained loneliness in terms of absence of either their spouse, a physical presence in the house or people. One-third (34% discussed loneliness in relation to time and place: night, weekends and home, and 4% described the emotional impact of loneliness. Fifteen per cent just said they were lonely without elaboration, assuming a common understanding of what loneliness means. Our findings suggest that widowed people’s understanding and experience of loneliness resonates with the concept of ‘‘emotional’’ loneliness, resulting from the loss of significant social and emotional attachment. This has important implications for the types of interventions that may be appropriate for remediating loneliness in this group.

  17. Summary statistics for fossil spider species taxonomy

    Directory of Open Access Journals (Sweden)

    David Penney


    Full Text Available Spiders (Araneae are one of the most species-rich orders on Earth today, and also have one of the longest geological records of any terrestrial animal groups, as demonstrated by their extensive fossil record. There are currently around 1150 described fossil spider species, representing 2.6% of all described spiders (i.e. extinct and extant. Data for numbers of fossil and living spider taxa described annually (and various other metrics for the fossil taxa were compiled from current taxonomic catalogues. Data for extant taxa showed a steady linear increase of approximately 500 new species per year over the last decade, reflecting a rather constant research activity in this area by a large number of scientists, which can be expected to continue. The results for fossil species were very different, with peaks of new species descriptions followed by long troughs, indicating minimal new published research activity for most years. This pattern is indicative of short bursts of research by a limited number of authors. Given the frequent discovery of new fossil deposits containing spiders, a wealth of new material coming to light from previously worked deposits, and the application of new imaging techniques in palaeoarachnology that allow us to extract additional data from historical specimens, e.g. X-ray computed tomography, it is important not only to ensure a sustained research activity on fossil spiders (and other arachnids through training and enthusing the next generation of palaeoarachnologists, but preferably to promote increased research and expertise in this field.

  18. Interspecific infanticide and infant-directed aggression by spider monkeys (Ateles hybridus) in a fragmented forest in Colombia. (United States)

    Rimbach, Rebecca; Pardo-Martinez, Alejandra; Montes-Rojas, Andres; Di Fiore, Anthony; Link, Andres


    Interspecific aggression amongst nonhuman primates is rarely observed and has been mostly related to scenarios of resource competition. Interspecific infanticide is even rarer, and both the ultimate and proximate socio-ecological factors explaining this behavior are still unclear. We report two cases of interspecific infanticide and five cases of interspecific infant-directed aggression occurring in a well-habituated primate community living in a fragmented landscape in Colombia. All cases were initiated by male brown spider monkeys (Ateles hybridus) and were directed toward infants of either red howler monkeys (Alouatta seniculus: n = 6 cases) or white-fronted capuchins (Cebus albifrons: n = 1 case). One individual, a subadult spider monkey male, was involved in all but one case of interspecific infanticide or aggression. Other adult spider monkeys participated in interspecific aggression that did not escalate into potentially lethal encounters. We suggest that competition for food resources and space in a primate community living in high population densities and restricted to a forest fragment of ca. 65 ha might partly be driving the observed patterns of interspecific aggression. On the other hand, the fact that all but one case of interspecific infanticide and aggression involved the only subadult male spider monkey suggests this behavior might either be pathological or constitute a particular case of redirected aggression. Even if the underlying principles behind interspecific aggression and infanticide are poorly understood, they represent an important factor influencing the demographic trends of the primate community at this study site.

  19. Interspecific infanticide and infant-directed aggression by spider monkeys (Ateles hybridus) in a fragmented forest in Colombia. (United States)

    Rimbach, Rebecca; Pardo-Martinez, Alejandra; Montes-Rojas, Andres; Di Fiore, Anthony; Link, Andres


    Interspecific aggression amongst nonhuman primates is rarely observed and has been mostly related to scenarios of resource competition. Interspecific infanticide is even rarer, and both the ultimate and proximate socio-ecological factors explaining this behavior are still unclear. We report two cases of interspecific infanticide and five cases of interspecific infant-directed aggression occurring in a well-habituated primate community living in a fragmented landscape in Colombia. All cases were initiated by male brown spider monkeys (Ateles hybridus) and were directed toward infants of either red howler monkeys (Alouatta seniculus: n = 6 cases) or white-fronted capuchins (Cebus albifrons: n = 1 case). One individual, a subadult spider monkey male, was involved in all but one case of interspecific infanticide or aggression. Other adult spider monkeys participated in interspecific aggression that did not escalate into potentially lethal encounters. We suggest that competition for food resources and space in a primate community living in high population densities and restricted to a forest fragment of ca. 65 ha might partly be driving the observed patterns of interspecific aggression. On the other hand, the fact that all but one case of interspecific infanticide and aggression involved the only subadult male spider monkey suggests this behavior might either be pathological or constitute a particular case of redirected aggression. Even if the underlying principles behind interspecific aggression and infanticide are poorly understood, they represent an important factor influencing the demographic trends of the primate community at this study site. PMID:22767357

  20. The Effects of Alcohol on Spiders: What Happens to Web Construction after Spiders Consume Alcohol? (United States)

    Cross, Victor E.


    In the high school experiment reported in this paper, spiders were provided with 40% ethanol (ETOH) in order to determine the effects of alcohol on the web-spinning ability of orb weaver spiders. It was hypothesized that alcohol would have a deleterious effect on the number of radii, number of cells, and area of cells in the webs of orb weaving…

  1. Cognitive bias in spider-phobic children: Comparison of a pictorial and a linguistic spider Stroop.

    NARCIS (Netherlands)

    M. Kindt; J.F. Brosschot


    Examined the relation between spider fear in children and cognitive processing bias toward threatening information. It was investigated whether spider fear in children is related to a cognitive bias for threatening pictures and words. Pictorial and linguistic Stroop stimuli were administered to 28 s

  2. Fecundity increase supports adaptive radiation hypothesis in spider web evolution


    Todd A. Blackledge; Coddington, Jonathan A.; Agnarsson, Ingi


    Identifying the mechanisms driving adaptive radiations is key to explaining the diversity of life. The extreme reliance of spiders upon silk for survival provides an exceptional system in which to link patterns of diversification to adaptive changes in silk use. Most of the world’s 41,000 species of spiders belong to two apical lineages of spiders that exhibit quite different silk ecologies, distinct from their ancestors. Orb spiders spin highly stereotyped webs that are suspended in air and ...

  3. Cry1Ab-expressing rice did not influence expression of fecundity-related genes in the wolf spider Pardosa pseudoannulata. (United States)

    Wang, Juan; Peng, Yuan-De; He, Chao; Wei, Bao-Yang; Liang, Yun-Shan; Yang, Hui-Lin; Wang, Zhi; Stanley, David; Song, Qi-Sheng


    The impact of Bacillus thuringiensis (Bt) toxin proteins on non-target predatory arthropods is not well understood at the cellular and molecular levels. Here, we investigated the potential effects of Cry1Ab expressing rice on fecundity of the wolf spider, Pardosa pseudoannulata, and some of the underlying molecular mechanisms. The results indicated that brown planthoppers (BPHs) reared on Cry1Ab-expressing rice accumulated the Cry toxin and that reproductive parameters (pre-oviposition period, post-oviposition stage, number of eggs, and egg hatching rate) of the spiders that consumed BPHs reared on Bt rice were not different from those that consumed BPHs reared on the non-Bt control rice. The accumulated Cry1Ab did not influence several vitellin (Vt) parameters, including stored energy and amino acid composition, during one generation. We considered the possibility that the Cry toxins exert their influence on beneficial predators via more subtle effects detectable at the molecular level in terms of gene expression. This led us to transcriptome analysis to detect differentially expressed genes in the ovaries of spiders exposed to dietary Cry1Ab and their counterpart control spiders. Eight genes, associated with vitellogenesis, vitellogenin receptor activity, and vitellin membrane formation were not differentially expressed between ovaries from the treated and control spiders, confirmed by qPCR analysis. We infer that dietary Cry1Ab expressing rice does not influence fecundity, nor expression levels of Vt-associated genes in P. pseudoannulata. PMID:27452121

  4. Flee or fight: ontogenetic changes in the behavior of cobweb spiders in encounters with spider-hunting wasps. (United States)

    Uma, Divya B; Weiss, Martha R


    An animal's body size plays a predominant role in shaping its interspecific interactions, and, in encounters between two predators, often determines which shall be predator and which shall be prey. Spiders are top predators of insects, yet can fall prey to mud-dauber wasps that provision their larval nests with paralyzed spiders. Here we examined predator-prey interactions between Chalybion californicum (Saussure) (Sphecidae), a mud-dauber wasp, and Parasteatoda tepidariorum C. L. Koch (Theridiidae), a cobweb spider. We examined whether a spider's size influences its response to an attacking wasp, and report a size-dependent change in spider behavior: small-sized spiders fled, whereas medium- and large-sized spiders fought in response to wasp attacks. From the wasps' perspective, we examined whether spider size influences a wasp's hunting behavior and capture success. We found that wasps commonly approached small spiders, but were much less likely to approach medium and large spiders. However, wasp capture success did not vary with spider size. We also report a strategy used by Chalybion wasps toward cobweb spiders that is consistent with an interpretation of aggressive mimicry.

  5. Remembering the object you fear: brain potentials during recognition of spiders in spider-fearful individuals.

    Directory of Open Access Journals (Sweden)

    Jaroslaw M Michalowski

    Full Text Available In the present study we investigated long-term memory for unpleasant, neutral and spider pictures in 15 spider-fearful and 15 non-fearful control individuals using behavioral and electrophysiological measures. During the initial (incidental encoding, pictures were passively viewed in three separate blocks and were subsequently rated for valence and arousal. A recognition memory task was performed one week later in which old and new unpleasant, neutral and spider pictures were presented. Replicating previous results, we found enhanced memory performance and higher confidence ratings for unpleasant when compared to neutral materials in both animal fearful individuals and controls. When compared to controls high animal fearful individuals also showed a tendency towards better memory accuracy and significantly higher confidence during recognition of spider pictures, suggesting that memory of objects prompting specific fear is also facilitated in fearful individuals. In line, spider-fearful but not control participants responded with larger ERP positivity for correctly recognized old when compared to correctly rejected new spider pictures, thus showing the same effects in the neural signature of emotional memory for feared objects that were already discovered for other emotional materials. The increased fear memory for phobic materials observed in the present study in spider-fearful individuals might result in an enhanced fear response and reinforce negative beliefs aggravating anxiety symptomatology and hindering recovery.

  6. Remembering the object you fear: brain potentials during recognition of spiders in spider-fearful individuals. (United States)

    Michalowski, Jaroslaw M; Weymar, Mathias; Hamm, Alfons O


    In the present study we investigated long-term memory for unpleasant, neutral and spider pictures in 15 spider-fearful and 15 non-fearful control individuals using behavioral and electrophysiological measures. During the initial (incidental) encoding, pictures were passively viewed in three separate blocks and were subsequently rated for valence and arousal. A recognition memory task was performed one week later in which old and new unpleasant, neutral and spider pictures were presented. Replicating previous results, we found enhanced memory performance and higher confidence ratings for unpleasant when compared to neutral materials in both animal fearful individuals and controls. When compared to controls high animal fearful individuals also showed a tendency towards better memory accuracy and significantly higher confidence during recognition of spider pictures, suggesting that memory of objects prompting specific fear is also facilitated in fearful individuals. In line, spider-fearful but not control participants responded with larger ERP positivity for correctly recognized old when compared to correctly rejected new spider pictures, thus showing the same effects in the neural signature of emotional memory for feared objects that were already discovered for other emotional materials. The increased fear memory for phobic materials observed in the present study in spider-fearful individuals might result in an enhanced fear response and reinforce negative beliefs aggravating anxiety symptomatology and hindering recovery.

  7. Fish predation by semi-aquatic spiders: a global pattern. (United States)

    Nyffeler, Martin; Pusey, Bradley J


    More than 80 incidences of fish predation by semi-aquatic spiders--observed at the fringes of shallow freshwater streams, rivers, lakes, ponds, swamps, and fens--are reviewed. We provide evidence that fish predation by semi-aquatic spiders is geographically widespread, occurring on all continents except Antarctica. Fish predation by spiders appears to be more common in warmer areas between 40° S and 40° N. The fish captured by spiders, usually ranging from 2-6 cm in length, are among the most common fish taxa occurring in their respective geographic area (e.g., mosquitofish [Gambusia spp.] in the southeastern USA, fish of the order Characiformes in the Neotropics, killifish [Aphyosemion spp.] in Central and West Africa, as well as Australian native fish of the genera Galaxias, Melanotaenia, and Pseudomugil). Naturally occurring fish predation has been witnessed in more than a dozen spider species from the superfamily Lycosoidea (families Pisauridae, Trechaleidae, and Lycosidae), in two species of the superfamily Ctenoidea (family Ctenidae), and in one species of the superfamily Corinnoidea (family Liocranidae). The majority of reports on fish predation by spiders referred to pisaurid spiders of the genera Dolomedes and Nilus (>75% of observed incidences). There is laboratory evidence that spiders from several more families (e.g., the water spider Argyroneta aquatica [Cybaeidae], the intertidal spider Desis marina [Desidae], and the 'swimming' huntsman spider Heteropoda natans [Sparassidae]) predate fish as well. Our finding of such a large diversity of spider families being engaged in fish predation is novel. Semi-aquatic spiders captured fish whose body length exceeded the spiders' body length (the captured fish being, on average, 2.2 times as long as the spiders). Evidence suggests that fish prey might be an occasional prey item of substantial nutritional importance. PMID:24940885

  8. Irradiated brown dwarfs

    CERN Document Server

    Casewell, S L; Lawrie, K A; Maxted, P F L; Dobbie, P D; Napiwotzki, R


    We have observed the post common envelope binary WD0137-349 in the near infrared $J$, $H$ and $K$ bands and have determined that the photometry varies on the system period (116 min). The amplitude of the variability increases with increasing wavelength, indicating that the brown dwarf in the system is likely being irradiated by its 16500 K white dwarf companion. The effect of the (primarily) UV irradiation on the brown dwarf atmosphere is unknown, but it is possible that stratospheric hazes are formed. It is also possible that the brown dwarf (an L-T transition object) itself is variable due to patchy cloud cover. Both these scenarios are discussed, and suggestions for further study are made.

  9. The Language of Revolution and the Power of Storytelling in The Pregnant Widow


    Alaa Alghamdi


    Martin Amis uses the language of revolution to describe the newly altered social circumstances at the height of the sexual revolution in his semi-autobiographical novel The Pregnant Widow. The concept of a ‘language of revolution’ as well as second- and third-wave feminist scholarship is applied to a textual analysis of the novel. Amis’s brand of satire creates a sense of displacement and challenges existing perceptions about gender, culture and sexuality, exposing them as constructed and cha...

  10. Ecopsychosocial Aspects of Human–Tiger Conflict: An Ethnographic Study of Tiger Widows of Sundarban Delta, India (United States)

    Chowdhury, Arabinda N.; Mondal, Ranajit; Brahma, Arabinda; Biswas, Mrinal K.


    AIMS Human–tiger conflict (HTC) is a serious public health issue in Sundarban Reserve Forest, India. HTC is a continued concern for the significant mortality and morbidity of both human and tiger population. This is the first comprehensive report on Sundarban tiger–human conflicts and its impact on widows whose husbands were killed by tigers. The study attempts to explore the situation analysis of HTC and the aftermath of the incident including bereavement and coping, the cultural stigma related to being killed by a tiger and the consequent discrimination, deprivation, and social rejection, and the impact on the mental health of the tiger-widows. METHODS This is a three-phase ethnographic research with a mix of quantitative and qualitative methods. In the first phase, a door-to-door village survey (3,084 households) was carried out in two villages of Sundarban, which are adjacent to the Reserve Forest, in which the incidents of human–animal conflicts and the 65 tiger-widows identified were documented. In the second phase, the 65 tiger-widows were studied to explore the ecodemography of tiger attacks and tiger-widows alongside the stigma issue by using a stigma questionnaire (n = 49). The stigma burden was compared with normal widows (n = 21) and snake-bite widows (n = 18). In the third phase, the psychosocial and cultural dimensions related to tiger attacks were studied by using in-depth interviews (IDI) of the tiger-widows, focus-group discussions (FGD), and participatory mapping in the community. Clinical examinations of the mental health of the widows were also carried out in this phase. RESULTS The mean age of the 65 widows was 43.49 ± 9.58 years. Of this, 12.3% of the widows had remarried and only 4.6% of the widows were literate. In all, 67.2% of all tiger attacks occurred as a result of illegal forest entry. The main livelihood of the former husbands of the widows were 43.8% wood cutting, 28.1% fishing, 10.9% crab catching, 9.4% tiger prawn seed

  11. Spider web-inspired acoustic metamaterials (United States)

    Miniaci, Marco; Krushynska, Anastasiia; Movchan, Alexander B.; Bosia, Federico; Pugno, Nicola M.


    Spider silk is a remarkable example of bio-material with superior mechanical characteristics. Its multilevel structural organization of dragline and viscid silk leads to unusual and tunable properties, extensively studied from a quasi-static point of view. In this study, inspired by the Nephila spider orb web architecture, we propose a design for mechanical metamaterials based on its periodic repetition. We demonstrate that spider-web metamaterial structure plays an important role in the dynamic response and wave attenuation mechanisms. The capability of the resulting structure to inhibit elastic wave propagation in sub-wavelength frequency ranges is assessed, and parametric studies are performed to derive optimal configurations and constituent mechanical properties. The results show promise for the design of innovative lightweight structures for tunable vibration damping and impact protection, or the protection of large scale infrastructure such as suspended bridges.

  12. Edge effect on weevils and spiders

    Directory of Open Access Journals (Sweden)

    R. Horváth


    Full Text Available The edge effect on weevils and spiders was tested along oak forest – meadow transects using sweep-net samples at the Síkfökút Project in Hungary. For spiders the species richness was significantly higher in the forest edge than either in the meadow or the forest interior. For weevils the species richness of the forest edge was higher than that of the meadow, but the difference was not statistically significant whereas the species richness of the forest interior was significantly lower than that of the forest edge and the meadow. The composition of the spider assemblage of the edge was more similar to the forest, while the composition of weevils in the edge was more similar to the meadow. Our results based on two invertebrate groups operating on different trophic levels suggest that there is a significant edge effect for the studied taxa resulting in higher species richness in the edge.

  13. Disentangling the phylogenetic and ecological components of spider phenotypic variation. (United States)

    Gonçalves-Souza, Thiago; Diniz-Filho, José Alexandre Felizola; Romero, Gustavo Quevedo


    An understanding of how the degree of phylogenetic relatedness influences the ecological similarity among species is crucial to inferring the mechanisms governing the assembly of communities. We evaluated the relative importance of spider phylogenetic relationships and ecological niche (plant morphological variables) to the variation in spider body size and shape by comparing spiders at different scales: (i) between bromeliads and dicot plants (i.e., habitat scale) and (ii) among bromeliads with distinct architectural features (i.e., microhabitat scale). We partitioned the interspecific variation in body size and shape into phylogenetic (that express trait values as expected by phylogenetic relationships among species) and ecological components (that express trait values independent of phylogenetic relationships). At the habitat scale, bromeliad spiders were larger and flatter than spiders associated with the surrounding dicots. At this scale, plant morphology sorted out close related spiders. Our results showed that spider flatness is phylogenetically clustered at the habitat scale, whereas it is phylogenetically overdispersed at the microhabitat scale, although phylogenic signal is present in both scales. Taken together, these results suggest that whereas at the habitat scale selective colonization affect spider body size and shape, at fine scales both selective colonization and adaptive evolution determine spider body shape. By partitioning the phylogenetic and ecological components of phenotypic variation, we were able to disentangle the evolutionary history of distinct spider traits and show that plant architecture plays a role in the evolution of spider body size and shape. We also discussed the relevance in considering multiple scales when studying phylogenetic community structure.

  14. Checklist of spider fauna of FR Peshawar, FATA, Pakistan

    Directory of Open Access Journals (Sweden)

    F. Perveen


    Full Text Available The spiders are known as poisonous arthropods, but they also act as the predator or biological pests control agent. Their 23 species belonging to 15 genera and 09 families were reported during 2009-2010 from FR Peshawar, FATA, Pakistan. The reported families Clubionidae, Scytodidae and Sprassidae covered each 4%, Araneidae, Gnaphosidae, Pholicidae and Salticidae each 9%, Thomisidae 13% and Lycosidae 43% biodiversity of spiders of FATA. However, the largest spider collected was huntsman, Isopoda tuhodnigra (Barrion with total body length 15.80+-0.83 mm. Moreover, the smallest spider was wolf spider, Pardosa birmanica (Simon with total body length 4.20+-1.30 mm. Further, the crab spiders, Thomisus pugilis (Stoliczka, T. spectabilis (Doleschall and Diaea evanida (Thorell were the most colorful species belonging to family Thomisidae. A detail study is required for further exploration of spider fauna of FATA.

  15. Cooperative effects enhance the transport properties of molecular spider teams

    CERN Document Server

    Rank, Matthias; Frey, Erwin


    Molecular spiders are synthetic molecular motors based on DNA nanotechnology. While natural molecular motors have evolved towards very high efficiency, it remains a major challenge to develop efficient designs for man-made molecular motors. Inspired by biological motor proteins like kinesin and myosin, molecular spiders comprise a body and several legs. The legs walk on a lattice that is coated with substrate which can be cleaved catalytically. We propose a novel molecular spider design in which n spiders form a team. Our theoretical considerations show that coupling several spiders together alters the dynamics of the resulting team significantly. Although spiders operate at a scale where diffusion is dominant, spider teams can be tuned to behave nearly ballistic, which results in fast and predictable motion. Based on the separation of time scales of substrate and product dwell times, we develop a theory which utilises equivalence classes to coarse-grain the micro-state space. In addition, we calculate diffus...

  16. Tangled in a sparse spider web

    DEFF Research Database (Denmark)

    Dimitrov, Dimitar Stefanov; Lopardo, Lara; Giribet, Gonzalo;


    In order to study the tempo and the mode of spider orb web evolution and diversification, we conducted a phylogenetic analysis using six genetic markers along with a comprehensive taxon sample. The present analyses are the first to recover the monophyly of orb-weaving spiders based solely on DNA...... orb-weaving families and web designs were already present. The processes that may have given origin to this diversification of lineages and web architectures are discussed. A combination of biotic factors, such as key innovations in web design and silk composition, as well as abiotic environmental...

  17. Assessing and managing spider and scorpion envenomation. (United States)

    McGhee, Stephen; Weiner, Aaron; Finnegan, Alan; Visovsky, Constance; Clochesy, John M; Graves, Brian


    Envenomation by spiders or scorpions is a public health problem in many parts of the world and is not isolated to the tropics and subtropics. Spiders and scorpions can be unintentionally transported globally, and keeping them as pets is becoming more popular, so envenomation can occur anywhere. Emergency nurses should be prepared to assess and treat patients who present with a bite or sting. This article gives an overview of the signs, symptoms and treatment of envenomation by species of arachnids that are clinically significant to humans. PMID:26542925

  18. Programming spiders, bots, and aggregators in Java

    CERN Document Server

    Heaton, Jeff


    The content and services available on the web continue to be accessed mostly through direct human control. But this is changing. Increasingly, users rely on automated agents that save them time and effort by programmatically retrieving content, performing complex interactions, and aggregating data from diverse sources. Programming Spiders, Bots, and Aggregators in Java teaches you how to build and deploy a wide variety of these agents-from single-purpose bots to exploratory spiders to aggregators that present a unified view of information from multiple user accounts. You will quickly build on

  19. Assessing and managing spider and scorpion envenomation. (United States)

    McGhee, Stephen; Weiner, Aaron; Finnegan, Alan; Visovsky, Constance; Clochesy, John M; Graves, Brian


    Envenomation by spiders or scorpions is a public health problem in many parts of the world and is not isolated to the tropics and subtropics. Spiders and scorpions can be unintentionally transported globally, and keeping them as pets is becoming more popular, so envenomation can occur anywhere. Emergency nurses should be prepared to assess and treat patients who present with a bite or sting. This article gives an overview of the signs, symptoms and treatment of envenomation by species of arachnids that are clinically significant to humans.

  20. Spider Silk: The Mother Nature's Biological Superlens

    CERN Document Server

    Monks, James N; Wang, Zengbo


    This paper demonstrates a possible new microfiber bio near field lens that uses minor ampullate spider silk,spun from the Nephila edulis spider, to create a real time image of a surface using near field optical techniques. The microfiber bio lens is the world's first natural superlens created by exploring biological materials. The resolution of the surface image overcomes the diffraction limit, with the ability to resolve patterns at 100 nm under a standard white light source in reflection mode. This resolution offers further developments in superlens technology and paves the way for new bio optics.

  1. Wayanad widows: A study of sustainable rural economic development using renewable energy technology for micro enterprise in Kerala, India (United States)

    Voorhees, Maire Claire

    This thesis examines the situation of the farmer widows of Wayanad, Kerala through exploration of the underlying agricultural and economic issues leading to farmers' suicides, the current state of the environment in the Wayanad District of Kerala, India, and an economic model of micro-entrepreneurship to address economic and social issues of the surviving widows. Quantitative and qualitative research methods were performed through the assessment and document analysis of archive, newspaper, and published reports to gain a macro perspective. The Environmental Vulnerability Index was used as a tool to evaluate and organize findings of the current environmental conditions in the region. This thesis supports the sustainability concept of considering the economic, ecological, and social impacts when identifying economic development pathways. The goal was to explore the appropriateness of small household solar systems as vehicle in the micro-enterprise model to be a sustainable alternative economic pathway to agriculture for the farmer widows of Wayanad.

  2. Fucoidans from brown seaweeds

    DEFF Research Database (Denmark)

    Ale, Marcel Tutor; Meyer, Anne S.


    Fucoidan or fucoidans cover a family of sulfated fucose-rich polysaccharides, built of a backbone of L-fucose units, and characteristically found in brown seaweeds. Fucoidans have potential therapeutic properties, including anti-inflammatory and anti-coagulant activities, as well as anti...

  3. The psychosocial effects of "La Violencia" on widows of El Quiche, Guatemala. (United States)

    Zur, J


    In Guatemala, government-sponsored terrorism directed at Mayan villagers resulted in at least 122,000 deaths and 18,000 "disappearances" during the period 1975-85. Even today, "low intensity warfare" in the form of random acts of terrorism continue. Thus, in the past 20 years, 120,000 women have been widowed, 11,000 in the province of El Quiche alone. This violence extended to threats of death directed toward women who joined a human rights organization, to the rape of women by their husbands' murderers and the further murder or kidnapping of their relatives. Groups of women were split between widows and married women, and women had to recreate their roles in society. The resulting reformation of family life led to an irretrievably altered relationship with the past. Survivors had to cope with pervasive fear, with a new understanding of their vulnerability, and with an inability to fulfill their obligations towards the dead who were buried in clandestine graves. The women who coped the best were those who learned to comprehend the violence in political terms through participation in human rights and women's groups and those who lived in villages where the dead were exhumed and properly buried. The psychological pain suffered by the women often manifested itself in physical ways and added to the suffering they realized from overwork and poor nutrition.

  4. Widowers' accounts of maternal mortality among women of low socioeconomic status in Nigeria. (United States)

    Nwokocha, Ezebunwa Ethelbert


    The research is based on information collected on 50 deceased Nigerian women of low socioeconomic status in different locations of the country including Lagos, Ibadan, Kaduna, Zaria, Minna, Enugu, and Port-Harcourt among others. They had some common characteristics such as low levels of education, involvement in petty trading and were clients of a microfinance bank as small loan receivers. Primary data were generated mainly through verbal autopsy with widowers employing in-depth interviews and key informant interviews. In addition, unobtrusive observation was carried out in these locations to ascertain in some instances the distance between the deceased homes and health facilities patronised by the women. Secondary data were specific to death certificates of the deceased supplied by the widowers. Both ethnographic summaries and content analysis were employed in data analysis to account for contextual differences, especially in a multicultural society like Nigeria. The findings implicated several issues that are taken for granted at the micro-family and macro-society levels. It specifically revealed that small loans alone are not sufficient to empower poor women to make meaningful contributions to their own reproductive health in a patriarchal society like Nigeria. Results also indicated that cultural differences as well as rural-urban dichotomy were not proximate determinants of maternal behaviour; the latter rather finds expression in low socioeconomic status. Consequently, policy relevant recommendations that could contribute to significant maternal mortality reduction were proffered. PMID:23437504

  5. [The social relegation of widows living with HIV in the time of ART in Senegal]. (United States)

    Desclaux, A; Boye, S; Taverne, B


    While prolonged widowhood is unusual in Senegalese society, some women living with HIV receiving antiretroviral therapy for ten years remained widows. Are they maintained in this situation for refusing or being unable to remarry? To understand the conditions and the reasons for this lack of "matrimonial normalization", a qualitative interview study was conducted in Dakar with 31 widows. Their living conditions are mostly marked by economic difficulties, dependence on host families, and responsibilities visà-vis their children. They refuse to remarry, regret not being able to, or wish to without success, despite the existence locally of social forms of marital union that would respond to their situation. The refusal to disclose their HIV status combined with self-stigma prevent them from improving their condition. This form of social vulnerability that remains beyond the restoration of health is ignored by public policy and HIV/AIDS community based organizations claims. It should be acknowledged and considered for defending PLWAs' rights. PMID:24563114

  6. Widowers' accounts of maternal mortality among women of low socioeconomic status in Nigeria. (United States)

    Nwokocha, Ezebunwa Ethelbert


    The research is based on information collected on 50 deceased Nigerian women of low socioeconomic status in different locations of the country including Lagos, Ibadan, Kaduna, Zaria, Minna, Enugu, and Port-Harcourt among others. They had some common characteristics such as low levels of education, involvement in petty trading and were clients of a microfinance bank as small loan receivers. Primary data were generated mainly through verbal autopsy with widowers employing in-depth interviews and key informant interviews. In addition, unobtrusive observation was carried out in these locations to ascertain in some instances the distance between the deceased homes and health facilities patronised by the women. Secondary data were specific to death certificates of the deceased supplied by the widowers. Both ethnographic summaries and content analysis were employed in data analysis to account for contextual differences, especially in a multicultural society like Nigeria. The findings implicated several issues that are taken for granted at the micro-family and macro-society levels. It specifically revealed that small loans alone are not sufficient to empower poor women to make meaningful contributions to their own reproductive health in a patriarchal society like Nigeria. Results also indicated that cultural differences as well as rural-urban dichotomy were not proximate determinants of maternal behaviour; the latter rather finds expression in low socioeconomic status. Consequently, policy relevant recommendations that could contribute to significant maternal mortality reduction were proffered.

  7. Living Arrangements of Widowed Elderly Women and their Differentials: A Study in an Urban Setting of Tamil Nadu, India

    Directory of Open Access Journals (Sweden)

    Neelu Singh


    Full Text Available Living arrangements in the twilight of life is a matter of primary concern for elderly widowedwomen. In view of this, an attempt is made to examine the effect of backgroundcharacteristics on the living arrangements of the widowed elderly women making use of thedata collected from 330 elderly widowed women from Coimbatore city, Tamil Nadu withfrequency and cross-tabular analyses as well as chi-square test of significance. The studyfound that slightly less than three-tenths of widowed women are „old-old‟ (75+ years. Onthe other hand, three-fifths of elderly belonged to most backward / backward caste andmajority (63% of them illiterates. About two-fifths (42% of the elderly widowed women areliving with married son. The differentials of elderly living alone vs with children are mostlyin expected direction and highly significant (p<0.001 with an increase in the number ofearning members in the family, number of children living in the same area / city as well asthose who belonged to the households of high standard of living. On the other hand, thepercentage of widowed elderly who live alone has shown a clear increasing pattern with anincrease in occupational status and instrumental activities of daily living scale. Further, it isnoticed that the elderly who are living alone is higher among those who are feeling„unhealthy‟ as compared to those elderly widowed women as „healthy‟. All these percentagedifferentials are also turned out as significant at different levels of extent (p<0.001 or p<0.05.Based on these findings a few policy implications have been postulated.


    Directory of Open Access Journals (Sweden)

    Bülent KARA


    Full Text Available In respect to social state principle, the 61’ st article of the Constitution is allocated for disadvantaged people. Because of special situations of Turkey, social rights of the casualties, the orphans and the widows, the handicapped and the veterans were determined and organized in this article. The main aim of this study is to evaluate the laws, policies and problems of the casualties, the orphans and the widows, the handicapped and the veterans who were preserved by the Constitution and some laws.

  9. Silk Spinning in Silkworms and Spiders. (United States)

    Andersson, Marlene; Johansson, Jan; Rising, Anna


    Spiders and silkworms spin silks that outcompete the toughness of all natural and manmade fibers. Herein, we compare and contrast the spinning of silk in silkworms and spiders, with the aim of identifying features that are important for fiber formation. Although spiders and silkworms are very distantly related, some features of spinning silk seem to be universal. Both spiders and silkworms produce large silk proteins that are highly repetitive and extremely soluble at high pH, likely due to the globular terminal domains that flank an intermediate repetitive region. The silk proteins are produced and stored at a very high concentration in glands, and then transported along a narrowing tube in which they change conformation in response primarily to a pH gradient generated by carbonic anhydrase and proton pumps, as well as to ions and shear forces. The silk proteins thereby convert from random coil and alpha helical soluble conformations to beta sheet fibers. We suggest that factors that need to be optimized for successful production of artificial silk proteins capable of forming tough fibers include protein solubility, pH sensitivity, and preservation of natively folded proteins throughout the purification and initial spinning processes.

  10. The aerodynamic signature of running spiders.

    Directory of Open Access Journals (Sweden)

    Jérôme Casas

    Full Text Available Many predators display two foraging modes, an ambush strategy and a cruising mode. These foraging strategies have been classically studied in energetic, biomechanical and ecological terms, without considering the role of signals produced by predators and perceived by prey. Wolf spiders are a typical example; they hunt in leaf litter either using an ambush strategy or by moving at high speed, taking over unwary prey. Air flow upstream of running spiders is a source of information for escaping prey, such as crickets and cockroaches. However, air displacement by running arthropods has not been previously examined. Here we show, using digital particle image velocimetry, that running spiders are highly conspicuous aerodynamically, due to substantial air displacement detectable up to several centimetres in front of them. This study explains the bimodal distribution of spider's foraging modes in terms of sensory ecology and is consistent with the escape distances and speeds of cricket prey. These findings may be relevant to the large and diverse array of arthropod prey-predator interactions in leaf litter.

  11. Spiders (Araneae. Chapter 7.3

    Directory of Open Access Journals (Sweden)

    Wolfgang Nentwig


    Full Text Available A total of 47 spider species are alien to Europe; this corresponds to 1.3 % of the native spider fauna. They belong to (in order of decreasing abundance Theridiidae (10 species, Pholcidae (7 species, Sparassidae, Salticidae, Linyphiidae, Oonopidae (4-5 species each and 11 further families. There is a remarkable increase of new records in the last years and the arrival of one new species for Europe per year has been predicted for the next decades. One third of alien spiders have an Asian origin, one fifth comes from North America and Africa each. 45 % of species may originate from temperate habitats and 55 % from tropical habitats. In the past banana or other fruit shipments were an important pathway of introduction; today potted plants and probably container shipments in general are more important. Most alien spiders established in and around human buildings, only few species established in natural sites. No environmental impact of alien species is known so far, but some alien species are theoretically dangerous to humans.

  12. Spiders Tune Glue Viscosity to Maximize Adhesion. (United States)

    Amarpuri, Gaurav; Zhang, Ci; Diaz, Candido; Opell, Brent D; Blackledge, Todd A; Dhinojwala, Ali


    Adhesion in humid conditions is a fundamental challenge to both natural and synthetic adhesives. Yet, glue from most spider species becomes stickier as humidity increases. We find the adhesion of spider glue, from five diverse spider species, maximizes at very different humidities that matches their foraging habitats. By using high-speed imaging and spreading power law, we find that the glue viscosity varies over 5 orders of magnitude with humidity for each species, yet the viscosity at maximal adhesion for each species is nearly identical, 10(5)-10(6) cP. Many natural systems take advantage of viscosity to improve functional response, but spider glue's humidity responsiveness is a novel adaptation that makes the glue stickiest in each species' preferred habitat. This tuning is achieved by a combination of proteins and hygroscopic organic salts that determines water uptake in the glue. We therefore anticipate that manipulation of polymer-salts interaction to control viscosity can provide a simple mechanism to design humidity responsive smart adhesives.

  13. Does Government subsidy for costs of medical and pharmaceutical services result in higher service utilization by older widowed women in Australia?

    Directory of Open Access Journals (Sweden)

    Tooth Leigh R


    Full Text Available Abstract Background In Australia, Medicare, the national health insurance system which includes the Medical Benefits Scheme (MBS and Pharmaceutical Benefits Scheme (PBS, provides partial coverage for most medical services and pharmaceuticals. For war widows, the Department of Veterans’ Affairs (DVA covers almost the entire cost of their health care. The objective of this study was to test whether war widows have higher usage of medical services and pharmaceuticals. Methods Data were from 730 women aged 70–84 years (mostly World War II widows participating in the Australian Longitudinal Study on Women’s Health who consented to data linkage to Medicare Australia. The main outcome measures were PBS costs, claims, co-payments and scripts presented, and MBS total costs, claims and gap payments for medical services in 2005. Results There was no difference between the war widows and similarly aged widows in the Australian population without DVA support on use of medical services. While war widows had more pharmaceutical prescriptions filled they generated equivalent total costs, number of claims and co-payments for pharmaceuticals than widows without DVA support. Conclusions Older war widows are not using more medical services and pharmaceuticals than other older Australian women despite having financial incentives to do so.

  14. A novel neurotoxin from venom of the spider, Brachypelma albopilosum. (United States)

    Zhong, Yunhua; Song, Bo; Mo, Guoxiang; Yuan, Mingwei; Li, Hongli; Wang, Ping; Yuan, Minglong; Lu, Qiumin


    Spiders have evolved highly selective toxins for insects. There are many insecticidal neurotoxins in spider venoms. Although a large amount of work has been done to focus on neurotoxicity of spider components, little information, which is related with effects of spider toxins on tumor cell proliferation and cytotoxicity, is available for Brachypelma albopilosum venom. In this work, a novel spider neurotoxin (brachyin) was identified and characterized from venoms of the spider, Brachypelma albopilosum. Brachyin is composed of 41 amino acid residues with the sequence of CLGENVPCDKDRPNCCSRYECLEPTGYGWWYASYYCYKKRS. There are six cysteines in this sequence, which form three disulfided bridges. The serine residue at the C-terminus is amidated. Brachyin showed strong lethal effects on American cockroaches (Periplaneta americana) and Tenebrio molitor (common mealbeetle). This neurotoxin also showed significant analgesic effects in mice models including abdominal writhing induced by acetic acid and formalin-induced paw licking tests. It was interesting that brachyin exerted marked inhibition on tumor cell proliferation.

  15. A novel neurotoxin from venom of the spider, Brachypelma albopilosum.

    Directory of Open Access Journals (Sweden)

    Yunhua Zhong

    Full Text Available Spiders have evolved highly selective toxins for insects. There are many insecticidal neurotoxins in spider venoms. Although a large amount of work has been done to focus on neurotoxicity of spider components, little information, which is related with effects of spider toxins on tumor cell proliferation and cytotoxicity, is available for Brachypelma albopilosum venom. In this work, a novel spider neurotoxin (brachyin was identified and characterized from venoms of the spider, Brachypelma albopilosum. Brachyin is composed of 41 amino acid residues with the sequence of CLGENVPCDKDRPNCCSRYECLEPTGYGWWYASYYCYKKRS. There are six cysteines in this sequence, which form three disulfided bridges. The serine residue at the C-terminus is amidated. Brachyin showed strong lethal effects on American cockroaches (Periplaneta americana and Tenebrio molitor (common mealbeetle. This neurotoxin also showed significant analgesic effects in mice models including abdominal writhing induced by acetic acid and formalin-induced paw licking tests. It was interesting that brachyin exerted marked inhibition on tumor cell proliferation.

  16. A novel neurotoxin from venom of the spider, Brachypelma albopilosum. (United States)

    Zhong, Yunhua; Song, Bo; Mo, Guoxiang; Yuan, Mingwei; Li, Hongli; Wang, Ping; Yuan, Minglong; Lu, Qiumin


    Spiders have evolved highly selective toxins for insects. There are many insecticidal neurotoxins in spider venoms. Although a large amount of work has been done to focus on neurotoxicity of spider components, little information, which is related with effects of spider toxins on tumor cell proliferation and cytotoxicity, is available for Brachypelma albopilosum venom. In this work, a novel spider neurotoxin (brachyin) was identified and characterized from venoms of the spider, Brachypelma albopilosum. Brachyin is composed of 41 amino acid residues with the sequence of CLGENVPCDKDRPNCCSRYECLEPTGYGWWYASYYCYKKRS. There are six cysteines in this sequence, which form three disulfided bridges. The serine residue at the C-terminus is amidated. Brachyin showed strong lethal effects on American cockroaches (Periplaneta americana) and Tenebrio molitor (common mealbeetle). This neurotoxin also showed significant analgesic effects in mice models including abdominal writhing induced by acetic acid and formalin-induced paw licking tests. It was interesting that brachyin exerted marked inhibition on tumor cell proliferation. PMID:25329070

  17. 'People insult her as a sexy woman': sexuality, stigma and vulnerability among widowed and divorced women in Oromiya, Ethiopia. (United States)

    Newton-Levinson, Anna; Winskell, Kate; Abdela, Berissa; Rubardt, Marcie; Stephenson, Rob


    Widowed and divorced women, sometimes referred to as 'female heads of household', are one of the most impoverished and marginalised groups in the world. Widowed and divorced women are often overlooked in the literature or are seen primarily as economically or socially marginalised beings; their sexuality is rarely addressed. In an effort to understand the experiences and challenges faced by such women, we conducted and analysed four focus-group discussions, seven in-depth interviews and four interactive activities with 32 widowed and divorced women and with 25 other community members in Oromiya, Ethiopia. Findings indicate that women experienced high levels of community stigma in relation to their sexuality. Participants' fear of community stigma, and the actions they took to avert it, further served to marginalise them within their community and had negative impact on their economic, social and health support systems and, ultimately, on their overall well-being. Future interventions need to acknowledge sexual stigma as a driving force in the many challenges these women face. Further programmatic work is needed to reduce stigma related to widowed and divorced women's sexuality and to decrease their vulnerability to rape. PMID:24945470

  18. The Language of Revolution and the Power of Storytelling in The Pregnant Widow

    Directory of Open Access Journals (Sweden)

    Alaa Alghamdi


    Full Text Available Martin Amis uses the language of revolution to describe the newly altered social circumstances at the height of the sexual revolution in his semi-autobiographical novel The Pregnant Widow. The concept of a ‘language of revolution’ as well as second- and third-wave feminist scholarship is applied to a textual analysis of the novel. Amis’s brand of satire creates a sense of displacement and challenges existing perceptions about gender, culture and sexuality, exposing them as constructed and changeable norms. Moreover, it becomes clear that the author is skeptical about the benefits of the sexual revolution for either gender, and that he views its liberating aspects as unfulfilled, particularly for women. Given that Amis names one of his characters Scheherazade, evoking the legendary heroine of The Arabian Nights, the importance of storytelling in the novel is also examined and found to be a potentially redeeming force. Keywords: Martin Amis, sexual revolution, feminism, satire, gender, revolution

  19. Filling in the helper-gap: the intentions of frail older widows. (United States)

    Porter, Eileen J; Ganong, Lawrence H


    Despite marked interest in continuity of care and transitions experienced by older persons, there is little information available about the intentions of older women regarding changes that occur in their support networks. This article reports the findings of a descriptive phenomenological study of older widows' experience of home care and describes the experiences of 10 women who lost a key helper during the 3-year study. Compared with theories of continuity of care or transition, the findings are in keeping with the focus of nonequilibrium systems theory: bringing order out of disorder. Findings imply the need for holistic nursing interventions with older women who hope to continue living alone for as long as possible.

  20. Reconstructing web evolution and spider diversification in the molecular era. (United States)

    Blackledge, Todd A; Scharff, Nikolaj; Coddington, Jonathan A; Szüts, Tamas; Wenzel, John W; Hayashi, Cheryl Y; Agnarsson, Ingi


    The evolutionary diversification of spiders is attributed to spectacular innovations in silk. Spiders are unique in synthesizing many different kinds of silk, and using silk for a variety of ecological functions throughout their lives, particularly to make prey-catching webs. Here, we construct a broad higher-level phylogeny of spiders combining molecular data with traditional morphological and behavioral characters. We use this phylogeny to test the hypothesis that the spider orb web evolved only once. We then examine spider diversification in relation to different web architectures and silk use. We find strong support for a single origin of orb webs, implying a major shift in the spinning of capture silk and repeated loss or transformation of orb webs. We show that abandonment of costly cribellate capture silk correlates with the 2 major diversification events in spiders (1). Replacement of cribellate silk by aqueous silk glue may explain the greater diversity of modern orb-weaving spiders (Araneoidea) compared with cribellate orb-weaving spiders (Deinopoidea) (2). Within the "RTA clade," which is the sister group to orb-weaving spiders and contains half of all spider diversity, >90% of species richness is associated with repeated loss of cribellate silk and abandonment of prey capture webs. Accompanying cribellum loss in both groups is a release from substrate-constrained webs, whether by aerially suspended webs, or by abandoning webs altogether. These behavioral shifts in silk and web production by spiders thus likely played a key role in the dramatic evolutionary success and ecological dominance of spiders as predators of insects.

  1. Silk elasticity as a potential constraint on spider body size


    Rodríguez-Gironés, Miguel A; Corcobado, Guadalupe; Moya-Laraño, Jordi


    Abstract Silk is known for its strength and extensibility and has played a key role in the radiation of spiders. Individual spiders use different glands to produce silk types with unique sets of proteins. Most research has studied the properties of major ampullate and capture spiral silks and their ecological implications, while little is known about minor ampullate silk, the type used by those spider species studied to date for bridging displacements. A biomechanical model paramet...

  2. Transgenic Cry1Ab rice does not impact ecological fitness and predation of a generalist spider.

    Directory of Open Access Journals (Sweden)

    Jun-Ce Tian

    Full Text Available BACKGROUND: The commercial release of rice genetically engineered to express a Cry1Ab protein from Bacillus thuringiensis (Bt for control of Lepidoptera in China is a subject of debate. One major point of the debate has focused on the ecological safety of Bt rice on nontarget organisms, especially predators and parasitoids that help control populations of insect pests. METHODOLOGY/PRINCIPAL FINDINGS: A tritrophic bioassay was conducted to evaluate the potential impact of Cry1Ab-expressing rice on fitness parameters of a predaceous ground spider (Pardosa pseudoannulata (Bösenberg et Strand that had fed on Bt rice-fed brown planthopper (Nilaparvata lugens (Stål nymphs. Survival, development time and fecundity of this spider were not different when they were fed with Bt rice-fed or non-Bt rice-fed prey. Furthermore, ELISA and PCR gut assays, as well as a functional response trial, indicated that predation by P. pseudoannulata was not significantly different in Bt rice or non-Bt rice fields. CONCLUSIONS/SIGNIFICANCE: The transgenic Cry1Ab rice lines tested in this study had no adverse effects on the survival, developmental time and fecundity of P. pseudoannulata in the laboratory or on predation under field conditions. This suggests that this important predator would not be harmed if transgenic Cry1Ab rice were commercialized.

  3. Sublethal responses of wolf spiders (Lycosidae) to organophosphorous insecticides. (United States)

    Van Erp, S; Booth, L; Gooneratne, R; O'Halloran, K


    The activities of cholinesterase (ChE) and glutathione S-transferase (GST) enzymes were assessed in the wolf spider (Lycosa hilaris) as biomarkers of organophosphate contamination in agricultural ecosystems. Spiders were exposed to simulated field rates of two commercially available organophosphorous insecticides [Basudin (diazinon) and Lorsban (chlorpyrifos)] under laboratory conditions. In terms of survival, chlorpyrifos and diazinon were more toxic to male than to female wolf spiders, but gender-specific differences in ChE activities were not evident. Cholinesterase activity in male spiders was inhibited to 14% and 61% of control activity by Basudin and Lorsban, respectively. Gluthathione S-transferase activity was not affected by either pesticide. Mortality and biomarker responses in the wolf spider were further investigated following the application of Basudin to pasture. Wolf spiders were deployed into field mesocosms; after 24 h mortality was 40%, and surviving spiders displayed significant inhibition of ChE activity (87%) compared with controls. Cholinesterase activity in spiders exposed for subsequent 24- or 48-h time periods was monitored until it returned to control levels 8 days post-application. Inhibition of ChE activity after a single application of Basudin indicate the potential use of this enzyme in wolf spiders as a biomarker for evaluating organophosphate contamination.

  4. Searching for Brown Dwarf Outflows

    CERN Document Server

    Whelan, E T; Bacciotti, F; Randich, S; Natta, A


    As outflow activity in low mass protostars is strongly connected to ac- cretion it is reasonable to expect accreting brown dwarfs to also be driving out- flows. In the last three years we have searched for brown dwarf outflows using high quality optical spectra obtained with UVES on the VLT and the technique of spectro-astrometry. To date five brown dwarf outflows have been discovered. Here the method is discussed and the results to date outlined.

  5. The Jean Gutierrez spider mite collection

    Directory of Open Access Journals (Sweden)

    Alain Migeon


    Full Text Available The family Tetranychidae (spider mites currently comprises 1,275 species and represents one of the most important agricultural pest families among the Acari with approximately one hundred pest species, ten of which considered major pests. The dataset presented in this document includes all the identified spider mites composing the Jean Gutierrez Collection hosted at the CBGP (Montferrier-sur-Lez, France, gathered from 1963 to 1999 during his career at the Institut de Recherche pour le Développement (IRD. It consists of 5,262 specimens corresponding to 1,564 occurrences (combination species/host plant/date/location of 175 species. Most specimens were collected in Madagascar and other islands of the Western Indian Ocean, New Caledonia and other islands of the South Pacific and Papuasia. The dataset constitutes today the most important one available on Tetranychidae worldwide.

  6. The Jean Gutierrez spider mite collection. (United States)

    Migeon, Alain


    The family Tetranychidae (spider mites) currently comprises 1,275 species and represents one of the most important agricultural pest families among the Acari with approximately one hundred pest species, ten of which considered major pests. The dataset presented in this document includes all the identified spider mites composing the Jean Gutierrez Collection hosted at the CBGP (Montferrier-sur-Lez, France), gathered from 1963 to 1999 during his career at the Institut de Recherche pour le Développement (IRD). It consists of 5,262 specimens corresponding to 1,564 occurrences (combination species/host plant/date/location) of 175 species. Most specimens were collected in Madagascar and other islands of the Western Indian Ocean, New Caledonia and other islands of the South Pacific and Papuasia. The dataset constitutes today the most important one available on Tetranychidae worldwide.

  7. Araneae Sloveniae: a national spider species checklist

    Directory of Open Access Journals (Sweden)

    Rok Kostanjšek


    Full Text Available The research of the spider fauna of Slovenia dates back to the very beginning of binomial nomenclature, and has gone through more and less prolific phases with authors concentrating on taxonomy, faunistics, ecology and zoogeographic reviews. Although the body of published works is remarkable for a small nation, the faunistic data has remained too scattered for a thorough understanding of regional biotic diversity, for comparative and ecological research, and for informed conservation purposes. A national checklist is long overdue. Here, a critical review of all published records in any language is provided. The species list currently comprises 738 species, is published online at under the title Araneae Sloveniae, and will be updated in due course. This tool will fill the void in cataloguing regional spider faunas and will facilitate further araneological research in central and southern Europe.

  8. Spider-Venom Peptides as Bioinsecticides

    Directory of Open Access Journals (Sweden)

    Glenn F. King


    Full Text Available Over 10,000 arthropod species are currently considered to be pest organisms. They are estimated to contribute to the destruction of ~14% of the world’s annual crop production and transmit many pathogens. Presently, arthropod pests of agricultural and health significance are controlled predominantly through the use of chemical insecticides. Unfortunately, the widespread use of these agrochemicals has resulted in genetic selection pressure that has led to the development of insecticide-resistant arthropods, as well as concerns over human health and the environment. Bioinsecticides represent a new generation of insecticides that utilise organisms or their derivatives (e.g., transgenic plants, recombinant baculoviruses, toxin-fusion proteins and peptidomimetics and show promise as environmentally-friendly alternatives to conventional agrochemicals. Spider-venom peptides are now being investigated as potential sources of bioinsecticides. With an estimated 100,000 species, spiders are one of the most successful arthropod predators. Their venom has proven to be a rich source of hyperstable insecticidal mini-proteins that cause insect paralysis or lethality through the modulation of ion channels, receptors and enzymes. Many newly characterized insecticidal spider toxins target novel sites in insects. Here we review the structure and pharmacology of these toxins and discuss the potential of this vast peptide library for the discovery of novel bioinsecticides.

  9. Structure–Activity Relationship Study of Spider Polyamine Toxins as Inhibitors of Ionotropic Glutamate Receptors

    DEFF Research Database (Denmark)

    Xiong, Xiaofeng; Poulsen, Mette H; Hussein, Rama A;


    The spider polyamine toxins Joro spider toxin-3 (JSTX-3) and Nephila polyamine toxins-1 and -8 (NPTX-1 and NPTX-8) are isolated from the venom of the orb-weaver spider Nephila clavata (Joro spider). They share a high degree of structural resemblance, their aromatic head groups being the only...

  10. Tune Your Brown Clustering, Please

    DEFF Research Database (Denmark)

    Derczynski, Leon; Chester, Sean; Bøgh, Kenneth Sejdenfaden


    unexplored. Accordingly, we present information for practitioners on the behaviour of Brown clustering in order to assist hyper-parametre tuning, in the form of a theoretical model of Brown clustering utility. This model is then evaluated empirically in two sequence labelling tasks over two text types. We...

  11. Evidence for competition between carnivorous plants and spiders. (United States)

    Jennings, David E; Krupa, James J; Raffel, Thomas R; Rohr, Jason R


    Several studies have demonstrated that competition between disparate taxa can be important in determining community structure, yet surprisingly, to our knowledge, no quantitative studies have been conducted on competition between carnivorous plants and animals. To examine potential competition between these taxa, we studied dietary and microhabitat overlap between pink sundews (Drosera capillaris) and wolf spiders (Lycosidae) in the field, and conducted a laboratory experiment examining the effects of wolf spiders on sundew fitness. In the field, we found that sundews and spiders had a high dietary overlap with each other and with the available arthropod prey. Associations between sundews and spiders depended on spatial scale: both sundews and spiders were found more frequently in quadrats with more abundant prey, but within quadrats, spiders constructed larger webs and located them further away from sundews as the total sundew trapping area increased, presumably to reduce competition. Spiders also constructed larger webs when fewer prey were available. In the laboratory, our experiment revealed that spiders can significantly reduce sundew fitness. Our findings suggest that members of the plant and animal kingdoms can and do compete. PMID:20462904

  12. Forest floor spiders of woodlots in an agricultural landscape

    NARCIS (Netherlands)

    Mabelis, A.


    An inventory of spiders was made in woodlots, which are situated in an agricultural landscape in the eastern part of the Netherlands. Aim of the study was to test the hypotheses that good dispersers, like spiders, will be distributed randomly over habitat patches and consequently, that there will be

  13. Spider mite control and resistance management: does a genome help?

    NARCIS (Netherlands)

    T. Van Leeuwen; W. Dermauw; M. Grbic; L. Tirry; R. Feyereisen


    The complete genome of the two-spotted spider mite, Tetranychus urticae, has been reported. This is the first sequenced genome of a highly polyphagous and resistant agricultural pest. The question as to what the genome offers the community working on spider mite control is addressed.

  14. Splendid coloration of the peacock spider Maratus splendens

    NARCIS (Netherlands)

    Stavenga, Doekele G; Otto, Jürgen C; Wilts, Bodo D


    Jumping spiders are well known for their acute vision and often bright colours. The male peacock spider Maratus splendens is richly coloured by scales that cover the body. The colours of the white, cream and red scales, which have an elaborate shape with numerous spines, are pigmentary. Blue scales

  15. Rates and risks for prolonged grief disorder in a sample of orphaned and widowed genocide survivors

    Directory of Open Access Journals (Sweden)

    Jacob Nadja


    Full Text Available Abstract Background The concept of Prolonged Grief Disorder (PGD has been defined in recent years by Prigerson and co-workers, who have developed and empirically tested consensus and diagnostic criteria for PGD. Using these most recent criteria defining PGD, the aim of this study was to determine rates of and risks for PGD in survivors of the 1994 Rwandan genocide who had lost a parent and/or the husband before, during or after the 1994 events. Methods The PG-13 was administered to 206 orphans or half orphans and to 194 widows. A regression analysis was carried out to examine risk factors of PGD. Results 8.0% (n = 32 of the sample met criteria for PGD with an average of 12 years post-loss. All but one person had faced multiple losses and the majority indicated that their grief-related loss was due to violent death (70%. Grief was predicted mainly by time since the loss, by the violent nature of the loss, the severity of symptoms of posttraumatic stress disorder (PTSD and the importance given to religious/spiritual beliefs. By contrast, gender, age at the time of bereavement, bereavement status (widow versus orphan, the number of different types of losses reported and participation in the funeral ceremony did not impact the severity of prolonged grief reactions. Conclusions A significant portion of the interviewed sample continues to experience grief over interpersonal losses and unresolved grief may endure over time if not addressed by clinical intervention. Severity of grief reactions may be associated with a set of distinct risk factors. Subjects who lose someone through violent death seem to be at special risk as they have to deal with the loss experience as such and the traumatic aspects of the loss. Symptoms of PTSD may hinder the completion of the mourning process. Religious beliefs may facilitate the mourning process and help to find meaning in the loss. These aspects need to be considered in the treatment of PGD.

  16. Biotechnological Trends in Spider and Scorpion Antivenom Development

    DEFF Research Database (Denmark)

    Laustsen, Andreas Hougaard; Solà, Mireia; Jappe, Emma Christine;


    Spiders and scorpions are notorious for their fearful dispositions and their ability to inject venom into prey and predators, causing symptoms such as necrosis, paralysis, and excruciating pain. Information on venom composition and the toxins present in these species is growing due to an interest...... at an increasingly faster pace. In this review, the current knowledge of spider and scorpion venoms is presented, followed by a discussion of all published biotechnological efforts within development of spider and scorpion antitoxins based on small molecules, antibodies and fragments thereof, and next generation...... in using bioactive toxins from spiders and scorpions for drug discovery purposes and for solving crystal structures of membrane-embedded receptors. Additionally, the identification and isolation of a myriad of spider and scorpion toxins has allowed research within next generation antivenoms to progress...

  17. Behavior of an adaptive bio-inspired spider web (United States)

    Zheng, Lingyue; Behrooz, Majid; Huie, Andrew; Hartman, Alex; Gordaninejad, Faramarz


    The goal of this study is to demonstrate the feasibility of an artificial adaptive spider web with comparable behavior to a real spider web. First, the natural frequency and energy absorption ability of a passive web is studied. Next, a control system that consists of stepper motors, load cells and an Arduino, is constructed to mimic a spider's ability to control the tension of radial strings in the web. The energy related characteristics in the artificial spider web is examined while the pre-tension of the radial strings are varied. Various mechanical properties of a damaged spider web are adjusted to study their effect on the behavior of the web. It is demonstrated that the pre-tension and stiffness of the web's radial strings can significantly affect the natural frequency and the total energy of the full and damaged webs.

  18. Vision in the nocturnal wandering spider Leucorchestris arenicola (Araneae: Sparassidae)

    DEFF Research Database (Denmark)

    Nørgaard, Thomas; Nilsson, Dan-Eric; Henschel, Joh R;


    At night the Namib Desert spider Leucorchestris arenicola performs long-distance homing across its sand dune habitat. By disabling all or pairs of the spiders' eight eyes we found that homing ability was severely reduced when vision was fully abolished. Vision, therefore, seems to play a key role...... in the nocturnal navigational performances of L. arenicola. After excluding two or three pairs of eyes, the spiders were found to be able to navigate successfully using only their lateral eyes or only their anterior median eyes. Measurement of the eyes' visual fields showed that the secondary eyes combined have...... resolution of the eyes is insufficient for detecting any visual information on structures in the landscape, and bright stars would be the only objects visible to the spiders. However, by summation in space and time, the spiders can rescue enough vision to detect coarse landscape structures. We show that L...

  19. Relatedness facilitates cooperation in the subsocial spider, Stegodyphus tentoriicola

    DEFF Research Database (Denmark)

    Ruch, Jasmin; Heinrich, Lisa; Bilde, T.;


    Background Cooperative hunting and foraging in spiders is rare and prone to cheating such that the actions of selfish individuals negatively affect the whole group. The resulting social dilemma may be mitigated by kin selection since related individuals lose indirect fitness benefits by acting...... selfishly. Indeed, cooperation with genetic kin reduces the disadvantages of within-group competition in the subsocial spider Stegodyphus lineatus, supporting the hypothesis that high relatedness is an important pre-adaptation in the transition to sociality in spiders. In this study we examined...... the consequences of group size and relatedness on cooperative feeding in the subsocial spider S. tentoriicola, a species suggested to be at the transition to permanent sociality. Results We formed groups of 3 and 6 spiders that were either siblings or non-siblings. We found that increasing group size negatively...

  20. And along Came a Spider: An Attentional Bias for the Detection of Spiders in Young Children and Adults (United States)

    LoBue, Vanessa


    Spiders are among the most common targets of fears and phobias in the world. In visual search tasks, adults detect their presence more rapidly than other kinds of stimuli. Reported here is an investigation of whether young children share this attentional bias for the detection of spiders. In a series of experiments, preschoolers and adults were…

  1. A two year study of verified spider bites in Switzerland and a review of the European spider bite literature. (United States)

    Nentwig, Wolfgang; Gnädinger, Markus; Fuchs, Joan; Ceschi, Alessandro


    During a two-year study, all spider bites recorded by Swiss primary care physicians were reported to the Swiss Toxicological Information Centre and all collected spiders were identified. A total of 14 verified spider bites were recorded, involving five species from four families: Zoropsis spinimana (five cases), Cheiracanthium punctorium (four cases), Tegenaria atrica (three cases) and one case of Malthonica ferruginea (= Tegenaria ferruginea) (both Agelenidae), and one case of Amaurobius ferox (Amaurobiidae). The bites of all spider species produced relatively mild symptoms. Local symptoms such as moderate to severe pain, circumscribed swelling and redness were the only effects in most cases. Systemic symptoms were rare. There was complete recovery in all cases and all lesions healed completely without further damage or secondary disorders. Following a review of the European spider bite literature, the number of spider species capable of biting humans in Europe is considered to be much larger than could be concluded from this study. Most spider bites are restricted to species living synanthropically, thus promoted by climate and habitat change. The annual frequency of spider bites in Switzerland is estimated at 10-100 bites per million inhabitants, but this is predicted to increase due to the continuous arrival of new alien species, many of which have a high potential to establish in urban areas. PMID:23872119

  2. Morphological evolution of spiders predicted by pendulum mechanics.

    Directory of Open Access Journals (Sweden)

    Jordi Moya-Laraño

    Full Text Available BACKGROUND: Animals have been hypothesized to benefit from pendulum mechanics during suspensory locomotion, in which the potential energy of gravity is converted into kinetic energy according to the energy-conservation principle. However, no convincing evidence has been found so far. Demonstrating that morphological evolution follows pendulum mechanics is important from a biomechanical point of view because during suspensory locomotion some morphological traits could be decoupled from gravity, thus allowing independent adaptive morphological evolution of these two traits when compared to animals that move standing on their legs; i.e., as inverted pendulums. If the evolution of body shape matches simple pendulum mechanics, animals that move suspending their bodies should evolve relatively longer legs which must confer high moving capabilities. METHODOLOGY/PRINCIPAL FINDINGS: We tested this hypothesis in spiders, a group of diverse terrestrial generalist predators in which suspensory locomotion has been lost and gained a few times independently during their evolutionary history. In spiders that hang upside-down from their webs, their legs have evolved disproportionately longer relative to their body sizes when compared to spiders that move standing on their legs. In addition, we show how disproportionately longer legs allow spiders to run faster during suspensory locomotion and how these same spiders run at a slower speed on the ground (i.e., as inverted pendulums. Finally, when suspensory spiders are induced to run on the ground, there is a clear trend in which larger suspensory spiders tend to run much more slowly than similar-size spiders that normally move as inverted pendulums (i.e., wandering spiders. CONCLUSIONS/SIGNIFICANCE: Several lines of evidence support the hypothesis that spiders have evolved according to the predictions of pendulum mechanics. These findings have potentially important ecological and evolutionary implications since

  3. Somatic panic-attack equivalents in a community sample of Rwandan widows who survived the 1994 genocide. (United States)

    Hagengimana, Athanase; Hinton, Devon; Bird, Bruce; Pollack, Mark; Pitman, Roger K


    The present study is the first to attempt to determine rates of panic attacks, especially 'somatically focused' panic attacks, panic disorder, symptoms of post-traumatic stress disorder (PTSD), and depression levels in a population of Rwandans traumatized by the 1994 genocide. The following measures were utilized: the Rwandan Panic-Disorder Survey (RPDS); the Beck Depression Inventory (BDI); the Harvard Trauma Questionnaire (HTQ); and the PTSD Checklist (PCL). Forty of 100 Rwandan widows suffered somatically focused panic attacks during the previous 4 weeks. Thirty-five (87%) of those having panic attacks suffered panic disorder, making the rate of panic disorder for the entire sample 35%. Rwandan widows with panic attacks had greater psychopathology on all measures. Somatically focused panic-attack subtypes seem to constitute a key response to trauma in the Rwandan population. Future studies of traumatized non-Western populations should carefully assess not only somatoform disorder but also somatically focused panic attacks. PMID:12581815

  4. Somatic panic-attack equivalents in a community sample of Rwandan widows who survived the 1994 genocide


    Hagengimana, Athanase; Hinton, Devon; Bird, Bruce; Pollack, Mark; Pitman, roger k


    The present study is the first to attempt to determine rates of panic attacks, especially ‘somatically focused’ panic attacks, panic disorder, symptoms of post-traumatic stress disorder (PTSD), and depression levels in a population of Rwandans traumatized by the 1994 genocide. The following measures were utilized: the Rwandan Panic-Disorder Survey (RPDS); the Beck Depression Inventory (BDI); the Harvard Trauma Questionnaire (HTQ); and the PTSD Checklist (PCL). Forty of 100 Rwandan widows suff...

  5. Ecopsychosocial Aspects of Human–Tiger Conflict: An Ethnographic Study of Tiger Widows of Sundarban Delta, India


    Chowdhury, Arabinda N.; Ranajit Mondal; Arabinda Brahma; Biswas, Mrinal K.


    AIMS Human–tiger conflict (HTC) is a serious public health issue in Sundarban Reserve Forest, India. HTC is a continued concern for the significant mortality and morbidity of both human and tiger population. This is the first comprehensive report on Sundarban tiger–human conflicts and its impact on widows whose husbands were killed by tigers. The study attempts to explore the situation analysis of HTC and the aftermath of the incident including bereavement and coping, the cultural stigma rela...

  6. Discovery of an unidentified Fermi object as a black widow-like millisecond pulsar

    CERN Document Server

    Kong, A K H; Cheng, K S; Takata, J; Yatsu, Y; Cheung, C C; Donato, D; Lin, L C C; Kataoka, J; Takahashi, Y; Maeda, K; Hui, C Y; Tam, P H T


    The Fermi Gamma-ray Space Telescope has revolutionized our knowledge of the gamma-ray pulsar population, leading to the discovery of almost 100 gamma-ray pulsars and dozens of gamma-ray millisecond pulsars (MSPs). Although the outer-gap model predicts different sites of emission for the radio and gamma-ray pulsars, until now all of the known gamma-ray MSPs have been visible in the radio. Here we report the discovery of a "radio-quiet" gamma-ray emitting MSP candidate by using Fermi, Chandra, Swift, and optical observations. The X-ray and gamma-ray properties of the source are consistent with known gamma-ray pulsars. We also found a 4.63-hr orbital period in optical and X-ray data. We suggest that the source is a black widow-like MSP with a ~0.1 solar-mass late-type companion star. Based on the profile of the optical and X-ray light-curves, the companion star is believed to be heated by the pulsar while the X-ray emissions originate from pulsar magnetosphere and/or from intra-binary shock. No radio detection o...

  7. A Spectroscopic Study of the Extreme Black Widow PSR J1311-3430

    CERN Document Server

    Romani, Roger W; Cenko, S Bradley


    We report on a series of spectroscopic observations of PSR J1311-3430, an extreme black-widow gamma-ray pulsar with a helium-star companion. In a previous study we estimated the neutron star mass as M_NS= 2.68+/-0.14M_Sun (statistical error), based on limited spectroscopy and a basic (direct heating) light curve model; however, much larger model-dependent systematics dominate the mass uncertainty. Our new spectroscopy reveals a range of complex source behavior. The variable He I companion wind emission lines can dominate broad-band photometry, especially in red filters or near minimum brightness, and the wind flux should complete companion evaporation in a spin-down time. The heated companion face also undergoes dramatic flares, reaching 40,000K over 20% of the star; this is likely powered by a magnetic field generated in the companion. The companion center-of-light radial velocity is now well measured with K_CoL = 615.4+/ We detect non-sinusoidal velocity components due to the heated face flux distri...

  8. Perceptions of filial responsibility by elderly Filipino widows and their primary caregivers. (United States)

    Blust, E P; Scheidt, R J


    This study assessed perceptions of filial responsibility among forty older Filipino mothers and their primary caregiver daughters from two urban and two rural barangays in the town of Los Banos (39 miles southeast of Manila). Using parallel standard structured interview measures, perceptions of filial expectations and filial behaviors were gathered across five categories of parental support: financial and material aid; personal care; service provision; respect; and warmth and affection. Intragenerational comparisons (analyses of variance) showed that widows' reports of actual amount of support received significantly exceeded their expectations for most forms of aid. In contrast, daughters' expectations for level of parental support exceeded their behaviors, but only for the more instrumental forms of aid. Intergenerational comparisons (t-test analyses) revealed that daughters held reliably higher filial expectations for almost all forms of support than did their mothers. Comparisons of reports of actual support showed intergenerational consensus on the whole. Implications of these data for research and intervention in this area are discussed. PMID:3360509

  9. Older widows' speculations and expectancies concerning professional home-care providers. (United States)

    Porter, Eileen J; Ganong, Lawrence H


    Little is known about older persons' expectancies (or anticipations) about the possible actions of home-care professionals, although such data have implications for the ethics of home care and home-care policies. From a longitudinal study of older women's experience of home care, findings are reported concerning their expectancies of professional home-care providers. A descriptive phenomenological method was used to detail the structure of the experience and its context. Data were analyzed from a series of interviews with 13 women aged 82 to 96 years. Among the five key structures of experience were 'finding that someone has the job of helping me here' and 'determining where the helper's field lies'. Two subsets within a category of expectancies were differentiated: speculations about helpers' possible actions and expectancies about outcomes of helpers' actions. As parameters of relational ethics, clients' speculations and expectancies are appropriate bases for dialogue about older widows' relationships with home-care professionals and the foci of home-care policies.

  10. Does Government subsidy for costs of medical and pharmaceutical services result in higher service utilization by older widowed women in Australia?


    Tooth Leigh R; Hockey Richard; Treloar Susan; McClintock Christine; Dobson Annette


    Abstract Background In Australia, Medicare, the national health insurance system which includes the Medical Benefits Scheme (MBS) and Pharmaceutical Benefits Scheme (PBS), provides partial coverage for most medical services and pharmaceuticals. For war widows, the Department of Veterans’ Affairs (DVA) covers almost the entire cost of their health care. The objective of this study was to test whether war widows have higher usage of medical services and pharmaceuticals. Methods Data were from 7...

  11. Spider Silk-CBD-Cellulose Nanocrystal Composites: Mechanism of Assembly (United States)

    Meirovitch, Sigal; Shtein, Zvi; Ben-Shalom, Tal; Lapidot, Shaul; Tamburu, Carmen; Hu, Xiao; Kluge, Jonathan A.; Raviv, Uri; Kaplan, David L.; Shoseyov, Oded


    The fabrication of cellulose-spider silk bio-nanocomposites comprised of cellulose nanocrystals (CNCs) and recombinant spider silk protein fused to a cellulose binding domain (CBD) is described. Silk-CBD successfully binds cellulose, and unlike recombinant silk alone, silk-CBD self-assembles into microfibrils even in the absence of CNCs. Silk-CBD-CNC composite sponges and films show changes in internal structure and CNC alignment related to the addition of silk-CBD. The silk-CBD sponges exhibit improved thermal and structural characteristics in comparison to control recombinant spider silk sponges. The glass transition temperature (Tg) of the silk-CBD sponge was higher than the control silk sponge and similar to native dragline spider silk fibers. Gel filtration analysis, dynamic light scattering (DLS), small angle X-ray scattering (SAXS) and cryo-transmission electron microscopy (TEM) indicated that silk-CBD, but not the recombinant silk control, formed a nematic liquid crystalline phase similar to that observed in native spider silk during the silk spinning process. Silk-CBD microfibrils spontaneously formed in solution upon ultrasonication. We suggest a model for silk-CBD assembly that implicates CBD in the central role of driving the dimerization of spider silk monomers, a process essential to the molecular assembly of spider-silk nanofibers and silk-CNC composites. PMID:27649169

  12. Spider Silk-CBD-Cellulose Nanocrystal Composites: Mechanism of Assembly. (United States)

    Meirovitch, Sigal; Shtein, Zvi; Ben-Shalom, Tal; Lapidot, Shaul; Tamburu, Carmen; Hu, Xiao; Kluge, Jonathan A; Raviv, Uri; Kaplan, David L; Shoseyov, Oded


    The fabrication of cellulose-spider silk bio-nanocomposites comprised of cellulose nanocrystals (CNCs) and recombinant spider silk protein fused to a cellulose binding domain (CBD) is described. Silk-CBD successfully binds cellulose, and unlike recombinant silk alone, silk-CBD self-assembles into microfibrils even in the absence of CNCs. Silk-CBD-CNC composite sponges and films show changes in internal structure and CNC alignment related to the addition of silk-CBD. The silk-CBD sponges exhibit improved thermal and structural characteristics in comparison to control recombinant spider silk sponges. The glass transition temperature (Tg) of the silk-CBD sponge was higher than the control silk sponge and similar to native dragline spider silk fibers. Gel filtration analysis, dynamic light scattering (DLS), small angle X-ray scattering (SAXS) and cryo-transmission electron microscopy (TEM) indicated that silk-CBD, but not the recombinant silk control, formed a nematic liquid crystalline phase similar to that observed in native spider silk during the silk spinning process. Silk-CBD microfibrils spontaneously formed in solution upon ultrasonication. We suggest a model for silk-CBD assembly that implicates CBD in the central role of driving the dimerization of spider silk monomers, a process essential to the molecular assembly of spider-silk nanofibers and silk-CNC composites. PMID:27649169

  13. Time-dependent motor properties of multipedal molecular spiders (United States)

    Samii, Laleh; Blab, Gerhard A.; Bromley, Elizabeth H. C.; Linke, Heiner; Curmi, Paul M. G.; Zuckermann, Martin J.; Forde, Nancy R.


    Molecular spiders are synthetic biomolecular walkers that use the asymmetry resulting from cleavage of their tracks to bias the direction of their stepping motion. Using Monte Carlo simulations that implement the Gillespie algorithm, we investigate the dependence of the biased motion of molecular spiders, along with binding time and processivity, on tunable experimental parameters, such as number of legs, span between the legs, and unbinding rate of a leg from a substrate site. We find that an increase in the number of legs increases the spiders’ processivity and binding time but not their mean velocity. However, we can increase the mean velocity of spiders with simultaneous tuning of the span and the unbinding rate of a spider leg from a substrate site. To study the efficiency of molecular spiders, we introduce a time-dependent expression for the thermodynamic efficiency of a molecular motor, allowing us to account for the behavior of spider populations as a function of time. Based on this definition, we find that spiders exhibit transient motor function over time scales of many hours and have a maximum efficiency on the order of 1%, weak compared to other types of molecular motors.

  14. Mermithid parasitism of Hawaiian Tetragnatha spiders in a fragmented landscape (United States)

    Vandergast, Amy; Roderick, George K.


    Hawaiian Tetragnatha spiders inhabiting small forest fragments on the Big Island of Hawaii are parasitized by mermithid nematodes. This is the first report of mermithid nematodes infecting spiders in Hawaii, and an initial attempt to characterize this host–parasite interaction. Because immature mermithids were not morphologically identifiable, a molecular identification was performed. A phylogenetic analysis based on 18S small ribosomal subunit nuclear gene sequences suggested that Hawaiian spider mermithids are more closely related to a mainland presumptive Aranimemis species that infects spiders, than to an insect-infecting mermithid collected on Oahu, HI, or to Mermis nigrescens, also a parasite of insects. Measured infection prevalence was low (ranging from 0 to 4%) but differed significantly among forest fragments. Infection prevalence was associated significantly with fragment area, but not with spider density nor spider species richness. Results suggest that mermithid populations are sensitive to habitat fragmentation, but that changes in infection prevalence do not appear to affect spider community structure.

  15. Spider Silk-CBD-Cellulose Nanocrystal Composites: Mechanism of Assembly

    Directory of Open Access Journals (Sweden)

    Sigal Meirovitch


    Full Text Available The fabrication of cellulose-spider silk bio-nanocomposites comprised of cellulose nanocrystals (CNCs and recombinant spider silk protein fused to a cellulose binding domain (CBD is described. Silk-CBD successfully binds cellulose, and unlike recombinant silk alone, silk-CBD self-assembles into microfibrils even in the absence of CNCs. Silk-CBD-CNC composite sponges and films show changes in internal structure and CNC alignment related to the addition of silk-CBD. The silk-CBD sponges exhibit improved thermal and structural characteristics in comparison to control recombinant spider silk sponges. The glass transition temperature (Tg of the silk-CBD sponge was higher than the control silk sponge and similar to native dragline spider silk fibers. Gel filtration analysis, dynamic light scattering (DLS, small angle X-ray scattering (SAXS and cryo-transmission electron microscopy (TEM indicated that silk-CBD, but not the recombinant silk control, formed a nematic liquid crystalline phase similar to that observed in native spider silk during the silk spinning process. Silk-CBD microfibrils spontaneously formed in solution upon ultrasonication. We suggest a model for silk-CBD assembly that implicates CBD in the central role of driving the dimerization of spider silk monomers, a process essential to the molecular assembly of spider-silk nanofibers and silk-CNC composites.

  16. Spider Silk-CBD-Cellulose Nanocrystal Composites: Mechanism of Assembly. (United States)

    Meirovitch, Sigal; Shtein, Zvi; Ben-Shalom, Tal; Lapidot, Shaul; Tamburu, Carmen; Hu, Xiao; Kluge, Jonathan A; Raviv, Uri; Kaplan, David L; Shoseyov, Oded


    The fabrication of cellulose-spider silk bio-nanocomposites comprised of cellulose nanocrystals (CNCs) and recombinant spider silk protein fused to a cellulose binding domain (CBD) is described. Silk-CBD successfully binds cellulose, and unlike recombinant silk alone, silk-CBD self-assembles into microfibrils even in the absence of CNCs. Silk-CBD-CNC composite sponges and films show changes in internal structure and CNC alignment related to the addition of silk-CBD. The silk-CBD sponges exhibit improved thermal and structural characteristics in comparison to control recombinant spider silk sponges. The glass transition temperature (Tg) of the silk-CBD sponge was higher than the control silk sponge and similar to native dragline spider silk fibers. Gel filtration analysis, dynamic light scattering (DLS), small angle X-ray scattering (SAXS) and cryo-transmission electron microscopy (TEM) indicated that silk-CBD, but not the recombinant silk control, formed a nematic liquid crystalline phase similar to that observed in native spider silk during the silk spinning process. Silk-CBD microfibrils spontaneously formed in solution upon ultrasonication. We suggest a model for silk-CBD assembly that implicates CBD in the central role of driving the dimerization of spider silk monomers, a process essential to the molecular assembly of spider-silk nanofibers and silk-CNC composites.

  17. Structural and optical studies on selected web spinning spider silks. (United States)

    Karthikeyani, R; Divya, A; Mathavan, T; Asath, R Mohamed; Benial, A Milton Franklin; Muthuchelian, K


    This study investigates the structural and optical properties in the cribellate silk of the sheet web spider Stegodyphus sarasinorum Karsch (Eresidae) and the combined dragline, viscid silk of the orb-web spiders Argiope pulchella Thorell (Araneidae) and Nephila pilipes Fabricius (Nephilidae). X-ray diffraction (XRD), Fourier transform infra-red (FTIR), Ultraviolet-visible (UV-Vis) and fluorescence spectroscopic techniques were used to study these three spider silk species. X-ray diffraction data are consistent with the amorphous polymer network which is arising from the interaction of larger side chain amino acid contributions due to the poly-glycine rich sequences known to be present in the proteins of cribellate silk. The same amorphous polymer networks have been determined from the combined dragline and viscid silk of orb-web spiders. From FTIR spectra the results demonstrate that, cribellate silk of Stegodyphus sarasinorum, combined dragline viscid silk of Argiope pulchella and Nephila pilipes spider silks are showing protein peaks in the amide I, II and III regions. Further they proved that the functional groups present in the protein moieties are attributed to α-helical and side chain amino acid contributions. The optical properties of the obtained spider silks such as extinction coefficients, refractive index, real and imaginary dielectric constants and optical conductance were studied extensively from UV-Vis analysis. The important fluorescent amino acid tyrosine is present in the protein folding was investigated by using fluorescence spectroscopy. This research would explore the protein moieties present in the spider silks which were found to be associated with α-helix and side chain amino acid contributions than with β-sheet secondary structure and also the optical relationship between the three different spider silks are investigated. Successful spectroscopic knowledge of the internal protein structure and optical properties of the spider silks could

  18. Structure-Function-Property-Design Interplay in Biopolymers: Spider Silk (United States)

    Tokareva, Olena; Jacobsen, Matthew; Buehler, Markus; Wong, Joyce; Kaplan, David L.


    Spider silks have been a focus of research for almost two decades due to their outstanding mechanical and biophysical properties. Recent advances in genetic engineering have led to the synthesis of recombinant spider silks, thus helping to unravel a fundamental understanding of structure-function-property relationships. The relationships between molecular composition, secondary structures, and mechanical properties found in different types of spider silks are described, along with a discussion of artificial spinning of these proteins and their bioapplications, including the role of silks in biomineralization and fabrication of biomaterials with controlled properties. PMID:23962644

  19. Recent Results from the 2015 flight of Spider (United States)

    Jones, William C.


    Spider is a balloon borne mm-wave polarimeter designed to provide high fidelity measurements of the large scale polarization of the microwave sky. Spider flew a 17 day mission in January 2015, mapping roughly 10% of the full sky (4500 square degrees) in the southern Galactic hemisphere at each of 94 and 150 GHz. Spider achieved an instrumental sensitivity of 4 μ K_{CMB}√{s}, providing maps that exceed the sensitivity of the Planck data. We discuss these data, the current status of our science analysis, and our understanding of the Galacticforeground emission in this high latitude region.

  20. Misdiagnosis of spider bites: bacterial associates, mechanical pathogen transfer, and hemolytic potential of venom from the hobo spider, Tegenaria agrestis (Araneae: Agelenidae). (United States)

    Gaver-Wainwright, Melissa M; Zack, Richard S; Foradori, Matthew J; Lavine, Laura Corley


    The European spider Tegenaria agrestis (Walckenaer) (hobo spider) has been implicated as a spider of medical importance in the Pacific Northwest since its introduction in the late 1980s. Studies have indicated that the hobo spider causes necrotic tissue lesions through hemolytic venom or through the transfer of pathogenic bacteria introduced by its bite. Bacterial infections are often diagnosed as spider bites, in particular the pathogenic bacteria methicillin-resistant Staphylococcus aureus (MRSA). This study examines three aspects of the potential medical importance of hobo spiders in part of its introduced range, Washington State. First, the bacterial diversity of the spider was surveyed using a polymerase chain reaction-based assay to determine whether the spider carries any pathogenic bacteria. Second, an experiment was conducted to determine the ability of the spiders to transfer MRSA. Third, the venom was evaluated to assess the hemolytic activity. We found 10 genera of ubiquitous bacteria on the exterior surface of the spiders. In addition, none of the spiders exposed to MRSA transferred this pathogen. Finally, the hemolytic venom assay corroborates previous studies that found hobo spider venom was not deleterious to vertebrate red blood cells.

  1. Phylogenomics resolves a spider backbone phylogeny and rejects a prevailing paradigm for orb web evolution. (United States)

    Bond, Jason E; Garrison, Nicole L; Hamilton, Chris A; Godwin, Rebecca L; Hedin, Marshal; Agnarsson, Ingi


    Spiders represent an ancient predatory lineage known for their extraordinary biomaterials, including venoms and silks. These adaptations make spiders key arthropod predators in most terrestrial ecosystems. Despite ecological, biomedical, and biomaterial importance, relationships among major spider lineages remain unresolved or poorly supported. Current working hypotheses for a spider "backbone" phylogeny are largely based on morphological evidence, as most molecular markers currently employed are generally inadequate for resolving deeper-level relationships. We present here a phylogenomic analysis of spiders including taxa representing all major spider lineages. Our robust phylogenetic hypothesis recovers some fundamental and uncontroversial spider clades, but rejects the prevailing paradigm of a monophyletic Orbiculariae, the most diverse lineage, containing orb-weaving spiders. Based on our results, the orb web either evolved much earlier than previously hypothesized and is ancestral for a majority of spiders or else it has multiple independent origins, as hypothesized by precladistic authors. Cribellate deinopoid orb weavers that use mechanically adhesive silk are more closely related to a diverse clade of mostly webless spiders than to the araneoid orb-weaving spiders that use adhesive droplet silks. The fundamental shift in our understanding of spider phylogeny proposed here has broad implications for interpreting the evolution of spiders, their remarkable biomaterials, and a key extended phenotype--the spider web.

  2. Sex-specific kleptoparasitic foraging in ant-eating spiders

    DEFF Research Database (Denmark)

    Martisová, Martina; Bilde, T.; Pekar, Stano


    Foraging by intraspecific kleptoparasitism is widespread among animal taxa. Most kleptoparasitic interactions are considered facultative, and can be influenced by life history stage and trade-offs with other activities such as mate searching. Trade-offs with mating strategies are often sex specific....... To investigate this hypothesis, we studied the effect of sex and life history stage on the frequency of kleptoparasitism in ant-eating spiders of the genus Zodarion in the field. These spiders use a special capture technique involving a quick attack on an ant that is left unguarded by spiders for several minutes......, providing ample opportunities for kleptoparasitism. We found that adult females consistently hunted actively, while adult males ceased active prey capture and instead engaged in kleptoparasitism. Juvenile spiders were active hunters irrespective of sex. Consistent with an ontogenetic shift in foraging...

  3. Bromeliad-living spiders improve host plant nutrition and growth. (United States)

    Romero, Gustavo Q; Mazzafera, Paulo; Vasconcellos-Neto, Joao; Trivelin, Paulo C O


    Although bromeliads are believed to obtain nutrients from debris deposited by animals in their rosettes, there is little evidence to support this assumption. Using stable isotope methods, we found that the Neotropical jumping spider Psecas chapoda (Salticidae), which lives strictly associated with the terrestrial bromeliad Bromelia balansae, contributed 18% of the total nitrogen of its host plant in a greenhouse experiment. In a one-year field experiment, plants with spiders produced leaves 15% longer than plants from which the spiders were excluded. This is the first study to show nutrient provisioning in a spider-plant system. Because several animal species live strictly associated with bromeliad rosettes, this type of facultative mutualism involving the Bromeliaceae may be more common than previously thought.

  4. Spiders of the Great Dismal Swamp: Lake Drummond 1977 (United States)

    US Fish and Wildlife Service, Department of the Interior — This report outlines the results of a study of spiders that was conducted along the shores of Lake Drummond, in the Great Dismal Swamp. The purpose of the study was...

  5. Unravelling the biodiversity of nanoscale signatures of spider silk fibres. (United States)

    Silva, Luciano P; Rech, Elibio L


    Living organisms are masters at designing outstanding self-assembled nanostructures through a hierarchical organization of modular proteins. Protein-based biopolymers improved and selected by the driving forces of molecular evolution are among the most impressive archetypes of nanomaterials. One of these biomacromolecules is the myriad of compound fibroins of spider silks, which combine surprisingly high tensile strength with great elasticity. However, no consensus on the nano-organization of spider silk fibres has been reached. Here we explore the biodiversity of spider silk fibres, focusing on nanoscale characterization with high-resolution atomic force microscopy. Our results reveal an evolution of the nanoroughness, nanostiffness, nanoviscoelastic, nanotribological and nanoelectric organization of microfibres, even when they share similar sizes and shapes. These features are related to unique aspects of their molecular structures. The results show that combined nanoscale analyses of spider silks may enable the screening of appropriate motifs for bioengineering synthetic fibres from recombinant proteins. PMID:24345771

  6. Molecular spring: from spider silk to silkworm silk

    CERN Document Server

    Wu, Xiang; Du, Ning; Xu, Gang-Qin; Li, Bao-Wen


    In this letter, we adopt a new approach combining theoretical modeling with silk stretching measurements to explore the mystery of the structures between silkworm and spider silks, leading to the differences in mechanical response against stretching. Hereby the typical stress-strain profiles are reproduced by implementing the newly discovered and verified "$\\beta$-sheet splitting" mechanism, which primarily varies the secondary structure of protein macromolecules; our modeling and simulation results show good accordance with the experimental measurements. Hence, it can be concluded that the post-yielding mechanical behaviors of both kinds of silks are resulted from the splitting of crystallines while the high extensibility of spider dragline is attributed to the tiny $\\beta$-sheets solely existed in spider silk fibrils. This research reveals for the first time the structural factors leading to the significant difference between spider and silkworm silks in mechanical response to the stretching force. Addition...

  7. Evolution of stenophagy in spiders (Araneae): evidence based on the comparative analysis of spider diets. (United States)

    Pekár, Stano; Coddington, Jonathan A; Blackledge, Todd A


    Stenophagy (narrow diet breadth) represents an extreme of trophic specialization in carnivores, but little is known about the forces driving its evolution. We used spiders, the most diversified group of terrestrial predators, to investigate whether stenophagy (1) promoted diversification; (2) was phylogenetically conserved and evolutionarily derived state; and (3) was determined either by geographical distribution and foraging guild. We used published data on the prey of almost 600 species. Six categories of stenophagy were found: myrmecophagy, araneophagy, lepidopterophagy, termitophagy, dipterophagy, and crustaceophagy. We found that the species diversity of euryphagous genera and families was similar to stenophagous genera and families. At the family level, stenophagy evolved repeatedly and independently. Within families, the basal condition was oligophagy or euryphagy. Most types of stenophagy were clearly derived: myrmecophagy in Zodariidae; lepidopterophagy in Araneidae; dipterophagy in Theridiidae. In contrast, araneophagy was confined to basal and intermediate lineages, suggesting its ancestral condition. The diet breadth of species from the tropics and subtropics was less diverse than species from the temperate zone. Diet breadth was lower in cursorial spiders compared to web-building species. Thus, the evolution of stenophagy in spiders appears to be complex and governed by phylogeny as well as by ecological determinants.

  8. Endosymbiont dominated bacterial communities in a dwarf spider.

    Directory of Open Access Journals (Sweden)

    Bram Vanthournout

    Full Text Available The microbial community of spiders is little known, with previous studies focussing primarily on the medical importance of spiders as vectors of pathogenic bacteria and on the screening of known cytoplasmic endosymbiont bacteria. These screening studies have been performed by means of specific primers that only amplify a selective set of endosymbionts, hampering the detection of unreported species in spiders. In order to have a more complete overview of the bacterial species that can be present in spiders, we applied a combination of a cloning assay, DGGE profiling and high-throughput sequencing on multiple individuals of the dwarf spider Oedothorax gibbosus. This revealed a co-infection of at least three known (Wolbachia, Rickettsia and Cardinium and the detection of a previously unreported endosymbiont bacterium (Rhabdochlamydia in spiders. 16S rRNA gene sequences of Rhabdochlamydia matched closely with those of Candidatus R. porcellionis, which is currently only reported as a pathogen from a woodlouse and with Candidatus R. crassificans reported from a cockroach. Remarkably, this bacterium appears to present in very high proportions in one of the two populations only, with all investigated females being infected. We also recovered Acinetobacter in high abundance in one individual. In total, more than 99% of approximately 4.5M high-throughput sequencing reads were restricted to these five bacterial species. In contrast to previously reported screening studies of terrestrial arthropods, our results suggest that the bacterial communities in this spider species are dominated by, or even restricted to endosymbiont bacteria. Given the high prevalence of endosymbiont species in spiders, this bacterial community pattern could be widespread in the Araneae order.

  9. Protective antibodies against a sphingomyelinase D from Loxosceles intermedia spider venom elicited in mice with different genetic background. (United States)

    Oliveira, Camila Franco Batista; Vilela, Andrea; Coura, Luis Augusto M; Rodrigues, Fernandes Tenório Gomes; Nagem, Ronaldo Alves Pinto; Chávez-Olortegui, Carlos; Maioli, Tatiani U; Felicori, Liza F


    In the present investigation we used a recombinant LiD1 toxin, named rLiD1his, from Loxosceles intermedia brown spider to elicit specific antibodies in mice carrying different Human Leukocyte Antigens class II (HLAII) {DRB1.0401 (DR4), DQB1.0601 (DQ6) and DQB1.0302 (DQ8)} as well as in BALB/C and C57BL/6 control mice. All mice strains produced high antibody titers against rLiD1his but DR4 mice antibodies (the lower responder mice) were not able to recognize L. intermedia crude venom. The anti-rLiD1his sera, except from DR4 mice, were able to neutralize dermonecrotic, hemorrhagic and edematogenic effects of rLiD1his in naïve rabbits. Overlapping peptides from the amino acid sequence of LiD1 toxin were prepared by SPOT method and differences in LiD1 epitope recognition were observed using different mice anti-rLiD1his sera. The region (160)DKVGHDFSGNDDISDVGK(177) was recognized by transgenic DQ8 and DQ6 mice sera. Other epitopes were recognized by at least two different animals' sera including (10)MGHMVNAIGQIDEFVNLG(27), (37)FDDNANPEYTYHGIP(51), (70)GLRSATTPGNSKYQEKLV(87) and (259)AAYKKKFRVATYDDN(273). Among these epitopes, the epitopes 37-51 and 160-177 have already been shown in previously studies as good candidates to be used alone or combined with other peptides to induce protective immune response against Loxosceles venoms. The results presented here highlight the importance of HLAII in antibody response and recognition of specific B-cell epitopes of rLiD1his spider toxin according to HLAII type and impact in the epitopic vaccine development against this spider. PMID:27265457

  10. SPIDER Progress Towards High Resolution Correlated Fission Product Data (United States)

    Shields, Dan; Meierbachtol, Krista; Tovesson, Fredrik; Arnold, Charles; Blackeley, Rick; Bredeweg, Todd; Devlin, Matt; Hecht, Adam; Jandel, Marian; Jorgenson, Justin; Nelson, Ron; White, Morgan; Spider Team


    The SPIDER detector (SPectrometer for Ion DEtermination in fission Research) is under development with the goal of obtaining high-resolution, high-efficiency, correlated fission product data needed for many applications including the modeling of next generation nuclear reactors, stockpile stewardship, and the fundamental understanding of the fission process. SPIDER simultaneously measures velocity and energy of both fission products to calculate fission product yields (FPYs), neutron multiplicity (ν), and total kinetic energy (TKE). A detailed description of the prototype SPIDER detector components will be presented. Characterization measurements with alpha and spontaneous fission sources will also be discussed. LA-UR-14-24875. The SPIDER detector (SPectrometer for Ion DEtermination in fission Research) is under development with the goal of obtaining high-resolution, high-efficiency, correlated fission product data needed for many applications including the modeling of next generation nuclear reactors, stockpile stewardship, and the fundamental understanding of the fission process. SPIDER simultaneously measures velocity and energy of both fission products to calculate fission product yields (FPYs), neutron multiplicity (ν), and total kinetic energy (TKE). A detailed description of the prototype SPIDER detector components will be presented. Characterization measurements with alpha and spontaneous fission sources will also be discussed. LA-UR-14-24875. This work is in part supported by LANL Laboratory Directed Research and Development Projects 20110037DR and 20120077DR.

  11. Biodiversity baseline of the French Guiana spider fauna. (United States)

    Vedel, Vincent; Rheims, Christina; Murienne, Jérôme; Brescovit, Antonio Domingos


    The need for an updated list of spiders found in French Guiana rose recently due to many upcoming studies planned. In this paper, we list spiders from French Guiana from existing literature (with corrected nomenclature when necessary) and from 2142 spiders sampled in 12 sites for this baseline study. Three hundred and sixty four validated species names of spider were found in the literature and previous authors' works. Additional sampling, conducted for this study added another 89 identified species and 62 other species with only a genus name for now. The total species of spiders sampled in French Guiana is currently 515. Many other Morphospecies were found but not described as species yet. An accumulation curve was drawn with seven of the sampling sites and shows no plateau yet. Therefore, the number of species inhabiting French Guiana cannot yet be determined. As the very large number of singletons found in the collected materials suggests, the accumulation curve indicates nevertheless that more sampling is necessary to discover the many unknown spider species living in French Guiana, with a focus on specific periods (dry season and wet season) and on specific and poorly studied habitats such as canopy, inselberg and cambrouze (local bamboo monospecific forest).

  12. A clinical and epidemiological study on spider bites in Turkey

    Institute of Scientific and Technical Information of China (English)

    Yildirim Cesaretli; Ozcan Ozkan


    Objective:To classify and characterize spider bites among inquiries to the National Poison Information Center (NPIC) between1995 and2004, in terms of the epidemiology and clinical symptomatology.Methods: Clinical and epidemiological data were obtained from theNPIC’s patient records. The following information was recorded for each spider bite: demographics, circumstances of the bite, and local and systemic effects.Results: A total of82 cases were reported. The accidents were mostly seen during August. The gender distribution was59.76%male, 37.20% female, and2.44% unknown and the20-29 age group presented more spider bites. Most of the cases were in the Central Anatolia, Marmara, Mediterranean, and Black Sea regions. Local symptoms were observed in60.87% of the cases, including local pain, edema, redness, itching, debris, burning, and numbness. Systemic symptoms were observed such as nausea, vomiting, abdominal pain, lethargy, anxiety, weakness, somnolence, dyspnea, hypertension, hypotension, and hyperthermia.Conclusions: In conclusion, these findings emphasize the presence of medically important spider species in Turkey. All patients and especially pediatric patients should be admitted to the hospital. Identification of spider species may be considered a useful clinical and epidemiological tool in determining the incidence and risk of spider bites.

  13. Molecular Fundaments of Mechanical Properties of Spider Silk

    Institute of Scientific and Technical Information of China (English)

    潘志娟; 刘敏; 李春萍; 李栋高; 盛家镛


    Dragline,framework and cocoon silk fibers of Araneus Ventricosus were used for this study.To investigate the microstructure mechanisms of stress-strain behavior of spider silk,firstly,amino acid compositions were analyzed and molecular conformations and crystallinity were measured with Raman spectra and X-ray diffraction respectively.The results showed that there were more amino acids with large side groups and polar ones in spider silk than those of Bombyx silk,and the amino acid distribution varied with different spider silk.The molecular structures were mainly α-helix and β-sheet,and random coil and β-turn existed as well.The proportions and arrangement of these conformations of dragline silk were different from framework and cocoon silk fibers.Microstructure was one of important factors of excellent mechanical properties of spider silk.Crystallinity of spider silk was very low,which implied that the roles of crystal on spider silk were not as great as other protein fibers.

  14. Relatedness facilitates cooperation in the subsocial spider, Stegodyphus tentoriicola

    Directory of Open Access Journals (Sweden)

    Bilde Trine


    Full Text Available Abstract Background Cooperative hunting and foraging in spiders is rare and prone to cheating such that the actions of selfish individuals negatively affect the whole group. The resulting social dilemma may be mitigated by kin selection since related individuals lose indirect fitness benefits by acting selfishly. Indeed, cooperation with genetic kin reduces the disadvantages of within-group competition in the subsocial spider Stegodyphus lineatus, supporting the hypothesis that high relatedness is an important pre-adaptation in the transition to sociality in spiders. In this study we examined the consequences of group size and relatedness on cooperative feeding in the subsocial spider S. tentoriicola, a species suggested to be at the transition to permanent sociality. Results We formed groups of 3 and 6 spiders that were either siblings or non-siblings. We found that increasing group size negatively affected feeding efficiency but that these negative effects were reduced in sib-groups. Sib groups were more likely to feed cooperatively and all group members grew more homogenously than groups of unrelated spiders. The measured differences did not translate into differential growth or mortality during the experimental period of 8 weeks. Conclusion The combination of our results with those from previous studies indicates that the conflict between individual interests and group interests may be reduced by nepotism and that the latter promote the maintenance of the social community.

  15. Spider-mite problems and control in Taiwan. (United States)

    Ho, C C


    Problems with spider mites first appeared in Taiwan in 1958, eight years after the importation of synthetic pesticides, and the mites evolved into major pests on many crops during the 1980s. Of the 74 spider mite species recorded from Taiwan 10 are major pests, with Tetranychus kanzawai most important, followed by T. urticae, Panonychus citri, T. cinnabarinus, T. truncatus and Oligonychus litchii. Most crops suffer from more than one species. Spider mites reproduce year-round in Taiwan. Diapause occurs only in high-elevation areas. Precipitation is the most important abiotic factor restricting spider-mite populations. Control is usually accomplished by applying chemicals. Fifty acaricides are currently registered for the control of spider mites. Acaricide resistance is a serious problem, with regional variation in resistance levels. Several phytoseiid mites and a chrysopid predator have been studied for control of spider mites with good effect. Efforts to market these predators should be intensified so that biological control can be a real choice for farmers. PMID:11156169

  16. Physical model of a floating trash boom to control aquatic weeds at the TVA Widows Creek Fossil Plant

    International Nuclear Information System (INIS)

    This paper reports that the Tennessee Valley Authority (TVA) Widows Creek Fossil plant seasonally encounters adverse accumulations of aquatic weeds at the intakes of the condenser cooling water pumps. To reduce the accumulations, a floating trash boom has been proposed for the intakes. To evaluate the hydraulic feasibility of a boom, a physical model of the intakes has been built at the TVA Engineering Laboratory. The model was used to determine the boom alignment and depth of skimming needed to successfully deflect weeds away from the intakes and provide self-cleaning

  17. Sperm Dynamics in Spiders (Araneae): Ultrastructural Analysis of the Sperm Activation Process in the Garden Spider Argiope bruennichi (Scopoli, 1772)


    Oliver Vöcking; Gabriele Uhl; Peter Michalik


    Storage of sperm inside the female genital tract is an integral phase of reproduction in many animal species. The sperm storage site constitutes the arena for sperm activation, sperm competition and female sperm choice. Consequently, to understand animal mating systems information on the processes that occur from sperm transfer to fertilization is required. Here, we focus on sperm activation in spiders. Male spiders produce sperm whose cell components are coiled within the sperm cell and that...

  18. Early Cretaceous spider web with its prey. (United States)

    Peñalver, Enrique; Grimaldi, David A; Delclòs, Xavier


    The orb web is a spectacular evolutionary innovation that enables spiders to catch flying prey. This elegant, geometric structure is woven with silk fibers that are renowned for their superior mechanical properties. We used silk gland expression libraries to address a long-standing controversy concerning the evolution of the orb-web architecture. Contrary to the view that the orb-web design evolved multiple times, we found that the distribution and phylogeny of silk proteins support a single, ancient origin of the orb web at least 136 million years ago. Furthermore, we substantially expanded the repository of silk sequences that can be used for the synthesis of high-performance biomaterials. PMID:16794072

  19. The rotation of brown dwarfs

    CERN Document Server

    Scholz, Aleks


    One of the characteristic features of low-mass stars is their propensity to shed large amounts of angular momentum throughout their evolution. This distinguishs them from brown dwarfs which remain fast rotators over timescales of gigayears. Brown dwarfs with rotation periods longer than a couple of days have only been found in star forming regions and young clusters. This is a useful constraint on the mass dependency of mechanisms for angular momentum regular in stars. Rotational braking by disks and winds become highly inefficient in the substellar regime. In this short review I discuss the observational evidence for the fast rotation in brown dwarfs, the implications, and the link to the spin-mass relation in planets.

  20. Function of bright coloration in the wasp spider Argiope bruennichi (Araneae: Araneidae)


    Alex A Bush; Yu, Douglas W; Marie E Herberstein


    There are two major competing explanations for the counter-intuitive presence of bright coloration in certain orb-web spiders. Bright coloration could lure insect prey to the web vicinity, increasing the spider's foraging success. Alternatively, the markings could function as disruptive camouflage, making it difficult for the insect prey to distinguish spiders from background colour variation. We measured the prey capture rates of wasp spiders, Argiope bruennichi, that were blacked out, shiel...

  1. Live-trapping and handling brown bear (United States)

    US Fish and Wildlife Service, Department of the Interior — This paper reports techniques developed to live trap and handle brown bears on the Kodiak National Wildlife Refuge. The brown bears (Ursus middendorffi) on the...

  2. Browns Park NWR Water Use Report- 1999 (United States)

    US Fish and Wildlife Service, Department of the Interior — This report contains locations and water use at Browns Park NWR for 1999. A basic introduction highlighting the region that Browns Park NWR is a part of and the...

  3. Browns Park NWR Water Use Report- 2000 (United States)

    US Fish and Wildlife Service, Department of the Interior — This report contains locations and water use at Browns Park NWR for 2000. A basic introduction highlighting the region that Browns Park NWR is a part of and the...

  4. Multi-wavelength observations of the black widow pulsar 2FGL J2339.6-0532 with OISTER and Suzaku

    CERN Document Server

    Yatsu, Yoichi; Takahashi, Yosuke; Tachibana, Yutaro; Kawai, Nobuyuki; Shibata, Shimpei; Pike, Sean; Yoshii, Taketoshi; Arimoto, Makoto; Saito, Yoshihiko; NakamorI, Takeshi; Sekiguchi, Kazuhiro; Kuroda, Daisuke; Yanagisawa, Kenshi; Hanayama, Hidekazu; Watanabe, Makoto; Hamamoto, Ko; Nakao, Hikaru; Ozaki, Akihito; Motohara, Kentaro; Konishi, Masahiro; Tateuchi, Ken; Matsunaga, Noriyuki; Morokuma, Tomoki; Nagayama, Takahiro; Murata, Katsuhiro; Akitaya, Hiroshi; Yoshida, Michitoshi; Ali, Gamal B; Mohamed, A Essam; Isogai, Mizuki; Arai, Akira; Takahashi, Hidenori; Hashimoto, Osamu; Miyanoshita, Ryo; Omodaka, Toshihiro; Takahashi, Jun; Tokimasa, Noritaka; Matsuda, Kentaro; Okumura, Shin-Ichiro; Nishiyama, Kota; Urakawa, Seitaro; Nogami, Daisaku; Oasa, Yumiko


    Multi-wavelength observations of the black-widow binary system 2FGL J2339.6-0532 are reported. The Fermi gamma-ray source 2FGL J2339.6-0532 was recently categorized as a black widow in which a recycled millisecond pulsar (MSP) is evaporating up the companion star with its powerful pulsar wind. Our optical observations show clear sinusoidal light curves due to the asymmetric temperature distribution of the companion star. Assuming a simple geometry, we constrained the range of the inclination angle of the binary system to 52$^{\\circ}$ < i < 59$^{\\circ}$, which enables us to discuss the interaction between the pulsar wind and the companion in detail. The X-ray spectrum consists of two components: a soft, steady component that seems to originate from the surface of the MSP, and a hard variable component from the wind-termination shock near the companion star. The measured X-ray luminosity is comparable to the bolometric luminosity of the companion, meaning that the heating efficiency is less than 0.5. In t...

  5. Male-directed infanticide in spider monkeys (Ateles spp.). (United States)

    Alvarez, Sara; Di Fiore, Anthony; Champion, Jane; Pavelka, Mary Susan; Páez, Johanna; Link, Andrés


    Infanticide is considered a conspicuous expression of sexual conflict amongst mammals, including at least 35 primate species. Here we describe two suspected and one attempted case of intragroup infanticide in spider monkeys that augment five prior cases of observed or suspected infanticide in this genus. Contrary to the typical pattern of infanticide seen in most primate societies, where infants are killed by conspecifics independent of their sex, all eight cases of observed or suspected infanticide in spider monkeys have been directed toward male infants within their first weeks of life. Moreover, although data are still scant, infanticides seem to be perpetrated exclusively by adult males against infants from their own social groups and are not associated with male takeovers or a sudden rise in male dominance rank. Although the slow reproductive cycles of spider monkeys might favor the presence of infanticide because of the potential to shorten females' interbirth intervals, infanticide is nonetheless uncommon among spider monkeys, and patterns of male-directed infanticide are not yet understood. We suggest that given the potentially close genetic relationships among adult males within spider monkey groups, and the need for males to cooperate with one another in territorial interactions with other groups of related males, infanticide may be expected to occur primarily where the level of intragroup competition among males outweighs that of competition between social groups. Finally, we suggest that infanticide in spider monkeys may be more prevalent than previously thought, given that it may be difficult for observers to witness cases of infanticide or suspected infanticide that occur soon after birth in taxa that are characterized by high levels of fission-fusion dynamics. Early, undetected, male-biased infanticide could influence the composition of spider monkey groups and contribute to the female-biased adult sex ratios often reported for this genus.

  6. Male-directed infanticide in spider monkeys (Ateles spp.). (United States)

    Alvarez, Sara; Di Fiore, Anthony; Champion, Jane; Pavelka, Mary Susan; Páez, Johanna; Link, Andrés


    Infanticide is considered a conspicuous expression of sexual conflict amongst mammals, including at least 35 primate species. Here we describe two suspected and one attempted case of intragroup infanticide in spider monkeys that augment five prior cases of observed or suspected infanticide in this genus. Contrary to the typical pattern of infanticide seen in most primate societies, where infants are killed by conspecifics independent of their sex, all eight cases of observed or suspected infanticide in spider monkeys have been directed toward male infants within their first weeks of life. Moreover, although data are still scant, infanticides seem to be perpetrated exclusively by adult males against infants from their own social groups and are not associated with male takeovers or a sudden rise in male dominance rank. Although the slow reproductive cycles of spider monkeys might favor the presence of infanticide because of the potential to shorten females' interbirth intervals, infanticide is nonetheless uncommon among spider monkeys, and patterns of male-directed infanticide are not yet understood. We suggest that given the potentially close genetic relationships among adult males within spider monkey groups, and the need for males to cooperate with one another in territorial interactions with other groups of related males, infanticide may be expected to occur primarily where the level of intragroup competition among males outweighs that of competition between social groups. Finally, we suggest that infanticide in spider monkeys may be more prevalent than previously thought, given that it may be difficult for observers to witness cases of infanticide or suspected infanticide that occur soon after birth in taxa that are characterized by high levels of fission-fusion dynamics. Early, undetected, male-biased infanticide could influence the composition of spider monkey groups and contribute to the female-biased adult sex ratios often reported for this genus. PMID

  7. Spider phobia - Interaction of disgust and perceived likelihood of involuntary physical contact

    NARCIS (Netherlands)

    de Jong, Peter; Muris, P


    After reading vignettes, a group of spider-phobic girls (n = 18) and a group of nonphobic girls (n = 18) rated the subjective probability of spiders entering their private living space, their tendency to approach and make physical contact, and the subjective probability of spiders doing physical har

  8. 21 CFR 184.1120 - Brown algae. (United States)


    ... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Brown algae. 184.1120 Section 184.1120 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN... Substances Affirmed as GRAS § 184.1120 Brown algae. (a) Brown algae are seaweeds of the species...

  9. Biomimetic calcium phosphate coatings on recombinant spider silk fibres

    Energy Technology Data Exchange (ETDEWEB)

    Yang Liang; Habibovic, Pamela; Van Blitterswijk, Clemens A [Department of Tissue Regeneration, University of Twente, PO Box 217, 7500 AE Enschede (Netherlands); Hedhammar, My; Johansson, Jan [Department of Anatomy, Physiology and Biochemistry, Swedish University of Agricultural Sciences, the Biomedical Centre, Box 575, 751 23 Uppsala (Sweden); Blom, Tobias; Leifer, Klaus [Department of Engineering Sciences, Uppsala University, Box 534, S-751 21 Uppsala (Sweden)


    Calcium phosphate ceramic coatings, applied on surfaces of metallic and polymeric biomaterials, can improve their performance in bone repair and regeneration. Spider silk is biocompatible, strong and elastic, and hence an attractive biomaterial for applications in connective tissue repair. Recently, artificial spider silk, with mechanical and structural characteristics similar to those of native spider silk, has been produced from recombinant minispidroins. In the present study, supersaturated simulated body fluid was used to deposit calcium phosphate coatings on recombinant spider silk fibres. The mineralization process was followed in time using scanning electron microscopy equipped with an energy dispersive x-ray (EDX) detector and Raman spectroscope. Focused ion beam technology was used to produce a cross section of a coated fibre, which was further analysed by EDX. Preliminary in vitro experiments using a culture of bone marrow-derived human mesenchymal stem cells (hMSCs) on coated fibres were also performed. This study showed that recombinant spider silk fibres were successfully coated with a homogeneous and thick crystalline calcium phosphate layer. In the course of the mineralization process from modified simulated body fluid, sodium chloride crystals were first deposited on the silk surface, followed by the deposition of a calcium phosphate layer. The coated silk fibres supported the attachment and growth of hMSCs.

  10. Radiation Safety System for SPIDER Neutral Beam Accelerator (United States)

    Sandri, S.; Coniglio, A.; D'Arienzo, M.; Poggi, C.


    SPIDER (Source for Production of Ion of Deuterium Extracted from RF Plasma only) and MITICA (Megavolt ITER Injector Concept Advanced) are the ITER neutral beam injector (NBI) testing facilities of the PRIMA (Padova Research Injector Megavolt Accelerated) Center. Both injectors accelerate negative deuterium ions with a maximum energy of 1 MeV for MITICA and 100 keV for SPIDER with a maximum beam current of 40 A for both experiments. The SPIDER facility is classified in Italy as a particle accelerator. At present, the design of the radiation safety system for the facility has been completed and the relevant reports have been presented to the Italian regulatory authorities. Before SPIDER can operate, approval must be obtained from the Italian Regulatory Authority Board (IRAB) following a detailed licensing process. In the present work, the main project information and criteria for the SPIDER injector source are reported together with the analysis of hypothetical accidental situations and safety issues considerations. Neutron and photon nuclear analysis is presented, along with special shielding solutions designed to meet Italian regulatory dose limits. The contribution of activated corrosion products (ACP) to external exposure of workers has also been assessed. Nuclear analysis indicates that the photon contribution to worker external exposure is negligible, and the neutron dose can be considered by far the main radiation protection issue. Our results confirm that the injector has no important radiological impact on the population living around the facility.

  11. Radiation Safety System for SPIDER Neutral Beam Accelerator

    Energy Technology Data Exchange (ETDEWEB)

    Sandri, S.; Poggi, C. [ENEA, Radiation Protection Institute, IRP-FUAC, Frascati (Italy); Coniglio, A. [Medical Physics Department, S. Giovanni Calibita Hospital, Fatebenefratelli, Isola Tiberina, Roma (Italy); D' Arienzo, M. [ENEA, Ionizing Radiation Metrology National Institute, METR, Casaccia, Rome (Italy)


    SPIDER (Source for Production of Ion of Deuterium Extracted from RF Plasma only) and MITICA (Megavolt ITER Injector Concept Advanced) are the ITER neutral beam injector (NBI) testing facilities of the PRIMA (Padova Research Injector Megavolt Accelerated) Center. Both injectors accelerate negative deuterium ions with a maximum energy of 1 MeV for MITICA and 100 keV for SPIDER with a maximum beam current of 40 A for both experiments. The SPIDER facility is classified in Italy as a particle accelerator. At present, the design of the radiation safety system for the facility has been completed and the relevant reports have been presented to the Italian regulatory authorities. Before SPIDER can operate, approval must be obtained from the Italian Regulatory Authority Board (IRAB) following a detailed licensing process. In the present work, the main project information and criteria for the SPIDER injector source are reported together with the analysis of hypothetical accidental situations and safety issues considerations. Neutron and photon nuclear analysis is presented, along with special shielding solutions designed to meet Italian regulatory dose limits. The contribution of activated corrosion products (ACP) to external exposure of workers has also been assessed. Nuclear analysis indicates that the photon contribution to worker external exposure is negligible, and the neutron dose can be considered by far the main radiation protection issue. Our results confirm that the injector has no important radiological impact on the population living around the facility.

  12. Biased motion and molecular motor properties of bipedal spiders (United States)

    Samii, Laleh; Linke, Heiner; Zuckermann, Martin J.; Forde, Nancy R.


    Molecular spiders are synthetic molecular motors featuring multiple legs that each can interact with a substrate through binding and cleavage. Experimental studies suggest the motion of the spider in a matrix is biased toward uncleaved substrates and that spider properties such as processivity can be altered by changing the binding strength of the legs to substrate [R. Pei, S. K. Taylor, D. Stefanovic, S. Rudchenko, T. E. Mitchell, and M. N. Stojanovic, J. Am. Chem. Soc. 128, 12693 (2006)]. We investigate the origin of biased motion and molecular motor properties of bipedal spiders using Monte Carlo simulations. Our simulations combine a realistic chemical kinetic model, hand-over-hand or inchworm modes of stepping, and the use of a one-dimensional track. We find that stronger binding to substrate, cleavage and spider detachment from the track are contributing mechanisms to population bias. We investigate the contributions of stepping mechanism to speed, randomness parameter, processivity, coupling, and efficiency, and comment on how these molecular motor properties can be altered by changing experimentally tunable kinetic parameters.

  13. Detection and phylogenetic analysis of bacteriophage WO in spiders (Araneae). (United States)

    Yan, Qian; Qiao, Huping; Gao, Jin; Yun, Yueli; Liu, Fengxiang; Peng, Yu


    Phage WO is a bacteriophage found in Wolbachia. Herein, we represent the first phylogenetic study of WOs that infect spiders (Araneae). Seven species of spiders (Araneus alternidens, Nephila clavata, Hylyphantes graminicola, Prosoponoides sinensis, Pholcus crypticolens, Coleosoma octomaculatum, and Nurscia albofasciata) from six families were infected by Wolbachia and WO, followed by comprehensive sequence analysis. Interestingly, WO could be only detected Wolbachia-infected spiders. The relative infection rates of those seven species of spiders were 75, 100, 88.9, 100, 62.5, 72.7, and 100 %, respectively. Our results indicated that both Wolbachia and WO were found in three different body parts of N. clavata, and WO could be passed to the next generation of H. graminicola by vertical transmission. There were three different sequences for WO infected in A. alternidens and two different WO sequences from C. octomaculatum. Only one sequence of WO was found for the other five species of spiders. The discovered sequence of WO ranged from 239 to 311 bp. Phylogenetic tree was generated using maximum likelihood (ML) based on the orf7 gene sequences. According to the phylogenetic tree, WOs in N. clavata and H. graminicola were clustered in the same group. WOs from A. alternidens (WAlt1) and C. octomaculatum (WOct2) were closely related to another clade, whereas WO in P. sinensis was classified as a sole cluster.

  14. Biotechnological Trends in Spider and Scorpion Antivenom Development (United States)

    Laustsen, Andreas Hougaard; Solà, Mireia; Jappe, Emma Christine; Oscoz, Saioa; Lauridsen, Line Præst; Engmark, Mikael


    Spiders and scorpions are notorious for their fearful dispositions and their ability to inject venom into prey and predators, causing symptoms such as necrosis, paralysis, and excruciating pain. Information on venom composition and the toxins present in these species is growing due to an interest in using bioactive toxins from spiders and scorpions for drug discovery purposes and for solving crystal structures of membrane-embedded receptors. Additionally, the identification and isolation of a myriad of spider and scorpion toxins has allowed research within next generation antivenoms to progress at an increasingly faster pace. In this review, the current knowledge of spider and scorpion venoms is presented, followed by a discussion of all published biotechnological efforts within development of spider and scorpion antitoxins based on small molecules, antibodies and fragments thereof, and next generation immunization strategies. The increasing number of discovery and development efforts within this field may point towards an upcoming transition from serum-based antivenoms towards therapeutic solutions based on modern biotechnology. PMID:27455327

  15. Biotechnological Trends in Spider and Scorpion Antivenom Development

    Directory of Open Access Journals (Sweden)

    Andreas Hougaard Laustsen


    Full Text Available Spiders and scorpions are notorious for their fearful dispositions and their ability to inject venom into prey and predators, causing symptoms such as necrosis, paralysis, and excruciating pain. Information on venom composition and the toxins present in these species is growing due to an interest in using bioactive toxins from spiders and scorpions for drug discovery purposes and for solving crystal structures of membrane-embedded receptors. Additionally, the identification and isolation of a myriad of spider and scorpion toxins has allowed research within next generation antivenoms to progress at an increasingly faster pace. In this review, the current knowledge of spider and scorpion venoms is presented, followed by a discussion of all published biotechnological efforts within development of spider and scorpion antitoxins based on small molecules, antibodies and fragments thereof, and next generation immunization strategies. The increasing number of discovery and development efforts within this field may point towards an upcoming transition from serum-based antivenoms towards therapeutic solutions based on modern biotechnology.

  16. Phylogenomic analysis of spiders reveals nonmonophyly of orb weavers. (United States)

    Fernández, Rosa; Hormiga, Gustavo; Giribet, Gonzalo


    Spiders constitute one of the most successful clades of terrestrial predators. Their extraordinary diversity, paralleled only by some insects and mites, is often attributed to the use of silk, and, in one of the largest lineages, to stereotyped behaviors for building foraging webs of remarkable biomechanical properties. However, our understanding of higher-level spider relationships is poor and is largely based on morphology. Prior molecular efforts have focused on a handful of genes but have provided little resolution to key questions such as the origin of the orb weavers. We apply a next-generation sequencing approach to resolve spider phylogeny, examining the relationships among its major lineages. We further explore possible pitfalls in phylogenomic reconstruction, including missing data, unequal rates of evolution, and others. Analyses of multiple data sets all agree on the basic structure of the spider tree and all reject the long-accepted monophyly of Orbiculariae, by placing the cribellate orb weavers (Deinopoidea) with other groups and not with the ecribellate orb weavers (Araneoidea). These results imply independent origins for the two types of orb webs (cribellate and ecribellate) or a much more ancestral origin of the orb web with subsequent loss in the so-called RTA clade. Either alternative demands a major reevaluation of our current understanding of the spider evolutionary chronicle.

  17. Local tolerance to spider silks and protein polymers in vivo. (United States)

    Vollrath, F; Barth, P; Basedow, A; Engström, W; List, H


    Spider silks were implanted subcutaneously in pigs for a study of the tolerance against this material. Four types of spider silks of high purity and cleanliness were implanted: (i) major ampullate dragline silk reeled from the golden silk spider Nephila clavipes, (ii) native (unsterilised) silk reeled from a Brachypelma spider, (iii) native silk taken from this spider's web and (iv) its web silk thermally treated at 80 degrees C. For comparison we used fibrous silk analogue protein polymers and four already marketed wound dressings (polyurethane film, collagen dressings, gauze pads). All materials were applied epicutaneously to split skin wounds. The implants were examined macroscopically as well as by light microscopy. Superficially, all sites healed rapidly. There were marked inflammatory reactions in all sites with lympho-plasmacellular infiltrations, evidence of phagocytosis and granuloma formation as indicated by the appearance of giant cells. However there was a marked absence of epitheloid cells indicating that the observed reaction was a foreign body granuloma. Furthermore, the histopathological images recorded after 14 days revealed no marked differences between the dressings. Polyurethane films, however, seemed to be superior with respect to the duration of the wound healing process. PMID:12224131

  18. Visual odometry in the wolf spider Lycosa tarantula (Araneae: Lycosidae). (United States)

    Ortega-Escobar, J; Ruiz, M A


    The wolf spider Lycosa tarantula homes using path integration. The angular component of the displacement is measured using a polarized-light compass associated with the functioning of the anterior median eyes. However, how L. tarantula estimates the linear component of the displacement was not known prior to this investigation. The ability of L. tarantula to gauge the distance walked after being displaced from its burrow was investigated using experimental channels placed in an indoor setup. Firstly, we manipulated the perception of visual stimuli by covering all the spider's eyes. Secondly, we changed the optic flow supplied by a black-and-white grating (λ=2 cm) perceived either in the lateral or in the ventral field of view. Finally, the period of the lateral or ventral grating was changed from λ=2 cm to λ=1 cm. Our results indicate that visual information contributes to distance estimation because when the spider's eyes were covered, the spiders tended to search for the burrow at very variable distances. This visual information is created by the motion of the image as the spider walks, the motion in the lateral field of view being the most important. The preference of a lateral optic flow over the ventral flow can be explained by the difference in the resolution capacity of the posterior lateral eyes and the anterior lateral eyes. PMID:24477612

  19. On the Formation of Brown Dwarfs

    CERN Document Server

    Jiang, I G; Lin, D N C; Jiang, Ing-Guey


    The observational properties of brown dwarfs pose challenges to the theory of star formation. Because their mass is much smaller than the typical Jeans mass of interstellar clouds, brown dwarfs are most likely formed through secondary fragmentation processes, rather than through the direct collapse of a molecular cloud core. In order to prevent substantial post-formation mass accretion, young brown dwarfs must leave the high density formation regions in which they form. We propose here that brown dwarfs are formed in the circumbinary disks. Through post-formation dynamical interaction with their host binary stars, young brown dwarfs are either scattered to large distance or removed, with modest speed, from their cradles.

  20. Prey interception drives web invasion and spider size determines successful web takeover in nocturnal orb-web spiders

    Directory of Open Access Journals (Sweden)

    Wenjin Gan


    Full Text Available A striking feature of web-building spiders is the use of silk to make webs, mainly for prey capture. However, building a web is energetically expensive and increases the risk of predation. To reduce such costs and still have access to abundant prey, some web-building spiders have evolved web invasion behaviour. In general, no consistent patterns of web invasion have emerged and the factors determining web invasion remain largely unexplored. Here we report web invasion among conspecifics in seven nocturnal species of orb-web spiders, and examined the factors determining the probability of webs that could be invaded and taken over by conspecifics. About 36% of webs were invaded by conspecifics, and 25% of invaded webs were taken over by the invaders. A web that was built higher and intercepted more prey was more likely to be invaded. Once a web was invaded, the smaller the size of the resident spider, the more likely its web would be taken over by the invader. This study suggests that web invasion, as a possible way of reducing costs, may be widespread in nocturnal orb-web spiders.

  1. Investigating the efficacy of attention bias modification in reducing high spider fear: The role of individual differences in initial bias


    Fox, E; Zougkou, K; Ashwin, C; Cahill, S


    Background and objectives Attention Bias Modification (ABM) targets attention bias (AB) towards threat and is a potential therapeutic intervention for anxiety. The current study investigated whether initial AB (towards or away from spider images) influenced the effectiveness of ABM in spider fear. Methods AB was assessed with an attentional probe task consisting of spider and neutral images presented simultaneously followed by a probe in spider congruent or spider incongruent loca...

  2. Interactions Between the Chilean Recluse Spider (Araneae: Sicariidae) and an Araneophagic Spitting Spider (Araneae: Scytodidae). (United States)

    Canals, Mauricio; Arriagada, Nicolás; Solís, Rigoberto


    In Chile, all necrotic arachnidism is attributed to the Chilean recluse spider, Loxosceles laeta Nicolet, a species that shares the microenvironmental habitats with the spitting spider Scytodes globula Nicolet. The latter species has been proposed as a potential predator of L. laeta. For this research, we studied the interaction between both species during individual encounters to assess the possibility of population regulation of L. laeta cohorts exposed to this potential predator. We found that in most encounters S. globula prevailed. Also, S. globula preys on spiderlings of L. laeta, with a population effect on cohorts of this species. These findings suggest that S. globula may be influencing L. laeta populations in central Chile. The population regulation of L. laeta by predation would be important because this species, in the absence of predators, has a high reproductive rate, and it can maintain populations of large size. However according to our results, although S. globula may aid in the reduction of both spiderling and adult L. laeta populations, and perhaps other Loxosceles species, it is insufficient for biological control of Loxosceles species. Its presence together with other control measures such as hygiene of the rooms can help to decrease loxoscelism incidence. PMID:26336293

  3. Heterologous expression of an insecticidal gene from the armed spider (Phoneutria nigriventer

    Directory of Open Access Journals (Sweden)

    J. E. F. Figueiredo


    Full Text Available Insect-pests are global problems that cause severe damage to crop plants, and their control is commonly based on chemical insecticides. However, negative effects of pesticides on the environment and human health emphasize the necessity to develop alternative methods for insect-pest control. In the present study, a gene coding for the insecticidal peptide TX4(6-1 of the Brazilian armed spider (Phoneutria nigriventer was cloned in fusion with maltose binding protein (MBP and expressed in Escherichia coli. The affinity purified protein MBP-GlyTX4 was cleaved with the Xa factor and used for a bioassay against Spodoptera frugiperda and rabbit immunization. Five micrograms GlyTX4 protein injected into the hemocoel of larvae and abdominal cavity of adults produced trembling and uncoordinated movements immediately after injection and all adult insects died after 12h. After two days, larvae became paralyzed and the epidermal color changed to dark brown. Furthermore, the development stage was prolonged for two weeks. Alternatively, slices of maize leaves were imbibed with 15 micrograms of the recombinant protein cleaved with the Xa factor and used as diet for larvae. In this experiment, all larvae died in about 30 minutes. Polyclonal antibodies anti-MBP-GlyTX4 were effective for recognizing MBP and GlyTX4 in whole cell extract from E. coli expressing the recombinant protein.

  4. Recombinant Spider Silks—Biopolymers with Potential for Future Applications

    Directory of Open Access Journals (Sweden)

    Thomas Scheibel


    Full Text Available Nature has evolved a range of materials that compete with man-made materials in physical properties; one of these is spider silk. Silk is a fibrous material that exhibits extremely high strength and toughness with regard to its low density. In this review we discuss the molecular structure of spider silk and how this understanding has allowed the development of recombinant silk proteins that mimic the properties of natural spider silks. Additionally, we will explore the material morphologies and the applications of these proteins. Finally, we will look at attempts to combine the silk structure with chemical polymers and how the structure of silk has inspired the engineering of novel polymers.

  5. Acute generalized exanthematous pustulosis associated with spider bite* (United States)

    Milman, Laura de Mattos; Müller, Giana Paula; Souza, Paulo Ricardo Martins; Grill, Aline Barcellos; Rhoden, Deise Louise Bohn; Mello-da-Silva, Carlos Augusto; Vettorato, Gerson


    Acute generalized exanthematous pustulosis (AGEP) is an acute febrile rash, usually induced by drugs, which recently has been linked to spider bite. We report a case of a male patient, 48 years old, with an erythematous rash accompanied by fever and small non-follicular pustules. He reported previous pain in the buttock with the onset of a necrotic plaque. The lesion was compatible with spider bite of the genus Loxosceles. According to the EuroSCAR group instrument, the patient scored +10 indicating definite diagnosis of AGEP. As the patient had a compatible lesion and had no other triggers of AGEP, in an Loxosceles endemic area, the AGEP would be associated with spider bite, as described in other publications. PMID:27579754

  6. Final design of thermal diagnostic system in SPIDER ion source (United States)

    Brombin, M.; Dalla Palma, M.; Pasqualotto, R.; Pomaro, N.


    The prototype radio frequency source of the ITER heating neutral beams will be first tested in SPIDER test facility to optimize H- production, cesium dynamics, and overall plasma characteristics. Several diagnostics will allow to fully characterise the beam in terms of uniformity and divergence and the source, besides supporting a safe and controlled operation. In particular, thermal measurements will be used for beam monitoring and system protection. SPIDER will be instrumented with mineral insulated cable thermocouples, both on the grids, on other components of the beam source, and on the rear side of the beam dump water cooled elements. This paper deals with the final design and the technical specification of the thermal sensor diagnostic for SPIDER. In particular the layout of the diagnostic, together with the sensors distribution in the different components, the cables routing and the conditioning and acquisition cubicles are described.

  7. Molecular architecture and engineering of spider dragline silk protein

    Institute of Scientific and Technical Information of China (English)

    ZHANG Hengmu; LIU Jinyuan


    Spider dragline silk, which is produced in spider major ampullate gland, is a composite proteinacious fiber with highly repetitive Ala-Gly-rich domain. The unique combination of both high tensile strength and high elasticity makes spider dragline silk superior to almost any other natural or synthetic fibers. Cloning of the genes reveals that the silk is composed of at least two major proteins. Each protein component contains multiple repeats of modular structures that alternate between Ala-rich domains and Gly-rich domains. Molecular engineering not only opens a door to the production of spidroins but also provides a valuable experimental system to test and further establish the relationship between modular structures and mechanical properties. Here, based on our own studies, we review the latest progress of the modular structure and genetic engineering and outline the future prospects.

  8. Production of spider silk proteins in tobacco and potato. (United States)

    Scheller, J; Gührs, K H; Grosse, F; Conrad, U


    Spider dragline silk is a proteinaceous fiber with remarkable mechanical properties that make it attractive for technical applications. Unfortunately, the material cannot be obtained in large quantities from spiders. We have therefore generated transgenic tobacco and potato plants that express remarkable amounts of recombinant Nephila clavipes dragline proteins. Using a gene synthesis approach, the recombinant proteins exhibit homologies of >90% compared to their native models. Here, we demonstrate the accumulation of recombinant silk proteins, which are encoded by synthetic genes of 420-3,600 base pairs, up to a level of at least 2% of total soluble protein in the endoplasmic reticulum (ER) of tobacco and potato leaves and potato tubers, respectively. Using the present expression system, spider silk proteins up to 100 kDa could be detected in plant tissues. When produced in plants, the recombinant spidroins exhibit extreme heat stability-a property that is used to purify the spidroins by a simple and efficient procedure.

  9. Bird predation affects diurnal and nocturnal web-building spiders in a Mediterranean citrus grove (United States)

    Mestre, L.; Garcia, N.; Barrientos, J. A.; Espadaler, X.; Piñol, J.


    Spiders and birds can greatly decrease insect populations, but birds also limit spider densities in some habitats. Bird predation is thought to be one of the causes behind nocturnal activity in spiders, so night-active spiders that hide in retreats during the day should be less affected by bird foraging than day-active spiders. However, this hypothesis has not yet been tested. We investigated the importance of bird predation on the spider community of a Mediterranean organic citrus grove. We excluded birds by placing net cages over the trees and we conducted visual searches in the canopies to sample web-building spiders. As there are many nocturnal species in the family Araneidae, we conducted searches both by day and by night to compare the abundance of active araneids in these two time periods. We sampled the tree trunks with cardboard bands to collect hunting spiders. In bird-excluded canopies there were more spiders of the families Araneidae and Theridiidae. There were higher numbers of active Araneidae at night, but these were just as negatively affected by bird predation as day-active Araneidae, so there was no evidence of nocturnal activity serving as an anti-predator strategy. We did not find any negative impact of birds on hunting spiders. Our results contrast with other studies reporting a negative effect of birds on hunting but not on web-building spiders.

  10. Function of bright coloration in the wasp spider Argiope bruennichi (Araneae: Araneidae). (United States)

    Bush, Alex A; Yu, Douglas W; Herberstein, Marie E


    There are two major competing explanations for the counter-intuitive presence of bright coloration in certain orb-web spiders. Bright coloration could lure insect prey to the web vicinity, increasing the spider's foraging success. Alternatively, the markings could function as disruptive camouflage, making it difficult for the insect prey to distinguish spiders from background colour variation. We measured the prey capture rates of wasp spiders, Argiope bruennichi, that were blacked out, shielded from view using a leaf fragment, or left naturally coloured. Naturally coloured spiders caught over twice the number of prey as did either blacked-out or leaf-shielded spiders, and almost three times as many orthopteran prey. Spectrophotometer measurements suggest that the bright yellow bands on the spider's abdomen are visible to insect prey, but not the banding on the legs, which could disguise the spider's outline. Thus, our results provide strong support for the hypothesis that bright coloration in the wasp spider acts as a visual lure for insect prey and weak support for the hypothesis that the arrangement of the banding pattern across the spider's body disguises the presence of the spider on the web. PMID:18331982

  11. How spiders practice aggressive and Batesian mimicry

    Institute of Scientific and Technical Information of China (English)

    Ximena J.NELSON; Robert R.JACKSON


    To understand communication,the interests of the sender and the receiver/s of signals should be considered separately.When our goal is to understand the adaptive significance of specific responses to specific signals by the receiver,questions about signal information are useful.However,when our goal is to understand the adaptive significance to the sender of generating a signal,it may be better to envisage the receiver's response to signals as part of the sender's extended phenotype.By making signals,a sender interfaces with the receiver's model of the world and indirectly manipulates its behaviour.This is especially clear in cases of mimicry,where animals use deceptive signals that indirectly manipulate the behaviour of receivers.Many animals adopt Batesian mimicry to deceive their predators,or aggressive mimicry to deceive their prey.We review examples from the literature on spiders to illustrate how these phenomena,traditionally thought of as distinct,can become entangled in a web of lies.

  12. Thermal architecture for the SPIDER flight cryostat

    CERN Document Server

    Gudmundsson, J E; Amiri, M; Benton, S J; Bihary, R; Bock, J J; Bond, J R; Bonetti, J A; Bryan, S A; Chiang, H C; Contaldi, C R; Crill, B P; O'Dea, D; Farhang, M; Filippini, J P; Fissel, L M; Gandilo, N N; Golwala, S R; Halpern, M; Hasselfield, M; Helson, K R; Hilton, G; Holmes, W; Hristov, V V; Irwin, K D; Jones, W C; Kuo, C L; MacTavish, C J; Mason, P V; Montroy, T E; Morford, T A; Netterfield, C B; Rahlin, A S; Reintsema, C D; Ruhl, J E; Runyan, M C; Schenker, M A; Shariff, J A; Soler, J D; Trangsrud, A; Tucker, C; Tucker, R S; Turner, A D; 10.1117/12.857925


    We describe the cryogenic system for SPIDER, a balloon-borne microwave polarimeter that will map 8% of the sky with degree-scale angular resolution. The system consists of a 1284 L liquid helium cryostat and a 16 L capillary-filled superfluid helium tank, which provide base operating temperatures of 4 K and 1.5 K, respectively. Closed-cycle helium-3 adsorption refrigerators supply sub-Kelvin cooling power to multiple focal planes, which are housed in monochromatic telescope inserts. The main helium tank is suspended inside the vacuum vessel with thermally insulating fiberglass flexures, and shielded from thermal radiation by a combination of two vapor cooled shields and multi-layer insulation. This system allows for an extremely low instrumental background and a hold time in excess of 25 days. The total mass of the cryogenic system, including cryogens, is approximately 1000 kg. This enables conventional long duration balloon flights. We will discuss the design, thermal analysis, and qualification of the cryog...

  13. Thermal architecture for the SPIDER flight cryostat (United States)

    Gudmundsson, J. E.; Ade, P. A. R.; Amiri, M.; Benton, S. J.; Bihary, R.; Bock, J. J.; Bond, J. R.; Bonetti, J. A.; Bryan, S. A.; Burger, B.; Chiang, H. C.; Contaldi, C. R.; Crill, B. P.; Doré, O.; Farhang, M.; Filippini, J.; Fissel, L. M.; Gandilo, N. N.; Golwala, S. R.; Halpern, M.; Hasselfield, M.; Hilton, G.; Holmes, W.; Hristov, V. V.; Irwin, K. D.; Jones, W. C.; Kuo, C. L.; MacTavish, C. J.; Mason, P. V.; Montroy, T. E.; Morford, T. A.; Netterfield, C. B.; O'Dea, D. T.; Rahlin, A. S.; Reintsema, C. D.; Ruhl, J. E.; Runyan, M. C.; Schenker, M. A.; Shariff, J. A.; Soler, J. D.; Trangsrud, A.; Tucker, C.; Tucker, R. S.; Turner, A. D.


    We describe the cryogenic system for SPIDER, a balloon-borne microwave polarimeter that will map 8% of the sky with degree-scale angular resolution. The system consists of a 1284 L liquid helium cryostat and a 16 L capillary-filled superfluid helium tank, which provide base operating temperatures of 4 K and 1.5 K, respectively. Closed-cycle 3He adsorption refrigerators supply sub-Kelvin cooling power to multiple focal planes, which are housed in monochromatic telescope inserts. The main helium tank is suspended inside the vacuum vessel with thermally insulating fiberglass flexures, and shielded from thermal radiation by a combination of two vapor cooled shields and multi-layer insulation. This system allows for an extremely low instrumental background and a hold time in excess of 25 days. The total mass of the cryogenic system, including cryogens, is approximately 1000 kg. This enables conventional long duration balloon flights. We will discuss the design, thermal analysis, and qualification of the cryogenic system.

  14. Predator perception of detritus and eggsac decorations spun by orb-web spiders Cyclosa octotuberculata: Do they function to camouflage the spiders?


    Wenjin GAN, Fengxiang LIU, Zengtao ZHANG, Daiqin LI


    Camouflage is one of the most widespread and powerful strategies that animals use to make detection/recognition more difficult. Many orb-web spiders of the genus Cyclosa add prey remains, plant debris, moults, and/or eggsacs to their webs called web decorations. Web decorations resembling spider body colour pattern have been considered to camouflage the spider from predators. While this camouflage is obvious from a human’s perspective, it has rarely been investigated from a predator’s perspec...

  15. Prey type, vibrations and handling interactively influence spider silk expression. (United States)

    Blamires, S J; Chao, I-C; Tso, I-M


    The chemical and mechanical properties of spider major ampullate (MA) silks vary in response to different prey, mostly via differential expression of two genes - MaSp1 and MaSp2 - although the spinning process exerts additional influence over the mechanical properties of silk. The prey cues that initiate differential gene expression are unknown. Prey nutrients, vibratory stimuli and handling have been suggested to be influential. We performed experiments to decouple the vibratory stimuli and handling associated with high and low kinetic energy prey (crickets vs flies) from their prey nutrients to test the relative influence of each as inducers of silk protein expression in the orb web spider Nephila pilipes. We found that the MA silks from spiders feeding on live crickets had greater percentages of glutamine, serine, alanine and glycine than those from spiders feeding on live flies. Proline composition of the silks was unaffected by feeding treatment. Increases in alanine and glycine in the MA silks of the live-cricket-feeding spiders indicate a probable increase in MaSp1 gene expression. The amino acid compositions of N. pilipes feeding on crickets with fly stimuli and N. pilipes feeding on flies with cricket stimuli did not differ from each other or from pre-treatment responses, so these feeding treatments did not induce differential MaSp expression. Our results indicate that cricket vibratory stimuli and handling interact with nutrients to induce N. pilipes to adjust their gene expression to produce webs with mechanical properties appropriate for the retention of this prey. This shows that spiders can genetically alter their silk chemical compositions and, presumably, mechanical properties upon exposure to different prey types. The lack of any change in proline composition with feeding treatment in N. pilipes suggests that the MaSp model determined for Nephila clavipes is not universally applicable to all Nephila.

  16. The implications of marital history change on women's eligibility for Social Security wife and widow benefits, 1990-2009. (United States)

    Iams, Howard M; Tamborini, Christopher R


    Social Security retirement benefits in the United States (US) reflect marital histories and lifetime earnings of current and former married couples. Focusing on the link between marital history and benefit eligibility, this article examines women's marital patterns over the past two decades. Using the 1990 and 2009 Marital History Modules to the Census Bureau's Survey of Income and Program Participation, descriptive/regression analysis reveals substantial changes in women's marital patterns among baby boomers and generation Xers. Those changes have prompted a decline in qualifying marital histories for Social Security spouse and widow benefits. The findings also reveal substantial variation by race/ethnicity. Black women are significantly more likely to be potentially ineligible for a marriage-based benefit than white women, particularly in more recent cohorts. Hispanic women's marriage-based eligibility is between that of black and white women. US-born Hispanic women had higher shares without a qualifying marital history compared with the foreign born. PMID:22799136

  17. Silk reinforced with graphene or carbon nanotubes spun by spiders


    Lepore, Emiliano; Bonaccorso, Francesco; Bruna, Matteo; Bosia, Federico; Taioli, Simone; Garberoglio, Giovanni; Ferrari, Andrea C.; Pugno, Nicola Maria


    Here, we report the production of silk incorporating graphene and carbon nanotubes directly by spider spinning, after spraying spiders with the corresponding aqueous dispersions. We observe a significant increment of the mechanical properties with respect to the pristine silk, in terms of fracture strength, Young's and toughness moduli. We measure a fracture strength up to 5.4 GPa, a Young's modulus up to 47.8 GPa and a toughness modulus up to 2.1 GPa, or 1567 J/g, which, to the best of our k...

  18. Learning from animal sensors: the clever "design" of spider mechanoreceptors (United States)

    Barth, Friedrich G.


    Three types of spider sensors responding to different forms of mechanical energy are chosen to illustrate the power of evolutionary constraints to fine-tune the functional "design" of animal sensors to the particular roles they play in particular behavioral contexts. As demonstrated by the application of computational biomechanics and a fruitful cooperation between biologists and engineers there are remarkable "technical" tricks to be found by which spider tactile sensors, airflow sensors, and strain sensors are adjusted to their biologically relevant stimulus patterns. The application of such "tricks" to technical solutions of measuring problems similar to those animals have to cope with, seems both realistic and very promising.

  19. Volatile compounds from leaves of the African spider plant (Gynandropsis gynandra) with bioactivity against spider mite (Tetranychus urticae)

    DEFF Research Database (Denmark)

    Nyalala, Samuel Odeyo; Petersen, Mikael Agerlin; Grout, Brian William Wilson


    Previous studies have demonstrated that Gynandropsis gynandra emits acetonitrile as a foliar volatile from intact plants and isolated leaves, and that this compound is an effective spider mite repellent. This study has used gas chromatography–mass spectrometry to investigate volatile compounds...... emitted from homogenised G. gynandra leaves to evaluate their tissue acetonitrile content and to look for other compounds that might be exploited for the management of spider mites. Acetonitrile was absent from the homogenised tissues of five lines of G. gynandra, studied over two seasons. Thirteen...... volatile compounds were emitted by G. gynandra at significantly higher levels than mite-susceptible pot roses, including isothiocyanates, aldehydes, esters, alcohols and terpenes. Six representative compounds were selected to assess bioactivity. Spider mite populations were completely inactive after a 2¿h...

  20. Microlensing, Brown Dwarfs and GAIA

    CERN Document Server

    Evans, N W


    The GAIA satellite can precisely measure the masses of nearby brown dwarfs and lower main sequence stars by the microlensing effect. The scientific yield is maximised if the microlensing event is also followed with ground-based telescopes to provide densely sampled photometry. There are two possible strategies. First, ongoing events can be triggered by photometric or astrometric alerts by GAIA. Second, events can be predicted using known high proper motion stars as lenses. This is much easier, as the location and time of an event can be forecast. Using the GAIA source density, we estimate that the sample size of high proper motion ($>300$ mas yr$^{-1}$) brown dwarfs needed to provide predictable events during the 5 year mission lifetime is surprisingly small, only of the order of a hundred. This is comparable to the number of high proper motion brown dwarfs already known from the work of the UKIDSS Large Area Survey and the all-sky WISE satellite. Provided the relative parallax of the lens and the angular Ein...

  1. Sequential presentation of bilateral Brown syndrome. (United States)

    Sekeroğlu, Hande Taylan; Türkçüoğlu, Peykan; Sanaç, Ali Şefik; Sener, Emin Cumhur


    Brown syndrome, characterized by a limitation of elevation in adduction and positive forced duction testing, is usually unilateral but occurs bilaterally in 10% of all cases. It may present as a congenital condition in one eye and develop in the other eye with no apparent cause. We present a case of bilateral Brown syndrome in which the right eye became involved within 1 year of surgery on the left eye for congenital Brown syndrome.

  2. Acidic Residues Control the Dimerization of the N-terminal Domain of Black Widow Spiders’ Major Ampullate Spidroin 1 (United States)

    Bauer, Joschka; Schaal, Daniel; Eisoldt, Lukas; Schweimer, Kristian; Schwarzinger, Stephan; Scheibel, Thomas


    Dragline silk is the most prominent amongst spider silks and comprises two types of major ampullate spidroins (MaSp) differing in their proline content. In the natural spinning process, the conversion of soluble MaSp into a tough fiber is, amongst other factors, triggered by dimerization and conformational switching of their helical amino-terminal domains (NRN). Both processes are induced by protonation of acidic residues upon acidification along the spinning duct. Here, the structure and monomer-dimer-equilibrium of the domain NRN1 of Latrodectus hesperus MaSp1 and variants thereof have been investigated, and the key residues for both could be identified. Changes in ionic composition and strength within the spinning duct enable electrostatic interactions between the acidic and basic pole of two monomers which prearrange into an antiparallel dimer. Upon naturally occurring acidification this dimer is stabilized by protonation of residue E114. A conformational change is independently triggered by protonation of clustered acidic residues (D39, E76, E81). Such step-by-step mechanism allows a controlled spidroin assembly in a pH- and salt sensitive manner, preventing premature aggregation of spider silk proteins in the gland and at the same time ensuring fast and efficient dimer formation and stabilization on demand in the spinning duct. PMID:27681031

  3. Spiders do not escape reproductive manipulations by Wolbachia

    Directory of Open Access Journals (Sweden)

    Hendrickx Frederik


    Full Text Available Abstract Background Maternally inherited bacteria that reside obligatorily or facultatively in arthropods can increase their prevalence in the population by altering their hosts' reproduction. Such reproductive manipulations have been reported from the major arthropod groups such as insects (in particular hymenopterans, butterflies, dipterans and beetles, crustaceans (isopods and mites. Despite the observation that endosymbiont bacteria are frequently encountered in spiders and that the sex ratio of particular spider species is strongly female biased, a direct relationship between bacterial infection and sex ratio variation has not yet been demonstrated for this arthropod order. Results Females of the dwarf spider Oedothorax gibbosus exhibit considerable variation in the sex ratio of their clutches and were infected with at least three different endosymbiont bacteria capable of altering host reproduction i.e. Wolbachia, Rickettsia and Cardinium. Breeding experiments show that sex ratio variation in this species is primarily maternally inherited and that removal of the bacteria by antibiotics restores an unbiased sex ratio. Moreover, clutches of females infected with Wolbachia were significantly female biased while uninfected females showed an even sex ratio. As female biased clutches were of significantly smaller size compared to non-distorted clutches, killing of male embryos appears to be the most likely manipulative effect. Conclusions This represents to our knowledge the first direct evidence that endosymbiont bacteria, and in particular Wolbachia, might induce sex ratio variation in spiders. These findings are pivotal to further understand the diversity of reproductive phenotypes observed in this arthropod order.

  4. Competition between introduced and native spiders (Araneae: Linyphiidae) (United States)

    Houser, J.D.; Ginsberg, Howard S.; Jakob, Elizabeth M.


    The European sheet-web spider Linyphia triangularis (Araneae: Linyphiidae) has become established in Maine, where it often reaches very high densities. Two lines of evidence from previous work suggest that L. triangularis affects populations of the native linyphiid spider Frontinella communis. First, F. communis individuals are relatively scarce in both forest and coastal habitat where L. triangularis is common, but more common where L. triangularis is at low density. Second, in field experiments, F. communis species are less likely to settle in experimental plots when L. triangularis is present, and F. communis disappears from study plots when L. triangularis is introduced. Here we test two mechanisms that may underlie these patterns. First, we tested whether L. triangularis invades and usurps the webs of F. communis. When spiders were released onto webs of heterospecifics, L. triangularis was more likely to take over or share webs of F. communis than the reverse. We also observed natural takeovers of F. communis webs. Second, we explored the hypothesis that L. triangularis reduces prey availability for native species. We sampled flying prey in areas with L. triangularis and those where it had been removed, and found no effect of spider presence on measured prey density. We also found no effect of prey supplementation on web tenacity in F. communis, suggesting that F. communis movements are not highly dependent on prey availability. We conclude that web takeover is likely more important than prey reduction in driving negative effects of L. triangularis on F. communis.

  5. Spiders (Araneae) as polyphagous natural enemies in orchards

    NARCIS (Netherlands)

    Bogya, S.


    Spiders (Araneae) occur in high abundance in all terrestrial ecosystems including agro-ecosystems. They are a very heterogeneous group of animals with different hunting tactics and therefore they play very different ecological roles. At family level these tactics are rather similar thus properties a

  6. Infanticide by a solitary koinobiont ichneumonid ectoparasitoid of spiders (United States)

    Takasuka, Keizo; Matsumoto, Rikio


    When encountering an already parasitized host, a parasitoid's optimal choices (superparasitism, host rejection, host feeding or infanticide) seem to depend on the individual species' life history, because the same choice may have different fitness consequences. We demonstrate infanticide under laboratory conditions by a polysphinctine, Zatypota albicoxa, which is a solitary koinobiont ectoparasitoid of spiders. The female always removed any previously attached egg or larva from the body of the host spider, Parasteatoda tepidariorum, with a rubbing behaviour. She rubbed her ovipositor back and forth toward the undersurface of the attached egg or of the saddle under the attached larva to pry it off and laid an egg after removal. When removing a larva, the infanticidal female engaged exclusively in unfastening the `saddle' which fastens the larva to the body of the spider. All larvae were removed with the `saddle' attached to the ventral surface of the body. The female invested more time to remove the medium second and the large penultimate instar larvae than to remove eggs and first instar larvae because of the labour involved in unfastening the saddle. Oviposition with infanticide of the medium second and the penultimate instar larvae imposed more time upon the female than that on an unparasitized host. Removal of any previous occupant in spite of the associated labour costs suggests that infanticide will always be adaptive, no matter the time costs to Z. albicoxa, because so much is invested in attacking the host and because the parasitoid cannot detect whether the spider is already parasitized until she achieves subjugation.

  7. Preservice Teachers' Conceptions about Animals and Particularly about Spiders (United States)

    Jambrina, Carmen Urones; Vacas, Jose Manuel; Sanchez-Barbudo, Miguel


    Introduction: This article explores the scientific ideas and alternative conceptions that pre-service teachers have regarding animal classification and spiders in particular. Method: The study involved 40 pre-service teachers of elementary education in Spain and the data was collected by means of questionnaires, descriptions and drawings. The…

  8. ArachnoServer: a database of protein toxins from spiders

    Directory of Open Access Journals (Sweden)

    Kaas Quentin


    Full Text Available Abstract Background Venomous animals incapacitate their prey using complex venoms that can contain hundreds of unique protein toxins. The realisation that many of these toxins may have pharmaceutical and insecticidal potential due to their remarkable potency and selectivity against target receptors has led to an explosion in the number of new toxins being discovered and characterised. From an evolutionary perspective, spiders are the most successful venomous animals and they maintain by far the largest pool of toxic peptides. However, at present, there are no databases dedicated to spider toxins and hence it is difficult to realise their full potential as drugs, insecticides, and pharmacological probes. Description We have developed ArachnoServer, a manually curated database that provides detailed information about proteinaceous toxins from spiders. Key features of ArachnoServer include a new molecular target ontology designed especially for venom toxins, the most up-to-date taxonomic information available, and a powerful advanced search interface. Toxin information can be browsed through dynamic trees, and each toxin has a dedicated page summarising all available information about its sequence, structure, and biological activity. ArachnoServer currently manages 567 protein sequences, 334 nucleic acid sequences, and 51 protein structures. Conclusion ArachnoServer provides a single source of high-quality information about proteinaceous spider toxins that will be an invaluable resource for pharmacologists, neuroscientists, toxinologists, medicinal chemists, ion channel scientists, clinicians, and structural biologists. ArachnoServer is available online at

  9. Incidense of spider mites in South Texas cotton fields (United States)

    The incidence of spider mites was evaluated· in four locations of south Texas between Progreso (Hidalgo Co.) to Bishop (Nueces Co.). This is an area with a south to north transect of 125 miles from south Progreso to north Bishop (respectively).The other two intermediate sampled locations were Harlin...

  10. On the Colours of Spider Orb-Webs (United States)

    Suhr, Wilfried; Schlichting, H. Joachim


    A sticky capture thread from the spiral element of spider orb-webs is formed of almost regularly spaced droplets that surround a supporting axial fibre. From the perspective of physical optics it represents a periodic linear array of scattering elements that acts as a diffraction grating. This is a novel aspect, which is of vital importance for…

  11. Mating duration and sperm precedence in the spider Linyphia triangularis

    DEFF Research Database (Denmark)

    Weldingh, Ditte L.; Toft, Søren; Larsen, Ole Næsbye


    , especially the males, are able to influence the outcome of mating for their own benefit. We studied the linyphiid spider Linyphia triangularis in which mating follows a strict sequence during which the male inducts two droplets of sperm and transfers them to the female. We performed sperm competition...

  12. The Spider's Web: Creativity and Survival in Dynamic Balance. (United States)

    Cohen, Bill


    The spider's web is presented as a model for Indigenous education and community transformation, grounded in Okanagan philosophy. Children are at the center and benefit from the influence of extended family and community. The model's relevance for language revitalization, cultural maintenance, and educational planning and assessment is discussed.…

  13. Surprising Legacies of Brown v. Board


    Minow, Martha Louise


    Perhaps the most powerful legacy of Brown v. Board is this: opponents in varied political battles fifty years later each claim ties to the decision and its meaning. So although the analogy between Brown and same-sex marriage has divided Black clergy, each side vies to inherit the civil rights heritage. President George W. Bush invoked Brown in opposing race-conscious college admission practices. The success of Brown in reshaping the moral landscape has been so profound that I fear we do not f...


    Directory of Open Access Journals (Sweden)

    Violeta Trandafir


    Full Text Available Brown tumor arises as a direct result of the effect of parathyroid hormone on bone tissue in some patients with hyperparathyroidism. The lesion localizes in areas of intense bone resorbtion, and the bone defect becomes filled with fibroblastic tissue that can deform the bone and simulate a neoplastic process. Brown tumors can affect the mandible, maxilla, clavicle, ribs and pelvic bones. Most patients with hyperparathyroidism are asymptomatic. Skeletal changes may represent the first manifestations of the disease. Radiologically, brown tumor in the jaws presents as a well-defined radiolucent osteolytic lesion, making it hard to differentiate it from other maxillary expansive lesions that can present with a similar imaging. Brown tumors exhibit no pathognomonic histologic changes. Differentiating between a brown tumor and other giant-cell tumors may be very difficult, even with histology. A final diagnosis can be defined only by evaluating the radiological findings with histopathological, laboratory and clinical data. At present, brown tumor is considered as a reparative cellular process rather than a real neoplasia. This phenomenon is considered as pathognomonic of hyperparathyroidism secondary to renal failure, especially in patients on long-term hemodialysis. The initial treatment of brown tumor involves control of hyperparathyroidism, regardless of whether it is primary or secondary. The clinical management of brown tumor aims primarily to reduce the elevated parathyroid hormone levels by pharmacological treatment. Surgical treatment is reserved to nonresponders or to patients with painful symptomatology or alteration of normal function. Brown tumor can recur if hyperparathyroidism persists or recurs.

  15. The Engrailed-1 Gene Stimulates Brown Adipogenesis

    Directory of Open Access Journals (Sweden)

    Chuanhai Zhang


    Full Text Available As a thermogenic organ, brown adipose tissue (BAT has received a great attention in treating obesity and related diseases. It has been reported that brown adipocyte was derived from engrailed-1 (EN1 positive central dermomyotome. However, functions of EN1 in brown adipogenesis are largely unknown. Here we demonstrated that EN1 overexpression increased while EN1 knockdown decreased lipid accumulation and the expressions of key adipogenic genes including PPARγ2 and C/EBPα and mitochondrial OXPHOS as well as BAT specific marker UCP1. Taken together, our findings clearly indicate that EN1 is a positive regulator of brown adipogenesis.

  16. Brown Fat and Browning for the Treatment of Obesity and Related Metabolic Disorders

    Directory of Open Access Journals (Sweden)

    So Hun Kim


    Full Text Available Brown fat is a specialized fat depot that can increase energy expenditure and produce heat. After the recent discovery of the presence of active brown fat in human adults and novel transcription factors controlling brown adipocyte differentiation, the field of the study of brown fat has gained great interest and is rapidly growing. Brown fat expansion and/or activation results in increased energy expenditure and a negative energy balance in mice and limits weight gain. Brown fat is also able to utilize blood glucose and lipid and results in improved glucose metabolism and blood lipid independent of weight loss. Prolonged cold exposure and beta adrenergic agonists can induce browning of white adipose tissue. The inducible brown adipocyte, beige adipocyte evolving by thermogenic activation of white adipose tissue have different origin and molecular signature from classical brown adipocytes but share the characteristics of high mitochondria content, UCP1 expression and thermogenic capacity when activated. Increasing browning may also be an efficient way to increase whole brown fat activity. Recent human studies have shown possibilities that findings in mice can be reproduced in human, making brown fat a good candidate organ to treat obesity and its related disorders.

  17. Nonlinear material behaviour of spider silk yields robust webs. (United States)

    Cranford, Steven W; Tarakanova, Anna; Pugno, Nicola M; Buehler, Markus J


    Natural materials are renowned for exquisite designs that optimize function, as illustrated by the elasticity of blood vessels, the toughness of bone and the protection offered by nacre. Particularly intriguing are spider silks, with studies having explored properties ranging from their protein sequence to the geometry of a web. This material system, highly adapted to meet a spider's many needs, has superior mechanical properties. In spite of much research into the molecular design underpinning the outstanding performance of silk fibres, and into the mechanical characteristics of web-like structures, it remains unknown how the mechanical characteristics of spider silk contribute to the integrity and performance of a spider web. Here we report web deformation experiments and simulations that identify the nonlinear response of silk threads to stress--involving softening at a yield point and substantial stiffening at large strain until failure--as being crucial to localize load-induced deformation and resulting in mechanically robust spider webs. Control simulations confirmed that a nonlinear stress response results in superior resistance to structural defects in the web compared to linear elastic or elastic-plastic (softening) material behaviour. We also show that under distributed loads, such as those exerted by wind, the stiff behaviour of silk under small deformation, before the yield point, is essential in maintaining the web's structural integrity. The superior performance of silk in webs is therefore not due merely to its exceptional ultimate strength and strain, but arises from the nonlinear response of silk threads to strain and their geometrical arrangement in a web.

  18. Global patterns of guild composition and functional diversity of spiders.

    Directory of Open Access Journals (Sweden)

    Pedro Cardoso

    Full Text Available The objectives of this work are: (1 to define spider guilds for all extant families worldwide; (2 test if guilds defined at family level are good surrogates of species guilds; (3 compare the taxonomic and guild composition of spider assemblages from different parts of the world; (4 compare the taxonomic and functional diversity of spider assemblages and; (5 relate functional diversity with habitat structure. Data on foraging strategy, prey range, vertical stratification and circadian activity was collected for 108 families. Spider guilds were defined by hierarchical clustering. We searched for inconsistencies between family guild placement and the known guild of each species. Richness and abundance per guild before and after correcting guild placement were compared, as were the proportions of each guild and family between all possible pairs of sites. Functional diversity per site was calculated based on hierarchical clustering. Eight guilds were discriminated: (1 sensing, (2 sheet, (3 space, and (4 orb web weavers; (5 specialists; (6 ambush, (7 ground, and (8 other hunters. Sixteen percent of the species richness corresponding to 11% of all captured individuals was incorrectly attributed to a guild by family surrogacy; however, the correlation of uncorrected vs. corrected guilds was invariably high. The correlation of guild richness or abundances was generally higher than the correlation of family richness or abundances. Functional diversity was not always higher in the tropics than in temperate regions. Families may potentially serve as ecological surrogates for species. Different families may present similar roles in the ecosystems, with replacement of some taxa by other within the same guild. Spiders in tropical regions seem to have higher redundancy of functional roles and/or finer resource partitioning than in temperate regions. Although species and family diversity were higher in the tropics, functional diversity seems to be also

  19. Enzymatic Browning: a practical class

    Directory of Open Access Journals (Sweden)

    Maria Teresa Pedrosa Silva Clerici


    Full Text Available This paper presents a practical class about the enzymes polyphenol oxidases, which have been shown to be responsible for the enzymatic browning of fruits and vegetables. Vegetables samples were submitted to enzymatic inactivation process with chemical reagents, as well as by bleaching methods of applying heat by conventional oven and microwave oven. Process efficiency was assessed qualitatively by both observing the guaiacol peroxidase activity and after the storage period under refrigeration or freezing. The practical results obtained in this class allow exploring multidisciplinary knowledge in food science, with practical applications in everyday life.

  20. Disgust and disgust sensitivity in spider phobia : Facial EMG in response to spider and oral disgust imagery

    NARCIS (Netherlands)

    de Jong, Peter; Peters, Madelon L.; Vanderhallen, [Unknown


    Increasing evidence suggests that disgust and fear of contamination is involved in spider phobia. Yet, because the evidence exclusively relies on self-report data it can not be ruled out these findings are produced by mechanisms such as a negative attribution bias, or imprecise emotional labeling. T

  1. Biochemical and pharmacological study of venom of the wolf spider Lycosa singoriensis

    Directory of Open Access Journals (Sweden)

    ZH Liu


    Full Text Available The wolf spider Lycosa singoriensis is a large and venomous spider distributed throughout northwestern China. Like other spider venoms, the wolf spider venom is a chemical cocktail. Its protein content is 0.659 mg protein/mg crude venom as determined by the Lowry method. MALDI-TOF analysis revealed that the venom peptides are highly diverse and may be divided into three groups characterized by three independent molecular ranges: 2,000 to 2,500 Da, 4,800 to 5,500 Da and 7,000 to 8,000 Da, respectively. This molecular distribution differs substantially from those of most spider venoms studied so far. This wolf spider venom has low neurotoxic action on mice, but it can induce hemolysis of human erythrocytes. Furthermore, the venom shows antimicrobial activity against prokaryotic and eukaryotic cells.

  2. An insecticidal peptide from the theraposid Brachypelma smithi spider venom reveals common molecular features among spider species from different genera. (United States)

    Corzo, Gerardo; Diego-García, Elia; Clement, Herlinda; Peigneur, Steve; Odell, George; Tytgat, Jan; Possani, Lourival D; Alagón, Alejandro


    The soluble venom of the Mexican theraposid spider Brachypelma smithi was screened for insecticidal peptides based on toxicity to house crickets. An insecticidal peptide, named Bs1 (which stands for Brachypelma smithi toxin 1) was obtained in homogeneous form after the soluble venom was fractionated using reverse-phase and cation-exchange chromatography. It contains 41 amino acids cross-linked by three disulfide bridges. Its sequence is similar to an insecticidal peptide isolated from the theraposid spider Ornithoctonus huwena from China, and another from the hexathelid spider Macrothelegigas from Japan, indicating that they are phylogenetically related. A cDNA library was prepared from the venomous glands of B. smithi and the gene that code for Bs1 was cloned. Sequence analysis of the nucleotides of Bs1 showed similarities to that of the hexathelid spider from Japan proving additional evidence for close genetic relationship between these spider peptides. The mRNAs of these toxins code for signal peptides that are processed at the segment rich in acidic and basic residues. Their C-terminal amino acids are amidated. However, they contain only a glycine residue at the most C-terminal position, without the presence of additional basic amino acid residues, normally required for post-translation processing of other toxins reported in the literature. The possible mechanism of action of Bs1 was investigated using several ion channels as putative receptors. Bs1 had minor, but significant effects on the Para/tipE insect ion channel, which could indirectly correlate with the observed lethal activity to crickets. PMID:18687374

  3. Loss of legs: is it or not a handicap for an orb-weaving spider? (United States)

    Pasquet, Alain; Anotaux, Mylène; Leborgne, Raymond


    Leg loss is a common phenomenon in spiders, and according to the species 5% to 40% of the adults can present at least one missing leg. There is no possibility of regeneration after adult moult and the animal must manage with its missing appendages until its death. With the loss of one or more legs, female orb-weaving spiders can be penalized twice: firstly, because the legs are necessary for web construction and secondly, the legs are essential for the control of the prey after its interception by the web. During development, spiders may be also penalized because regeneration has energetic costs that take away resources for survival, growth and reproduction. All these consequences should influence negatively the development of the spider and thus its fitness. We investigated the impact of leg loss in the orb-weaving spider, Zygiella x-notata by studying its frequency in a natural population and web building and prey capture behaviours in laboratory. In field populations, 9.5% to 13%, of the adult females presented the loss of one or more legs; the majority of individuals had lost only one leg (in 48% of cases, a first one). Leg loss seems to affect all the adult spiders, as there is no difference of mass between intact spiders and those with missing leg. Data obtained with laboratory-reared spiders, showed that the loss of legs due to the moult is rare (less than 1%). Considering changes in web design, spiders with missing legs decreased their silk investment, increased the distance between spiral turns but did not change the capture surface of the web. Under our laboratory experimental conditions, spiders with one or two lost legs did not present any difference in prey capture efficiency. In laboratory conditions, spiders with lost leg(s) did not show any difference in egg sac production or in longevity (adult lifespan) compared to intact spiders.

  4. fMRI neurofeedback facilitates anxiety regulation in females with spider phobia


    Anna eZilverstand; Bettina eSorger; Pegah eSarkheil; Rainer eGoebel


    Background: Spider phobics show an exaggerated fear response when encountering spiders. This fear response is aggravated by negative and irrational beliefs about the feared object. Cognitive reappraisal can target these beliefs, and therefore has a fear regulating effect. The presented study investigated if neurofeedback derived from functional magnetic resonance imaging (fMRI) would facilitate anxiety regulation by cognitive reappraisal, using spider phobia as a model of anxiety disorders. F...

  5. High school students' attitudes towards spiders: a cross-cultural comparison


    Prokop, Pavol; Tolarovičová, Andrea; Camerik, Anne M; Peterková, Viera


    Abstract Spiders are traditionally considered to be among the least popular of animals. Current evidence suggests that a negative attitude towards spiders could be influenced by both cultural and evolutionary pressures. Some researchers suggest that science education activities could positively influence students? perceptions of spiders. Their evidence is, however, ambivalent. Using a five-point score Likert-type questionnaire in which the items were developed in a similar way to f...

  6. A spider that feeds indirectly on vertebrate blood by choosing female mosquitoes as prey


    Robert R. Jackson; Nelson, Ximena J.; Sune, Godfrey O.


    Spiders do not feed directly on vertebrate blood, but a small East African jumping spider (Salticidae), Evarcha culicivora, feeds indirectly on vertebrate blood by choosing as preferred prey female mosquitoes that have had recent blood meals. Experiments show that this spider can identify its preferred prey by sight alone and by odor alone. When presented with two types of size-matched motionless lures, E. culicivora consistently chose blood-fed female mosquitoes in preference to nonmosquito ...

  7. Prediction of abundance of forest spiders according to climate warming in South Korea


    Tae-Sung Kwon; Cheol Min Lee; Tae Woo Kim; Sung-Soo Kim; Joo Han Sung


    Distribution of spiders will be changed as climate warms. Abundance of spider species was predicted nationwide in South Korea. Abundance of spiders was projected using temperature species distribution model based on a nationwide data (366 forest sites) according to climate change scenario RCP 4.5 and 8.5. The model predicts that 9 out of 17 species will increase in abundance while 8 species will decrease. Based on this finding, a qualitative prediction (increase or decrease) was conducted on ...

  8. Isolation of glycoproteins from brown algae.


    Surendraraj, Alagarsamy; Farvin Koduvayur Habeebullah , Sabeena; Jacobsen, Charlotte


    The present invention relates to a novel process for the isolation of unique anti-oxidative glycoproteins from the pH precipitated fractions of enzymatic extracts of brown algae. Two brown seaweeds viz, Fucus serratus and Fucus vesiculosus were hydrolysed by using 3 enzymes viz, Alcalase, Viscozyme and Termamyl and the glycoproteins were isolated from these enzyme extracts.

  9. The Indirectness of Young Goodman Brown

    Institute of Scientific and Technical Information of China (English)



    Young Goodman Brown is one the best short fictions written by Nathaniel Hawthorne in 1835. The indirectness of the Young Goodman Brown can be seen from the produce, narration and the characteristics of the short fiction. The indirectness of expression or description leaves enough space for readers to understand the theme of the short fiction by themselves.

  10. Isolation of glycoproteins from brown algae

    DEFF Research Database (Denmark)


    The present invention relates to a novel process for the isolation of unique anti-oxidative glycoproteins from the pH precipitated fractions of enzymatic extracts of brown algae. Two brown seaweeds viz, Fucus serratus and Fucus vesiculosus were hydrolysed by using 3 enzymes viz, Alcalase, Viscozyme...

  11. Microlensing Binaries with Candidate Brown Dwarf Companions

    DEFF Research Database (Denmark)

    Shin, I.-G; Han, C.; Gould, A.;


    Brown dwarfs are important objects because they may provide a missing link between stars and planets, two populations that have dramatically different formation histories. In this paper, we present the candidate binaries with brown dwarf companions that are found by analyzing binary microlensing ...

  12. On the Formation of Brown Dwarfs

    CERN Document Server

    Jiang, I G; Lin, D N C; Jiang, Ing-Guey


    The observational properties of brown dwarfs pose challenges to the theory of star formation. Because their mass is much smaller than the typical Jeans mass of interstellar clouds, brown dwarfs are most likely formed through secondary fragmentation processes, rather than through the direct collapse of a molecular cloud core. In order to prevent substantial post-formation mass accretion, young brown dwarfs must leave the high density formation regions in which they form. We propose here that brown dwarfs are formed in the optically thin outer regions of circumbinary disks. Through post-formation dynamical interaction with their host binary stars, young brown dwarfs are either scattered to large distance or removed, with modest speed, from their cradles.

  13. Disks, accretion and outflows of brown dwarfs

    CERN Document Server

    Joergens, V; Liu, Y; Pascucci, I; Whelan, E; Alcala, J; Biazzo, K; Costigan, G; Gully-Santiago, M; Henning, Th; Natta, A; Rigliaco, E; Rodriguez-Ledesma, V; Sicilia-Aguilar, A; Tottle, J; Wolf, S


    Characterization of the properties of young brown dwarfs are important to constraining the formation of objects at the extreme low-mass end of the IMF. While young brown dwarfs share many properties with solar-mass T Tauri stars, differences may be used as tests of how the physics of accretion/outflow and disk chemistry/dissipation depend on the mass of the central object. This article summarizes the presentations and discussions during the splinter session on 'Disks, accretion and outflows of brown dwarfs' held at the CoolStars17 conference in Barcelona in June 2012. Recent results in the field of brown dwarf disks and outflows include the determination of brown dwarf disk masses and geometries based on Herschel far-IR photometry (70-160 um), accretion properties based on X-Shooter spectra, and new outflow detections in the very low-mass regime.

  14. Spiders do not evoke greater early posterior negativity in the event-related potential as snakes. (United States)

    He, Hongshen; Kubo, Kenta; Kawai, Nobuyuki


    It has been long believed that both snakes and spiders are archetypal fear stimuli for humans. Furthermore, snakes have been assumed as stronger threat cues for nonhuman primates. However, it is still unclear whether spiders hold a special status in human perception. The current study explored to what extent spider pictures draw early visual attention [as assessed with early posterior negativity (EPN)] when compared with insects similar to spiders. To measure the EPN, participants watched a random rapid serial presentation of pictures, which consisted of two conditions: spider condition (spider, wasp, bumblebee, beetle) and snake condition (snake, bird). EPN amplitudes revealed no significant difference between spider, wasp, bumblebee, and beetle pictures, whereas EPN amplitudes were significantly larger for snake pictures relative to bird pictures. In addition, EPN amplitudes were significantly larger for snake pictures relative to spider pictures. These results suggest that the early visual attentional capture of animate objects is stronger for snakes, whereas spiders do not appear to hold special early attentional value.

  15. A comparison of spider communities in Bt and non-Bt rice fields. (United States)

    Lee, Sue Yeon; Kim, Seung Tae; Jung, Jong Kook; Lee, Joon-Ho


    To assess the potential adverse effects of a Bt rice line (Japonica rice cultivar, Nakdong) expressing a synthetic cry1Ac1 gene, C7-1-9-1-B, which was highly active against all larval stages of Cnaphalocrocis medinalis (Guenée) (Lepidoptera: Crambidae), we investigated the community structure of spiders in Bt and non-Bt rice fields during the rice-growing season in 2007 and 2008 in Chungcheongnam-do, Korea. Spiders were surveyed with a sweep net and suction device. Suction sampling captured more spiders, measured in terms of species level and abundance, than sweeping. Araneidae and Thomisidae were captured more by sweeping, and certain species were captured only by sweeping. These findings show that both suction and sweep sampling methods should be used because these methods are most likely complementary. In total, 29 species in 23 genera and nine families were identified from the 4,937 spiders collected, and both Bt and non-Bt rice fields showed a typical Korean spider assemblage. The temporal patterns of spider species richness and spider abundance were very similar between Bt and non-Bt rice, although significant differences in species richness were observed on a few occasions. Overall, spider community structure, including diversity, the dominant species, and abundance did not differ between Bt and non-Bt rice. The results of the study indicated that the transgenic Cry1Ac rice lines tested in this study had no adverse effects on the spider community structure of the rice fields.

  16. Polarimetry from the stratosphere with SPIDER and BLASTPol (United States)

    Shariff, Jamil Aly

    This thesis presents the hardware development and flight performance of two balloon-borne experiments. The SPIDER experiment is a millimetre-wavelength polarimeter designed to measure B-mode polarization in the Cosmic Microwave Background at degree scales. This pattern is the imprint of the primordial gravitational waves predicted to have been produced by inflation. The BLASTPol experiment is a submillimetre-wavelength polarimeter designed to measure the linearly-polarized emission from aligned dust grains in Galactic molecular clouds, inferring the directions of the magnetic fields there. One goal of this measurement is to understand the role of magnetic fields in the earliest stages of star formation. SPIDER had a Long-Duration Balloon flight around Antarctica in January 2015. BLASTPol had two such flights, in December 2010 and 2012. Analysis of SPIDER data is underway. Results of BLASTPol 2012 data analysis are presented herein. The design and performance of the SPIDER pointing control system is presented. A new pivot motor control mode was developed, in which the servo drive controlled motor velocity, not current. This mode enabled sinusoidal azimuth scans at a peak speed of 5 deg/s, with a peak acceleration of 0.5 deg·s-2, in flight. The pointing stability in flight was 1'' to 2'' RMS. A new elevation drive system was designed and built for SPIDER. The SPIDER observing strategy is presented. It enabled observation of a 10% patch of sky, avoiding the sun and Galactic plane, with uniform coverage in declination, and good cross-linking. A model of the BLASTPol 2012 PSF was developed, allowing centroiding, flat-fielding, and map deconvolution. The latter was attempted in Fourier space, and using the Lucy-Richardson method. A net linear polarization of the dust emission in the Carina Nebula was measured by BLASTPol. The mean fractional polarization is 6.75% +/- 0.015%, 6.84% v 0.016% and 7.06% v 0.019%, at 250, 350, and 500 microm respectively. A falling

  17. Adopting an heir: Widows' heir adoption and related legal and social issues in the Qing Dynasty%清代寡妇立嗣问题探析

    Institute of Scientific and Technical Information of China (English)



    清代,寡妇在守志的情况下,可以成为立嗣权利的主体.其立嗣方式主要有应继和爱继两种,有时也有异姓继承情况发生.寡妇在立嗣时多伴有相关的经济补偿行为.清代的寡妇立嗣权常受到父家长权及宗族制度和传统礼法习惯的制约,是不完整的.但清代寡妇已能运用法律手段来适当地保护自己的权利,地方官在审理此类案件时,也多倾向于支持寡妇的主张,充分运用自由裁量权以保护弱势者的权益.%In the Qing Dynasty,widows who did not remarry could become the right subject of adopting an heir.There were two main types,adoption by order and adoption by affection.Sometimes an heir with a different surname could also be adopted.Some relatively economic compensation actions were taken in the adoption.The widows' right of adoption was restricted by such factors as patriarchy,clan,feudal ethical codes and conventions.However,the widows could appropriately use law-to protect their rights and interests.Meanwhile,when the magistrates judged cases about adoption,they were usually apt to support the widows' requests so as to protect the rights and interests of social vulnerable group with fully applying the right of discretion.

  18. The Tension between Widows and Their Husband's Family on Remarriage in Qing Dynasty%清代民间寡妇再嫁与亡夫家族紧张关系探析

    Institute of Scientific and Technical Information of China (English)



    The remarriage of a widow was closely related to the interests of late husband's family.There were many acerb contradictions between the widow and her late husband's family around the remarriage of the widow .The late husband's family often compelled the wid-ow to marry again,but sometimes the widow would remarry while the late husband's family disagreed with the decision ,even when the goal of the remarriage of the widow was same , they both would hold apiece an opinion on benefit distribution ,the model of remarriage and the widow's remarriage object .Some profound reasons caused the tensions mentioned previously:the contradictions between the de-pendence of the widows in their lives and the freedom not to marry again;the contradictions between the completeness of the ownership of the widow identity and the finiteness of emotional adoption by her husband's family;the inconsistency of the remarriage of the widow and the betrothal gift belonging to late husband's family in the laws.But this tension reflected the Qing Dynasty widow was weak ,they were not lack of the awareness of the right of social reality .%  清代民间寡妇再嫁与亡夫家族利益息息相关。围绕寡妇再嫁问题,寡妇与亡夫家族很多时候矛盾尖锐,亡夫家族往往会违背寡妇意愿强嫁寡妇,有时寡妇也会绕过亡夫家族自主改嫁,即便是再嫁目标一致,双方也会因为利益分配、再嫁方式等原因各执已见。寡妇生活的依赖性与守节思想的自由性之间的矛盾、寡妇身份归属完全性与夫家情感接纳有限性的不同步、法律规范下寡妇再嫁与夫家受财主体的不一致性是导致这种紧张关系出现的深刻原因。从紧张关系中也可看出清代寡妇虽为弱势,却已不乏权利意识的社会现实。

  19. Individual variation in ballooning dispersal by black widow spiderlings:The effects of family and social rearing

    Institute of Scientific and Technical Information of China (English)

    J. Chadwick JOHNSON; Rebecca HALPIN; Dale STEVENS II; Annika VANNAN; Jesse LAM; Katie BRATSCH


    Individual behavioral variation is ubiquitous across taxa and important to understand if we wish to fully use beha-vioral data to understand the ecology and evolution of organisms. Only recently have studies of individual variation in dispersal behavior become a focus of research. A better understanding of individual variation in dispersal behavior is likely to improve our understanding of population dynamics. In particular, the dynamics of critically small populations (endangered species) and large populations (pest species) may be driven by unique dispersal variants. Here we documented individual variation in the ballooning dispersal behavior of Western black widow spiderlingsLatrodectus hesperus, an urban pest species found in superabundant in-festations throughout cities of the desert Southwest USA. We found a great deal of family-level variation in ballooning dispersal, and this variation was highly consistent (repeatable) across time. Maternal egg investment was a poor predictor of this ballooning dispersal. Instead, we show that spiderlings reared in isolation are significantly slower to disperse than spiderlings raised in a more natural setting surrounded by full siblings. Thus, our study examines a widespread but poorly understood dispersal behavior (ballooning), and suggests urban pest population dynamics are likely driven by the interaction of variation in individuals, families and social environments [Current Zoology 61 (3): 520–528, 2015].

  20. High energy emission from the nebula around the Black Widow binary system containing millisecond pulsar B1957+20

    CERN Document Server

    Bednarek, W


    The features of pulsed $\\gamma$-ray emission from classical and millisecond pulsars indicate that the high energy radiation processes in their inner magnetospheres occur in a similar way. In the last decade several TeV $\\gamma$-ray nebulae have been discovered around classical pulsars. The above facts suggest that $\\gamma$-rays should be produced also in the surroundings of millisecond pulsars. We discuss a model for the bow shock nebula around the well known Black Widow binary system containing the millisecond pulsar B1957+20. This model predicts the existence of a synchrotron X-ray and inverse Compton $\\gamma$-ray nebula around this system. We want to find out whether $\\gamma$-ray emission from the nebula around B1957+20 could be detected by the future and present Cherenkov telescopes. Using the Monte Carlo method we followed the propagation of relativistic electrons in the vicinity of the pulsar. We calculated the very high energy radiation produced by them in the synchrotron process and the inverse Compto...

  1. The efficacy of treatment reminders of life with emphasis on integrative reminiscence on self-esteem and anxiety in widowed old men.

    Directory of Open Access Journals (Sweden)

    Malihe Pishvaei


    Full Text Available Loss of wife besides the phenomenon of aging could cause some psychological disorders and may shorten the duration of this stage of life. The aim of this study was to examine the efficacy of treatment reminders of life with emphasis on integrative reminiscence on self-esteem and anxiety in widowed old men.This was a clinical trial with pre-test and post-test design with a control group. The study population included All 60 to 80 year old men living in Meshginshahr; among whom, 34 participants were selected using convenience sampling method. They were randomly allocated into two equal groups (experimental and control. The experimental group participated in therapy sessions and the control group did not receive any intervention. The research instruments were Rosenberg Self-Esteem Scale and the General Anxiety Questionnaire. Data were analyzed using multivariable covariance analysis in SSPS-19. Statistical significance was set at P<0.05.MANCOVA results showed that the treatment positively affected the variables of self-esteem and anxiety in old widowed men (p<0.001.The reminders of life therapy with emphasis on integrative reminiscence may enhance self-esteem and reduce anxiety in widowed old men. This treatment gives better results compared to the traditional treatments and it is recommended to be implemented in nursing homes.

  2. Spider-mediated flux of PCBs from contaminated sediments to terrestrial ecosystems and potential risks to arachnivorous birds (United States)

    We investigated aquatic insect utilization and PCB exposure in riparian spiders at the Lake Hartwell superfund site (Clemson, SC , USA). We sampled sediments, adult chironomids, terrestrial insects, riparian spiders (Tetragnathidae, Araneidae, and Mecynogea lemniscata), and upla...

  3. Brown Swiss cattle cytogenetic analysis

    Directory of Open Access Journals (Sweden)

    Rita Maria Ladeira Pires


    Full Text Available At 1985, a Brown Swiss herd from the Institute of Animal Science and Pastures, APTA/ SAA was cytogenetically analyzed and 1/29 Robertsonian translocation was observed. Such anomaly is related to fertility reduction. Quimeric abnormality such as 60,XX/60,XY in freemartin females. This study aimed to evaluate the incidence of cromossomic abnormalities in Brown Swiss animals, descending form herd karyotyped earlier. After 25 years, 127 animals (97 females and 30 males from this herd were karyotyped by metaphases obtained from blood lymphocyte cultures. The typical diploid number 2n=60, 58 acrocentric and two X submetacentric chromosomes were confirmed in 94 females and in 27 males the sexual complement X and Y, both submetacentric, although from different sizes. Four females from gemelar parturition whit males were karyotyped. Three of them presented quimerism 60,XX/60,XY (one with 25.8% of female cells (XX and 74.2% male cells (XY; one another with 10% of cells XX e 90% of XY and the third with 50% of each type showing genital masculinization, diagnosed as freemartism and discarded from herd. Two hundred and five cells were analyzed from another female twins and only 60,XX cells were found, diagnosed as normal. His sister also were normal (60,XY. The another three males were also analyzed from gemelar heterosexual parturition, with karyotype 60,XX/60,XY. Cytogenetic analysis are a safe methodology for freemartin abnormalities identification in female bovine twins with male bovine, giving the opportunity of selecting fertile animals, avoiding loses in the management of sterile animals. Robertsonian’s translocation was not observed in any of the animals analyzed.

  4. Structure to function: Spider silk and human collagen (United States)

    Rabotyagova, Olena S.

    Nature has the ability to assemble a variety of simple molecules into complex functional structures with diverse properties. Collagens, silks and muscles fibers are some examples of fibrous proteins with self-assembling properties. One of the great challenges facing Science is to mimic these designs in Nature to find a way to construct molecules that are capable of organizing into functional supra-structures by self-assembly. In order to do so, a construction kit consisting of molecular building blocks along with a complete understanding on how to form functional materials is required. In this current research, the focus is on spider silk and collagen as fibrous protein-based biopolymers that can shed light on how to generate nanostructures through the complex process of self-assembly. Spider silk in fiber form offers a unique combination of high elasticity, toughness, and mechanical strength, along with biological compatibility and biodegrability. Spider silk is an example of a natural block copolymer, in which hydrophobic and hydrophilic blocks are linked together generating polymers that organize into functional materials with extraordinary properties. Since silks resemble synthetic block copolymer systems, we adopted the principles of block copolymer design from the synthetic polymer literature to build block copolymers based on spider silk sequences. Moreover, we consider spider silk to be an important model with which to study the relationships between structure and properties in our system. Thus, the first part of this work was dedicated to a novel family of spider silk block copolymers, where we generated a new family of functional spider silk-like block copolymers through recombinant DNA technology. To provide fundamental insight into relationships between peptide primary sequence, block composition, and block length and observed morphological and structural features, we used these bioengineered spider silk block copolymers to study secondary structure

  5. Hamiltonian Dynamics of Spider-Type Multirotor Rigid Bodies Systems

    International Nuclear Information System (INIS)

    This paper sets out to develop a spider-type multiple-rotor system which can be used for attitude control of spacecraft. The multirotor system contains a large number of rotor-equipped rays, so it was called a 'Spider-type System', also it can be called 'Rotary Hedgehog'. These systems allow using spinups and captures of conjugate rotors to perform compound attitude motion of spacecraft. The paper describes a new method of spacecraft attitude reorientation and new mathematical model of motion in Hamilton form. Hamiltonian dynamics of the system is investigated with the help of Andoyer-Deprit canonical variables. These variables allow obtaining exact solution for hetero- and homoclinic orbits in phase space of the system motion, which are very important for qualitative analysis.

  6. VIPR III VADR SPIDER Structural Design and Analysis (United States)

    Li, Wesley; Chen, Tony


    In support of the National Aeronautics and Space Administration (NASA) Vehicle Integrated Propulsion Research (VIPR) Phase III team to evaluate the volcanic ash environment effects on the Pratt & Whitney F117-PW-100 turbofan engine, NASA Armstrong Flight Research Center has successfully performed structural design and analysis on the Volcanic Ash Distribution Rig (VADR) and the Structural Particulate Integration Device for Engine Research (SPIDER) for the ash ingestion test. Static and dynamic load analyses were performed to ensure no structural failure would occur during the test. Modal analysis was conducted, and the results were used to develop engine power setting avoidance zones. These engine power setting avoidance zones were defined to minimize the dwell time when the natural frequencies of the VADR/SPIDER system coincided with the excitation frequencies of the engine which was operating at various revolutions per minute. Vortex-induced vibration due to engine suction air flow during the ingestion test was also evaluated, but was not a concern.

  7. A Spider That Lays Its Eggs in Rows

    Directory of Open Access Journals (Sweden)

    Robert L. Edwards


    Full Text Available The small (2.5-3.0 mm, colorful metine spider, Homalometa nigritarsis Simon 1897, Family Tetragnathidae, has previously been reported from northern Mexico, Panama and the southern islands of the Lesser Antilles (Levi 1986. In the rain forest of northeastern Puerto Rico it is most frequently found with webbing on the larger outer concave surfaces of pendulous leaves. H. nigritarsis typically makes a circular, relatively flat retreat within which the female deposits two parallel rows of naked eggs. The rows are produced at intervals; as one row hatches another replaces it shortly thereafter. Evidence of up to four generations of rows has been observed. Above the retreat, and closely aligned with it, the spider builds a nearly invisible, delicate orb web, typically from edge to edge of the leaf (Fig. 1a and b. While retaining the traditional orb-web, H. nigritarsis has adopted a unique habitat and set of life history features.

  8. Innate pattern recognition and categorization in a jumping spider.

    Directory of Open Access Journals (Sweden)

    Yinnon Dolev

    Full Text Available The East African jumping spider Evarcha culicivora feeds indirectly on vertebrate blood by preferentially preying upon blood-fed Anopheles mosquitoes, the vectors of human malaria1, using the distinct resting posture and engorged abdomen characteristic of these specific prey as key elements for their recognition. To understand perceptual categorization of objects by these spiders, we investigated their predatory behavior toward different digital stimuli--abstract 'stick figure' representations of Anopheles constructed solely by known key identification elements, disarranged versions of these, as well as non-prey items and detailed images of alternative prey. We hypothesized that the abstract images representing Anopheles would be perceived as potential prey, and would be preferred to those of non-preferred prey. Spiders perceived the abstract stick figures of Anopheles specifically as their preferred prey, attacking them significantly more often than non-preferred prey, even when the comprising elements of the Anopheles stick figures were disarranged and disconnected from each other. However, if the relative angles between the elements of the disconnected stick figures of Anopheles were altered, the otherwise identical set of elements was no longer perceived as prey. These data show that E. culicivora is capable of making discriminations based on abstract concepts, such as the hypothetical angle formed by discontinuous elements. It is this inter-element angle rather than resting posture that is important for correct identification of Anopheles. Our results provide a glimpse of the underlying processes of object recognition in animals with minute brains, and suggest that these spiders use a local processing approach for object recognition, rather than a holistic or global approach. This study provides an excellent basis for a comparative analysis on feature extraction and detection by animals as diverse as bees and mammals.

  9. Spiders (Araneae) as polyphagous natural enemies in orchards


    Bogya, S.


    Spiders (Araneae) occur in high abundance in all terrestrial ecosystems including agro-ecosystems. They are a very heterogeneous group of animals with different hunting tactics and therefore they play very different ecological roles. At family level these tactics are rather similar thus properties and behaviour found in different species of one family can be seen as characteristic for the whole family. Especially in orchards little is known about their role and probably it is undervalued. The...

  10. Evidence for competition between carnivorous plants and spiders


    Jennings, David E.; Krupa, James J.; Raffel, Thomas R.; Rohr, Jason R.


    Several studies have demonstrated that competition between disparate taxa can be important in determining community structure, yet surprisingly, to our knowledge, no quantitative studies have been conducted on competition between carnivorous plants and animals. To examine potential competition between these taxa, we studied dietary and microhabitat overlap between pink sundews (Drosera capillaris) and wolf spiders (Lycosidae) in the field, and conducted a laboratory experiment examining the e...

  11. ArachnoServer: a database of protein toxins from spiders


    Kaas Quentin; Raven Robert J; Cai Shuzhi; Miljenović Tomas; Wood David LA; Escoubas Pierre; Herzig Volker; Wilson David; King Glenn F


    Abstract Background Venomous animals incapacitate their prey using complex venoms that can contain hundreds of unique protein toxins. The realisation that many of these toxins may have pharmaceutical and insecticidal potential due to their remarkable potency and selectivity against target receptors has led to an explosion in the number of new toxins being discovered and characterised. From an evolutionary perspective, spiders are the most successful venomous animals and they maintain by far t...

  12. Climate change and sexual size dimorphism in an Arctic spider


    Høye, Toke Thomas; Hammel, Jörg U; Fuchs, Thomas; Toft, Søren


    Climate change is advancing the onset of the growing season and this is happening at a particularly fast rate in the High Arctic. However, in most species the relative fitness implications for males and females remain elusive. Here, we present data on 10 successive cohorts of the wolf spider Pardosa glacialis from Zackenberg in High-Arctic, northeast Greenland. We found marked inter-annual variation in adult body size (carapace width) and this variation was greater in females than in males. E...

  13. Early environmental conditions shape personality types in a jumping spider

    Directory of Open Access Journals (Sweden)

    Jannis eLiedtke


    Full Text Available Individuals of many species across the animal kingdom are found to be less plastic than expected, even in behavioral traits. The existence of consistent behavioral differences between individuals, termed personality differences, is puzzling, since plastic behavior is considered ideal to enable animals to adaptively respond to changes in environmental conditions. In order to elucidate which mechanisms are important for the evolution of personality differences, it is crucial to understand which aspects of the environment are important for the development of personality differences. Here, we tested whether physical or social aspects of the environment during development influence individual differentiation (mean level of behavior using the jumping spider Marpissa muscosa. Furthermore, we assessed whether those behaviors were repeatable, i.e. whether personalities existed. We applied a split-brood design and raised spider siblings in three different environments: a deprived environment with no enrichment, a socially and a physically enriched environment. We focused on exploratory behavior and repeatedly assessed individual behavior in a novel environment and a novel object test. Results show that the environment during development influenced spiders’ exploratory tendencies: spiders raised in enriched environments tended to be more exploratory. Most investigated behaviors were repeatable (i.e. personalities existed across all individuals tested, whereas only few behaviors were also repeatable across individuals that had experienced the same environmental condition. Taken together, our results indicate that external stimuli can influence the development of one aspect of personality, the inter-individual variation (mean level of behavior, in a jumping spider. We also found family by environment interactions on behavioral traits potentially suggesting genetic variation in developmental plasticity.

  14. Auroral Phenomena in Brown Dwarf Atmospheres (United States)

    Pineda, J. Sebastian; Hallinan, Gregg


    Since the unexpected discovery of radio emission from brown dwarfs some 15 years ago, investigations into the nature of this emission have revealed that, despite their cool and neutral atmospheres, brown dwarfs harbor strong kG magnetic fields, but unlike the warmer stellar objects, they generate highly circularly polarized auroral radio emission, like the giant planets of the Solar System. Our recent results from Keck LRIS monitoring of the brown dwarf LSR1835+32 definitively confirm this picture by connecting the auroral radio emission to spectroscopic variability at optical wavelengths as coherent manifestations of strong large-scale magnetospheric auroral current systems. I present some of the results of my dissertation work to understand the nature brown dwarf auroral phenomena. My efforts include a survey of Late L dwarfs and T dwarfs, looking for auroral Hα emission and a concurrent survey looking for the auroral emission of H3+ from brown dwarfs with radio pulse detections. I discuss the potential connection of this auroral activity to brown dwarf weather phenomena and how brown dwarf aurorae may differ from the analogous emission of the magnetized giant planets in the Solar System.

  15. Morphology and Microstructure of Spider Dragline Silk from Araneus Ventricosus

    Institute of Scientific and Technical Information of China (English)

    PAN Zhi-juan; MIURA Mikihiko; MORIKAWA Hideaki; IWASA Masayuki; LIU Min


    The spider dragline silk has excellent mechanical properties. The stress- strain curves of dragline silk fibers have intraspecific and intraindividual variability because of the spiders active control during spinning process. To investigate the relationship between the morphology of dragline silk fibers and spinning conditions, four samples were made at the reeling rates of 1mm/s, 20mm/s, 43.5mm/s and 110mm/s from the major ampullate glands of Araneus Ventricosus and the other two of dragline silks were prepared from a crawling or dropping spider. The surface microstructure and nanofibril characteristic were analyzed with atomic force microscopy (AFM). AFM images of 2000nm*2000nm and 500nm*500nm of these samples showed that the spinning condition influenced the surface roughness and fibril size, while AFM images of 200nm*200nm clearly displayed that dragline silk of Araneus Ventricosus included sheet macro-conformation structure. These results can facilitate the further investigation of the spinning mechanism of a spider in order to understand mechanical properties and macromolecular structures of dragline silk.

  16. Post-secretion processing influences spider silk performance. (United States)

    Blamires, Sean J; Wu, Chung-Lin; Blackledge, Todd A; Tso, I-Min


    Phenotypic variation facilitates adaptations to novel environments. Silk is an example of a highly variable biomaterial. The two-spidroin (MaSp) model suggests that spider major ampullate (MA) silk is composed of two proteins-MaSp1 predominately contains alanine and glycine and forms strength enhancing β-sheet crystals, while MaSp2 contains proline and forms elastic spirals. Nonetheless, mechanical properties can vary in spider silks without congruent amino acid compositional changes. We predicted that post-secretion processing causes variation in the mechanical performance of wild MA silk independent of protein composition or spinning speed across 10 species of spider. We used supercontraction to remove post-secretion effects and compared the mechanics of silk in this 'ground state' with wild native silks. Native silk mechanics varied less among species compared with 'ground state' silks. Variability in the mechanics of 'ground state' silks was associated with proline composition. However, variability in native silks did not. We attribute interspecific similarities in the mechanical properties of native silks, regardless of amino acid compositions, to glandular processes altering molecular alignment of the proteins prior to extrusion. Such post-secretion processing may enable MA silk to maintain functionality across environments, facilitating its function as a component of an insect-catching web. PMID:22628213

  17. Spider Optimization II: Optical, Magnetic and Foreground Effects

    CERN Document Server

    O'Dea, D T; Amiri, M; Benton, S J; Bock, J J; Bond, J R; Bonetti, J A; Bryan, S; Burger, B; Chiang, H C; Clark, C N; Contaldi, C R; Crill, B P; Davis, G; Dore, O; Farhang, M; Filippini, J P; Fissel, L M; Fraisse, A A; Gandilo, N N; Golwala, S; Gudmundsson, J E; Hasselfield, M; Hilton, G; Holmes, W; Hristov, V V; Irwin, K; Jones, W C; Kuo, C L; MacTavish, C J; Mason, P V; Montroy, T E; Morford, T A; Netterfield, C B; Rahlin, A S; Reintsema, C; Ruhl, J E; Runyan, M C; Schenker, M A; Shariff, J A; Soler, J D; Trangsrud, A; Tucker, C; Tucker, R S; Turner, A D; Wiebe, D


    Spider is a balloon-borne instrument designed to map the polarization of the cosmic microwave background (CMB) with degree-scale resolution over a large fraction of the sky. Spider's main goal is to measure the amplitude of primordial gravitational waves through their imprint on the polarization of the CMB if the tensor-to-scalar ratio, r, is greater than 0.03. To achieve this goal, instrumental systematic errors must be controlled with unprecedented accuracy. Here, we build on previous work to use simulations of Spider observations to examine the impact of several systematic effects that have been characterized through testing and modeling of various instrument components. In particular, we investigate the impact of the non-ideal spectral response of the half-wave plates, coupling between focal plane components and the Earth's magnetic field, and beam mismatches and asymmetries. We also present a model of diffuse polarized foreground emission based on a three-dimensional model of the Galactic magnetic field ...

  18. Pointing control for the SPIDER balloon-borne telescope

    CERN Document Server

    Shariff, Jamil A; Amiri, Mandana; Benton, Steven J; Bock, Jamie J; Bond, J Richard; Bryan, Sean A; Chiang, H Cynthia; Contaldi, Carlo R; Crill, Brendan P; Doré, Olivier P; Farhang, Marzieh; Filippini, Jeffrey P; Fissel, Laura M; Fraisse, Aurelien A; Gambrel, Anne E; Gandilo, Natalie N; Golwala, Sunil R; Gudmundsson, Jon E; Halpern, Mark; Hasselfield, Matthew; Hilton, Gene C; Holmes, Warren A; Hristov, Viktor V; Irwin, Kent D; Jones, William C; Kermish, Zigmund D; Kuo, Chao-Lin; MacTavish, Carolyn J; Mason, Peter V; Megerian, Krikor G; Moncelsi, Lorenzo; Morford, Tracy A; Nagy, Johanna M; Netterfield, C Barth; O'Brient, Roger; Rahlin, Alexandra S; Reintsema, Carl D; Ruhl, John E; Runyan, Marcus C; Soler, Juan D; Trangsrud, Amy; Tucker, Carole E; Tucker, Rebecca S; Turner, Anthony D; Weber, Alexis C; Wiebe, Donald V; Young, Edward Y


    We present the technology and control methods developed for the pointing system of the SPIDER experiment. SPIDER is a balloon-borne polarimeter designed to detect the imprint of primordial gravitational waves in the polarization of the Cosmic Microwave Background radiation. We describe the two main components of the telescope's azimuth drive: the reaction wheel and the motorized pivot. A 13 kHz PI control loop runs on a digital signal processor, with feedback from fibre optic rate gyroscopes. This system can control azimuthal speed with < 0.02 deg/s RMS error. To control elevation, SPIDER uses stepper-motor-driven linear actuators to rotate the cryostat, which houses the optical instruments, relative to the outer frame. With the velocity in each axis controlled in this way, higher-level control loops on the onboard flight computers can implement the pointing and scanning observation modes required for the experiment. We have accomplished the non-trivial task of scanning a 5000 lb payload sinusoidally in az...

  19. Evidence for antimicrobial activity associated with common house spider silk

    Directory of Open Access Journals (Sweden)

    Wright Simon


    Full Text Available Abstract Background Spider silk is one of the most versatile materials in nature with great strength and flexibility. Native and synthetically produced silk has been used in a wide range of applications including the construction of artificial tendons and as substrates for human cell growth. In the literature there are anecdotal reports that suggest that native spider silk may also have antimicrobial properties. Findings In this study we compared the growth of a Gram positive and a Gram negative bacterium in the presence and absence of silk produced by the common house spider Tegenaria domestica. We demonstrate that native web silk of Tegenaria domestica can inhibit the growth of the Gram positive bacterium, Bacillus subtilis. No significant inhibition of growth was detected against the Gram negative bacterium, Escherichia coli. The antimicrobial effect against B. subtilis appears to be short lived thus the active agent potentially acts in a bacteriostatic rather than bactericidal manner. Treatment of the silk with Proteinase K appears to reduce the ability to inhibit bacterial growth. This is consistent with the active agent including a protein element that is denatured or cleaved by treatment. Tegenaria silk does not appear to inhibit the growth of mammalian cells in vitro thus there is the potential for therapeutic applications.

  20. Study on Extrusion Technological Parametersof Brown Rice

    Institute of Scientific and Technical Information of China (English)

    ZhuYongyi; ZhouXianqing; LingLizhong


    Abstract: Extrusion is an efficient measure to improve the texture and physic-chemical properties of brown rice. The polynomial degree two model of extrusiontechnological parameters and gelatinized degree, water absorption index, water solubleindex and moisture content of extruded matter was obtained by methods of single factorand response surface methodology, R2=0.9649, 0.8745, 0.9079, 0.8677. The optimaltechnoiogica! parameters of brown rice extrusion were figured out as follows:moisturecontent of brown rice, 11.42%, speed of screw, 30rpm, feeding speed, and 20rpm.

  1. Brown Dwarfs at the Exoplanet Mass Boundary (United States)

    Faherty, J. K.; Cruz, K. L.; Rice, E. L.; Riedel, A.


    Young brown dwarfs and directly-imaged exoplanets have enticingly similar photometric and spectroscopic characteristics, indicating that their cool, low gravity atmospheres should be studied in concert. Similarities between the peculiar shaped H band, near and mid-IR photometry as well as location on color magnitude diagrams provide important clues about how to extract physical properties of planets from current brown dwarf observations. Our team has assigned >30 brown dwarfs to 10-150 Myr nearby moving groups. In so doing, we have discovered important diversity among this extremely low-mass (10 - 30 M_{Jup}) age-calibrated sample indicating that cloud properties play a critical role in their observables.

  2. Young Brown Dwarfs as Giant Exoplanet Analogs

    CERN Document Server

    Faherty, Jacqueline K; Rice, Emily L; Riedel, Adric


    Young brown dwarfs and directly-imaged exoplanets have enticingly similar photometric and spectroscopic characteristics, indicating that their cool, low gravity atmospheres should be studied in concert. Similarities between the peculiar shaped H band, near and mid-IR photometry as well as location on color magnitude diagrams provide important clues about how to extract physical properties of planets from current brown dwarf observations. In this proceeding we discuss systems newly assigned to 10-150 Myr nearby moving groups, highlight the diversity of this uniform age-calibrated brown dwarf sample, and reflect on their implication for understanding current and future planetary data.

  3. Thomas Brown on the philosophy and psychology of perception. (United States)

    Mills, J A


    Thomas Brown's theory of perception is set in its philosophical context, and the influence of George Berkeley, David Hume, and Thomas Reid on Brown is discussed. Destutt de Tracy, who appears to have been an unacknowledged source for Brown's ideas, is also discussed. Brown's theory of perception is elaborated, and he is categorized both as a sense-datum theorist and as a phenomenalist.

  4. Untangling spider silk evolution with spidroin terminal domains

    Directory of Open Access Journals (Sweden)

    Garb Jessica E


    Full Text Available Abstract Background Spidroins are a unique family of large, structural proteins that make up the bulk of spider silk fibers. Due to the highly variable nature of their repetitive sequences, spidroin evolutionary relationships have principally been determined from their non-repetitive carboxy (C-terminal domains, though they offer limited character data. The few known spidroin amino (N-terminal domains have been difficult to obtain, but potentially contain critical phylogenetic information for reconstructing the diversification of spider silks. Here we used silk gland expression data (ESTs from highly divergent species to evaluate the functional significance and phylogenetic utility of spidroin N-terminal domains. Results We report 11 additional spidroin N-termini found by sequencing ~1,900 silk gland cDNAs from nine spider species that shared a common ancestor > 240 million years ago. In contrast to their hyper-variable repetitive regions, spidroin N-terminal domains have retained striking similarities in sequence identity, predicted secondary structure, and hydrophobicity. Through separate and combined phylogenetic analyses of N-terminal domains and their corresponding C-termini, we find that combined analysis produces the most resolved trees and that N-termini contribute more support and less conflict than the C-termini. These analyses show that paralogs largely group by silk gland type, except for the major ampullate spidroins. Moreover, spidroin structural motifs associated with superior tensile strength arose early in the history of this gene family, whereas a motif conferring greater extensibility convergently evolved in two distantly related paralogs. Conclusions A non-repetitive N-terminal domain appears to be a universal attribute of spidroin proteins, likely retained from the origin of spider silk production. Since this time, spidroin N-termini have maintained several features, consistent with this domain playing a key role in silk

  5. Sperm dynamics in spiders (Araneae: ultrastructural analysis of the sperm activation process in the garden spider Argiope bruennichi (Scopoli, 1772.

    Directory of Open Access Journals (Sweden)

    Oliver Vöcking

    Full Text Available Storage of sperm inside the female genital tract is an integral phase of reproduction in many animal species. The sperm storage site constitutes the arena for sperm activation, sperm competition and female sperm choice. Consequently, to understand animal mating systems information on the processes that occur from sperm transfer to fertilization is required. Here, we focus on sperm activation in spiders. Male spiders produce sperm whose cell components are coiled within the sperm cell and that are surrounded by a proteinaceous sheath. These inactive and encapsulated sperm are transferred to the female spermathecae where they are stored for later fertilization. We analyzed the ultrastructural changes of sperm cells during residency time in the female genital system of the orb-web spider Argiope bruennichi. We found three clearly distinguishable sperm conditions: encapsulated sperm (secretion sheath present, decapsulated (secretion sheath absent and uncoiled sperm (cell components uncoiled, presumably activated. After insemination, sperm remain in the encapsulated condition for several days and become decapsulated after variable periods of time. A variable portion of the decapsulated sperm transforms rapidly to the uncoiled condition resulting in a simultaneous occurrence of decapsulated and uncoiled sperm. After oviposition, only decapsulated and uncoiled sperm are left in the spermathecae, strongly suggesting that the activation process is not reversible. Furthermore, we found four different types of secretion in the spermathecae which might play a role in the decapsulation and activation process.

  6. Sperm dynamics in spiders (Araneae): ultrastructural analysis of the sperm activation process in the garden spider Argiope bruennichi (Scopoli, 1772). (United States)

    Vöcking, Oliver; Uhl, Gabriele; Michalik, Peter


    Storage of sperm inside the female genital tract is an integral phase of reproduction in many animal species. The sperm storage site constitutes the arena for sperm activation, sperm competition and female sperm choice. Consequently, to understand animal mating systems information on the processes that occur from sperm transfer to fertilization is required. Here, we focus on sperm activation in spiders. Male spiders produce sperm whose cell components are coiled within the sperm cell and that are surrounded by a proteinaceous sheath. These inactive and encapsulated sperm are transferred to the female spermathecae where they are stored for later fertilization. We analyzed the ultrastructural changes of sperm cells during residency time in the female genital system of the orb-web spider Argiope bruennichi. We found three clearly distinguishable sperm conditions: encapsulated sperm (secretion sheath present), decapsulated (secretion sheath absent) and uncoiled sperm (cell components uncoiled, presumably activated). After insemination, sperm remain in the encapsulated condition for several days and become decapsulated after variable periods of time. A variable portion of the decapsulated sperm transforms rapidly to the uncoiled condition resulting in a simultaneous occurrence of decapsulated and uncoiled sperm. After oviposition, only decapsulated and uncoiled sperm are left in the spermathecae, strongly suggesting that the activation process is not reversible. Furthermore, we found four different types of secretion in the spermathecae which might play a role in the decapsulation and activation process. PMID:24039790

  7. High-toughness silk produced by a transgenic silkworm expressing spider (Araneus ventricosus dragline silk protein.

    Directory of Open Access Journals (Sweden)

    Yoshihiko Kuwana

    Full Text Available Spider dragline silk is a natural fiber that has excellent tensile properties; however, it is difficult to produce artificially as a long, strong fiber. Here, the spider (Araneus ventricosus dragline protein gene was cloned and a transgenic silkworm was generated, that expressed the fusion protein of the fibroin heavy chain and spider dragline protein in cocoon silk. The spider silk protein content ranged from 0.37 to 0.61% w/w (1.4-2.4 mol% native silkworm fibroin. Using a good silk-producing strain, C515, as the transgenic silkworm can make the raw silk from its cocoons for the first time. The tensile characteristics (toughness of the raw silk improved by 53% after the introduction of spider dragline silk protein; the improvement depended on the quantity of the expressed spider dragline protein. To demonstrate the commercial feasibility for machine reeling, weaving, and sewing, we used the transgenic spider silk to weave a vest and scarf; this was the first application of spider silk fibers from transgenic silkworms.

  8. Plant effects on biological control of spider mites in the ornamental crop Gerbera

    NARCIS (Netherlands)

    Krips, O.E.


    IntroductionThe spider mite Tetranychus urticae Koch is an important pest in many greenhouse crops. In vegetables it can be successfully controlled with the predatory mite Phytoseiulus persimilis Athias-Henriot, a specialist predator of spider mites (Helle & Sabelis, 1985). However,

  9. Heritability of defence and life-history traits in the two-spotted spider mite

    NARCIS (Netherlands)

    N.S.H. Tien; M.W. Sabelis; M. Egas


    Background: Two-spotted spider mites hide against predatory mites in a web of self-produced sticky silk. The proteins invested in this shelter may reduce investment in reproduction. Questions: Do spider mite populations harbor genetic variation for web production, thereby enabling a response to sele


    NARCIS (Netherlands)



    The role of disgust and contamination sensitivity in the development and treatment of spider phobia was examined. It was predicted that spider phobics high in disgust and contamination sensitivity have been more susceptible to evaluative conditioning processes and, as a result, less often report tra

  11. Utility Assessment Report for SPIDERS Phase 2: Ft. Carson (Rev 1.0)

    Energy Technology Data Exchange (ETDEWEB)

    Barr, Jonathan L.; Tuffner, Francis K.; Hadley, Mark D.; Schneider, Kevin P.


    This document contains the Utility Assessment Report (UAR) for the Phase 2 operational Demonstration (OD) of the Smart Power Infrastructure Demonstration for Energy Reliability and Security (SPIDERS) Joint Capability Technology Demonstration (JCTD). The UAR for Phase 2 shows that the SPIDERS system was able to meet the requirements of the Implementation Directive at Ft. Carson.

  12. Neural correlation of successful cognitive behaviour therapy for spider phobia: a magnetoencephalography study. (United States)

    Wright, Barry; Alderson-Day, Ben; Prendergast, Garreth; Kennedy, Juliette; Bennett, Sophie; Docherty, Mary; Whitton, Clare; Manea, Laura; Gouws, Andre; Tomlinson, Heather; Green, Gary


    Cognitive behavioural therapy (CBT) can be an effective treatment for spider phobia, but the underlying neural correlates of therapeutic change are yet to be specified. The present study used magnetoencephalography (MEG) to study responses within the first half second, to phobogenic stimuli in a group of individuals with spider phobia prior to treatment (n=12) and then in nine of them following successful CBT (where they could touch and manage live large common house spiders) at least 9 months later. We also compared responses to a group of age-matched healthy control participants (n=11). Participants viewed static photographs of real spiders, other fear-inducing images (e.g. snakes, sharks) and neutral stimuli (e.g. kittens). Beamforming methods were used to localise sources of significant power changes in response to stimuli. Prior to treatment, participants with spider phobia showed a significant maximum response in the right frontal pole when viewing images of real spiders specifically. No significant frontal response was observed for either control participants or participants with spider phobia post-treatment. In addition, participants' subjective ratings of spider stimuli significantly predicted peak responses in right frontal regions. The implications for understanding brain-based effects of cognitive therapies are discussed.

  13. Transcriptome analysis of venom glands from a single fishing spider Dolomedes mizhoanus. (United States)

    Jiang, Liping; Liu, Changjun; Duan, Zhigui; Deng, Meichun; Tang, Xing; Liang, Songping


    The spider venom is a large pharmacological repertoire composed of different types of bioactive peptide toxins. Despite the importance of spider toxins in capturing terrestrial prey and defending themselves against predators, we know little about the venom components from the spider acting on the fish. Here we constructed a cDNA library of a pair of venomous glands from a single fish-hunting spider Dolomedes mizhoanus. A total of 356 high-quality expressed sequence tags (ESTs) were obtained from the venom gland cDNA library and analyzed. These transcripts were further classified into 45 clusters (19 contigs and 26 singletons), most of which encoded cystine knot toxins (CKTs) and non-CKTs. The ESTs coding for 53 novel CKT precursors were abundant transcripts in the venom glands of the spider D. mizhoanus, accounting for 76% of the total ESTs, the precursors of which were grouped into six families based on the sequence identity and the phylogenetic analysis. In addition, the non-CKTs deduced from 21% of the total ESTs were annotated by Gene Ontology terms and eukaryotic orthologous groups. Fifty-five CKT precursors deduced from 273 ESTs are the largest dataset for a single spider specimen to date. The results may contribute to discovering novel potential drug leads from spider venoms and a better understanding of the evolutionary relationship of the spider toxin.

  14. Differences among plant species in acceptance by the spider mite Tetranychus urticae Koch

    NARCIS (Netherlands)

    Boom, van den C.E.M.; Beek, van T.A.; Dicke, M.


    The spider mite Tetranychus urticae Koch has a broad range of host plants. However, the spider mite does not accept all plants to the same degree because of differences in nutritive and toxic constituents. Other factors, such as the induction of secondary metabolites, the morphology of a leaf surfac

  15. Spectral response of spider mite infested cotton: Mite density and miticide rate study (United States)

    Two-spotted spider mites are important pests in many agricultural systems. Spider mites (Acari: Tetranychidae) have been found to cause economic damage in corn, cotton, and sorghum. Adult glass vial bioassays indicate that Temprano™ (abamectin) is the most toxic technical miticide for adult two-spot...

  16. Unidirectional and transitive predatory relationships of spider species in one-on-one encounters (Arachnida; Araneae)

    NARCIS (Netherlands)

    T.M. Brunt; B.A. Heuts


    Inter-specific predation (‘inter-specific araneophagy’) among spiders is very common in the field. We investigated the transitivity (defined hereafter) of inter-specific predatory dominance relationships among 60 spider species belonging to 16 families in the laboratory in one-on-one encounters betw

  17. A New Spin on Miscue Analysis: Using Spider Charts to Web Reading Processes (United States)

    Wohlwend, Karen E.


    This article introduces a way of seeing miscue analysis data through a "spider chart", a readily available digital graphing tool that provides an effective way to visually represent readers' complex coordination of interrelated cueing systems. A spider chart is a standard feature in recent spreadsheet software that puts a new spin on miscue…

  18. fMRI neurofeedback facilitates anxiety regulation in females with spider phobia

    NARCIS (Netherlands)

    Zilverstand, Anna; Sorger, Bettina; Sarkheil, Pegah; Goebel, R.


    BACKGROUND: Spider phobics show an exaggerated fear response when encountering spiders. This fear response is aggravated by negative and irrational beliefs about the feared object. Cognitive reappraisal can target these beliefs, and therefore has a fear regulating effect. The presented study investi

  19. Biased interpretation and memory in children with varying levels of spider fear

    NARCIS (Netherlands)

    A.M. Klein; G. Titulaer; C. Simons; E. Allart; E. de Gier; S.M. Bögels; E.S. Becker; M. Rinck


    This study investigated multiple cognitive biases in children simultaneously, to investigate whether spider-fearful children display an interpretation bias, a recall bias, and source monitoring errors, and whether these biases are specific for spider-related materials. Furthermore, the independent a

  20. High School Students' Attitudes Towards Spiders: A cross-cultural comparison (United States)

    Prokop, Pavol; Tolarovičová, Andrea; Camerik, Anne M.; Peterková, Viera


    Spiders are traditionally considered to be among the least popular of animals. Current evidence suggests that a negative attitude towards spiders could be influenced by both cultural and evolutionary pressures. Some researchers suggest that science education activities could positively influence students' perceptions of spiders. Their evidence is, however, ambivalent. Using a five-point score Likert-type questionnaire in which the items were developed in a similar way to four of Kellert's categories of attitude (scientistic, negativistic, naturalistic, and ecologistic) towards invertebrates, we compared the level of knowledge of and attitudes towards spiders of high school students from two countries, Slovakia (n = 354) and South Africa (n = 382). The students represented different cultures and followed dissimilar science education curricula. Only among the Slovakian students there was a statistically significant but low correlation between knowledge and attitude (r = 0.30). The South African students scored higher in the categories of scientistic, naturalistic, and ecologistic attitudes. Comparison of attitude towards spiders of indigenous Africans from coeducational Catholic schools revealed that South African students have greater fear of spiders than Slovakian students, supporting the biological preparedness hypothesis. This hypothesis predicts a greater fear of spiders in South Africa than in Europe since several South African spiders possess venoms that are dangerous to humans. The results of this study are discussed from science education, cultural, and evolutionary perspectives.

  1. Counterconditioning in the treatment of spider phobia : effects on disgust, fear and valence

    NARCIS (Netherlands)

    de Jong, Peter; Vorage, [Unknown; van den Hout, MA


    From the perspective that disgust is a core feature of spider phobia, we investigated whether the treatment efficacy could be improved by adding a counterconditioning procedure. Women with a clinically diagnosed spider phobia (N = 34) were randomly assigned to the regular one-session exposure condit

  2. Species richness and composition assessment of spiders in a Mediterranean scrubland

    DEFF Research Database (Denmark)

    Bondoso Cardoso, Pedro Miguel; Henriques, Sérgio S.; Gaspar, Clara;


    Intensive fieldwork has been undertaken in Portugal in order to develop a standardized and optimized sampling protocol for Mediterranean spiders. The present study had the objectives of testing the use of semi-quantitative sampling for obtaining an exhaustive species richness assessment of spider...

  3. Browns Park NWR Water Use Report- 1997 (United States)

    US Fish and Wildlife Service, Department of the Interior — This report contains locations and water use at Browns Park NWR for 1997. A general background is presented first with water rights information, management...

  4. Browns Park NWR Water Use Report- 1993 (United States)

    US Fish and Wildlife Service, Department of the Interior — This report contains locations and water use at Browns Park NWR for 1993. A general background is presented first with water rights information, management...

  5. Browns Park NWR Water Use Report- 1988 (United States)

    US Fish and Wildlife Service, Department of the Interior — This report contains locations and water use at Browns Park NWR for 1988. A general background is presented first with water rights information, management...

  6. Browns Park NWR Water Use Report- 1989 (United States)

    US Fish and Wildlife Service, Department of the Interior — This report contains locations and water use at Browns Park NWR for 1989. A general background is presented first with water rights information, management...

  7. Browns Park NWR Water Use Report- 1991 (United States)

    US Fish and Wildlife Service, Department of the Interior — This report contains locations and water use at Browns Park NWR for 1991. A general background is presented first with water rights information, management...

  8. Browns Park NWR Water Use Report- 1995 (United States)

    US Fish and Wildlife Service, Department of the Interior — This report contains locations and water use at Browns Park NWR for 1995. A general background is presented first with water rights information, management...

  9. Browns Park NWR Water Use Report- 1992 (United States)

    US Fish and Wildlife Service, Department of the Interior — This report contains locations and water use at Browns Park NWR for 1992. A general background is presented first with water rights information, management...

  10. Browns Park NWR Water Use Report- 1996 (United States)

    US Fish and Wildlife Service, Department of the Interior — This report contains locations and water use at Browns Park NWR for 1996. A general background is presented first with water rights information, management...

  11. Browns Park NWR Water Use Report- 1994 (United States)

    US Fish and Wildlife Service, Department of the Interior — This report contains locations and water use at Browns Park NWR for 1994. A general background is presented first with water rights information, management...

  12. Browns Park NWR Water Use Report- 1990 (United States)

    US Fish and Wildlife Service, Department of the Interior — This report contains locations and water use at Browns Park NWR for 1990. A general background is presented first with water rights information, management...

  13. Browns Park NWR Water Use Report- 1998 (United States)

    US Fish and Wildlife Service, Department of the Interior — This report contains locations and water use at Browns Park NWR for 1998. A general background is presented first with water rights information, management...

  14. Mediastinal Parathyroid Adenoma and Brown Tumors


    Bernal, P.; Ucros, G.; Mejia, A


    In this report, we describe a rare case of brown tumor and mediastinal parathyroid adenoma. This report emphasizes the value of radionuclide scintigraphy in the setting of persistent disease following parathyroid surgery.

  15. Giant planet and brown dwarf formation

    CERN Document Server

    Chabrier, G; Janson, M; Rafikov, R


    Understanding the dominant brown dwarf and giant planet formation processes, and finding out whether these processes rely on completely different mechanisms or share common channels represents one of the major challenges of astronomy and remains the subject of heated debates. It is the aim of this review to summarize the latest developments in this field and to address the issue of origin by confronting different brown dwarf and giant planet formation scenarios to presently available observational constraints. As examined in the review, if objects are classified as "Brown Dwarfs" or "Giant Planets" on the basis of their formation mechanism, it has now become clear that their mass domains overlap and that there is no mass limit between these two distinct populations. Furthermore, while there is increasing observational evidence for the existence of non-deuterium burning brown dwarfs, some giant planets, characterized by a significantly metal enriched composition, might be massive enough to ignite deuterium bur...

  16. Browns Park National Wildlife Refuge : Master Plan (United States)

    US Fish and Wildlife Service, Department of the Interior — Master plan for Browns Park NWR that discusses the history, wildlife goals, recreation goals, habitat goals, recreational and operational facilities, and estimated...

  17. Telemetry techniques used on Kodiak brown bear (United States)

    US Fish and Wildlife Service, Department of the Interior — This report summarizes the results of a study on the techniques used to monitor the movements of Kodiak brown bears instrumented with radio transmitters. Methods...

  18. Browns Park NWR Water Use Report- 2007 (United States)

    US Fish and Wildlife Service, Department of the Interior — This report contains locations and water use at Browns Park NWR for 2007. After the creation of the Flaming Gorge Dam, the annual flooding of the Green River ceased...

  19. Browns Park NWR Water Use Report- 2008 (United States)

    US Fish and Wildlife Service, Department of the Interior — This report contains locations and water use at Browns Park NWR for 2008. After the creation of the Flaming Gorge Dam, the annual flooding of the Green River ceased...

  20. Browns Park NWR Water Use Report- 2009 (United States)

    US Fish and Wildlife Service, Department of the Interior — This report contains locations and water use at Browns Park NWR for 2009. After the creation of the Flaming Gorge Dam, the annual flooding of the Green River ceased...

  1. Brown CA et al 2016 Dataset (United States)

    U.S. Environmental Protection Agency — This dataset contains the research described in the following publication: Brown, C.A., D. Sharp, and T. Mochon Collura. 2016. Effect of Climate Change on Water...

  2. Brown bear telemetry and trapping: Special report (United States)

    US Fish and Wildlife Service, Department of the Interior — Brown bear studies were continued during the 1967 field season with emphasis on development of techniques for instrumenting bears with radio transmitters and...

  3. Factors that influence the beta-diversity of spider communities in northwestern Argentinean Grasslands. (United States)

    Rodriguez-Artigas, Sandra M; Ballester, Rodrigo; Corronca, Jose A


    Beta-diversity, defined as spatial replacement in species composition, is crucial to the understanding of how local communities assemble. These changes can be driven by environmental or geographic factors (such as geographic distance), or a combination of the two. Spiders have been shown to be good indicators of environmental quality. Accordingly, spiders are used in this work as model taxa to establish whether there is a decrease in community similarity that corresponds to geographic distance in the grasslands of the Campos & Malezales ecoregion (Corrientes). Furthermore, the influence of climactic factors and local vegetation heterogeneity (environmental factors) on assemblage composition was evaluated. Finally, this study evaluated whether the differential dispersal capacity of spider families is a factor that influences their community structure at a regional scale. Spiders were collected with a G-Vac from vegetation in six grassland sites in the Campos & Malezales ecoregion that were separated by a minimum of 13 km. With this data, the impact of alpha-diversity and different environmental variables on the beta-diversity of spider communities was analysed. Likewise, the importance of species replacement and nesting on beta-diversity and their contribution to the regional diversity of spider families with different dispersion capacities was evaluated. The regional and site-specific inventories obtained were complete. The similarity between spider communities declined as the geographic distance between sites increased. Environmental variables also influenced community composition; stochastic events and abiotic forces were the principal intervening factors in assembly structure. The differential dispersal capacity of spider groups also influenced community structure at a regional scale. The regional beta-diversity, as well as species replacement, was greater in high and intermediate vagility spiders; while nesting was greater in spiders with low dispersion

  4. Factors that influence the beta-diversity of spider communities in northwestern Argentinean Grasslands. (United States)

    Rodriguez-Artigas, Sandra M; Ballester, Rodrigo; Corronca, Jose A


    Beta-diversity, defined as spatial replacement in species composition, is crucial to the understanding of how local communities assemble. These changes can be driven by environmental or geographic factors (such as geographic distance), or a combination of the two. Spiders have been shown to be good indicators of environmental quality. Accordingly, spiders are used in this work as model taxa to establish whether there is a decrease in community similarity that corresponds to geographic distance in the grasslands of the Campos & Malezales ecoregion (Corrientes). Furthermore, the influence of climactic factors and local vegetation heterogeneity (environmental factors) on assemblage composition was evaluated. Finally, this study evaluated whether the differential dispersal capacity of spider families is a factor that influences their community structure at a regional scale. Spiders were collected with a G-Vac from vegetation in six grassland sites in the Campos & Malezales ecoregion that were separated by a minimum of 13 km. With this data, the impact of alpha-diversity and different environmental variables on the beta-diversity of spider communities was analysed. Likewise, the importance of species replacement and nesting on beta-diversity and their contribution to the regional diversity of spider families with different dispersion capacities was evaluated. The regional and site-specific inventories obtained were complete. The similarity between spider communities declined as the geographic distance between sites increased. Environmental variables also influenced community composition; stochastic events and abiotic forces were the principal intervening factors in assembly structure. The differential dispersal capacity of spider groups also influenced community structure at a regional scale. The regional beta-diversity, as well as species replacement, was greater in high and intermediate vagility spiders; while nesting was greater in spiders with low dispersion

  5. Factors that influence the beta-diversity of spider communities in northwestern Argentinean Grasslands (United States)

    Rodriguez-Artigas, Sandra M.; Ballester, Rodrigo


    Beta-diversity, defined as spatial replacement in species composition, is crucial to the understanding of how local communities assemble. These changes can be driven by environmental or geographic factors (such as geographic distance), or a combination of the two. Spiders have been shown to be good indicators of environmental quality. Accordingly, spiders are used in this work as model taxa to establish whether there is a decrease in community similarity that corresponds to geographic distance in the grasslands of the Campos & Malezales ecoregion (Corrientes). Furthermore, the influence of climactic factors and local vegetation heterogeneity (environmental factors) on assemblage composition was evaluated. Finally, this study evaluated whether the differential dispersal capacity of spider families is a factor that influences their community structure at a regional scale. Spiders were collected with a G-Vac from vegetation in six grassland sites in the Campos & Malezales ecoregion that were separated by a minimum of 13 km. With this data, the impact of alpha-diversity and different environmental variables on the beta-diversity of spider communities was analysed. Likewise, the importance of species replacement and nesting on beta-diversity and their contribution to the regional diversity of spider families with different dispersion capacities was evaluated. The regional and site-specific inventories obtained were complete. The similarity between spider communities declined as the geographic distance between sites increased. Environmental variables also influenced community composition; stochastic events and abiotic forces were the principal intervening factors in assembly structure. The differential dispersal capacity of spider groups also influenced community structure at a regional scale. The regional beta-diversity, as well as species replacement, was greater in high and intermediate vagility spiders; while nesting was greater in spiders with low dispersion

  6. The path to the nest of spiders The path to the nest of spiders

    Directory of Open Access Journals (Sweden)

    Eliane Luz Bayer


    Full Text Available Italo Calvino writes in his preface to The Path to the Nest of Spiders that the novel answers to the "ripeness of the time" since ht wrote it after wartime, a period when everyone had a tale to tell. He tells us that this is a story in which iobody is a hero and nobody has the class consciousness necessary to unify them in the struggle. Calvino acknowledges that it was difficult to conciliate his experiences with the postwar literary movement which he calls Neo-expresSionism, a term which, he thinks, describes better Italian Neo-realism. This is a book with a full realistic depictior of the incongruousness of the whole situation, showing rumen beings driven by loneliness, aggressiveness, unfulfilment and failure to meet, their nerves frayed by the War. It reveals human beings in their weaknesses, subjected to deterministic fates changing roles according to circumstance. Partisans shift to the Nazi side and inform on their f rmer allies and vice-versa, being later chased in revenge. The novel has as its setting Italy under Fascism and unde German occupation, the Italian people being divided betw en the fascists of the "Black Brigade" and the "Partisa4s" who belonged to the Resistance. Although this is a pOlitical book, it has universal appeal. At the same time that it livens up historical facts about the period, it moves our feelings. Calvino's book is about World War II as it is viewed and felt by a small outcast, Pin, who makes considerable efforts to be accepted and understood by adults. In his daily life Pinsuffers the consequences Of the war. His aggressive disposition reflects the environment which he has been brought up in: since he was born, his country has been at war. Besides that, his only sister is a whore, whom he hates and despises. Italo Calvino writes in his preface to The Path to the Nest of Spiders that the novel answers to the "ripeness of the time" since ht wrote it after wartime, a period when everyone had a tale to tell

  7. The time course of location-avoidance learning in fear of spiders. (United States)

    Rinck, Mike; Koene, Marieke; Telli, Sibel; Moerman-van den Brink, Wiltine; Verhoeven, Barbara; Becker, Eni S


    Two experiments were designed to study the time course of avoidance learning in spider fearfuls (SFs) under controlled experimental conditions. To achieve this, we employed an immersive virtual environment (IVE): While walking freely through a virtual art museum to search for specific paintings, the participants were exposed to virtual spiders. Unbeknown to the participants, only two of four museum rooms contained spiders, allowing for avoidance learning. Indeed, the more SF the participants were, the faster they learned to avoid the rooms that contained spiders (Experiment. 1), and within the first six trials, high fearfuls already developed a preference for starting their search task in rooms without spiders (Experiment 2). These results illustrate the time course of avoidance learning in SFs, and they speak to the usefulness of IVEs in fundamental anxiety research. PMID:25707541

  8. Microstructure of the water spider (Argyroneta aquatica using the scanning electron microscope

    Directory of Open Access Journals (Sweden)

    Jung-Hoon Kang


    Full Text Available This study is aimed to identify the external features of the water spiders (Argyroneta aquatica collected from “The Natural Monument No. 412 Yeoncheon Eundaeri Water Spider Habitat” through observation of their microstructures using a scanning electron microscope. There is no study on the microstructures of the water spiders excluding several studies on protection plans and ecological investigations, thus giving this study considerable academic significance. Based on the scanning electron microscopy analysis, the water spider has eight simple eyes, and both of its lateral simple eyes are stuck together. A lateral bump was confirmed on the upper jaw, and the pedipalps had six joints and the legs had seven joints. The abdomen and sternum of A. aquatica have more hairs compared with those of land spiders, and its structure shows an elongated area of contact with the air bell so that the air bell can become attached to the abdomen better.

  9. Spider genomes provide insight into composition and evolution of venom and silk. (United States)

    Sanggaard, Kristian W; Bechsgaard, Jesper S; Fang, Xiaodong; Duan, Jinjie; Dyrlund, Thomas F; Gupta, Vikas; Jiang, Xuanting; Cheng, Ling; Fan, Dingding; Feng, Yue; Han, Lijuan; Huang, Zhiyong; Wu, Zongze; Liao, Li; Settepani, Virginia; Thøgersen, Ida B; Vanthournout, Bram; Wang, Tobias; Zhu, Yabing; Funch, Peter; Enghild, Jan J; Schauser, Leif; Andersen, Stig U; Villesen, Palle; Schierup, Mikkel H; Bilde, Trine; Wang, Jun


    Spiders are ecologically important predators with complex venom and extraordinarily tough silk that enables capture of large prey. Here we present the assembled genome of the social velvet spider and a draft assembly of the tarantula genome that represent two major taxonomic groups of spiders. The spider genomes are large with short exons and long introns, reminiscent of mammalian genomes. Phylogenetic analyses place spiders and ticks as sister groups supporting polyphyly of the Acari. Complex sets of venom and silk genes/proteins are identified. We find that venom genes evolved by sequential duplication, and that the toxic effect of venom is most likely activated by proteases present in the venom. The set of silk genes reveals a highly dynamic gene evolution, new types of silk genes and proteins, and a novel use of aciniform silk. These insights create new opportunities for pharmacological applications of venom and biomaterial applications of silk.

  10. Association of spiders and lichen on Robben Island, South Africa: a case report

    Directory of Open Access Journals (Sweden)

    A. Mukherjee


    Full Text Available The present study is a firstrecord of spider occurrence on Robben Island, South Africa. Some habitats were rich in lichens. As we know, lichens enhance wildlife habitat in less direct ways. The objective of the study was to examine the potential importance of lichens in enriching spider diversity and abundance. A total of 260 spiders (170 from lichens and 90 from bush were collected following the visual search method over one year. Seasonal trends in overall species richness and abundance indicated that the relative density of spiders was greater in lichens than in bushes. The result suggests that habitat structure, such as branch size and epiphytic lichen abundance, can be an explanation for the greater number of spiders in lichen-rich patches of the island.

  11. Transcriptional Regulatory Circuits Controlling Brown Fat Development and Activation


    Seale, Patrick


    Brown and beige adipose tissue is specialized for heat production and can be activated to reduce obesity and metabolic dysfunction in animals. Recent studies also have indicated that human brown fat activity levels correlate with leanness. This has revitalized interest in brown fat biology and has driven the discovery of many new regulators of brown fat development and function. This review summarizes recent advances in our understanding of the transcriptional mechanisms that control brown an...

  12. Species composition and relative seasonal abundance of spiders from the field and tree layers of the Roodeplaat Dam Nature Reserve

    Directory of Open Access Journals (Sweden)

    Anna S. Dippenaar-Schoeman


    Full Text Available A survey of spiders was carried out at the Roodeplaat Dam Nature Reserve near Pretoria. Over a 4-year period 10 270 spiders were collected from grasses, herbs and trees. A total of 82 genera of spiders representing 27 families were recorded. Of all the spiders caught, 29,3 percent belonged to the Tetrag-nathidae, 22,7 percent to the Araneidae and 21,4 percent to the Salticidae. The proportion of spiders in each of the remaining 24 families did not exceed 6 percent of the total catch. The species composition and seasonal abundance are discussed.

  13. Structural color and its interaction with other color-producing elements: perspectives from spiders (United States)

    Hsiung, Bor-Kai; Blackledge, Todd A.; Shawkey, Matthew D.


    Structural color is produced when nanostructures called schemochromes alter light reflected from a surface through different optic principles, in contrast with other types of colors that are produced when pigments selectively absorb certain wavelengths of light. Research on biogenic photonic nanostructures has focused primarily on bird feathers, butterfly wings and beetle elytra, ignoring other diverse groups such as spiders. We argue that spiders are a good model system to study the functions and evolution of colors in nature for the following reasons. First, these colors clearly function in spiders such as the tarantulas outside of sexual selection, which is likely the dominant driver of the evolution of structural colors in birds and butterflies. Second, within more than 44,000 currently known spider species, colors are used in every possible way based on the same sets of relatively simple materials. Using spiders, we can study how colors evolve to serve different functions under a variety of combinations of driving forces, and how those colors are produced within a relatively simple system. Here, we first review the different color-producing materials and mechanisms (i.e., light absorbing, reflecting and emitting) in birds, butterflies and beetles, the interactions between these different elements, and the functions of colors in different organisms. We then summarize the current state of knowledge of spider colors and compare it with that of birds and insects. We then raise questions including: 1. Could spiders use fluorescence as a mechanism to protect themselves from UV radiation, if they do not have the biosynthetic pathways to produce melanins? 2. What functions could color serve for nearly blind tarantulas? 3. Why are only multilayer nanostructures (thus far) found in spiders, while birds and butterflies use many diverse nanostructures? And, does this limit the diversity of structural colors found in spiders? Answering any of these questions in the future

  14. Adaptation of the spiders to the environment: the case of some Chilean species

    Directory of Open Access Journals (Sweden)

    Mauricio eCanals


    Full Text Available Spiders are small arthropods that have colonized terrestrial environments. These impose three main problems: i terrestrial habitats have large fluctuations in temperature and humidity; ii the internal concentration of water is higher than the external environment in spiders, which exposes them continually to water loss; and iii their small body size determines a large surface / volume ratio, affecting energy exchange and influencing the life strategy. In this review we focus on body design, energetic, thermal selection, and water balance characteristics of some spider species present in Chile and correlate our results with ecological and behavioral information. Preferred temperatures and critical temperatures of Chilean spiders vary among species and individuals and may be adjusted by phenotypic plasticity. For example in the mygalomorph high-altitude spider Paraphysa parvula the preferred temperature is similar to that of the lowland spider Grammostola rosea; but while P. parvula shows phenotypic plasticity, G. rosea does not. The araneomorph spiders Loxosceles laeta and Scytodes globula have greater daily variations in preferred temperatures at twilight and during the night, which are set to the nocturnal activity rhythms of these species. They also present acclimation of the minimum critical temperatures. Dysdera crocata has a low preferred temperature adjusted to its favorite prey, the woodlouse. Spider metabolic rate is low compared to other arthropods, which may be associated with its sit and wait predatory strategy particularly in primitive hunter and weavers. In mygalomorph spiders the respiratory system is highly optimized with high oxygen conductance, for example G. rosea needs only a difference of 0.12 to 0.16 kPa in the oxygen partial pressure across the air-hemolymph barrier to satisfy its resting oxygen consumption demands. Water loss is a significant stress for spiders. Paraphysa parvula shows an evaporative water loss ten times

  15. Climatic control of trophic interaction strength: the effect of lizards on spiders. (United States)

    Spiller, David A; Schoener, Thomas W


    We investigated how temporal variation in rainfall influences the impact of lizards on spiders inhabiting small islands in Abaco, Bahamas. Annual censuses of web spiders were conducted on nine lizard islands and on eight no-lizard islands 1994-2003. Repeated-measures ANOVA showed that annual variation in spider density (time) and in the lizard effect on spider density (lizard x time) were both significant. Correlation coefficients between the lizard effect (ln ratio of no-lizard to lizard spider densities) and number of rainfall days were generally negative, and strengthened with length of the time period during which rainfall was measured prior to annual spider censuses. Spider density was also negatively correlated with rainfall days and strengthened with length of the prior time period. Longer time intervals included the hurricane season, suggesting that the strong negative correlations were linked to high rainfall years during which tropical storms impacted the region and reduced spider and lizard densities. Split-plot ANOVA showed that rainfall during the hurricane season had a significant effect on the lizard effect and on spider density. Results in this study are opposite to those found in our previous 10-year study (1981-1990) conducted in the Exuma Cays, a moderately xeric region of the Bahamas, where the relation between rainfall and the lizard effect on spider density was positive. Combined data from the Exuma and Abaco studies produce a unimodal relation between trophic interaction strength and rainfall; we suggest that the negative effect of storms associated with rainfall was paramount in the present study, whereas the positive bottom-up effect of rainfall prevailed in our previous study. We conclude that climatic variability has a major impact on the trophic interaction and suggest that a substantial change in precipitation in either direction may weaken the interaction significantly. PMID:17972107

  16. The red spider mite, Oligonychus coffeae (Acari: Tetranychidae): its status, biology, ecology and management in tea plantations. (United States)

    Roy, Somnath; Muraleedharan, Narayanannair; Mukhopadhyay, Ananda


    Oligonychus coffeae Nietner (Acari: Tetranychidae), the red spider mite (RSM), is a major pest of tea (Camellia sinensis) in most tea-producing countries. Nymphs and adults of RSM lacerate cells, producing minute characteristic reddish brown marks on the upper surface of mature leaves, which turn red in severe cases of infestation, resulting in crop loss. The pest is present on tea all the year round, although numbers vary depending on season. Their number increases as the weather warms up and decreases markedly once rains set in. Under optimal conditions there may be 22 overlapping generations in a year. Parthenogenesis is known to occur; consequently, all mite stages can be found at a given time. Their infestation is mainly confined to the upper surface of the mature leaves and could readily be identified by the bronzing of the leaf. There are several naturally occurring insect predators, such as coccinellid and staphylinid larvae, lacewing larvae, and mite predators, most importantly species of the families Phytoseiidae and Stigmaeidae. Integrated management has been adopted to control this mite pest, involving cultural, mechanical, physical, biological and chemical methods. This review collates the most important works carried out on biology, ecology and management of O. coffeae. Also the scope of future studies for better management of this regular mite pest of tea is discussed.

  17. Resistance status of the carmine spider mite, Tetranychus cinnabarinus and the twospotted spider mite, Tetranychus urticae to selected acaricides on strawberries. (United States)

    Bi, Jian-Long; Niu, Zi-Mian; Yu, Lu; Toscano, Nick C


    The carmine spider mite, Tetranychus cinnabarinus (Boisduval) and the twospotted spider mite, Tetranychus urticae Koch, are serious pests of strawberries and many other horticultural crops. Control of these pests has been heavily dependent upon chemical acaricides. Objectives of this study were to determine the resistance status of these two pest species to commonly used acaricides on strawberries in a year-round intensive horticultural production region. LC90 of abamectin for adult carmine spider mites was 4% whereas that for adult twospotted spider mites was 24% of the top label rate. LC90s of spiromesifen, etoxazole, hexythiazox and bifenazate were 0.5%, 0.5%, 1.4% and 83% of their respective highest label rates for carmine spider mite eggs, 0.7%, 2.7%, 12.1% and 347% of their respective highest label rates for the nymphs. LC90s of spiromesifen, etoxazole, hexythiazox and bifenazate were 4.6%, 11.1%, 310% and 62% of their respective highest label rates for twospotted spider mite eggs, 3%, 13%, 432,214% and 15% of their respective highest label rates for the nymphs. Our results suggest that T. cinnabarinus have developed resistance to bifenazate and that the T. urticae have developed resistance to hexythiazox. These results strongly emphasize the need to develop resistance management strategies in the region.

  18. European brown hare syndrome virus in free-ranging European brown hares from Argentina

    DEFF Research Database (Denmark)

    Frolich, K.; Kujawski, G.E.J.G.; Rudolph, M.;


    From 1998 to 2000, serum samples of 80 shot European brown hares (Lepus europaeus) from Argentina were examined for antibodies against European brown hare syndrome virus (EBHSV) and 80 spleen samples were tested for EBHSV-antigen by enzyme linked immunosorbent assay (ELISA). Nine hares were...

  19. Biodistribution studies of bee venom and spider toxin using radiotracers

    Directory of Open Access Journals (Sweden)

    C. M. Yonamine


    Full Text Available The use of radiotracers allows the understanding of the bioavailability process, biodistribution, and kinetics of any molecule labelled with an isotope, which does not alter the molecule's biological properties. In this work, technetium-99m and iodine-125 were chosen as radiotracers for biodistribution studies in mice using bee (Apis mellifera venom and a toxin (PnTX2-6 from the Brazilian "armed" spider (Phoneutria nigriventer venom. Incorporated radioactivity was measured in the blood, brain, heart, lung, liver, kidney, adrenal gland, spleen, stomach, testicle, intestine, muscle, and thyroid gland. Results provided the blood kinetic parameter, and different organs distribution rates.

  20. Transient Myocarditis and Cardiomyopathy After Scorpion and Spider Envenomation

    Directory of Open Access Journals (Sweden)

    Mustafa Kır


    Full Text Available Introduction: Spider and scorpion stings can cause multiple clinical manifestations such as local skin reactions or multiple organ failure that can cause death. Multi-organ involvement is more frequent in children due to their lower body weight. The most important life threatening event after the sting is cardiac and lung involvement. In this case report, two cases who developed myocarditis and cardiomyopathy following scorpion and spider stings were reported.Case Report: Clinical evaluation of a ten-year-old boy with respiratory distress and tachycardia after being bitten by a spider on his right hand revealed high levels of cardiac enzymes [CK-MB: 16.5 ng/ml (N:0.0-7.2 ng/ml, troponin: 3.06 ng/ml (N:0.0-0.3ng/ml], pathological ST elevations in leads V3 and V4, and T wave negativity in leads V5 and V6. In echocardiography, left ventricular dilatation and moderate systolic dysfunction were found. Antivenom [Serum antiscorpionique (labs 50] was given (5 cc antivenom was administered intravenously following a 1:10 dilution with normal saline. With supportive treatment, all pathological findings resolved in a week. The second case was an eight-year-old boy who had been bitten by a scorpion on his foot and taken to the intensive care unit because of respiratory distress and convulsion. Two doses of antivenom were given to the case who had elevated levels of troponin and CK-MB, pathological ST depressions in ECG, and left ventricular dilatation and systolic dysfunction, as revealed by echocardiography. With dobutamin and supportive treatment, the pathological findings normalized in ten days.Conclusion: Myocarditis developing following spider or scorpion bites can threaten life due to left ventricular systolic dysfunction. This consequence has been attributed to increased catecholaminergic activity or direct effect of toxin to myocardial fibres. ECG must be performed, cardiac enzymes must be monitored and echocardiography must be done to evaluate

  1. Systemic lupus erythematosus flare triggered by a spider bite. (United States)

    Martín Nares, Eduardo; López Iñiguez, Alvaro; Ontiveros Mercado, Heriberto


    Systemic lupus erythematosus is a chronic autoimmune disease with a relapsing and remitting course characterized by disease flares. Flares are a major cause of hospitalization, morbidity and mortality in patients with systemic lupus erythematosus. Some triggers for these exacerbations have been identified, including infections, vaccines, pregnancy, environmental factors such as weather, stress and drugs. We report a patient who presented with a lupus flare with predominantly mucocutaneous, serosal and cardiac involvement after being bitten by a spider and we present the possible mechanisms by which the venom elicited such a reaction. To the best of our knowledge, this is the first such case reported in the literature. PMID:26494589

  2. Mechanical behavior of silk during the evolution of orb-web spinning spiders. (United States)

    Elices, Manuel; Plaza, Gustavo R; Arnedo, Miquel A; Pérez-Rigueiro, José; Torres, Fernando G; Guinea, Gustavo V


    The development of an accurate and reproducible approach to measuring the tensile behavior of spider silk has allowed characterizing and comparing the range of mechanical properties exhibited by different spider species with unprecedented detail. The comparison of silks spun by spiders belonging to different phylogenetic groups has revealed that evolution locked in many of the important properties of spider silks very early in the history of orb-web weaving spiders, despite the fact that the silk gland system is relatively isolated in physiological terms from the rest of the organism and should thus mutate quickly. The variations observed between species may be grouped in at least two patterns that are shown not to be related to phylogeny. Beyond the relevance of these results for the evolutionary biology of spiders and silks, the conservation of the basic traits observed in the mechanical behavior of spider silks is likely to set a limit to the range of properties that can be expected from artificial fibers bioinspired in natural silks.

  3. Dynamics of spider glue adhesion: effect of surface energy and contact area (United States)

    Amarpuri, Gaurav; Chen, Yizhou; Blackledge, Todd; Dhinojwala, Ali

    Spider glue is a unique biological adhesive which is humidity responsive such that the adhesion continues to increase upto 100% relative humidity (RH) for some species. This is unlike synthetic adhesives that significantly drop in adhesion with an increase in humidity. However, most of adhesion data reported in literature have used clean hydrophilic glass substrate, unlike the hydrophobic, and charged insect cuticle surface that adheres to spider glue in nature. Previously, we have reported that the spider glue viscosity changes over five orders of magnitude with humidity. Here, we vary the surface energy and surface charge of the substrate to test the change in Larnioides cornutus spider glue adhesion with humidity. We find that an increase in both surface energy and surface charge density increases the droplet spreading and there exists an optimum droplet contact area where adhesion is maximized. Moreover, spider glue droplets act as reusable adhesive for low energy hydrophobic surface at the optimum humidity. These results explain why certain prey are caught more efficiently by spiders in their habitat. The mechanism by which spider species tune its glue adhesion for local prey capture can inspire new generation smart adhesives.

  4. Comparative growth and development of spiders reared on live and dead prey.

    Directory of Open Access Journals (Sweden)

    Yu Peng

    Full Text Available Scavenging (feeding on dead prey has been demonstrated across a number of spider families, yet the implications of feeding on dead prey for the growth and development of individuals and population is unknown. In this study we compare the growth, development, and predatory activity of two species of spiders that were fed on live and dead prey. Pardosa astrigera (Lycosidae and Hylyphantes graminicola (Lyniphiidae were fed live or dead fruit flies, Drosophila melanogaster. The survival of P. astrigera and H. graminicola was not affected by prey type. The duration of late instars of P. astrigera fed dead prey were longer and mature spiders had less protein content than those fed live prey, whereas there were no differences in the rate of H. graminicola development, but the mass of mature spiders fed dead prey was greater than those fed live prey. Predation rates by P. astrigera did not differ between the two prey types, but H. graminicola had a higher rate of predation on dead than alive prey, presumably because the dead flies were easier to catch and handle. Overall, the growth, development and reproduction of H. graminicola reared with dead flies was better than those reared on live flies, yet for the larger P. astrigera, dead prey may suit smaller instars but mature spiders may be best maintained with live prey. We have clearly demonstrated that dead prey may be suitable for rearing spiders, although the success of the spiders fed such prey appears size- and species specific.

  5. Climatic Variables Do Not Directly Predict Spider Richness and Abundance in Semiarid Caatinga Vegetation, Brazil. (United States)

    Carvalho, Leonardo S; Sebastian, Nicholas; Araújo, Helder F P; Dias, Sidclay C; Venticinque, Eduardo; Brescovit, Antonio D; Vasconcellos, Alexandre


    Spiders are abundant in tropical ecosystems and exert predatory pressure on a wide variety of invertebrate populations and also serve as prey for many others organisms, being part of complex interrelationships influenced directly and indirectly by a myriad of factors. We examined the influence of biotic (i.e., prey availability) and abiotic (i.e., temperature, precipitation, relative humidity, real evapotranspiration) factors on species richness and abundance during a two-year period in the semiarid Caatinga vegetation in northeastern Brazil. Data were analyzed through partial autocorrelation functions, cross correlations, and a path analysis. A total of 2522 spiders were collected with beating tray, pit-fall traps, and malaise traps, comprising 91 species and 34 families. Spider abundance peaked in the rainy season. Our results suggest that total invertebrate abundance has a direct influence on spider richness and abundance, whereas the effects of precipitation were mainly indirectly related to most spider assemblage parameters. The increase in vegetation cover with the rainy season in the Caatinga provides more breeding and foraging sites for spiders and stimulates their activities. Additionally, rainfall in arid and semiarid ecosystems stimulated the activity and reproduction of many herbivore and detritivore invertebrates dependent on plant biomass and necromass consumption, leading to an increase in spider prey availability. PMID:26308806

  6. A Tank Bromeliad Favors Spider Presence in a Neotropical Inundated Forest.

    Directory of Open Access Journals (Sweden)

    Yann Hénaut

    Full Text Available Tank bromeliads are good models for understanding how climate change may affect biotic associations. We studied the relationships between spiders, the epiphytic tank bromeliad, Aechmea bracteata, and its associated ants in an inundated forest in Quintana Roo, Mexico, during a drought period while, exceptionally, this forest was dry and then during the flooding that followed. We compared spider abundance and diversity between 'Aechmea-areas' and 'control-areas' of the same surface area. We recorded six spider families: the Dipluridae, Ctenidae, Salticidae, Araneidae, Tetragnathidae and Linyphiidae among which the funnel-web tarantula, Ischnothele caudata, the only Dipluridae noted, was the most abundant. During the drought period, the spiders were more numerous in the Aechmea-areas than in the control-areas, but they were not obligatorily associated with the Aechmea. During the subsequent flooding, the spiders were concentrated in the A. bracteata patches, particularly those sheltering an ant colony. Also, a kind of specificity existed between certain spider taxa and ant species, but varied between the drought period and subsequent flooding. We conclude that climatic events modulate the relationship between A. bracteata patches and their associated fauna. Tank bromeliads, previously considered only for their ecological importance in supplying food and water during drought, may also be considered refuges for spiders during flooding. More generally, tank bromeliads have an important role in preserving non-specialized fauna in inundated forests.

  7. The lethal toxin from Australian funnel-web spiders is encoded by an intronless gene.

    Directory of Open Access Journals (Sweden)

    Sandy Steffany Pineda

    Full Text Available Australian funnel-web spiders are generally considered the most dangerous spiders in the world, with envenomations from the Sydney funnel-web spider Atrax robustus resulting in at least 14 human fatalities prior to the introduction of an effective anti-venom in 1980. The clinical envenomation syndrome resulting from bites by Australian funnel-web spiders is due to a single 42-residue peptide known as δ-hexatoxin. This peptide delays the inactivation of voltage-gated sodium channels, which results in spontaneous repetitive firing and prolongation of action potentials, thereby causing massive neurotransmitter release from both somatic and autonomic nerve endings. Here we show that δ-hexatoxin from the Australian funnel-web spider Hadronyche versuta is produced from an intronless gene that encodes a prepropeptide that is post-translationally processed to yield the mature toxin. A limited sampling of genes encoding unrelated venom peptides from this spider indicated that they are all intronless. Thus, in distinct contrast to cone snails and scorpions, whose toxin genes contain introns, spiders may have developed a quite different genetic strategy for evolving their venom peptidome.

  8. Spider mites adaptively learn recognizing mycorrhiza-induced changes in host plant volatiles. (United States)

    Patiño-Ruiz, J David; Schausberger, Peter


    Symbiotic root micro-organisms such as arbuscular mycorrhizal fungi commonly change morphological, physiological and biochemical traits of their host plants and may thus influence the interaction of aboveground plant parts with herbivores and their natural enemies. While quite a few studies tested the effects of mycorrhiza on life history traits, such as growth, development and reproduction, of aboveground herbivores, information on possible effects of mycorrhiza on host plant choice of herbivores via constitutive and/or induced plant volatiles is lacking. Here we assessed whether symbiosis of the mycorrhizal fungus Glomus mosseae with common bean plants Phaseolus vulgaris influences the response of the two-spotted spider mite Tetranychus urticae to volatiles of plants that were clean or infested with spider mites. Mycorrhiza-naïve and -experienced spider mites, reared on mycorrhizal or non-mycorrhizal bean plants for several days before the experiments, were subjected to Y-tube olfactometer choice tests. Experienced but not naïve spider mites distinguished between constitutive volatiles of clean non-mycorrhizal and mycorrhizal plants, preferring the latter. Neither naïve nor experienced spider mites distinguished between spider mite-induced volatiles of mycorrhizal and non-mycorrhizal plants. Learning the odor of clean mycorrhizal plants, resulting in a subsequent preference for these odors, is adaptive because mycorrhizal plants are more favorable host plants for fitness of the spider mites than are non-mycorrhizal plants.

  9. Characterization of the complete mitogenomes of two Neoscona spiders (Araneae: Araneidae) and its phylogenetic implications. (United States)

    Wang, Zheng-Liang; Li, Chao; Fang, Wen-Yuan; Yu, Xiao-Ping


    The complete mitogenomes of two orb-weaving spiders Neoscona doenitzi and Neoscona nautica were determined and a comparative mitogenomic analysis was performed to depict evolutionary trends of spider mitogenomes. The circular mitogenomes are 14,161bp with A+T content of 74.6% in N. doenitzi and 14,049bp with A+T content of 78.8% in N. nautica, respectively. Both mitogenomes contain a standard set of 37 genes typically presented in metazoans. Gene content and orientation are identical to all previously sequenced spider mitogenomes, while gene order is rearranged by tRNAs translocation when compared with the putative ancestral gene arrangement pattern presented by Limulus polyphemus. A comparative mitogenomic analysis reveals that the nucleotide composition bias is obviously divergent between spiders in suborder Opisthothelae and Mesothelae. The loss of D-arm in the trnS(UCN) among all of Opisthothelae spiders highly suggested that this common feature is a synapomorphy for entire suborder Opisthothelae. Moreover, the trnS(AGN) in araneoids preferred to use TCT as an anticodon rather than the typical anticodon GCT. Phylogenetic analysis based on the 13 protein-coding gene sequences consistently yields trees that nest the two Neoscona spiders within Araneidae and recover superfamily Araneoidea as a monophyletic group. The molecular information acquired from the results of this study should be very useful for future research on mitogenomic evolution and genetic diversities in spiders. PMID:27259661

  10. Effects of kaolin particle films on the life span of an orb-weaver spider. (United States)

    Benhadi-Marín, Jacinto; Pereira, José Alberto; Santos, Sónia A P


    Araniella cucurbitina (Araneae: Araneidae) is a widespread orb-weaver spider commonly found in agroecosystems. Mineral particle films such as kaolin, due to their protective or anti-feeding action, can represent an alternative to pesticides, especially in organic farming systems, but little is known about its effects on A. cucurbitina. Therefore, we tested the effect of kaolin sprays on the life span of A. cucurbitina under laboratory conditions. Four treatments were tested encompassing different exposure routes. Thus, kaolin sprays were applied on (i) the surface, (ii) the prey (fly), (iii) the spider and (iv) both spider & prey. A control group was tested with water in each treatment. Results showed that sprays of kaolin significantly affected the survival of A. curcubitina when applications were done on the surface and on both spider & prey registering a reduction of 48% and 56%, respectively. Spiders in control obtained higher probability of reaching alive at the end of the assay than those treated with kaolin. Differences observed can be explained by the feeding behavior of the species and may depend on the consumption of the web by the spider and the ratio spider/fly for body size. PMID:26432533

  11. Effects of kaolin particle films on the life span of an orb-weaver spider. (United States)

    Benhadi-Marín, Jacinto; Pereira, José Alberto; Santos, Sónia A P


    Araniella cucurbitina (Araneae: Araneidae) is a widespread orb-weaver spider commonly found in agroecosystems. Mineral particle films such as kaolin, due to their protective or anti-feeding action, can represent an alternative to pesticides, especially in organic farming systems, but little is known about its effects on A. cucurbitina. Therefore, we tested the effect of kaolin sprays on the life span of A. cucurbitina under laboratory conditions. Four treatments were tested encompassing different exposure routes. Thus, kaolin sprays were applied on (i) the surface, (ii) the prey (fly), (iii) the spider and (iv) both spider & prey. A control group was tested with water in each treatment. Results showed that sprays of kaolin significantly affected the survival of A. curcubitina when applications were done on the surface and on both spider & prey registering a reduction of 48% and 56%, respectively. Spiders in control obtained higher probability of reaching alive at the end of the assay than those treated with kaolin. Differences observed can be explained by the feeding behavior of the species and may depend on the consumption of the web by the spider and the ratio spider/fly for body size.

  12. Exploration behaviour and behavioural flexibility in orb-web spiders: A review

    Institute of Scientific and Technical Information of China (English)



    Orb-web spiders and their webs constitute an ideal model system in which to study behavioural flexibility and spatial cognition in invertebrates due to the easily quantifiable nature of the orb web.A large number of studies demonstrate how spiders are able to modify the geometry of their webs in response to a range of different conditions including the ability to adapt their webs to spatial constraints.However,the mechanisms behind this impressive web-building flexibility in these cognitively limited animals remain poorly explored.One possible mechanism though may be spatial learning during the spiders' exploration of their immediate surroundings.This review discusses the importance of exploration behaviour,the reliance on simple behavioural rules,and the use of already laid threads as guidelines for web-building in orb-web spiders.The focus is on the spiders' ability to detect and adapt their webs to space limitations and other spatial disruptions.I will also review the few published studies on how spatial information is gathered during the exploration phase and discuss the possibility of the use of ‘cognitive map’-like processes in spiders.Finally,the review provides suggestions for designing experimental studies to shed light on whether spiders gather metric information during the site exploration (cognitive map hypothesis) or rely on more simple binary information in combination with previously laid threads to build their webs (stigmergy hypothesis) [Current Zoology 61 (2):313-327,2015].

  13. Molecular characterization and evolutionary study of spider tubuliform (eggcase) silk protein. (United States)

    Tian, Maozhen; Lewis, Randolph V


    As a result of hundreds of millions of years of evolution, orb-web-weaving spiders have developed the use of seven different silks produced by different abdominal glands for various functions. Tubuliform silk (eggcase silk) is unique among these spider silks due to its high serine and very low glycine content. In addition, tubuliform silk is the only silk produced just during a short period of time, the reproductive season, in the spider's life. To understand the molecular characteristics of the proteins composing this silk, we constructed tubuliform-gland-specific cDNA libraries from three different spider families, Nephila clavipes, Argiope aurantia, and Araneus gemmoides. Sequencing of tubuliform silk cDNAs reveals the repetitive architecture of its coding sequence and novel amino acid motifs. The inferred protein, tubuliform spidroin 1 (TuSp1), contains highly homogenized repeats in all three spiders. Amino acid composition comparison of the predicted tubuliform silk protein sequence to tubuliform silk indicates that TuSp1 is the major component of tubuliform silk. Repeat unit alignment of TuSp1 among three spider species shows high sequence conservation among tubuliform silk protein orthologue groups. Sequence comparison among TuSp1 repetitive units within species suggests intragenic concerted evolution, presumably through gene conversion and unequal crossover events. Comparative analysis demonstrates that TuSp1 represents a new orthologue in the spider silk gene family.

  14. A Tank Bromeliad Favors Spider Presence in a Neotropical Inundated Forest. (United States)

    Hénaut, Yann; Corbara, Bruno; Pélozuelo, Laurent; Azémar, Frédéric; Céréghino, Régis; Herault, Bruno; Dejean, Alain


    Tank bromeliads are good models for understanding how climate change may affect biotic associations. We studied the relationships between spiders, the epiphytic tank bromeliad, Aechmea bracteata, and its associated ants in an inundated forest in Quintana Roo, Mexico, during a drought period while, exceptionally, this forest was dry and then during the flooding that followed. We compared spider abundance and diversity between 'Aechmea-areas' and 'control-areas' of the same surface area. We recorded six spider families: the Dipluridae, Ctenidae, Salticidae, Araneidae, Tetragnathidae and Linyphiidae among which the funnel-web tarantula, Ischnothele caudata, the only Dipluridae noted, was the most abundant. During the drought period, the spiders were more numerous in the Aechmea-areas than in the control-areas, but they were not obligatorily associated with the Aechmea. During the subsequent flooding, the spiders were concentrated in the A. bracteata patches, particularly those sheltering an ant colony. Also, a kind of specificity existed between certain spider taxa and ant species, but varied between the drought period and subsequent flooding. We conclude that climatic events modulate the relationship between A. bracteata patches and their associated fauna. Tank bromeliads, previously considered only for their ecological importance in supplying food and water during drought, may also be considered refuges for spiders during flooding. More generally, tank bromeliads have an important role in preserving non-specialized fauna in inundated forests. PMID:25494055

  15. Brown adipose tissue and its therapeutic potential. (United States)

    Lidell, M E; Betz, M J; Enerbäck, S


    Obesity and related diseases are a major cause of human morbidity and mortality and constitute a substantial economic burden for society. Effective treatment regimens are scarce, and new therapeutic targets are needed. Brown adipose tissue, an energy-expending tissue that produces heat, represents a potential therapeutic target. Its presence is associated with low body mass index, low total adipose tissue content and a lower risk of type 2 diabetes mellitus. Knowledge about the development and function of thermogenic adipocytes in brown adipose tissue has increased substantially in the last decade. Important transcriptional regulators have been identified, and hormones able to modulate the thermogenic capacity of the tissue have been recognized. Intriguingly, it is now clear that humans, like rodents, possess two types of thermogenic adipocytes: the classical brown adipocytes found in the interscapular brown adipose organ and the so-called beige adipocytes primarily found in subcutaneous white adipose tissue after adrenergic stimulation. The presence of two distinct types of energy-expending adipocytes in humans is conceptually important because these cells might be stimulated and recruited by different signals, raising the possibility that they might be separate potential targets for therapeutic intervention. In this review, we will discuss important features of the energy-expending brown adipose tissue and highlight those that may serve as potential targets for pharmacological intervention aimed at expanding the tissue and/or enhancing its function to counteract obesity.

  16. Brown adipose tissue growth and development. (United States)

    Symonds, Michael E


    Brown adipose tissue is uniquely able to rapidly produce large amounts of heat through activation of uncoupling protein (UCP) 1. Maximally stimulated brown fat can produce 300 watts/kg of heat compared to 1 watt/kg in all other tissues. UCP1 is only present in small amounts in the fetus and in precocious mammals, such as sheep and humans; it is rapidly activated around the time of birth following the substantial rise in endocrine stimulatory factors. Brown adipose tissue is then lost and/or replaced with white adipose tissue with age but may still contain small depots of beige adipocytes that have the potential to be reactivated. In humans brown adipose tissue is retained into adulthood, retains the capacity to have a significant role in energy balance, and is currently a primary target organ in obesity prevention strategies. Thermogenesis in brown fat humans is environmentally regulated and can be stimulated by cold exposure and diet, responses that may be further modulated by photoperiod. Increased understanding of the primary factors that regulate both the appearance and the disappearance of UCP1 in early life may therefore enable sustainable strategies in order to prevent excess white adipose tissue deposition through the life cycle.

  17. Microlensing Binaries with Candidate Brown Dwarf Companions

    DEFF Research Database (Denmark)

    Shin, I.-G; Han, C.; Gould, A.;


    Brown dwarfs are important objects because they may provide a missing link between stars and planets, two populations that have dramatically different formation histories. In this paper, we present the candidate binaries with brown dwarf companions that are found by analyzing binary microlensing......-278/OGLE-2011-BLG-012N. Among them, we are able to confirm that the companions of the lenses of MOA-2011-BLG-104/OGLE-2011-BLG-0172 and MOA-2011-BLG-149 are brown dwarfs by determining the mass of the lens based on the simultaneous measurement of the Einstein radius and the lens parallax. The measured...... masses of the brown dwarf companions are 0.02 ± 0.01 M⊙ and 0.019 ± 0.002 M⊙ for MOA-2011-BLG-104/OGLE-2011-BLG-0172 and MOA-2011-BLG-149, respectively, and both companions are orbiting low-mass M dwarf host stars. More microlensing brown dwarfs are expected to be detected as the number of lensing events...

  18. Functional relations between locomotor performance traits in spiders and implications for evolutionary hypotheses

    Directory of Open Access Journals (Sweden)

    Taylor Phillip W


    Full Text Available Abstract Background Locomotor performance in ecologically relevant activities is often linked to individual fitness. Recent controversy over evolution of extreme sexual size dimorphism (SSD in spiders centres on the relationship between size and locomotor capacity in males. Advantages for large males running over horizontal surfaces and small males climbing vertically have been proposed. Models have implicitly treated running and climbing as functionally distinct activities and failed to consider the possibility that they reflect common underlying capacities. Findings We examine the relationship between maximum climbing and running performance in males of three spider species. Maximum running and climbing speeds were positively related in two orb-web spiders with high SSD (Argiope keyserlingi and Nephila plumipes, indicating that for these species assays of running and climbing largely reveal the same underlying capacities. Running and climbing speeds were not related in a jumping spider with low SSD (Jacksonoides queenslandica. We found no evidence of a performance trade-off between these activities. Conclusions In the web-spiders A. keyserlingi and N. plumipes good runners were also good climbers. This indicates that climbing and running largely represent a single locomotor performance characteristic in these spiders, but this was not the case for the jumping spider J. queenslandica. There was no evidence of a trade-off between maximum running and climbing speeds in these spiders. We highlight the need to establish the relationship between apparently disparate locomotor activities when testing alternative hypotheses that yield predictions about different locomotor activities. Analysis of slopes suggests greater potential for an evolutionary response on performance in the horizontal compared to vertical context in these spiders.

  19. Deer herbivory reduces web-building spider abundance by simplifying forest vegetation structure (United States)

    Chips, Michael J.; Carson, Walter P.


    Indirect ecological effects are a common feature of ecological systems, arising when one species affects interactions among two or more other species. We examined how browsing by white-tailed deer (Odocoileus virginianus) indirectly affected the abundance and composition of a web-building spider guild through their effects on the structure of the ground and shrub layers of northern hardwood forests. We examined paired plots consisting of deer-free and control plots in the Allegheny Plateau region Pennsylvania and Northern Highlands region of Wisconsin. We recorded the abundance of seven types of webs, each corresponding to a family of web-building spiders. We quantified vegetation structure and habitat suitability for the spiders by computing a web scaffold availability index (WSAI) at 0.5 m and 1.0 m above the ground. At Northern Highlands sites, we recorded prey availability. Spider webs were twice as abundant in deer-free plots compared to control plots, while WSAI was 7–12 times greater in deerfree plots. Prey availability was lower in deer-free plots. With the exception of funnel web-builders, all spider web types were significantly more abundant in deer-free plots. Both deer exclusion and the geographic region of plots were significant predictors of spider community structure. In closed canopy forests with high browsing pressure, the low density of tree saplings and shrubs provides few locations for web-building spiders to anchor webs. Recruitment of these spiders may become coupled with forest disturbance events that increase tree and shrub recruitment. By modifying habitat structure, deer appear to indirectly modify arthropod food web interactions. As deer populations have increased in eastern North America over the past several decades, the effects of deer on web-building spiders may be widespread.

  20. Documented bites by a yellow sac spider (Cheiracanthium punctorium in Italy: a case report

    Directory of Open Access Journals (Sweden)

    R Papini


    Full Text Available In Italy reports of human envenomations by yellow sac spiders have been sporadic. Since increasing clinical information would improve understanding of the danger of yellow sac spiders to humans, we report the case of a 7-year-old child and her father bitten by a documented Cheiracanthium punctorium. They developed acute persistent pain with local skin signs and numbness, and required emergency treatment. The father recovered completely within 1 to 2 hours and the child within 3 to 4 days after treatment, probably as a result of spontaneous evolution. Clinicians should be aware of the risks and immediate management of spider bites.

  1. Adaptation of the spiders to the environment: the case of some Chilean species (United States)

    Canals, Mauricio; Veloso, Claudio; Solís, Rigoberto


    Spiders are small arthropods that have colonized terrestrial environments. These impose three main problems: (i) terrestrial habitats have large fluctuations in temperature and humidity; (ii) the internal concentration of water is higher than the external environment in spiders, which exposes them continually to water loss; and (iii) their small body size determines a large surface/volume ratio, affecting energy exchange and influencing the life strategy. In this review we focus on body design, energetic, thermal selection, and water balance characteristics of some spider species present in Chile and correlate our results with ecological and behavioral information. Preferred temperatures and critical temperatures of Chilean spiders vary among species and individuals and may be adjusted by phenotypic plasticity. For example in the mygalomorph high-altitude spider Paraphysa parvula the preferred temperature is similar to that of the lowland spider Grammostola rosea; but while P. parvula shows phenotypic plasticity, G. rosea does not. The araneomorph spiders Loxosceles laeta and Scytodes globula have greater daily variations in preferred temperatures at twilight and during the night, which are set to the nocturnal activity rhythms of these species. They also present acclimation of the minimum critical temperatures. Dysdera crocata has a low preferred temperature adjusted to its favorite prey, the woodlouse. Spider metabolic rate is low compared to other arthropods, which may be associated with its sit and wait predatory strategy particularly in primitive hunter and weavers. In mygalomorph spiders the respiratory system is highly optimized with high oxygen conductance, for example G. rosea needs only a difference of 0.12–0.16 kPa in the oxygen partial pressure across the air-hemolymph barrier to satisfy its resting oxygen consumption demands. Water loss is a significant stress for spiders. Paraphysa parvula shows an evaporative water loss 10 times more than usual

  2. Stability of the volume of air trapped on the abdomen of the water spider Argyroneta aquatica


    Neumann, Dietrich; Woermann, Dietrich


    The water spider Argyroneta aquatica lives under water, diving to various depths from time to time. At rest, it breathes air trapped within its diving bell with a hydrophilic surface. Outside their diving bell water spiders trap air on their abdomen under a layer of hydrophobic hair. Is the structure of the layer of hair trapping a volume of air on the abdomen of the water spider Argyroneta aquatica under water related to its observed diving depth (of the order of decimetre)? A positive answe...

  3. Mitochondria in White, Brown, and Beige Adipocytes

    Directory of Open Access Journals (Sweden)

    Miroslava Cedikova


    Full Text Available Mitochondria play a key role in energy metabolism in many tissues, including cardiac and skeletal muscle, brain, liver, and adipose tissue. Three types of adipose depots can be identified in mammals, commonly classified according to their colour appearance: the white (WAT, the brown (BAT, and the beige/brite/brown-like (bAT adipose tissues. WAT is mainly involved in the storage and mobilization of energy and BAT is predominantly responsible for nonshivering thermogenesis. Recent data suggest that adipocyte mitochondria might play an important role in the development of obesity through defects in mitochondrial lipogenesis and lipolysis, regulation of adipocyte differentiation, apoptosis, production of oxygen radicals, efficiency of oxidative phosphorylation, and regulation of conversion of white adipocytes into brown-like adipocytes. This review summarizes the main characteristics of each adipose tissue subtype and describes morphological and functional modifications focusing on mitochondria and their activity in healthy and unhealthy adipocytes.

  4. Novel nuances of human brown fat

    DEFF Research Database (Denmark)

    Scheele, Camilla; Larsen, Therese Juhlin; Nielsen, Søren


    There is a current debate in the literature on whether human fat derived from the supraclavicular region should be classified as brown, or as the white fat-derived less potent, brite/beige. This commentary addresses whether the existing classification defined in mice is sufficient to describe...... the types of thermogenic adipocytes in humans. We recently published a contradictory mRNA expression signature of human supraclavicular fat defined by an upregulation of the brite marker TBX1 along with the classical brown markers ZIC1 and LHX8, as well as genes indicating brown fat activity including UCP1......, PGC-1α, and PRDM16; and, finally, a downregulation of the white/brite markers HOXC8 and HOXC9. Subcutaneous fat was used as reference material. Another recent study presents a higher expression of ZIC1 and a lower expression of TBX1 in interscapular compared with supraclavicular fat. Here, however...

  5. Brown adipogenesis of mouse embryonic stem cells in alginate microstrands (United States)

    Unser, Andrea Mannarino

    The ability of brown adipocytes (fat cells) to dissipate energy as heat shows great promise for the treatment of obesity and other metabolic disorders. Employing pluripotent stem cells, with an emphasis on directed differentiation, may overcome many issues currently associated with primary fat cell cultures. However, brown adipocytes are difficult to transplant in vivo due to the instability of fat, in terms of necrosis and neovascularization, once injected. Thus, 3D cell culture systems that have the potential to mimic adipogenic microenvironments are needed, not only to advance brown fat implantation, but also to better understand the role of brown adipocytes in treating obesity. To address this need, we created 3D "Brown-Fat-in-Microstrands" by microfluidic synthesis of alginate hydrogel microstrands that encapsulated cells and directly induced cell differentiation into brown adipocytes, using mouse embryonic stem cells (ESCs) as a model of pluripotent stem cells and brown preadipocytes as a positive control. The effect of hydrogel formation parameters on brown adipogenesis was studied, leading to the establishment of "Brown-Fat-in-Microstrands". Brown adipocyte differentiation within microstrands was confirmed by lipid droplet accumulation, immunocytochemistry and qPCR analysis of gene expression of brown adipocyte marker uncoupling protein 1 (UCP1) in addition to adipocyte marker expression. Compared to a 2D approach, 3D differentiated "Brown-Fat-in-Microstrands" exhibited higher level of brown adipocyte marker expression. The functional analysis of "Brown-Fat-in-Microstrands" was attempted by measuring the mitochondrial activity of ESC-differentiated brown adipocytes in 3D using Seahorse XF24 3 Extracellular Flux Analyzer. The ability to create "Brown-Fat-in-Microstrands" from pluripotent stem cells opens up a new arena to understanding brown adipogenesis and its implications in obesity and metabolic disorders.

  6. The relation among variables of mental health and cognition in widowed elders / A relação entre variáveis de saúde mental e cognição em idosos viúvos

    Directory of Open Access Journals (Sweden)

    Clarissa Marceli Trentini


    Full Text Available To assess the cognitive abilities of widowed elders, a total sample of 34 elders (who have lost their spouses in the last 12 months was identified among elders in Veranópolis-RS and 30 of them accepted to participate in the study. The control group was composed by 30 married subjects paired according to gender, age and level of education. The instruments used were: Measure Questionnaire of Memory Loss Complaints; Verbal Fluency - animal category; Mini-Mental State Examination (MMSE; Free and Cued Selective Reminding Test; Digit subtest; Geriatric Depression Scales and Bereavement Phenomenology Questionnaire. Widowed elders had significantly more depressive symptoms and more points on the bereavement scale. However, there was no significant difference between the means of cognitive performance of widowed or married elders. In the census, the choice of widowhood as a selection criterion instead of bereavement (self reported might have influenced the lack of association between widowhood and cognitive dysfunction, among other aspects.

  7. Local trophic specialisation in a cosmopolitan spider (Araneae). (United States)

    Líznarová, Eva; Sentenská, Lenka; García, Luis Fernando; Pekár, Stano; Viera, Carmen


    Trophic specialisation can be observed in species with long-term constant exploitation of a certain prey in all populations or in a population of a species with short-term exploitation of a certain prey. While in the former case the species would evolve stereotyped or specialised trophic adaptations, the trophic traits of the latter should be versatile or generalised. Here, we studied the predatory behavioural adaptations of a presumed myrmecophagous spider, Oecobius navus. We chose two distinct populations, one in Portugal and the other in Uruguay. We analysed the actual prey of both populations and found that the Portuguese population feeds mainly on dipterans, while the Uruguayan population feeds mainly on ants. Indeed, dipterans and springtails in Portugal, and ants in Uruguay were the most abundant potential prey. In laboratory trials O. navus spiders recognised and captured a wide variety of prey. The capture efficiency of the Portuguese population measured as components of the handling time was higher for flies than for ants, while that of the Uruguayan population was higher for ants. We found phenotypic plasticity in behavioural traits that lead to increased capture efficiency with respect to the locally abundant prey, but it remains to be determined whether the traits of the two populations are genetically fixed. We conclude that O. navus is a euryphagous generalist predator which shows local specialisation on the locally abundant prey. PMID:23200575

  8. Benefits of cooperation with genetic kin in a subsocial spider. (United States)

    Schneider, J M; Bilde, T


    Interaction within groups exploiting a common resource may be prone to cheating by selfish actions that result in disadvantages for all members of the group, including the selfish individuals. Kin selection is one mechanism by which such dilemmas can be resolved. This is because selfish acts toward relatives include the cost of lowering indirect fitness benefits that could otherwise be achieved through the propagation of shared genes. Kin selection theory has been proved to be of general importance for the origin of cooperative behaviors, but other driving forces, such as direct fitness benefits, can also promote helping behavior in many cooperatively breeding taxa. Investigating transitional systems is therefore particularly suitable for understanding the influence of kin selection on the initial spread of cooperative behaviors. Here we investigated the role of kinship in cooperative feeding. We used a cross-fostering design to control for genetic relatedness and group membership. Our study animal was the periodic social spider Stegodyphus lineatus, a transitional species that belongs to a genus containing both permanent social and periodic social species. In S. lineatus, the young cooperate in prey capture and feed communally. We provide clear experimental evidence for net benefits of cooperating with kin. Genetic relatedness within groups and not association with familiar individuals directly improved feeding efficiency and growth rates, demonstrating a positive effect of kin cooperation. Hence, in communally feeding spiders, nepotism favors group retention and reduces the conflict between selfish interests and the interests of the group. PMID:18658236

  9. Nectar Meals of a Mosquito-Specialist Spider

    Directory of Open Access Journals (Sweden)

    Josiah O. Kuja


    Full Text Available Evarcha culicivora, an East African jumping spider, is known for feeding indirectly on vertebrate blood by actively choosing blood-carrying mosquitoes as prey. Using cold-anthrone tests to detect fructose, we demonstrate that E. culicivora also feeds on nectar. Field-collected individuals, found on the plant Lantana camara, tested positive for plant sugar (fructose. In the laboratory, E. culicivora tested positive for fructose after being kept with L. camara or one of another ten plant species (Aloe vera, Clerodendron magnifica, Hamelia patens, Lantana montevideo, Leonotis nepetaefolia, Parthenium hysterophorus, Ricinus communis, Senna didymobotrya, Striga asiatica, and Verbena trivernia. Our findings demonstrate that E. culicivora acquires fructose from its natural diet and can ingest fructose directly from plant nectaries. However, experiments in the laboratory also show that E. culicivora can obtain fructose indirectly by feeding on prey that have fed on fructose, implying a need to consider this possibility when field-collected spiders test positive for fructose. In laboratory tests, 53.5% of 1,215 small juveniles, but only 3.4% of 622 adult E. culicivora, left with plants for 24 hours, were positive for fructose. These findings, along with the field data, suggest that fructose is especially important for early-instar juveniles of E. culicivora.

  10. A dragline-forming mobile robot inspired by spiders

    International Nuclear Information System (INIS)

    Mobility of wheeled or legged machines can be significantly increased if they are able to move from a solid surface into a three-dimensional space. Although that may be achieved by addition of flying mechanisms, the payload fraction will be the limiting factor in such hybrid mobile machines for many applications. Inspired by spiders producing draglines to assist locomotion, the paper proposes an alternative mobile technology where a robot achieves locomotion from a solid surface into a free space. The technology resembles the dragline production pathway in spiders to a technically feasible degree and enables robots to move with thermoplastic spinning of draglines. As an implementation, a mobile robot has been prototyped with thermoplastic adhesives as source material of the draglines. Experimental results show that a dragline diameter range of 1.17–5.27 mm was achievable by the 185 g mobile robot in descending locomotion from the solid surface of a hanging structure with a power consumption of 4.8 W and an average speed of 5.13 cm min−1. With an open-loop controller consisting of sequences of discrete events, the robot has demonstrated repeatable dragline formation with a relative deviation within −4% and a length close to the metre scale. (paper)

  11. Spider silk-like proteins derived from transgenic Nicotiana tabacum. (United States)

    Peng, Congyue Annie; Russo, Julia; Gravgaard, Charlene; McCartney, Heather; Gaines, William; Marcotte, William R


    The high tensile strength and biocompatibility of spider dragline silk makes it a desirable material in many engineering and tissue regeneration applications. Here, we present the feasibility to produce recombinant proteins in transgenic tobacco Nicotiana tabacum with sequences representing spider silk protein building blocks . Recombinant mini-spidroins contain native N- and C-terminal domains of major ampullate spidroin 1 (rMaSp1) or rMaSp2 flanking an abbreviated number (8, 16 or 32) of consensus repeat domains. Two different expression plasmid vectors were tested and a downstream chitin binding domain and self-cleavable intein were included to facilitate protein purification. We confirmed gene insertion and RNA transcription by PCR and reverse-transcriptase PCR, respectively. Mini-spidroin production was detected by N-terminus specific antibodies. Purification of mini-spidroins was performed through chitin affinity chromatography and subsequent intein activation with reducing reagent. Mini-spidroins, when dialyzed and freeze-dried, formed viscous gelatin-like fluids. PMID:27026165

  12. The SPIDER fission fragment spectrometer for fission product yield measurements

    Energy Technology Data Exchange (ETDEWEB)

    Meierbachtol, K.; Tovesson, F. [Los Alamos National Laboratory, Los Alamos, NM 87545 (United States); Shields, D. [Los Alamos National Laboratory, Los Alamos, NM 87545 (United States); Colorado School of Mines, Golden, CO 80401 (United States); Arnold, C. [Los Alamos National Laboratory, Los Alamos, NM 87545 (United States); Blakeley, R. [University of New Mexico, Albuquerque, NM 87131 (United States); Bredeweg, T.; Devlin, M. [Los Alamos National Laboratory, Los Alamos, NM 87545 (United States); Hecht, A.A.; Heffern, L.E. [University of New Mexico, Albuquerque, NM 87131 (United States); Jorgenson, J.; Laptev, A. [Los Alamos National Laboratory, Los Alamos, NM 87545 (United States); Mader, D. [University of New Mexico, Albuquerque, NM 87131 (United States); O' Donnell, J.M.; Sierk, A.; White, M. [Los Alamos National Laboratory, Los Alamos, NM 87545 (United States)


    The SPectrometer for Ion DEtermination in fission Research (SPIDER) has been developed for measuring mass yield distributions of fission products from spontaneous and neutron-induced fission. The 2E–2v method of measuring the kinetic energy (E) and velocity (v) of both outgoing fission products has been utilized, with the goal of measuring the mass of the fission products with an average resolution of 1 atomic mass unit (amu). The SPIDER instrument, consisting of detector components for time-of-flight, trajectory, and energy measurements, has been assembled and tested using {sup 229}Th and {sup 252}Cf radioactive decay sources. For commissioning, the fully assembled system measured fission products from spontaneous fission of {sup 252}Cf. Individual measurement resolutions were met for time-of-flight (250 ps FWHM), spacial resolution (2 mm FHWM), and energy (92 keV FWHM for 8.376 MeV). Mass yield results measured from {sup 252}Cf spontaneous fission products are reported from an E–v measurement.

  13. Untangling taxonomy: a DNA barcode reference library for Canadian spiders. (United States)

    Blagoev, Gergin A; deWaard, Jeremy R; Ratnasingham, Sujeevan; deWaard, Stephanie L; Lu, Liuqiong; Robertson, James; Telfer, Angela C; Hebert, Paul D N


    Approximately 1460 species of spiders have been reported from Canada, 3% of the global fauna. This study provides a DNA barcode reference library for 1018 of these species based upon the analysis of more than 30,000 specimens. The sequence results show a clear barcode gap in most cases with a mean intraspecific divergence of 0.78% vs. a minimum nearest-neighbour (NN) distance averaging 7.85%. The sequences were assigned to 1359 Barcode index numbers (BINs) with 1344 of these BINs composed of specimens belonging to a single currently recognized species. There was a perfect correspondence between BIN membership and a known species in 795 cases, while another 197 species were assigned to two or more BINs (556 in total). A few other species (26) were involved in BIN merges or in a combination of merges and splits. There was only a weak relationship between the number of specimens analysed for a species and its BIN count. However, three species were clear outliers with their specimens being placed in 11-22 BINs. Although all BIN splits need further study to clarify the taxonomic status of the entities involved, DNA barcodes discriminated 98% of the 1018 species. The present survey conservatively revealed 16 species new to science, 52 species new to Canada and major range extensions for 426 species. However, if most BIN splits detected in this study reflect cryptic taxa, the true species count for Canadian spiders could be 30-50% higher than currently recognized. PMID:26175299

  14. Coincidental intraguild predation by caterpillars on spider mites. (United States)

    Shirotsuka, Kanako; Yano, Shuichi


    Intraguild predation (IGP) is defined as the killing and eating of prey species by a predator that also can utilize the resources of the prey. It is mainly reported among carnivores that share common herbivorous prey. However, a large chewing herbivore could prey upon sedentary and/or micro herbivores in addition to utilizing a host plant. To investigate such coincidental IGP, we observed the behavioral responses of the polyphagous mite Tetranychus kanzawai Kishida (Acari: Tetranychidae) when its host plant Cayratia japonica (Thunb.) Gagnep. (Vitaceae) was attacked by hornworms, Theretra japonica Boisduval (Sphingidae) and T. oldenlandiae Fabricius (Sphingidae). We also examined an interaction between the oligophagous mite Panonychus citri McGregor (Acari: Tetranychidae) and caterpillars of the swallowtail Papilio xuthus L. (Papilionidae) that share citrus plants as their main food source. Although all T. kanzawai and some active stage P. citri tried to escape from the coincidental IGP, some were consumed together with eggs, quiescent mites, and host plant leaves, suggesting that coincidental IGP occurs on spider mites in the wild. Moreover, neither hornworms nor swallowtail caterpillars distinguished between spider mite-infested and uninfested leaves, suggesting that the mite-infested leaves do not discourage caterpillar feeding. The reasons that the mites have no effective defense against coincidental IGP other than escaping are discussed. PMID:22286142

  15. Damage, Self-Healing, and Hysteresis in Spider Silks (United States)

    De Tommasi, D.; Puglisi, G.; Saccomandi, G.


    Abstract In this article, we propose a microstructure-based continuum model to describe the material behavior of spider silks. We suppose that the material is composed of a soft fraction with entropic elasticity and a hard, damageable fraction. The hard fraction models the presence of stiffer, crystal-rich, oriented regions and accounts for the effect of softening induced by the breaking of hydrogen bonds. To describe the observed presence of crystals with different size, composition, and orientation, this hard fraction is modeled as a distribution of materials with variable properties. The soft fraction describes the remaining regions of amorphous material and is here modeled as a wormlike chain. During stretching, we consider the effect of bond-breaking as a transition from the hard- to the soft-material phase. As we demonstrate, a crucial effect of bond-breaking that accompanies the softening of the material is an increase in contour length associated with chains unraveling. The model describes also the self-healing properties of the material by assuming partial bond reconnection upon unloading. Despite its simplicity, the proposed mechanical system reproduces the main experimental effects observed in cyclic loading of spider silks. Moreover, our approach is amenable to two- or three-dimensional extensions and may prove to be a useful tool in the field of microstructure optimization for bioinspired materials. PMID:20441758

  16. Radio timing and optical photometry of the black widow system PSR J1518+0204C in the globular cluster M5

    International Nuclear Information System (INIS)

    We report on the determination of astrometric, spin, and orbital parameters for PSR J1518+0204C, a 'black widow' binary millisecond pulsar in the globular cluster (GC) M5. The accurate position and orbital parameters obtained from radio timing allowed us to search for the optical companion. By using WFC3/Hubble Space Telescope images, we identified a very faint variable star (mF390W ≳ 24.8, mF606W ≳ 24.3, mF814W ≳ 23.1) located at only 0.''25 from the pulsar's timing position. Due to its strong variability, this star is visible only in a subsample of images. However, the light curve obtained folding the available data with the orbital parameters of the pulsar shows a maximum at the pulsar inferior conjunction and a possible minimum at the pulsar superior conjunction. Furthermore, the shape of the optical modulation indicates a heating process possibly due to the pulsar wind. This is the first identification of an optical companion to a black widow pulsar in the dense stellar environment of a GC.

  17. Radio Timing and Optical Photometry of the Black Widow System PSR J1953+1846A in the Globular Cluster M71

    CERN Document Server

    Cadelano, M; Ferraro, F R; Stairs, I; Ransom, S M; Dalessandro, E; Lanzoni, B; Hessels, J W T; Freire, P C C


    We report on the determination of the astrometric, spin and orbital parameters for PSR J1953+1846A, a "black widow" binary millisecond pulsar in the globular cluster M71. By using the accurate position and orbital parameters obtained from radio timing, we identified the optical companion in ACS/Hubble Space Telescope images. It turns out to be a faint (m_F606W>=24, m_F814W>=23) and variable star located at only ~0.06" from the pulsar timing position. The light curve shows a maximum at the pulsar inferior conjunction and a minimum at the pulsar superior conjunction, thus confirming the association with the system. The shape of the optical modulation suggests that the companion star is heated, likely by the pulsar wind. The comparison with the X-ray light curve possibly suggests the presence of an intra-binary shock due to the interaction between the pulsar wind and the material released by the companion. This is the second identification (after COM-M5C) of an optical companion to a black widow pulsar in a glob...

  18. Radio timing and optical photometry of the black widow system PSR J1518+0204C in the globular cluster M5

    CERN Document Server

    Pallanca, C; Ferraro, F R; Dalessandro, E; Lanzoni, B; Hessels, J W T; Stairs, I; Freire, P C C


    We report on the determination of astrometric, spin and orbital parameters for PSR J1518+0204C, a "black widow" binary millisecond pulsar in the globular cluster M5. The accurate position and orbital parameters obtained from radio timing allowed us to search for the optical companion. By using WFC3/HST images we identified a very faint variable star (m_F390W > 24.8, m_F606W > 24.3, m_F814W > 23.1) located at only 0.25" from the pulsar's timing position. Due to its strong variability, this star is visible only in a sub-sample of images. However, the light curve obtained folding the available data with the orbital parameters of the pulsar shows a maximum at the pulsar inferior conjunction and a possible minimum at the pulsar superior conjunction. Furthermore, the shape of the optical modulation indicates a heating process possibly due to the pulsar wind. This is the first identification of an optical companion to a black widow pulsar in the dense stellar environment of a globular cluster.

  19. Radio timing and optical photometry of the black widow system PSR J1518+0204C in the globular cluster M5

    Energy Technology Data Exchange (ETDEWEB)

    Pallanca, C.; Ferraro, F. R.; Dalessandro, E.; Lanzoni, B. [Dipartimento di Fisica e Astronomia, Università di Bologna, Viale Berti Pichat 6/2, I-40127 Bologna (Italy); Ransom, S. M. [National Radio Astronomy Observatory (NRAO), 520 Edgemont Road, Charlottesville, VA 22901 (United States); Hessels, J. W. T. [ASTRON, the Netherlands Institute for Radio Astronomy, Postbus 2, 7990 AA Dwingeloo (Netherlands); Stairs, I. [Department of Physics and Astronomy, University of British Columbia, 6224 Agricultural Road, Vancouver, BC V6T1Z1 (Canada); Freire, P. C. C. [Max-Planck-Institute für Radioastronomie, D-53121 Bonn (Germany)


    We report on the determination of astrometric, spin, and orbital parameters for PSR J1518+0204C, a 'black widow' binary millisecond pulsar in the globular cluster (GC) M5. The accurate position and orbital parameters obtained from radio timing allowed us to search for the optical companion. By using WFC3/Hubble Space Telescope images, we identified a very faint variable star (m{sub F390W} ≳ 24.8, m{sub F606W} ≳ 24.3, m{sub F814W} ≳ 23.1) located at only 0.''25 from the pulsar's timing position. Due to its strong variability, this star is visible only in a subsample of images. However, the light curve obtained folding the available data with the orbital parameters of the pulsar shows a maximum at the pulsar inferior conjunction and a possible minimum at the pulsar superior conjunction. Furthermore, the shape of the optical modulation indicates a heating process possibly due to the pulsar wind. This is the first identification of an optical companion to a black widow pulsar in the dense stellar environment of a GC.

  20. Brown adipose tissue, thermogenesis, angiogenesis: pathophysiological aspects. (United States)

    Honek, Jennifer; Lim, Sharon; Fischer, Carina; Iwamoto, Hideki; Seki, Takahiro; Cao, Yihai


    The number of obese and overweight individuals is globally rising, and obesity-associated disorders such as type 2 diabetes, cardiovascular disease and certain types of cancer are among the most common causes of death. While white adipose tissue is the key player in the storage of energy, active brown adipose tissue expends energy due to its thermogenic capacity. Expanding and activating brown adipose tissue using pharmacological approaches therefore might offer an attractive possibility for therapeutic intervention to counteract obesity and its consequences for metabolic health.

  1. Kodiak brown bear population on Kodiak Island, Alaska (United States)

    US Fish and Wildlife Service, Department of the Interior — Methods and estimates of the Brown bear population on Kodiak Island. The total number of Kodiak Brown Bears on Kodiak Island has been estimated to be 1669. Three...

  2. Browns Park NWR Water Use Report- 2001 and 2002 (United States)

    US Fish and Wildlife Service, Department of the Interior — This report contains locations and water use at Browns Park NWR for 2001 and 2002. A basic introduction highlighting the region that Browns Park NWR is a part of...

  3. Predator perception of detritus and eggsac decorations spun by orb-web spiders Cyclosa octotuberculata: Do they function to camouflage the spiders?

    Directory of Open Access Journals (Sweden)

    Wenjin GAN, Fengxiang LIU, Zengtao ZHANG, Daiqin LI


    Full Text Available Camouflage is one of the most widespread and powerful strategies that animals use to make detection/recognition more difficult. Many orb-web spiders of the genus Cyclosa add prey remains, plant debris, moults, and/or eggsacs to their webs called web decorations. Web decorations resembling spider body colour pattern have been considered to camouflage the spider from predators. While this camouflage is obvious from a human’s perspective, it has rarely been investigated from a predator’s perspective. In this study, we tested the visibility of web decorations by calculating chromatic and achromatic contrasts of detritus and eggsac decorations built by Cyclosa octotuberculata, against four different backgrounds viewed by both bird (e.g., blue tits and hymenopteran (e.g. wasps predators. We showed that both juvenile and adult spiders on webs with detritus or egg-sac decorations were undetectable by both hymenopteran and bird predators over short and long distances. Our results thus suggest that decorating webs with detritus or eggsacs by C. octotuberculata may camouflage the spider from both hymenopteran and bird predators in their common habitats [Current Zoology 56 (3: 379–387, 2010].

  4. PRDM16 Controls a Brown Fat/Skeletal Muscle Switch


    Seale, Patrick; Bjork, Bryan; Yang, Wenli; Kajimura, Shingo; Kuang, Shihuan; Scime, Anthony; Devarakonda, Srikripa; Chin, Sherry; Conroe, Heather M.; Erdjument-Bromage, Hediye; Tempst, Paul; Rudnicki, Michael A.; Beier, David R; Spiegelman, Bruce M.


    Brown fat can increase energy expenditure and protect against obesity through a specialized program of uncoupled respiration. We show here by in vivo fate mapping that brown but not white fat cells arise from precursors that express myf5, a gene previously thought to be expressed only in the myogenic lineage. Notably, the transcriptional regulator, PRDM16 controls a bidirectional cell fate switch between skeletal myoblasts and brown fat cells. Loss of PRDM16 from brown fat precursors causes a...

  5. The age and evolution of sociality in Stegodyphus spiders: a molecular phylogenetic perspective

    DEFF Research Database (Denmark)

    Johannesen, Jes; Lubin, Yael; Smith, Deborah R.;


    Social, cooperative breeding behaviour is rare in spiders and generally characterized by inbreeding, skewed sex ratios and high rates of colony turnover, processes that when combined may reduce genetic variation and lower individual fitness quickly. On these grounds, social spider species have been...... suggested to be unstable in evolutionary time, and hence sociality a rare phenomenon in spiders. Based on a partial molecular phylogeny of the genus Stegodyphus, we address the hypothesis that social spiders in this genus are evolutionary transient. We estimate the age of the three social species, test...... whether they represent an ancestral or derived state and assess diversification relative to subsocial congeners. Intraspecific sequence divergence was high in all of the social species, lending no support for the idea that they are young, transient species. The age of the social lineages, constant lineage...

  6. Spiders (Araneae) of the Moosehorn National Wildlife Refuge, Washington County, Maine (United States)

    US Fish and Wildlife Service, Department of the Interior — This report summarizes my identifications of spiders for graduate student Matthew Vander Haegen, College of Forest Resources, Department of Wildlife, University of...

  7. The distribution of spiders and Harvestmen (Chelicerata) in the Dutch National Park "De Hoge Veluwe"

    NARCIS (Netherlands)

    Hammen, van der L.


    A preliminary study is made of the distribution of Araneida and Opilionida (Chelicerata) in a National Park in The Netherlands. Special attention is paid to the influence of vegetation structure on the distribution of the spiders.

  8. Prediction of abundance of forest spiders according to climate warming in South Korea

    Directory of Open Access Journals (Sweden)

    Tae-Sung Kwon


    Full Text Available Distribution of spiders will be changed as climate warms. Abundance of spider species was predicted nationwide in South Korea. Abundance of spiders was projected using temperature species distribution model based on a nationwide data (366 forest sites according to climate change scenario RCP 4.5 and 8.5. The model predicts that 9 out of 17 species will increase in abundance while 8 species will decrease. Based on this finding, a qualitative prediction (increase or decrease was conducted on the species with more than 1% occurrence: 68 species are expected to decrease, 9 to increase, and 8 to change a little. In pooled estimation, 76 species (75% are expected to decrease, 18 species (18% to increase, and by 8 species (8% to have little change. The projection indicates that majority of spider species will decrease, but minority of species will increase as climate warms, suggesting great increase of remained species in lowlands.

  9. Effects of the Spider Venom on proliferation of Human Lung Adenocarcinoma Cell A549

    Directory of Open Access Journals (Sweden)

    Zengxiang HU


    Full Text Available Background and objective The spider venom may inspire new drugs to treat cancer. The aim of this study is to investigate the effects and mechanisms of spider venom on lung adenocarcinoma cell A549. Methods The proliferation of lung adenocarcinoma A549 cells was detected by MTT. The apoptosis rate was observed with MTT assay and flow cytometer. The activity of catalase was detected by colorimetry. The malondialdehyde (MDA content was determined by improved thiobarbituric acid fluorometric method. The expression of P38MAPK protein was analyzed with Western blot. Results Spider venom can remarkably inhibite the proliferation of lung adenocarcinoma A549 cells, increased activity of catalase and MDA content, down-regulated expression of P38MAPK compared with the control group. Conclusion The reduced proliferation of lung adenocarcinoma A549 cells by spider venom is may be associated with the increased of activity of catalase and MDA content and decreased expression of P38MAPK.

  10. Pre-flight integration and characterization of the SPIDER balloon-borne telescope

    CERN Document Server

    Rahlin, A S; Amiri, M; Benton, S J; Bock, J J; Bond, J R; Bryan, S A; Chiang, H C; Contaldi, C R; Crill, B P; Doré, O; Farhang, M; Filippini, J P; Fissel, L M; Fraisse, A A; Gambrel, A E; Gandilo, N N; Golwala, S; Gudmundsson, J E; Halpern, M; Hasselfield, M F; Hilton, G; Holmes, W A; Hristov, V V; Irwin, K D; Jones, W C; Kermish, Z D; Kuo, C L; MacTavish, C J; Mason, P V; Megerian, K; Moncelsi, L; Morford, T A; Nagy, J M; Netterfield, C B; O'Brient, R; Reintsema, C; Ruhl, J E; Runyan, M C; Shariff, J A; Soler, J D; Trangsrud, A; Tucker, C; Tucker, R S; Turner, A D; Weber, A C; Wiebe, D V; Young, E Y


    We present the results of integration and characterization of the SPIDER instrument after the 2013 pre-flight campaign. SPIDER is a balloon-borne polarimeter designed to probe the primordial gravitational wave signal in the degree-scale $B$-mode polarization of the cosmic microwave background. With six independent telescopes housing over 2000 detectors in the 94 GHz and 150 GHz frequency bands, SPIDER will map 7.5% of the sky with a depth of 11 to 14 $\\mu$K$\\cdot$arcmin at each frequency, which is a factor of $\\sim$5 improvement over Planck. We discuss the integration of the pointing, cryogenic, electronics, and power sub-systems, as well as pre-flight characterization of the detectors and optical systems. SPIDER is well prepared for a December 2014 flight from Antarctica, and is expected to be limited by astrophysical foreground emission, and not instrumental sensitivity, over the survey region.

  11. [Effect of Segestria florentina spider venom on the mechanism of inactivation of sodium channels]. (United States)

    Usmanov, P B; Kalikulov, D; Nasledov, G A; Tashmukhamedov, B A


    It was shown that Segestria florentina spider venom mainly reduces the rate and amount of sodium inactivation. This effect is likely to be responsible for the prolongation of the action potential. PMID:2413900

  12. Envia garciai, a new genus and species of mygalomorph spiders (Araneae, Microstigmatidae from Brazilian Amazonia

    Directory of Open Access Journals (Sweden)

    Ott Ricardo


    Full Text Available The genus Envia, comprising only the new species Envia garciai, is proposed. These small mygalomorph spiders were abundantly collected in soil cores and litter samples in primary rain forests near Manaus, Amazonas, Brazil.

  13. Biomimetic Spider Leg Joints: A Review from Biomechanical Research to Compliant Robotic Actuators

    Directory of Open Access Journals (Sweden)

    Stefan Landkammer


    Full Text Available Due to their inherent compliance, soft actuated joints are becoming increasingly important for robotic applications, especially when human-robot-interactions are expected. Several of these flexible actuators are inspired by biological models. One perfect showpiece for biomimetic robots is the spider leg, because it combines lightweight design and graceful movements with powerful and dynamic actuation. Building on this motivation, the review article focuses on compliant robotic joints inspired by the function principle of the spider leg. The mechanism is introduced by an overview of existing biological and biomechanical research. Thereupon a classification of robots that are bio-inspired by spider joints is presented. Based on this, the biomimetic robot applications referring to the spider principle are identified and discussed.

  14. SPIDER: Listening for the echoes of inflation from above the clouds (United States)

    Filippini, Jeffrey; Spider Collaboration


    We report on the status of SPIDER, a balloon-borne instrument to map the polarization of the cosmic microwave background at large angular scales. SPIDER targets the B-mode signature of primordial gravitational waves, with a focus on mapping a large sky area at multiple frequencies. SPIDER's six monochromatic refracting telescopes (three each at 95 and 150 GHz) feed a total of more than 2000 antenna-coupled superconducting transition-edge sensors. A sapphire half-wave plate at the aperture of each telescope modulates sky polarization for control of systematics. We discuss SPIDER's first long-duration balloon flight in January 2015, as well as the status of data analysis and development toward a second flight.

  15. Investigating the influence of farm-scape geospatial characteristics on spider diversity (United States)

    Biodiversity is an important aspect of sustainable crop management and agricultural production. Maintaining biodiversity within agricultural ecosystems, especially in regards to predator species, promotes natural pest control and many other ecosystem services. Spiders (Araneae) often prey upon commo...

  16. To spin or not to spin: spider silk fibers and more. (United States)

    Doblhofer, Elena; Heidebrecht, Aniela; Scheibel, Thomas


    Spider silk fibers have a sophisticated hierarchical structure composed of proteins with highly repetitive sequences. Their extraordinary mechanical properties, defined by a unique combination of strength and extensibility, are superior to most man-made fibers. Therefore, spider silk has fascinated mankind for thousands of years. However, due to their aggressive territorial behavior, farming of spiders is not feasible on a large scale. For this reason, biotechnological approaches were recently developed for the production of recombinant spider silk proteins. These recombinant proteins can be assembled into a variety of morphologies with a great range of properties for technical and medical applications. Here, the different approaches of biotechnological production and the advances in material processing toward various applications will be reviewed.

  17. Task specialization in two social spiders, Stegodyphus sarasinorum (Eresidae) and Anelosimus eximius (Theridiidae)

    DEFF Research Database (Denmark)

    Settepani, Virginia; Grinsted, Lena; Pedersen, Jørgen Granfeldt;


    questions: Do individual spiders vary consistently in their propensity to engage in prey attack? Are individual spiders' propensities to engage in web maintenance behaviour influenced by their previous engagement in prey attack? Interestingly, we found that both species showed some degree of task...... no individual specialization, but showed differentiation according to instar, where adult and subadult females were more likely to engage in prey attack than were juveniles. We found no evidence for division of labour between prey attack and web maintenance. Different solutions to achieve task differentiation...... skew is common in other group-living animals. Permanently, social spiders form highly related groups with reproductive skew and communal brood care. We investigated task differentiation in nonreproductive tasks in two permanently and independently derived social spider species asking the following...

  18. Captive spider monkeys (Ateles geoffroyi) arm-raise to solicit allo-grooming. (United States)

    Scheel, Matthew H; Edwards, Dori


    Old World monkeys solicit allo-grooming from conspecifics. However, there are relatively few studies of allo-grooming among spider monkeys, and descriptions of allo-grooming solicitation among spider monkeys are anecdotal. In this study, eighty-one hours of video, shot over eight weeks, captured 271 allo-grooming bouts among small groups of captive spider monkeys. Six of eight monkeys made heretofore unreported arm-raises that solicited higher than normal rates of allo-grooming. Allo-grooming bout durations following arm-raises also tended to be longer than bouts not preceded by arm-raises. The efficacy of the arm-raise at soliciting allo-grooming suggests spider monkeys are capable of intentional communication.

  19. SpiderFab: Architecture for On-Orbit Construction of Kilometer-Scale Apertures Project (United States)

    National Aeronautics and Space Administration — The SpiderFab effort has investigated the value proposition and technical feasibility of radically changing the way we build and deploy spacecraft in order to...

  20. Inhibition of enzymatic browning in foods and beverages. (United States)

    McEvily, A J; Iyengar, R; Otwell, W S


    Enzymatic browning is a major factor contributing to quality loss in foods and beverages. Sulfiting agents are used commonly to control browning; however, several negative attributes associated with sulfites have created the need for functional alternatives. Recent advances in the development of nonsulfite inhibitors of enzymatic browning are reviewed. The review focuses on compositions that are of practical relevance to food use.