WorldWideScience

Sample records for brown widow spider

  1. Black and brown widow spider bites in South Africa

    African Journals Online (AJOL)

    JUNIE 1993 ten were adults, 2 were aged 13 - 19 years and 11 were ... back 1). In contrast, 10 of the brown widow bites were on the upper part and 5 on the lower part of the body ..... patient develops generalised muscular pain and cramps,.

  2. Black widow spider

    Science.gov (United States)

    ... medlineplus.gov/ency/article/002858.htm Black widow spider To use the sharing features on this page, please enable JavaScript. The black widow spider (Latrodectus) has a shiny black body with a ...

  3. Exposure of Brown Recluse and Brown Widow Spiders (Araneae: Sicariidae, Theridiidae) to a Commercial Sulfuryl Fluoride Fumigation.

    Science.gov (United States)

    Vetter, Richard S; Hoddle, Mark S; Choe, Dong-Hwan; Thoms, Ellen

    2014-10-01

    The body of pesticide research on spiders is sparse with most studies using topical or residual applications to assess efficacy. Data on the effects of fumigation on spider survivorship are scarce in the scientific literature. In this study, we exposed adult male and female brown recluse spiders, Loxosceles reclusa Gertsch & Mulaik, and female brown widow spiders, Latrodectus geometricus C. L. Koch, to a commercial fumigation event using sulfuryl fluoride directed at termite control. General consensus from the pest control industry is that fumigation is not always effective for control of spiders for a variety of reasons, including insufficient fumigant dosage, particularly, for contents of egg sacs that require a higher fumigant dosage for control. We demonstrated that a sulfuryl fluoride fumigation with an accumulated dosage of 162 oz-h per 1,000 ft(3) at 21°C over 25 h (≈1.7 × the drywood termite dosage) directed at termites was sufficient to kill adult brown recluse and brown widow spiders. The effectiveness of commercial fumigation practices to control spiders, and particularly their egg sacs, warrants further study. © 2014 Entomological Society of America.

  4. Establishment of the Brown Widow Spider (Araneae: Theridiidae) and Infestation of its Egg Sacs by a Parasitoid, Philolema latrodecti (Hymenoptera: Eurytomidae), in French Polynesia and the Cook Islands.

    Science.gov (United States)

    Marie, Jérôme; Vetter, Richard S

    2015-11-01

    This paper presents two newly established species for French Polynesia: the invasive brown widow spider, Latrodectus geometricus C. L. Koch, and its potential biocontrol agent, the parasitoid wasp, Philolema latrodecti (Fullaway). The brown widow spider was recorded from the island of Moorea in 2006 and, since that discovery, the occurrence of this species has expanded to two of the five archipelagos of French Polynesia including the main island of Tahiti and four of the Cook Islands. Although the tropical climate contributes to the establishment of L. geometricus, a biotic factor, P. latrodecti, may restrain population from demographic explosion. This eurytomid wasp is present in French Polynesia and is a parasitoid that has been used in biological control of the southern black widow Latrodectus mactans (F.) in Hawaii. This wasp could become a significant limiting factor for L. geometricus distribution on these islands, as it was found in 31% of the Tahitian brown widow spider egg sacs that were dissected. However, thus far, the wasp was only found on Tahiti in association with the brown widow spider. Although the brown widow is generally considered to be less toxic than its black widow relatives, it remains of medical concern in French Polynesia because reactions to its bites can, at times, be severe. The spider remains of public concern because it is a novel species; it has the word widow in its name and dark morphs are mistaken as black widows. © The Authors 2015. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  5. Efficacy of Several Pesticide Products on Brown Widow Spider (Araneae: Theridiidae) Egg Sacs and Their Penetration Through the Egg Sac Silk.

    Science.gov (United States)

    Vetter, Richard S; Tarango, Jacob; Campbell, Kathleen A; Tham, Christine; Hayashi, Cheryl Y; Choe, Dong-Hwan

    2016-02-01

    Information on pesticide effects on spiders is less common than for insects; similar information for spider egg sacs is scarcer in the open literature. Spider egg sacs are typically covered with a protective silk layer. When pesticides are directly applied to egg sacs, the silk might prevent active ingredients from reaching the eggs, blocking their insecticidal effect. We investigated the impact of six water-based pesticide sprays and four oil-based aerosol products against egg sacs of brown widow spiders, Latrodectus geometricus C. L. Koch. All water-based spray products except one failed to provide significant mortality to egg sacs, resulting in successful spiderling emergence from treated egg sacs at a similar rate to untreated egg sacs. In contrast to water-based sprays, oil-based aerosols provided almost complete control, with 94-100% prevention of spiderling emergence. Penetration studies using colored pesticide products indicated that oil-based aerosols were significantly more effective in penetrating egg sac silk than were the water-based sprays, delivering the active ingredients on most (>99%) of the eggs inside the sac. The ability of pesticides to penetrate spider egg sac silk and deliver lethal doses of active ingredients to the eggs is discussed in relation to the chemical nature of egg sac silk proteins. Our study suggests that pest management procedures primarily relying on perimeter application of water-based sprays might not provide satisfactory control of brown widow spider eggs. Determination of the most effective active ingredients and carrier characteristics warrant further research to provide more effective control options for spider egg sacs. © The Authors 2015. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  6. Brown Recluse Spider

    Science.gov (United States)

    ... to a group of spiders commonly known as violin spiders or fiddlebacks. The characteristic fiddle-shaped pattern ... 4-19.1mm) • Color: Golden brown • A dark violin/fiddle shape (see top photo) is located on ...

  7. Spider Bites: First Aid

    Science.gov (United States)

    ... care immediately if: You were bitten by a black widow or brown recluse spider You are unsure whether the bite ... in the South. Signs and symptoms of a black widow spider bite may include: At ... fever and nausea Brown recluse spider The brown recluse spider has a ...

  8. Postharvest fumigation of California table grapes with ozone to control Western black widow spider (Araneae: Theridiidae)

    Science.gov (United States)

    Ozone fumigations were evaluated for postharvest control of Western black widow spider (BWS), Latrodectus hesperus (Chamberlin and Ivie), in fresh table grapes destined for export from California USA. Mature adult female black widow spiders were contained in separate gas-permeable cages within a flo...

  9. House spider genome uncovers evolutionary shifts in the diversity and expression of black widow venom proteins associated with extreme toxicity.

    Science.gov (United States)

    Gendreau, Kerry L; Haney, Robert A; Schwager, Evelyn E; Wierschin, Torsten; Stanke, Mario; Richards, Stephen; Garb, Jessica E

    2017-02-16

    Black widow spiders are infamous for their neurotoxic venom, which can cause extreme and long-lasting pain. This unusual venom is dominated by latrotoxins and latrodectins, two protein families virtually unknown outside of the black widow genus Latrodectus, that are difficult to study given the paucity of spider genomes. Using tissue-, sex- and stage-specific expression data, we analyzed the recently sequenced genome of the house spider (Parasteatoda tepidariorum), a close relative of black widows, to investigate latrotoxin and latrodectin diversity, expression and evolution. We discovered at least 47 latrotoxin genes in the house spider genome, many of which are tandem-arrayed. Latrotoxins vary extensively in predicted structural domains and expression, implying their significant functional diversification. Phylogenetic analyses show latrotoxins have substantially duplicated after the Latrodectus/Parasteatoda split and that they are also related to proteins found in endosymbiotic bacteria. Latrodectin genes are less numerous than latrotoxins, but analyses show their recruitment for venom function from neuropeptide hormone genes following duplication, inversion and domain truncation. While latrodectins and other peptides are highly expressed in house spider and black widow venom glands, latrotoxins account for a far smaller percentage of house spider venom gland expression. The house spider genome sequence provides novel insights into the evolution of venom toxins once considered unique to black widows. Our results greatly expand the size of the latrotoxin gene family, reinforce its narrow phylogenetic distribution, and provide additional evidence for the lateral transfer of latrotoxins between spiders and bacterial endosymbionts. Moreover, we strengthen the evidence for the evolution of latrodectin venom genes from the ecdysozoan Ion Transport Peptide (ITP)/Crustacean Hyperglycemic Hormone (CHH) neuropeptide superfamily. The lower expression of latrotoxins in

  10. The first report of the widow spider Latrodectus elegant (Araneae: Theridiidae from India

    Directory of Open Access Journals (Sweden)

    A. Kananbala

    2012-07-01

    Full Text Available The widow spider genus Latrodectus Walckenaer, 1805, in India is represented by three species L. erythromelas Schmidt & Klaas, 1991, L. geometricus C.L. Koch, 1841 and L. hasselti Thorell, 1870. In this paper, we report the occurrence of Lactrodectus elegans Thorell, 1898 for the first time from India. We provide additional information on taxonomy and natural history based on the specimens collected from Manipur.

  11. Brown spider dermonecrotic toxin directly induces nephrotoxicity

    International Nuclear Information System (INIS)

    Chaim, Olga Meiri; Sade, Youssef Bacila; Bertoni da Silveira, Rafael; Toma, Leny; Kalapothakis, Evanguedes; Chavez-Olortegui, Carlos; Mangili, Oldemir Carlos; Gremski, Waldemiro; Dietrich, Carl Peter von; Nader, Helena B.; Sanches Veiga, Silvio

    2006-01-01

    Brown spider (Loxosceles genus) venom can induce dermonecrotic lesions at the bite site and systemic manifestations including fever, vomiting, convulsions, disseminated intravascular coagulation, hemolytic anemia and acute renal failure. The venom is composed of a mixture of proteins with several molecules biochemically and biologically well characterized. The mechanism by which the venom induces renal damage is unknown. By using mice exposed to Loxosceles intermedia recombinant dermonecrotic toxin (LiRecDT), we showed direct induction of renal injuries. Microscopic analysis of renal biopsies from dermonecrotic toxin-treated mice showed histological alterations including glomerular edema and tubular necrosis. Hyalinization of tubules with deposition of proteinaceous material in the tubule lumen, tubule epithelial cell vacuoles, tubular edema and epithelial cell lysis was also observed. Leukocytic infiltration was neither observed in the glomerulus nor the tubules. Renal vessels showed no sign of inflammatory response. Additionally, biochemical analyses showed such toxin-induced changes in renal function as urine alkalinization, hematuria and azotemia with elevation of blood urea nitrogen levels. Immunofluorescence with dermonecrotic toxin antibodies and confocal microscopy analysis showed deposition and direct binding of this toxin to renal intrinsic structures. By immunoblotting with a hyperimmune dermonecrotic toxin antiserum on renal lysates from toxin-treated mice, we detected a positive signal at the region of 33-35 kDa, which strengthens the idea that renal failure is directly induced by dermonecrotic toxin. Immunofluorescence reaction with dermonecrotic toxin antibodies revealed deposition and binding of this toxin directly in MDCK epithelial cells in culture. Similarly, dermonecrotic toxin treatment caused morphological alterations of MDCK cells including cytoplasmic vacuoles, blebs, evoked impaired spreading and detached cells from each other and from

  12. Chromosome mapping of dragline silk genes in the genomes of widow spiders (Araneae, Theridiidae.

    Directory of Open Access Journals (Sweden)

    Yonghui Zhao

    Full Text Available With its incredible strength and toughness, spider dragline silk is widely lauded for its impressive material properties. Dragline silk is composed of two structural proteins, MaSp1 and MaSp2, which are encoded by members of the spidroin gene family. While previous studies have characterized the genes that encode the constituent proteins of spider silks, nothing is known about the physical location of these genes. We determined karyotypes and sex chromosome organization for the widow spiders, Latrodectus hesperus and L. geometricus (Araneae, Theridiidae. We then used fluorescence in situ hybridization to map the genomic locations of the genes for the silk proteins that compose the remarkable spider dragline. These genes included three loci for the MaSp1 protein and the single locus for the MaSp2 protein. In addition, we mapped a MaSp1 pseudogene. All the MaSp1 gene copies and pseudogene localized to a single chromosomal region while MaSp2 was located on a different chromosome of L. hesperus. Using probes derived from L. hesperus, we comparatively mapped all three MaSp1 loci to a single region of a L. geometricus chromosome. As with L. hesperus, MaSp2 was found on a separate L. geometricus chromosome, thus again unlinked to the MaSp1 loci. These results indicate orthology of the corresponding chromosomal regions in the two widow genomes. Moreover, the occurrence of multiple MaSp1 loci in a conserved gene cluster across species suggests that MaSp1 proliferated by tandem duplication in a common ancestor of L. geometricus and L. hesperus. Unequal crossover events during recombination could have given rise to the gene copies and could also maintain sequence similarity among gene copies over time. Further comparative mapping with taxa of increasing divergence from Latrodectus will pinpoint when the MaSp1 duplication events occurred and the phylogenetic distribution of silk gene linkage patterns.

  13. Systematics, Bioecology, and Medical Importance of Widow Spiders (Lathrodectus spp. in Khorasan Province, Iran

    Directory of Open Access Journals (Sweden)

    J Rafijenad

    2007-06-01

    Full Text Available Following the hospitalization of 195 individuals due to the spider bite in 1995 and three cases of recorded death in the year of 1993 which were referred to Emam Reza Hospital in Mashad, the present study was undertaken on bionomics and medical importance of Lathrodectus spp in Khorasan Province, during 1995-2005. A total cases of 195 bites were studied composing of 70.8 % males and 29.2% females. The most prevalence cases were observed in mid age (20-55 years old and par¬ticularly among farmers (36.4%. A total number of 216 adult widow spiders and 258 egg sacs were collected from their habitats in different localities of 15 counties in the province. The following species have been recognized: Lathrodectus tredecimgottatus (62%, L. dahli (32%, L. geometricus (5% and L. pallidus (1%. Here is the first report on the occurrence of males of L. pallidus as well as both sexes of L. trdecimgottatus and L. geometricus in the country. The sex ratio among collected specimens was 88% and 12% female and male, respectively. Summer provides the most suitable and favorable climatic condition for the activities of these spiders. However 65% of spiders were collected in this season. Among different cit¬ies, Mashad had (60% the most reported cases in the study area. Foot was more injured than other parts. 96.5% of pa¬tients exhib¬ited localized pain from which only 2% had no pain in the bitten part and 87% had a generalized pain in whole body.

  14. Scavenging by spiders (Araneae) and its relationship to pest management of the brown recluse spider.

    Science.gov (United States)

    Vetter, Richard S

    2011-06-01

    Experiments reported in Sandidge (2003; Nature 426: 30) indicated that the brown recluse spider, Loxosceles reclusa Gertsch & Mulaik, preferred to scavenge dead prey over live prey and that the spiders were not detrimentally affected when fed insecticide-killed crickets. Extrapolations made in subsequent media coverage disseminating the results of this research made counter-intuitive statements that pesticide treatment in houses would increase brown recluse populations in homes. This information was presented as if the scavenging behavior was specialized in the brown recluse; however, it was more likely that this behavior has not been well studied in other species. To provide a comparison, the current laboratory study examined the likelihood of non-Loxosceles spiders to scavenge dead prey. Of 100 non-Loxosceles spiders that were tested (from 11 families, 24 genera, and at least 29 species from a variety of spider hunting guilds), 99 scavenged dead crickets when offered in petri dishes. Some of the spiders were webspinners in which real-world scavenging of dead prey is virtually impossible, yet they scavenge when given the opportunity. Therefore, scavenging is a flexible opportunistic predatory behavior that is spread across a variety of taxa and is not a unique behavior in brown recluses. These findings are discussed in relation to pest management practices.

  15. Recent advances in the understanding of brown spider venoms: From the biology of spiders to the molecular mechanisms of toxins.

    Science.gov (United States)

    Gremski, Luiza Helena; Trevisan-Silva, Dilza; Ferrer, Valéria Pereira; Matsubara, Fernando Hitomi; Meissner, Gabriel Otto; Wille, Ana Carolina Martins; Vuitika, Larissa; Dias-Lopes, Camila; Ullah, Anwar; de Moraes, Fábio Rogério; Chávez-Olórtegui, Carlos; Barbaro, Katia Cristina; Murakami, Mario Tyago; Arni, Raghuvir Krishnaswamy; Senff-Ribeiro, Andrea; Chaim, Olga Meiri; Veiga, Silvio Sanches

    2014-06-01

    The Loxosceles genus spiders (the brown spiders) are encountered in all the continents, and the clinical manifestations following spider bites include skin necrosis with gravitational lesion spreading and occasional systemic manifestations, such as intravascular hemolysis, thrombocytopenia and acute renal failure. Brown spider venoms are complex mixtures of toxins especially enriched in three molecular families: the phospholipases D, astacin-like metalloproteases and Inhibitor Cystine Knot (ICK) peptides. Other toxins with low level of expression also present in the venom include the serine proteases, serine protease inhibitors, hyaluronidases, allergen factors and translationally controlled tumor protein (TCTP). The mechanisms by which the Loxosceles venoms act and exert their noxious effects are not fully understood. Except for the brown spider venom phospholipase D, which causes dermonecrosis, hemolysis, thrombocytopenia and renal failure, the pathological activities of the other venom toxins remain unclear. The objective of the present review is to provide insights into the brown spider venoms and loxoscelism based on recent results. These insights include the biology of brown spiders, the clinical features of loxoscelism and the diagnosis and therapy of brown spider bites. Regarding the brown spider venom, this review includes a description of the novel toxins revealed by molecular biology and proteomics techniques, the data regarding three-dimensional toxin structures, and the mechanism of action of these molecules. Finally, the biotechnological applications of the venom components, especially for those toxins reported as recombinant molecules, and the challenges for future study are discussed. Copyright © 2014 Elsevier Ltd. All rights reserved.

  16. Brown Spider (Loxosceles genus Venom Toxins: Tools for Biological Purposes

    Directory of Open Access Journals (Sweden)

    Andrea Senff-Ribeiro

    2011-03-01

    Full Text Available Venomous animals use their venoms as tools for defense or predation. These venoms are complex mixtures, mainly enriched of proteic toxins or peptides with several, and different, biological activities. In general, spider venom is rich in biologically active molecules that are useful in experimental protocols for pharmacology, biochemistry, cell biology and immunology, as well as putative tools for biotechnology and industries. Spider venoms have recently garnered much attention from several research groups worldwide. Brown spider (Loxosceles genus venom is enriched in low molecular mass proteins (5–40 kDa. Although their venom is produced in minute volumes (a few microliters, and contain only tens of micrograms of protein, the use of techniques based on molecular biology and proteomic analysis has afforded rational projects in the area and permitted the discovery and identification of a great number of novel toxins. The brown spider phospholipase-D family is undoubtedly the most investigated and characterized, although other important toxins, such as low molecular mass insecticidal peptides, metalloproteases and hyaluronidases have also been identified and featured in literature. The molecular pathways of the action of these toxins have been reported and brought new insights in the field of biotechnology. Herein, we shall see how recent reports describing discoveries in the area of brown spider venom have expanded biotechnological uses of molecules identified in these venoms, with special emphasis on the construction of a cDNA library for venom glands, transcriptome analysis, proteomic projects, recombinant expression of different proteic toxins, and finally structural descriptions based on crystallography of toxins.

  17. Isolation and Preliminary Characterization of Proteinaceous Toxins with Insecticidal and Antibacterial Activities from Black Widow Spider (L. tredecimguttatus Eggs

    Directory of Open Access Journals (Sweden)

    Qian Lei

    2015-03-01

    Full Text Available The eggs of black widow spider (L. tredecimguttatus have been demonstrated to be rich in toxic proteinaceous components. The study on such active components is of theoretical and practical importance. In the present work, using a combination of multiple biochemical and biological strategies, we isolated and characterized the proteinaceous components from the aqueous extract of the black widow spider eggs. After gel filtration of the egg extract, the resulting main protein and peptide peaks were further fractionated by ion exchange chromatography and reversed-phase high performance liquid chromatography. Two proteinaceous components, named latroeggtoxin-III and latroeggtoxin-IV, respectively, were purified to homogeneity. Latroeggtoxin-III was demonstrated to have a molecular weight of about 36 kDa. Activity analysis indicated that latroeggtoxin-III exhibited neurotoxicity against cockroaches but had no obvious effect on mice, suggesting that it is an insect-specific toxin. Latroeggtoxin-IV, with a molecular weight of 3.6 kDa, was shown to be a broad-spectrum antibacterial peptide, showing inhibitory activity against all five species of bacteria tested, with the highest activity against Staphylococcus aureus. Finally, the implications of the proteinaceous toxins in egg protection and their potential applications were analyzed and discussed.

  18. Vibration transmission through sheet webs of hobo spiders (Eratigena agrestis) and tangle webs of western black widow spiders (Latrodectus hesperus).

    Science.gov (United States)

    Vibert, Samantha; Scott, Catherine; Gries, Gerhard

    2016-11-01

    Web-building spiders construct their own vibratory signaling environments. Web architecture should affect signal design, and vice versa, such that vibratory signals are transmitted with a minimum of attenuation and degradation. However, the web is the medium through which a spider senses both vibratory signals from courting males and cues produced by captured prey. Moreover, webs function not only in vibration transmission, but also in defense from predators and the elements. These multiple functions may impose conflicting selection pressures on web design. We investigated vibration transmission efficiency and accuracy through two web types with contrasting architectures: sheet webs of Eratigena agrestis (Agelenidae) and tangle webs of Latrodectus hesperus (Theridiidae). We measured vibration transmission efficiencies by playing frequency sweeps through webs with a piezoelectric vibrator and a loudspeaker, recording the resulting web vibrations at several locations on each web using a laser Doppler vibrometer. Transmission efficiencies through both web types were highly variable, with within-web variation greater than among-web variation. There was little difference in transmission efficiencies of longitudinal and transverse vibrations. The inconsistent transmission of specific frequencies through webs suggests that parameters other than frequency are most important in allowing these spiders to distinguish between vibrations of prey and courting males.

  19. Geophagy in brown spider monkeys (Ateles hybridus) in a lowland tropical rainforest in Colombia.

    Science.gov (United States)

    Link, Andres; de Luna, Ana Gabriela; Arango, Ricardo; Diaz, Maria Clara

    2011-01-01

    Spider monkeys and howler monkeys are the only Neotropical primates that eat soil from mineral licks. Not all species within these genera visit mineral licks, and geophagy has been restricted to populations of Ateles belzebuth belzebuth,Ateles belzebuth chamek and Alouatta seniculus in western Amazonian rainforests. With the aid of a camera trap we studied the visitation patterns of a group of brown spider monkeys (Ateles hybridus) to a mineral lick at Serrania de Las Quinchas, in Colombia. Spider monkeys visited the lick frequently throughout the year, with a monthly average of 21.7 ± 7.2 visits per 100 days of camera trapping (n = 14 months). Spider monkeys visited the mineral lick almost always on days with no rain, or very little (<3 mm) rain, suggesting that proximate environmental variables might determine spider monkeys' decisions to come to the ground at the licks. This study expands the geographical occurrence of mineral lick use by spider monkeys providing additional data for future assessments on the biogeographical correlates of mineral lick use by platyrrhines. Copyright © 2011 S. Karger AG, Basel.

  20. The diet of the black widow spider Latrodectus mirabilis (Theridiidae in two cereal crops of central Argentina

    Directory of Open Access Journals (Sweden)

    Gabriel Pompozzi

    2013-12-01

    Full Text Available The spider Latrodectus mirabilis (Holmberg, 1876 is commonly found in cereals crops of central Argentina. We studied its diet composition at the field and capture rate on leaf-cutting ants based on laboratory experiments. This study comprises the first approach that documents the diet of L. mirabilis in wheat and oat fields of central Argentina. We identified 1,004 prey items collected from its webs during the last phenological stages of both cereal crops. The prey composition was variable but the spiders prey mainly on ants (Formicidae, Hymenoptera, who represented more than 86% of the total. Meanwhile, in the capture rate experiences we registered a high proportion of ants captured by spiders at the beginning of experiences, capturing the half of the ants from total in the first four hours. Summarizing, we reported a polyphagous diet of this spider species in wheat and oat fields. Ants were the most important prey item of this spider, as found in other Latrodectus spiders around the world.

  1. Brown spider (Loxosceles genus) venom toxins: Evaluation of biological conservation by immune cross-reactivity.

    Science.gov (United States)

    Buch, Daniela Regina; Souza, Fernanda Nunes; Meissner, Gabriel Otto; Morgon, Adriano Marcelo; Gremski, Luiza Helena; Ferrer, Valéria Pereira; Trevisan-Silva, Dilza; Matsubara, Fernando Hitomi; Boia-Ferreira, Mariana; Sade, Youssef Bacila; Chaves-Moreira, Daniele; Gremski, Waldemiro; Veiga, Silvio Sanches; Chaim, Olga Meiri; Senff-Ribeiro, Andrea

    2015-12-15

    Loxosceles spiders are responsible for serious human envenomations worldwide. The collection of symptoms found in victims after accidents is called loxoscelism and is characterized by two clinical conditions: cutaneous loxoscelism and systemic loxocelism. The only specific treatment is serum therapy, in which an antiserum produced with Loxosceles venom is administered to the victims after spider accidents. Our aim was to improve our knowledge, regarding the immunological relationship among toxins from the most epidemiologic important species in Brazil (Loxosceles intermedia, Loxosceles gaucho and Loxosceles laeta). Immunoassays using spider venoms and L. intermedia recombinant toxins were performed and their cross-reactivity assessed. The biological conservation of the main Loxosceles toxins (Phospholipases-D, Astacin-like metalloproteases, Hyaluronidase, ICK-insecticide peptide and TCTP-histamine releasing factor) were investigated. An in silico analysis of the putative epitopes was performed and is discussed on the basis of the experimental results. Our data is an immunological investigation in light of biological conservation throughout the Loxosceles genus. The results bring out new insights on brown spider venom toxins for study, diagnosis and treatment of loxoscelism and putative biotechnological applications concerning immune conserved features in the toxins. Copyright © 2015 Elsevier Ltd. All rights reserved.

  2. Tropical House Gecko (Hemidactylus mabouia predation on brown spiders (Loxosceles intermedia

    Directory of Open Access Journals (Sweden)

    E.N. Ramires

    2004-01-01

    Full Text Available Brown spiders (Loxosceles spp. are venomous arachnids, successfully adapted to urban habitats in Brazil. Loxoscelism became a serious public health problem in Paraná State, especially at the capital Curitiba, where the most abundant species is Loxosceles intermedia. Hemidactylus mabouia (Gekkonidae lizards are synanthropic predators of arthropods. In this paper, we describe the predatory behavior of the Tropical House Gecko H. mabouia on L. intermedia under laboratory conditions. Twelve geckos were observed, and all of them fed on brown spiders (n=123 observations. The attack consisted of a fast run followed by one bite on the spider’s abdomen or legs. The geckos did not attack L. intermedia anterior body parts, probably due to the fangs present in this region. Two Hemidactylus individuals were killed by L. intermedia bites: during a predatory encounter, and by an induced bite on a restrained lizard. The observations summarized in this paper show that H. mabouia could be used in the biological control of Loxosceles populations in human dwellings. However, additional field studies are necessary to quantify the impact of H. mabouia predation on urban populations of L. intermedia and other species of the same genus.

  3. Spider Bites (For Parents)

    Science.gov (United States)

    ... Videos for Educators Search English Español First Aid: Spider Bites KidsHealth / For Parents / First Aid: Spider Bites ... rare. Signs and Symptoms Of a brown recluse spider bite: red blister in the center with surrounding ...

  4. A Novel Hyaluronidase from Brown Spider (Loxosceles intermedia) Venom (Dietrich's Hyaluronidase): From Cloning to Functional Characterization

    Science.gov (United States)

    Ferrer, Valéria Pereira; de Mari, Thiago Lopes; Gremski, Luiza Helena; Trevisan Silva, Dilza; da Silveira, Rafael Bertoni; Gremski, Waldemiro; Chaim, Olga Meiri; Senff-Ribeiro, Andrea; Nader, Helena Bonciani; Veiga, Silvio Sanches

    2013-01-01

    Loxoscelism is the designation given to clinical symptoms evoked by Loxosceles spider's bites. Clinical manifestations include skin necrosis with gravitational spreading and systemic disturbs. The venom contains several enzymatic toxins. Herein, we describe the cloning, expression, refolding and biological evaluation of a novel brown spider protein characterized as a hyaluronidase. Employing a venom gland cDNA library, we cloned a hyaluronidase (1200 bp cDNA) that encodes for a signal peptide and a mature protein. Amino acid alignment revealed a structural relationship with members of hyaluronidase family, such as scorpion and snake species. Recombinant hyaluronidase was expressed as N-terminal His-tag fusion protein (∼45 kDa) in inclusion bodies and activity was achieved using refolding. Immunoblot analysis showed that antibodies that recognize the recombinant protein cross-reacted with hyaluronidase from whole venom as well as an anti-venom serum reacted with recombinant protein. Recombinant hyaluronidase was able to degrade purified hyaluronic acid (HA) and chondroitin sulfate (CS), while dermatan sulfate (DS) and heparan sulfate (HS) were not affected. Zymograph experiments resulted in ∼45 kDa lytic zones in hyaluronic acid (HA) and chondroitin sulfate (CS) substrates. Through in vivo experiments of dermonecrosis using rabbit skin, the recombinant hyaluronidase was shown to increase the dermonecrotic effect produced by recombinant dermonecrotic toxin from L. intermedia venom (LiRecDT1). These data support the hypothesis that hyaluronidase is a “spreading factor”. Recombinant hyaluronidase provides a useful tool for biotechnological ends. We propose the name Dietrich's Hyaluronidase for this enzyme, in honor of Professor Carl Peter von Dietrich, who dedicated his life to studying proteoglycans and glycosaminoglycans. PMID:23658852

  5. Evaluation of the efficacy of vacuum cleaners for the integrated control of brown spider Loxosceles intermedia

    Directory of Open Access Journals (Sweden)

    E. N. Ramires

    2007-01-01

    Full Text Available Some venomous spiders of the genus Loxosceles can reach high population densities inside and around houses. In Brazil, most spider accidents are related to Loxosceles intermedia. Control of loxoscelism should utilize integrated pest management tools, such as vacuum cleaners, to eliminate egg sacs, webs and spiders. The present study tested the efficacy of one type of vacuum cleaner (for professional and domestic use in the control of L. intermedia populations. Cockroaches (Pycnoscelus surinamensis were used in some tests for comparison. Vacuuming using standard accessories or a paper tube resulted in the death of all female (n=60, male (n=60, young (n=60 and just-hatched (n=60 L. intermedia, and all egg sacs (n=5 were destroyed. The removal of the plastic plate present at the bottom of the vacuuming tube inside the machine allowed some spiders to survive the vacuuming process. When kept inside a vacuum bag full of dust and debris, adult females (n=10 survived for 10 days; however, significant mortality was observed among male (n=10 and young individuals (n=10. Addition of cornstarch to the vacuum bag did not affect the spiders (n=20. Vacuum cleaners, such as the one used in the present investigation, are promising tools for integrated management of L. intermedia and other spiders in domestic environments.

  6. Brown Recluse spider bite mediated hemolysis: clinical features, a possible role for complement inhibitor therapy, and reduced RBC surface glycophorin A as a potential biomarker of venom exposure.

    Directory of Open Access Journals (Sweden)

    Eric A Gehrie

    Full Text Available The venom of Loxosceles reclusa (Brown Recluse spider can cause a severe, life-threatening hemolysis in humans for which no therapy is currently available in the USA beyond supportive measures. Because this hemolysis is uncommon, relatively little is known about its clinical manifestation, diagnosis, or management. Here, we aimed to clarify the clinical details of envenomation, to determine the efficacy of the complement inhibitor eculizumab to prevent the hemolysis in vitro, and to investigate markers of exposure to Brown Recluse venom.We performed a 10-year chart review of cases of Brown Recluse spider bite-mediated hemolysis at our institution. We also designed an in vitro assay to test the efficacy of eculizumab to inhibit hemolysis of venom exposed red blood cells. Finally, we compared levels of CD55, CD59 and glycophorin A on venom exposed versus venom-naïve cells.Most victims of severe Brown Recluse spider mediated hemolysis at our institution are children and follow an unpredictable clinical course. Brown Recluse spider bite mediated hemolysis is reduced by 79.2% (SD=18.8% by eculizumab in vitro. Erythrocyte glycophorin A, but not CD55 or CD59, is reduced after red blood cells are incubated with venom in vitro.Taken together, our laboratory data and clinical observations indicate that L. reclusa venom exposure results in non-specific antibody and complement fixation on red blood cells, resulting in complement mediated hemolysis that is curtailed by the complement inhibitor eculizumab in vitro. Glycophorin A measurement by flow cytometry may help to identify victims of L. reclusa envenomation.

  7. Coagulopathy after spider bites in a six-year-old boy

    Directory of Open Access Journals (Sweden)

    Ansari SH.

    2008-06-01

    Full Text Available Background: Spider bites are common in most parts of the world. In some areas, where snake or scorpion bites are common, spider bites may not be considered a significant problem by the general public and those who have been bitten by spiders may not go to a hospital. However, significant problems are observed in the victims of certain species of spiders including: widow spider (of the genus Latrodectus, including the black widow and brown spiders (of the genus Loxosceles, such as the brown recluse. Case: We report a six-year-old boy, admitted to the hospital two weeks after suffering a spider bite. The patient presented with a severe nose bleed, ecchymosis and purpura, as well as anemia, indicating a clotting disorder. Laboratory results revealed abnormal values for prothrombin time (PT >50 sec, partial thromboplastin time (PTT >120 min and fibrinogen = 0 mg/dl, whereas factor VIII was normal according to a mixing study, with a normal platelet count of 350,000/µl. The patient was managed with fresh frozen plasma every 12 h, and was discharged one week after hospital admission. At present, the patient is well with more normal laboratory results one month after treatment: PT=13.4 sec, PTT= 34 sec, fibrinogen=105 mg/dl.         Conclusions: Although spider bites are uncommon in Iran, severe systemic reactions may occur in the pediatric population requiring admission to the pediatric intensive care unit. These systemic reactions may include hemolytic anemia coagulopathy and renal failure.

  8. Widows banding together.

    Science.gov (United States)

    Owen, M

    1995-01-01

    In 1988, in India, more than 500 widows shocked their neighbors (and themselves) by gathering in the main square of a town to demand their pensions, legal protection so they could stay in their homes, their inheritance rights, the ability to retain their dead husband's portion of land, and proper remuneration for their labor. This event, organized by Shramjivi Samaj, a local trade union of the poor, was extremely successful in drawing public attention and public support to the formerly hidden problems of widows in a patriarchal society. SEWA, the Self-Employed Widows' Association, has expanded its programs to assist not only the already widowed but to prepare all women for eventual widowhood. SEWA members can acquire life and disability insurance on their husbands and can receive support in their efforts to protect their land from unfair claims. The Bangladesh Committee for Rural Advancement (BRAC) has trained paralegals to help enforce the aspects of Muslim law which protect widows. In Uganda, the International Federation of Women Lawyers and the Ministry of Women's Affairs helped groups of widows testify before officials in Kampala as part of a larger demonstration. Such actions not only draw public attention to the plight of widows, they also give widows the courage to demand justice from their own in-laws. The groups Philly Lutaya and TASO (the AIDS support organization) help AIDS widows in obtaining the necessities of life. TASO also trains widows to be counselors and teaches women how to write wills to protect their children. In Ghana, a grassroots "Ministry of Widows" rescues women banished from their homes and helps them find income-generating activities. In Kenya, the Widows and Orphans Societies help AIDS widows. In Africa, the widow's associations are relief and welfare-orientated. In India, the victim image has been shed, and women are becoming empowered. Widows are realizing that the support of other widows can replace and even surpass that received

  9. Hey! A Black Widow Spider Bit Me!

    Science.gov (United States)

    ... Their favorite places are woodpiles, tree stumps, trash piles, storage sheds, fruit and vegetable gardens, in stone ... spend time. Don't play around in rock piles or woodpiles. If you are working outside in ...

  10. Magnetic field decay in black widow pulsars

    Science.gov (United States)

    Mendes, Camile; de Avellar, Marcio G. B.; Horvath, J. E.; Souza, Rodrigo A. de; Benvenuto, O. G.; De Vito, M. A.

    2018-04-01

    We study in this work the evolution of the magnetic field in `redback-black widow' pulsars. Evolutionary calculations of these `spider' systems suggest that first the accretion operates in the redback stage, and later the companion star ablates matter due to winds from the recycled pulsar. It is generally believed that mass accretion by the pulsar results in a rapid decay of the magnetic field when compared to the rate of an isolated neutron star. We study the evolution of the magnetic field in black widow pulsars by solving numerically the induction equation using the modified Crank-Nicolson method with intermittent episodes of mass accretion on to the neutron star. Our results show that the magnetic field does not fall below a minimum value (`bottom field') in spite of the long evolution time of the black widow systems, extending the previous conclusions for much younger low-mass X-ray binary systems. We find that in this scenario, the magnetic field decay is dominated by the accretion rate, and that the existence of a bottom field is likely related to the fact that the surface temperature of the pulsar does not decay as predicted by the current cooling models. We also observe that the impurity of the pulsar crust is not a dominant factor in the decay of magnetic field for the long evolution time of black widow systems.

  11. Brown recluse spider

    Science.gov (United States)

    ... of the skin and whites of the eyes (jaundice) Kidney failure Seizures ... RS, Gausche-Hill M, eds. Rosen's Emergency Medicine: Concepts and Clinical Practice . 9th ed. Philadelphia, PA: Elsevier; ...

  12. Differences in the Morale of Older, Rural Widows and Widowers.

    Science.gov (United States)

    Scott, Jean Pearson; Kivett, Vira R.

    1985-01-01

    Examined effect of sex differences on morale of 257 older rural widows and widowers. Sex of respondent was not found to affect morale; however, perceived financial status and self-rated health had significant direct effects. Widows and widowers reporting higher morale had higher perceived financial status and rated their health as good.…

  13. Physiotherapeutic attendance after repairing surgeries of lesions by brown spider: a case report - doi:10.5020/18061230.2007.p133

    Directory of Open Access Journals (Sweden)

    Ricardo Marques Frezza

    2012-01-01

    Full Text Available The loxoscelism is the most serious form of arachnidism in Brazil. The genus Loxosceles comprises more than 100 species of spiders in African and American continents. In Brazil, they are known as brown spiders. Nevertheless the great incidence of occurrence, few are the reports about repairing procedures, specially related to Physiotherapy after surgeries due to dermonecrosis. The aim of this case report was to register the Physiotherapeutic attendance of a female patient, 29 years old, victim of loxoscelism and who underwent debridement and skin transplantation for repairing right forearm lesions while she was interned at a hospital. Afterwards, data were confronted with the literature about loxoscelism, burns and Physiotherapy after skin transplantation. It is concluded that the patients with lesions caused by loxoscelism, who need repairing surgeries, may benefit a lot from Physiotherapeutic attendance while still at hospital. Although, factors such as: the lesion’s location, the cicatrization period, the number and complexity of surgeries, may be decisive for this indication.

  14. 20 CFR 404.338 - Widow's and widower's benefits amounts.

    Science.gov (United States)

    2010-04-01

    ... benefit may change as explained in § 404.304. (c) Your monthly benefit will be reduced if the insured person chooses to receive old-age benefits before reaching full retirement age. If so, your benefit will... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Widow's and widower's benefits amounts. 404...

  15. Tarantula spider

    Science.gov (United States)

    ... page: //medlineplus.gov/ency/article/002855.htm Tarantula spider bite To use the sharing features on this ... This article describes the effects of a tarantula spider bite. The class of insects to which the ...

  16. Species status and conservation issues of New Zealand's endemic Latrodectus spider species (Araneae: Theridiidae)

    DEFF Research Database (Denmark)

    Vink, Cor J; Sirvid, Phillip J; Malumbres-Olarte, Jagoba

    2008-01-01

    New Zealand has two endemic widow spiders, Latrodectus katipo Powell, 1871 and L. atritus Urquhart, 1890. Both species face many conservation threats and are actively managed. The species status of the Latrodectus spiders of New Zealand was assessed using molecular (COI, ITS1, ITS2...

  17. Cytotoxic and apoptotic activities of black widow spiderling extract against HeLa cells.

    Science.gov (United States)

    Peng, Xiaozhen; Dai, Zhipan; Lei, Qian; Liang, Long; Yan, Shuai; Wang, Xianchun

    2017-06-01

    Black widow spiders contain toxic components not only in the venom glands but also in other parts of the spider body, including the legs and abdomen. Additionally, both the eggs and newborn spiderlings of the black widow spider contain venom. It is important to investigate their potential effects on cancer cells. In the present study, the effects of newborn black widow spiderling extract on human HeLa cells were evaluated in vitro . When applied at different concentrations, the total extract decreased HeLa cell viability in a dose-dependent manner, with an IC 50 value of 158 µg/ml. Flow cytometry indicated that treatment of HeLa cells with the total extract of the spiderlings induced apoptosis in HeLa cells in a dose-dependent manner and led to cell cycle arrest in the S-phase. Additionally, application of the total extract at different concentrations increased apoptosis-related caspase 3 activity in a dose-dependent manner. HeLa cells treated with the total extract appeared to be morphologically changed, exhibiting membrane blebbing, nuclear fragmentation and condensation of chromatin. Further separation and activity screening demonstrated that the cytotoxic and apoptotic activities of the total extract were attributable mainly to its high molecular mass proteins, one of which was purified and characterized to determine its anti-tumor activities on HeLa cells. The results of the present study therefore have expanded understanding regarding the effect of spider toxins on cancer cells and suggested that components of black widow spiderlings may be developed as a promising novel agent to treat cancer.

  18. The Case of the Missing Widow.

    Science.gov (United States)

    Veidemanis, Gladys V.

    When a woman is widowed, she automatically becomes a member of a community of isolated women who lack social status, economic power, and visibility in literature and the mass media. Literature by and about widows indicates four major reasons for this situation: there is no general recognition of the distinctive problems widows must face; except in…

  19. 20 CFR 222.24 - Relationship as remarried widow(er).

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Relationship as remarried widow(er). 222.24 Section 222.24 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT FAMILY RELATIONSHIPS Relationship as Divorced Spouse, Surviving Divorced Spouse, or Remarried Widow(er...

  20. SPIDER SILK

    Directory of Open Access Journals (Sweden)

    PORAV Viorica

    2014-05-01

    Full Text Available The strengthness and toughness of spider fiber and its multifunctional nature is only surpassed in some cases by synthetic high performance fibers. In the world of natural fibers, spider silk has been long time recognized as a wonder fiber for its unique combination of high strength and rupture elongation. Scientists in civil military engineering reveal that the power of biological material (spider silk lies in the geometric configuration of structural protein, and the small cluster of week hydrogen bonds that works together to resist force and dissipate energy. Each spider and each type of silk has a set of mechanical properties optimized for their biological function. Most silks, in particular deagline silk, have exceptional mechanical properties. They exhibit a unique combination of high tensile strength and extensibility (ductility. This enables a silk fiber to absorb a lot of energy before breaking (toughness, the area under a stress- strain curve. A frequent mistake made in the mainstream media is to confuse strength and toughness when comparing silk to other materials. As shown below in detail, weight for weight, silk is stronger than steel, but not as strong as Kevlar. Silk is,however, tougher than both.This paper inform about overview on the today trend in the world of spider silk.

  1. 20 CFR 218.44 - When a remarried widow(er) annuity ends.

    Science.gov (United States)

    2010-04-01

    ...(er)— (1) Dies; (2) Becomes entitled to an old age benefit under the Social Security Act that is equal...) remarries unless the marriage is to an individual entitled to a retirement, disability, widow(er)'s, father...

  2. Spider Vein Removal

    Science.gov (United States)

    Spider veins: How are they removed? I have spider veins on my legs. What options are available ... M.D. Several options are available to remove spider veins — thin red lines or weblike networks of ...

  3. Expression and immunological cross-reactivity of LALP3, a novel astacin-like metalloprotease from brown spider (Loxosceles intermedia) venom.

    Science.gov (United States)

    Morgon, Adriano M; Belisario-Ferrari, Matheus R; Trevisan-Silva, Dilza; Meissner, Gabriel O; Vuitika, Larissa; Marin, Brenda; Tashima, Alexandre K; Gremski, Luiza H; Gremski, Waldemiro; Senff-Ribeiro, Andrea; Veiga, Silvio S; Chaim, Olga M

    2016-01-01

    Loxosceles spiders' venom comprises a complex mixture of biologically active toxins, mostly consisting of low molecular mass components (2-40 kDa). Amongst, isoforms of astacin-like metalloproteases were identified through transcriptome and proteome analyses. Only LALP1 (Loxosceles Astacin-Like protease 1) has been characterized. Herein, we characterized LALP3 as a novel recombinant astacin-like metalloprotease isoform from Loxosceles intermedia venom. LALP3 cDNA was cloned in pET-SUMO vector, and its soluble heterologous expression was performed using a SUMO tag added to LALP3 to achieve solubility in Escherichia coli SHuffle T7 Express LysY cells, which express the disulfide bond isomerase DsbC. Protein purification was conducted by Ni-NTA Agarose resin and assayed for purity by SDS-PAGE under reducing conditions. Immunoblotting analyses were performed with specific antibodies recognizing LALP1 and whole venom. Western blotting showed linear epitopes from recombinant LALP3 that cross-reacted with LALP1, and dot blotting revealed conformational epitopes with native venom astacins. Mass spectrometry analysis revealed that the recombinant expressed protein is an astacin-like metalloprotease from L. intermedia venom. Furthermore, molecular modeling of LALP3 revealed that this isoform contains the zinc binding and Met-turn motifs, forming the active site, as has been observed in astacins. These data confirmed that LALP3, which was successfully obtained by heterologous expression using a prokaryote system, is a new astacin-like metalloprotease isoform present in L. intermedia venom. Copyright © 2016 Elsevier B.V. and Société Française de Biochimie et Biologie Moléculaire (SFBBM). All rights reserved.

  4. 20 CFR 404.337 - When does my entitlement to widow's and widower's benefits start and end?

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false When does my entitlement to widow's and widower's benefits start and end? 404.337 Section 404.337 Employees' Benefits SOCIAL SECURITY... does my entitlement to widow's and widower's benefits start and end? (a) We will find you entitled to...

  5. Widow inheritance and HIV/AIDS in rural Uganda.

    Science.gov (United States)

    Mabumba, E D; Mugyenyi, P; Batwala, V; Mulogo, E M; Mirembe, J; Khan, F A; Liljestrand, J

    2007-10-01

    Despite current efforts to combat HIV/AIDS through behavioural change, ingrained socio-cultural practices such as widow inheritance in south-western Uganda has not changed. Low education, unemployment, dowry, widows' socioeconomic demands and the inheritor's greed for the deceased's wealth, influence widow inheritance. Voluntary counselling and testing is needed for the widows and their inheritors; formal dowry should be removed from marriage and widow inheritance stripped of its sexual component.

  6. Spider Transcriptomes Identify Ancient Large-Scale Gene Duplication Event Potentially Important in Silk Gland Evolution.

    Science.gov (United States)

    Clarke, Thomas H; Garb, Jessica E; Hayashi, Cheryl Y; Arensburger, Peter; Ayoub, Nadia A

    2015-06-08

    The evolution of specialized tissues with novel functions, such as the silk synthesizing glands in spiders, is likely an influential driver of adaptive success. Large-scale gene duplication events and subsequent paralog divergence are thought to be required for generating evolutionary novelty. Such an event has been proposed for spiders, but not tested. We de novo assembled transcriptomes from three cobweb weaving spider species. Based on phylogenetic analyses of gene families with representatives from each of the three species, we found numerous duplication events indicative of a whole genome or segmental duplication. We estimated the age of the gene duplications relative to several speciation events within spiders and arachnids and found that the duplications likely occurred after the divergence of scorpions (order Scorpionida) and spiders (order Araneae), but before the divergence of the spider suborders Mygalomorphae and Araneomorphae, near the evolutionary origin of spider silk glands. Transcripts that are expressed exclusively or primarily within black widow silk glands are more likely to have a paralog descended from the ancient duplication event and have elevated amino acid replacement rates compared with other transcripts. Thus, an ancient large-scale gene duplication event within the spider lineage was likely an important source of molecular novelty during the evolution of silk gland-specific expression. This duplication event may have provided genetic material for subsequent silk gland diversification in the true spiders (Araneomorphae). © The Author(s) 2015. Published by Oxford University Press on behalf of the Society for Molecular Biology and Evolution.

  7. Nature Study Tips. Spiders.

    Science.gov (United States)

    Mulaik, Stanley B.

    1990-01-01

    Different types of spiders, their ranges and habits are discussed. Activities associated with the study of spiders are suggested. Four references are listed which may be of interest to beginners. (CW)

  8. Nervios and dysphoria in Mexican American widows.

    Science.gov (United States)

    Kay, M; Portillo, C

    1989-01-01

    One hundred widows participating in experimental research entitled Efficacy of Support Groups for Mexican American Widows were studied to learn how they express the loss of their husbands. Mourning practices, acknowledged symptoms of dysphoria, and somatic reactions were studied to learn if the syndrome of nervios subsumes their reaction to bereavement. In addition, their responses to instruments designed to measure depression, the Spanish version of the Beck Depression Inventory and the Center for Epidemiologic Studies Depression Scale, were examined for correlation with nervios and relationships to Mexican American acculturation. Nervios seems to be a manifestation of dysphoria rather than a specific syndrome for these women.

  9. Did You Say Spiders?

    Science.gov (United States)

    Campbell, Alene

    This spider unit focuses on students' development of cooperative learning and inquiry-based skills. Students read "The Very Busy Spider" by Eric Carle, and then work in cooperative groups using the Internet to research and synthesize important information about spiders. Technology is used for vocabulary instruction and to create a…

  10. Early events in the evolution of spider silk genes.

    Directory of Open Access Journals (Sweden)

    James Starrett

    Full Text Available Silk spinning is essential to spider ecology and has had a key role in the expansive diversification of spiders. Silk is composed primarily of proteins called spidroins, which are encoded by a multi-gene family. Spidroins have been studied extensively in the derived clade, Orbiculariae (orb-weavers, from the suborder Araneomorphae ('true spiders'. Orbicularians produce a suite of different silks, and underlying this repertoire is a history of duplication and spidroin gene divergence. A second class of silk proteins, Egg Case Proteins (ECPs, is known only from the orbicularian species, Lactrodectus hesperus (Western black widow. In L. hesperus, ECPs bond with tubuliform spidroins to form egg case silk fibers. Because most of the phylogenetic diversity of spiders has not been sampled for their silk genes, there is limited understanding of spidroin gene family history and the prevalence of ECPs. Silk genes have not been reported from the suborder Mesothelae (segmented spiders, which diverged from all other spiders >380 million years ago, and sampling from Mygalomorphae (tarantulas, trapdoor spiders and basal araneomorph lineages is sparse. In comparison to orbicularians, mesotheles and mygalomorphs have a simpler silk biology and thus are hypothesized to have less diversity of silk genes. Here, we present cDNAs synthesized from the silk glands of six mygalomorph species, a mesothele, and a non-orbicularian araneomorph, and uncover a surprisingly rich silk gene diversity. In particular, we find ECP homologs in the mesothele, suggesting that ECPs were present in the common ancestor of extant spiders, and originally were not specialized to complex with tubuliform spidroins. Furthermore, gene-tree/species-tree reconciliation analysis reveals that numerous spidroin gene duplications occurred after the split between Mesothelae and Opisthothelae (Mygalomorphae plus Araneomorphae. We use the spidroin gene tree to reconstruct the evolution of amino acid

  11. Spiders in dermatology.

    Science.gov (United States)

    Kang, Jun K; Bhate, Chinmoy; Schwartz, Robert A

    2014-09-01

    Spider bites represent an unusual and potentially over-represented clinical diagnosis. Despite a common fear of spiders, known as arachnophobia, current knowledge suggests that only a small number of families within the order Araneae are medically relevant. Moreover, most cutaneous spider reactions, including both evenomations and physical trauma, produce mild, local symptoms which may be managed with supportive care alone. The differential diagnosis for spider bites may be broad, especially if the offending arachnid is not seen or found. We describe a series of spiders relevant to the dermatologist in the United States.

  12. Hey! A Brown Recluse Spider Bit Me!

    Science.gov (United States)

    ... like antibiotics, antihistamines, or pain medicines. Rarely, a skin graft might be needed if the skin is really damaged at the area of the bite. (A skin graft is when a small amount of skin is ...

  13. [Widows of victims of Nazi concentration camps: their pathology].

    Science.gov (United States)

    Ryn, Z J

    1992-09-01

    The psychosocial situation of widows and orphans of victims of the Nazi concentration camps in Poland are presented. In 1984, 74 widows of victims from the Auschwitz-Birkenau camp were interviewed. This article describes widows' emotional-behavioral reactions when facing the imprisonment and death of their husbands, their difficulties in adapting themselves to widowhood, different adaptative forms of memories of their married life, and consequences relevant to widows' mental health and family, and social consequences of widowhood.

  14. British Widows of the South African War and the Origins of War Widows' Pensions.

    Science.gov (United States)

    Riedi, Eliza

    2018-06-01

    The South African War of 1899-1902 cost the lives of 22,000 British and colonial soldiers and created almost 5,000 British war widows. It was in this context that the first state pensions for the widows of rank and file soldiers were introduced in 1901. Triggered by unexpectedly high casualty rates and widespread dissatisfaction with charitable provision, the introduction of state pensions also reflected changing public attitudes towards soldiers and their dependants in the context of an imperial war. Dismissed in the historiography as insignificant because of its low rates and restrictive eligibility clauses, the 1901 scheme in fact delivered pensions to the majority of war widows and made the Edwardian state their most important source of financial support. This article, after discussing the social and political context in which widows' pensions were developed, analyses the economics of the scheme and how key eligibility rules were formulated, before investigating significant changes in the scheme to 1920, the point at which Boer War widows were finally granted full maintenance. Strongly influenced by the practices of Victorian armed forces charities and by contemporary ideologies of gender and class, the South African War pension regulations created precedents which would continue to shape pensions for military widows to the end of the twentieth century.

  15. 20 CFR 410.360 - Determination of dependency; widow.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Determination of dependency; widow. 410.360... OF 1969, TITLE IV-BLACK LUNG BENEFITS (1969- ) Relationship and Dependency § 410.360 Determination of dependency; widow. (a) General. An individual who is the miner's widow (see § 410.320) will be determined to...

  16. Attending to detail by communal spider-eating spiders.

    Science.gov (United States)

    Jackson, Robert R; Nelson, Ximena J

    2012-07-01

    Communal predators may often need to make especially intricate foraging decisions, as a predator's success may depend on the actions of its neighbours. Here,we consider the decisions made by Portia africana, a jumping spider (Salticidae) that preys on other spiders, including Oecobius amboseli (Oecobiidae), a small prey spider that lives under small sheets of silk (nests) on the walls of buildings. P. africana juveniles settle near oecobiid nests and then ambush oecobiids as they leave or enter the nest. Two or more P. africana juveniles sometimes settle at the same nest and, when an oecobiid is captured, the P. africana juveniles may share the meal. We investigated the joining decisions made by naïve P. africana juveniles. Experiments were based on using lures (dead spiders positioned in lifelike posture) arranged in a series of 17 different scenes defined by the presence/absence of a nest, the lure types present and the configuration of the lures and the nest. Our findings imply that P. africana juveniles make remarkably precise predatory decisions, with the variables that matter including whether a nest is present, the identity of spiders inside and outside a nest and how spiders are positioned relative to each other and the nest.

  17. Funnel-web spider bite

    Science.gov (United States)

    ... page: //medlineplus.gov/ency/article/002844.htm Funnel-web spider bite To use the sharing features on ... the effects of a bite from the funnel-web spider. Male funnel-web spiders are more poisonous ...

  18. 20 CFR 404.346 - Your relationship as wife, husband, widow, or widower based upon a deemed valid marriage.

    Science.gov (United States)

    2010-04-01

    ... widower based upon a deemed valid marriage. 404.346 Section 404.346 Employees' Benefits SOCIAL SECURITY... relationship as wife, husband, widow, or widower based upon a deemed valid marriage. (a) General. If your... explained in § 404.345, you may be eligible for benefits based upon a deemed valid marriage. You will be...

  19. Characterizing the Secondary Protein Structure of Black Widow Dragline Silk Using Solid-State NMR & X-ray Diffraction

    Science.gov (United States)

    Jenkins, Janelle E.; Sampath, Sujatha; Butler, Emily; Kim, Jihyun; Henning, Robert W.; Holland, Gregory P.; Yarger, Jeffery L.

    2013-01-01

    This study provides a detailed secondary structural characterization of major ampullate dragline silk from Latrodectus hesperus (black widow) spiders. X-ray diffraction results show that the structure of black widow major ampullate silk fibers is comprised of stacked β-sheet nanocrystallites oriented parallel to the fiber axis and an amorphous region with oriented (anisotropic) and isotropic components. The combination of two-dimensional (2D) 13C-13C through-space and through-bond solid-state NMR experiments provide chemical shifts that are used to determine detailed information about amino acid motif secondary structure in black widow spider dragline silk. Individual amino acids are incorporated into different repetitive motifs that make up the majority of this protein-based biopolymer. From the solid-state NMR measurements, we assign distinct secondary conformations to each repetitive amino acid motif and hence to the amino acids that make up the motifs. Specifically, alanine is incorporated in β-sheet (poly(Alan) and poly(Gly-Ala)), 31-helix (poly(Gly-Gly-Xaa), and α-helix (poly(Gln-Gln-Ala-Tyr)) components. Glycine is determined to be in β-sheet (poly(Gly-Ala)) and 31-helical (poly(Gly-Gly-Xaa)) regions, while serine is present in β-sheet (poly(Gly-Ala-Ser)), 31-helix (poly(Gly-Gly-Ser)), and β-turn (poly(Gly-Pro-Ser)) structures. These various motif-specific secondary structural elements are quantitatively correlated to the primary amino acid sequence of major ampullate spidroin 1 and 2 (MaSp1 and MaSp2) and are shown to form a self-consistent model for black widow dragline silk. PMID:24024617

  20. Older widows and married women: their intimates and confidants.

    Science.gov (United States)

    Babchuk, N; Anderson, T B

    1989-01-01

    Interview data obtained from 132 women sixty-five and older reveals that the widows and married women have a comparable number of primary friends. Being over age seventy-four influences the size of the friendship network for widows but not married women. The primary friendships of widows and married women parallel each other in terms of endurance and stability. Primary ties with men are the exception rather than the norm, for both widows and married women. Widows do differ from married women in that the former rely on confidant friends to a greater extent. Ties between older women and their confidants are characterized by norms of reciprocity.

  1. Complex gene expression in the dragline silk producing glands of the Western black widow (Latrodectus hesperus).

    Science.gov (United States)

    Lane, Amanda Kelly; Hayashi, Cheryl Y; Whitworth, Gregg B; Ayoub, Nadia A

    2013-12-02

    Orb-web and cob-web weaving spiders spin dragline silk fibers that are among the strongest materials known. Draglines are primarily composed of MaSp1 and MaSp2, two spidroins (spider fibrous proteins) expressed in the major ampullate (MA) silk glands. Prior genetic studies of dragline silk have focused mostly on determining the sequence of these spidroins, leaving other genetic aspects of silk synthesis largely uncharacterized. Here, we used deep sequencing to profile gene expression patterns in the Western black widow, Latrodectus hesperus. We sequenced millions of 3'-anchored "tags" of cDNAs derived either from MA glands or control tissue (cephalothorax) mRNAs, then associated the tags with genes by compiling a reference database from our newly constructed normalized L. hesperus cDNA library and published L. hesperus sequences. We were able to determine transcript abundance and alternative polyadenylation of each of three loci encoding MaSp1. The ratio of MaSp1:MaSp2 transcripts varied between individuals, but on average was similar to the estimated ratio of MaSp1:MaSp2 in dragline fibers. We also identified transcription of TuSp1 in MA glands, another spidroin family member that encodes the primary component of egg-sac silk, synthesized in tubuliform glands. In addition to the spidroin paralogs, we identified 30 genes that are more abundantly represented in MA glands than cephalothoraxes and represent new candidates for involvement in spider silk synthesis. Modulating expression rates of MaSp1 variants as well as MaSp2 and TuSp1 could lead to differences in mechanical properties of dragline fibers. Many of the newly identified candidate genes likely encode secreted proteins, suggesting they could be incorporated into dragline fibers or assist in protein processing and fiber assembly. Our results demonstrate previously unrecognized transcript complexity in spider silk glands.

  2. Spiders in caves.

    Science.gov (United States)

    Mammola, Stefano; Isaia, Marco

    2017-04-26

    World experts of different disciplines, from molecular biology to macro-ecology, recognize the value of cave ecosystems as ideal ecological and evolutionary laboratories. Among other subterranean taxa, spiders stand out as intriguing model organisms for their ecological role of top predators, their unique adaptations to the hypogean medium and their sensitivity to anthropogenic disturbance. As the description of the first eyeless spider ( Stalita taenaria ), an array of papers on subterranean spider biology, ecology and evolution has been published, but a comprehensive review on these topics is still lacking. We provide a general overview of the spider families recorded in hypogean habitats worldwide, we review the different adaptations of hypogean spiders to subterranean life, and we summarize the information gathered so far about their origin, population structure, ecology and conservation status. Finally, we point out the limits of the knowledge we currently have regarding hypogean spiders, aiming to stimulate future research. © 2017 The Author(s).

  3. Respiration in spiders (Araneae).

    Science.gov (United States)

    Schmitz, Anke

    2016-05-01

    Spiders (Araneae) are unique regarding their respiratory system: they are the only animal group that breathe simultaneously with lungs and tracheae. Looking at the physiology of respiration the existence of tracheae plays an important role in spiders with a well-developed tracheal system. Other factors as sex, life time, type of prey capture and the high ability to gain energy anaerobically influence the resting and the active metabolic rate intensely. Most spiders have metabolic rates that are much lower than expected from body mass; but especially those with two pairs of lungs. Males normally have higher resting rates than females; spiders that are less evolved and possess a cribellum have lower metabolic rates than higher evolved species. Freely hunting spiders show a higher energy turnover than spiders hunting with a web. Spiders that live longer than 1 year will have lower metabolic rates than those species that die after 1 year in which development and reproduction must be completed. Lower temperatures and starvation, which most spiders can cope with, will decrease the metabolic rate as well.

  4. Factors related to alcohol and drug consumption in Swedish widows.

    Science.gov (United States)

    Grimby, Agneta; Johansson, Asa K

    2009-01-01

    The use of alcohol and medications among Swedish widows was analyzed in relation to various background variables. In Total, 1053 widows (640 widows younger than 65 years and 413 widows older than 65 years) answered the questionnaire. Many reported increased fatigue and sleeping problems. Around one-third of the widows reported drinking alcohol for relief of grief and inadequate support. Association existed between grief and increased intake of sedatives and sleeping pills, and between grief and drinking for relief of grief, as well as increase in intake of sedatives. In widows older than 65 years, perception of bad health, negative outlook for the future, and insufficient support seemed to increase the risk of more sedatives and sleeping pills. Negative outlook for the future also tended to lead to a heightened risk for increased intake of alcohol. There seems to be remaining health problems a long time after bereavement, and counseling may be needed especially when drugs and alcohol are extensively used.

  5. Meaning of bereavement among older African American widows.

    Science.gov (United States)

    Rodgers, Laura S

    2004-01-01

    In spite of the increase in research on spousal bereavement, researchers have not specifically addressed the impact that ethnicity may have on the bereavement experience. The results of this descriptive phenomenological study increase the understanding of spousal bereavement among older African American widows. Storytelling was at the heart of every participant's description of her bereavement experience. Six themes were identified: awareness of death, care giving, getting through, moving on, changing feelings, and financial security. For nurses to effectively intervene in the lives of bereaved older African American widows, they must consider each widow's culture, heritage, and lived experiences, which can be ascertained through eliciting and listening to the widow's life stories.

  6. Bat Predation by Spiders

    Science.gov (United States)

    Nyffeler, Martin; Knörnschild, Mirjam

    2013-01-01

    In this paper more than 50 incidences of bats being captured by spiders are reviewed. Bat-catching spiders have been reported from virtually every continent with the exception of Antarctica (∼90% of the incidences occurring in the warmer areas of the globe between latitude 30° N and 30° S). Most reports refer to the Neotropics (42% of observed incidences), Asia (28.8%), and Australia-Papua New Guinea (13.5%). Bat-catching spiders belong to the mygalomorph family Theraphosidae and the araneomorph families Nephilidae, Araneidae, and Sparassidae. In addition to this, an attack attempt by a large araneomorph hunting spider of the family Pisauridae on an immature bat was witnessed. Eighty-eight percent of the reported incidences of bat catches were attributable to web-building spiders and 12% to hunting spiders. Large tropical orb-weavers of the genera Nephila and Eriophora in particular have been observed catching bats in their huge, strong orb-webs (of up to 1.5 m diameter). The majority of identifiable captured bats were small aerial insectivorous bats, belonging to the families Vespertilionidae (64%) and Emballonuridae (22%) and usually being among the most common bat species in their respective geographic area. While in some instances bats entangled in spider webs may have died of exhaustion, starvation, dehydration, and/or hyperthermia (i.e., non-predation death), there were numerous other instances where spiders were seen actively attacking, killing, and eating the captured bats (i.e., predation). This evidence suggests that spider predation on flying vertebrates is more widespread than previously assumed. PMID:23516436

  7. Bat predation by spiders.

    Science.gov (United States)

    Nyffeler, Martin; Knörnschild, Mirjam

    2013-01-01

    In this paper more than 50 incidences of bats being captured by spiders are reviewed. Bat-catching spiders have been reported from virtually every continent with the exception of Antarctica (≈ 90% of the incidences occurring in the warmer areas of the globe between latitude 30° N and 30° S). Most reports refer to the Neotropics (42% of observed incidences), Asia (28.8%), and Australia-Papua New Guinea (13.5%). Bat-catching spiders belong to the mygalomorph family Theraphosidae and the araneomorph families Nephilidae, Araneidae, and Sparassidae. In addition to this, an attack attempt by a large araneomorph hunting spider of the family Pisauridae on an immature bat was witnessed. Eighty-eight percent of the reported incidences of bat catches were attributable to web-building spiders and 12% to hunting spiders. Large tropical orb-weavers of the genera Nephila and Eriophora in particular have been observed catching bats in their huge, strong orb-webs (of up to 1.5 m diameter). The majority of identifiable captured bats were small aerial insectivorous bats, belonging to the families Vespertilionidae (64%) and Emballonuridae (22%) and usually being among the most common bat species in their respective geographic area. While in some instances bats entangled in spider webs may have died of exhaustion, starvation, dehydration, and/or hyperthermia (i.e., non-predation death), there were numerous other instances where spiders were seen actively attacking, killing, and eating the captured bats (i.e., predation). This evidence suggests that spider predation on flying vertebrates is more widespread than previously assumed.

  8. Dramatic expansion of the black widow toxin arsenal uncovered by multi-tissue transcriptomics and venom proteomics.

    Science.gov (United States)

    Haney, Robert A; Ayoub, Nadia A; Clarke, Thomas H; Hayashi, Cheryl Y; Garb, Jessica E

    2014-06-11

    Animal venoms attract enormous interest given their potential for pharmacological discovery and understanding the evolution of natural chemistries. Next-generation transcriptomics and proteomics provide unparalleled, but underexploited, capabilities for venom characterization. We combined multi-tissue RNA-Seq with mass spectrometry and bioinformatic analyses to determine venom gland specific transcripts and venom proteins from the Western black widow spider (Latrodectus hesperus) and investigated their evolution. We estimated expression of 97,217 L. hesperus transcripts in venom glands relative to silk and cephalothorax tissues. We identified 695 venom gland specific transcripts (VSTs), many of which BLAST and GO term analyses indicate may function as toxins or their delivery agents. ~38% of VSTs had BLAST hits, including latrotoxins, inhibitor cystine knot toxins, CRISPs, hyaluronidases, chitinase, and proteases, and 59% of VSTs had predicted protein domains. Latrotoxins are venom toxins that cause massive neurotransmitter release from vertebrate or invertebrate neurons. We discovered ≥ 20 divergent latrotoxin paralogs expressed in L. hesperus venom glands, significantly increasing this biomedically important family. Mass spectrometry of L. hesperus venom identified 49 proteins from VSTs, 24 of which BLAST to toxins. Phylogenetic analyses showed venom gland specific gene family expansions and shifts in tissue expression. Quantitative expression analyses comparing multiple tissues are necessary to identify venom gland specific transcripts. We present a black widow venom specific exome that uncovers a trove of diverse toxins and associated proteins, suggesting a dynamic evolutionary history. This justifies a reevaluation of the functional activities of black widow venom in light of its emerging complexity.

  9. Financial Planners: Educating Widows in Personal Financial Planning

    Science.gov (United States)

    Korb, Brian R.

    2010-01-01

    Widows constitute a growing segment of the U.S. population; however, very little has been done to educate them on the basics of personal financial planning. The creation and implementation of financial planning education programs for widows can help them become more financially literate and free them from anxiety and fear. Interviews with eight…

  10. Biomechanics of Spider Silks

    Science.gov (United States)

    2006-03-02

    water and deformation conditions. Such fibres [Nexia ’ biosteel ’ silk ] were spun from recombinant silk ’cloned’ from Spidroin II and indeed show 67...SUBTITLE 5. FUNDING NUMBERS Biomechanics of Spider Silks F49620-03-1-0111 6. AUTHOR(S) Fritz Vollrath 7. PERFORMING ORGANIZATION NAME(S) AND ADDRESS(ES...Perform Pro, WHSIDIOR, Oct 94 COVER SHEET FINAL (3rd Year) Report to AFOSR on: BIOMECHANICS OF SPIDER SILKS Fritz Vollrath, Oxford University, England

  11. Attentional bias to moving spiders in spider fearful individuals.

    Science.gov (United States)

    Vrijsen, Janna N; Fleurkens, Pascal; Nieuwboer, Wieteke; Rinck, Mike

    2009-05-01

    We investigated if an attentional bias for spiders in spider fearful individuals (SFs) can also be found for moving spiders, rather than static images. In Study 1, 28 SFs and 33 non-anxious controls (NACs) participated in a modified version of the dot probe paradigm: they had to react to a probe that appeared either in the next, previous, or side position of a spider's or a wheel's path. 24 SFs and 29 NACs participated in Study 2, in which a fourth, highly predictable, probe position was added. We expected that moving spiders would capture the attention of SFs. In addition, we tested whether SFs try to predict the movement of the spider to make it less threatening. As expected, SFs showed an attentional bias towards moving spiders. However, both groups reacted fastest to unpredictable movements, indicating that SFs and NACs alike anticipate unpredictable spider movements.

  12. Older widows' perspectives on sexuality: A life course perspective.

    Science.gov (United States)

    Kasif, Talia; Band-Winterstein, Tova

    2017-04-01

    Sexuality is a significant component in human experience and has an important impact on the individual's general well-being. Life course events and the social construction of sexuality lead older widows to reflect upon their sexuality. To explore and describe the ways in which older widows construct and perceive their sexuality along the life course. A phenomenological-qualitative approach was conducted. Data collection was performed through in-depth, semi-structured interviews with 17 widows, between the ages of 62-91, followed by content analysis. Three major themes emerged: (a) Approaching sexuality: Conservative vs. progressive attitudes; (b) Multiple ways of perceiving sexuality: Constructing a sexual identity along the life course; and (c) Sexual self-perception: Integrating late life and widowhood. Sexuality among widows in later life includes continuity and change processes. In the context of social construction, sexuality is a subject that should be examined in greater depth. Copyright © 2017 Elsevier Inc. All rights reserved.

  13. The Spider Files

    Science.gov (United States)

    McDonald, James; Dominguez, Lynn

    2012-01-01

    As children develop misconceptions about animals they believe are dangerous, they also adopt attitudes that are difficult to change. Changing these attitudes is challenging for teachers. One animal that is easy to find but difficult for children to understand is a spider. As with most wild animals, they are difficult to teach about because…

  14. PATHWAYS TO SPIDER PHOBIA

    NARCIS (Netherlands)

    MERCKELBACH, H; ARNTZ, A; ARRINDELL, WA; DEJONG, PJ

    Using a revised version of the Phobic Origin Questionnaire (POQ; Ost, L. G. & Hugdahl, K. Behaviour Research and Therapy, 19,439-477; 1981), the present study examined whether conditioning experiences, modeling experiences, and/or informational learning experiences were more often reported by spider

  15. Spider Web Pattern

    Science.gov (United States)

    2006-01-01

    A delicate pattern, like that of a spider web, appears on top of the Mars residual polar cap, after the seasonal carbon-dioxide ice slab has disappeared. Next spring, these will likely mark the sites of vents when the carbon-dioxide ice cap returns. This Mars Global Surveyor, Mars Orbiter Camera image is about 3-kilometers wide (2-miles).

  16. Health care utilization, somatic and mental health distress, and well-being among widowed and non-widowed female survivors of war

    NARCIS (Netherlands)

    Morina, N.; Emmelkamp, P.M.G.

    2012-01-01

    Background The aim of the study was to assess levels of somatic and mental health distress, well-being, AS WELL AS utilization of primary and specialist health care services among war-related widowed and non-widowed female civilian survivors of war. Methods 100 war-related widowed lone mothers and

  17. Spider-Ant Associations: An Updated Review of Myrmecomorphy, Myrmecophily, and Myrmecophagy in Spiders

    Directory of Open Access Journals (Sweden)

    Paula E. Cushing

    2012-01-01

    Full Text Available This paper provides a summary of the extensive theoretical and empirical work that has been carried out in recent years testing the adaptational significance of various spider-ant associations. Hundreds of species of spiders have evolved close relationships with ants and can be classified as myrmecomorphs, myrmecophiles, or myrmecophages. Myrmecomorphs are Batesian mimics. Their close morphological and behavioral resemblance to ants confers strong survival advantages against visually hunting predators. Some species of spiders have become integrated into the ant society as myrmecophiles or symbionts. These spider myrmecophiles gain protection against their own predators, live in an environment with a stable climate, and are typically surrounded by abundant food resources. The adaptations by which this integration is made possible are poorly known, although it is hypothesized that most spider myrmecophiles are chemical mimics and some are even phoretic on their hosts. The third type of spider-ant association discussed is myrmecophagy—or predatory specialization on ants. A table of known spider myrmecophages is provided as is information on their biology and hunting strategies. Myrmecophagy provides these predators with an essentially unlimited food supply and may even confer other protections to the spiders.

  18. Religiosity influences on bereavement adjustments of older widows in Taiwan.

    Science.gov (United States)

    Shih, Shaw-Nin; Turale, Sue; Shih, Fu-Jin; Tsai, Jen-Chen

    2010-03-01

    To describe difficulties encountered by older widows in Taiwan and the impact of intrinsic or extrinsic religiosity on their coping strategies during early widowhood. There is very limited information about how Taiwan's widows cope with their bereavement and no studies reporting the relationship between religious beliefs and healthy adjustment during this distressing period. Between-method qualitative and quantitative triangulation was used. Semi-structured interviews were conducted and transcribed data were analysed by critical thematic analysis. Twenty women in Taiwan, >65 years old, (mean = 72.95) were interviewed within three years of being widowed. There were two informant groups: those with intrinsic religious beliefs and those with extrinsic religious beliefs. They all reported intrapersonal and interpersonal problems. Several major coping strategies arose: 'practising positive or negative attitudes for adaptation'; 'using person-focused actions'; and 'taking the initiative or passively seeking help from others or helping others'. Informants with intrinsic religious beliefs reported fewer coping problems by holding positive attitudes and taking multiple actions for adaptation. The extrinsic religious group had more negative adaptation attitudes, such as withdrawal and low self-esteem and practised less faith religious activities in worshipping ancestors, experiencing fatalism and using divination. They reported more coping problems than the intrinsic religious group. Widows in Taiwan have different coping problems and strategies in postbereavement adjustment, affected by their different religious beliefs systems. More research is required to establish the generalisabilty of these findings. Widows in Taiwan need to be assessed for their religious belief systems and how this affects their ability to cope during bereavement. Clinicians should actively provide grief support and encourage new methods of social adaptation, especially with widows with extrinsic

  19. Inactivation of complement by Loxosceles reclusa spider venom.

    Science.gov (United States)

    Gebel, H M; Finke, J H; Elgert, K D; Cambell, B J; Barrett, J T

    1979-07-01

    Zymosan depletion of serum complement in guinea pigs rendered them highly resistant to lesion by Loxosceles reclusa spider venom. Guinea pigs deficient in C4 of the complement system are as sensitive to the venom as normal guinea pigs. The injection of 35 micrograms of whole recluse venom intradermally into guinea pigs lowered their complement level by 35.7%. Brown recluse spider venom in concentrations as slight as 0.02 micrograms protein/ml can totally inactivate one CH50 of guinea pig complement in vitro. Bee, scorpion, and other spider venoms had no influence on the hemolytic titer of complement. Fractionation of recluse spider venom by Sephadex G-200 filtration separated the complement-inactivating property of the venom into three major regions which could be distinguished on the basis of heat stability as well as size. None was neutralized by antivenom. Polyacrylamide gel electrophoresis of venom resolved the complement inactivators into five fractions. Complement inactivated by whole venom or the Sephadex fractions could be restored to hemolytic activity by supplements of fresh serum but not by heat-inactivated serum, pure C3, pure C5, or C3 and C5 in combination.

  20. Extended spider cognition.

    Science.gov (United States)

    Japyassú, Hilton F; Laland, Kevin N

    2017-05-01

    There is a tension between the conception of cognition as a central nervous system (CNS) process and a view of cognition as extending towards the body or the contiguous environment. The centralised conception requires large or complex nervous systems to cope with complex environments. Conversely, the extended conception involves the outsourcing of information processing to the body or environment, thus making fewer demands on the processing power of the CNS. The evolution of extended cognition should be particularly favoured among small, generalist predators such as spiders, and here, we review the literature to evaluate the fit of empirical data with these contrasting models of cognition. Spiders do not seem to be cognitively limited, displaying a large diversity of learning processes, from habituation to contextual learning, including a sense of numerosity. To tease apart the central from the extended cognition, we apply the mutual manipulability criterion, testing the existence of reciprocal causal links between the putative elements of the system. We conclude that the web threads and configurations are integral parts of the cognitive systems. The extension of cognition to the web helps to explain some puzzling features of spider behaviour and seems to promote evolvability within the group, enhancing innovation through cognitive connectivity to variable habitat features. Graded changes in relative brain size could also be explained by outsourcing information processing to environmental features. More generally, niche-constructed structures emerge as prime candidates for extending animal cognition, generating the selective pressures that help to shape the evolving cognitive system.

  1. South African Zulu widows in a time of poverty and social change.

    Science.gov (United States)

    Rosenblatt, Paul C; Nkosi, Busisiwe Catherine

    2007-01-01

    Interviews were carried out with 16 South African Zulu widows. Much of what the widows had to say seemed like what one might hear from widows in economically developed countries, but there were also striking differences. All the widows lived in poverty, and for some their grief seemed much more about the poverty than about the husband's death. Most widows observed a year of traditional ukuzila mourning practices, which made them a threat to others and which is difficult to carry out in the social upheaval of modern South Africa. Widowhood was in some cases a struggle with witchcraft--as cause of the death or as an accusation directed at the widow.

  2. Animal coloration: sexy spider scales.

    Science.gov (United States)

    Taylor, Lisa A; McGraw, Kevin J

    2007-08-07

    Many male jumping spiders display vibrant colors that are used in visual communication. A recent microscopic study on a jumping spider from Singapore shows that three-layered 'scale sandwiches' of chitin and air are responsible for producing their brilliant iridescent body coloration.

  3. Spider Movement, UV Reflectance and Size, but Not Spider Crypsis, Affect the Response of Honeybees to Australian Crab Spiders

    Science.gov (United States)

    Llandres, Ana L.; Rodríguez-Gironés, Miguel A.

    2011-01-01

    According to the crypsis hypothesis, the ability of female crab spiders to change body colour and match the colour of flowers has been selected because flower visitors are less likely to detect spiders that match the colour of the flowers used as hunting platform. However, recent findings suggest that spider crypsis plays a minor role in predator detection and some studies even showed that pollinators can become attracted to flowers harbouring Australian crab spider when the UV contrast between spider and flower increases. Here we studied the response of Apis mellifera honeybees to the presence of white or yellow Thomisus spectabilis Australian crab spiders sitting on Bidens alba inflorescences and also the response of honeybees to crab spiders that we made easily detectable painting blue their forelimbs or abdomen. To account for the visual systems of crab spider's prey, we measured the reflectance properties of the spiders and inflorescences used for the experiments. We found that honeybees did not respond to the degree of matching between spiders and inflorescences (either chromatic or achromatic contrast): they responded similarly to white and yellow spiders, to control and painted spiders. However spider UV reflection, spider size and spider movement determined honeybee behaviour: the probability that honeybees landed on spider-harbouring inflorescences was greatest when the spiders were large and had high UV reflectance or when spiders were small and reflected little UV, and honeybees were more likely to reject inflorescences if spiders moved as the bee approached the inflorescence. Our study suggests that only the large, but not the small Australian crab spiders deceive their preys by reflecting UV light, and highlights the importance of other cues that elicited an anti-predator response in honeybees. PMID:21359183

  4. Spider movement, UV reflectance and size, but not spider crypsis, affect the response of honeybees to Australian crab spiders.

    Science.gov (United States)

    Llandres, Ana L; Rodríguez-Gironés, Miguel A

    2011-02-16

    According to the crypsis hypothesis, the ability of female crab spiders to change body colour and match the colour of flowers has been selected because flower visitors are less likely to detect spiders that match the colour of the flowers used as hunting platform. However, recent findings suggest that spider crypsis plays a minor role in predator detection and some studies even showed that pollinators can become attracted to flowers harbouring Australian crab spider when the UV contrast between spider and flower increases. Here we studied the response of Apis mellifera honeybees to the presence of white or yellow Thomisus spectabilis Australian crab spiders sitting on Bidens alba inflorescences and also the response of honeybees to crab spiders that we made easily detectable painting blue their forelimbs or abdomen. To account for the visual systems of crab spider's prey, we measured the reflectance properties of the spiders and inflorescences used for the experiments. We found that honeybees did not respond to the degree of matching between spiders and inflorescences (either chromatic or achromatic contrast): they responded similarly to white and yellow spiders, to control and painted spiders. However spider UV reflection, spider size and spider movement determined honeybee behaviour: the probability that honeybees landed on spider-harbouring inflorescences was greatest when the spiders were large and had high UV reflectance or when spiders were small and reflected little UV, and honeybees were more likely to reject inflorescences if spiders moved as the bee approached the inflorescence. Our study suggests that only the large, but not the small Australian crab spiders deceive their preys by reflecting UV light, and highlights the importance of other cues that elicited an anti-predator response in honeybees.

  5. Protection of widows and surviving children under the intestate ...

    African Journals Online (AJOL)

    Protection of widows and surviving children under the intestate succession laws of Zimbabwe: The case of estates of persons subject to customary law. ... Although in theory, the heir was supposed to administer the estate in the interests of the surviving spouse and children, this has not always been the case. This paper ...

  6. Divorced, separated and widowed female workers in rural Mozambique

    NARCIS (Netherlands)

    Sender, J.; Oya, C.

    2007-01-01

    Compared to other rural women, a high proportion of female wageworkers in rural Mozambique are divorced, separated or widowed. The paper explores the factors underlying this difference and establishes a significant relationship between labour market participation and female divorce or widowhood. The

  7. Health care utilization, somatic and mental health distress, and well-being among widowed and non-widowed female survivors of war

    Science.gov (United States)

    2012-01-01

    Background The aim of the study was to assess levels of somatic and mental health distress, well-being, AS WELL AS utilization of primary and specialist health care services among war-related widowed and non-widowed female civilian survivors of war. Methods 100 war-related widowed lone mothers and 106 non-widowed mothers who had experienced the Kosovo war ten years previously participated in the study. Measures of somatic, depressive, post-traumatic stress, anxiety, and grief complaints, subjective well-being, and utilization of health care services during the previous three months were used. Results Compared to non-widowed mothers, widowed lone mothers reported significantly higher levels of somatic, depressive, post-traumatic stress, and anxiety complaints. Further, they reported significantly lower levels of subjective well-being as composed of positive and negative affect and satisfaction with life. More than half of both widowed and non-widowed mothers reported utilization of health care services during the last three months, without significant differences between the groups. However, only three percent of widowed lone mothers and four percent of non-bereaved mothers reported utilization of mental health services during the last three months, despite high levels of mental health distress especially among widowed lone mothers. Among widowed lone mothers, severity of prolonged grief symptoms significantly predicted number of contacts of specialist health care use over and above sociodemographic variables, number of war-related events, and other psychopathology. Conclusion War-related widowed lone mothers suffer from elevated somatic and mental distress even a decade after the war. The tiny proportion of widowed lone mothers in use of mental health services can be seen as a reflection of lack of previous and current mental health services to meet mental health needs of this population. PMID:22578096

  8. A spider elevator

    Energy Technology Data Exchange (ETDEWEB)

    Butylkin, A.V.; Butylkin, V.A.; Izosimov, A.M.

    1983-01-01

    A spider elevator is proposed which contains a body, a wedge clamp with wedges hinged to each other, a subassembly for holding the wedge clamp in the open and closed positions and a mechanism for changing the wedge clamp, which is made in the form of levers with ears for cleats and installed in the body with the capability of turning. To increase reliability in the operational mode through using the external force for clamping the pipe, the free ends of the levers are hinged with the body by a power cylinder.

  9. The sexuality experience of older widows in Korea.

    Science.gov (United States)

    Yun, Okjong; Kim, Miyoung; Chung, Seung Eun

    2014-04-01

    Sexuality plays an important role in elders' lives. However, few studies exist concerning the essential meaning crucial for the overall understanding of sexuality in later life. In this study we explored the experience of what sexuality implied and meant to older widows using the descriptive phenomenological approach. Purposive sampling yielded 10 elderly women who were in sexual relationships. We collected data through in-depth interviews with participants and conducted a thematic analysis. The findings were classified into eight themes: trying to find another side of herself, starting a romantic relationship, invigorating life, displaying femininity, being concerned about the perceptions of others, enjoying sexual freedom, feeling the limit of sexual intimacy, and facing up to reality. The sexual lives of older widows entailed a process of recovering their femininity, self-achievement, and self-esteem, which helped them to live independent lives by developing more active and flexible attitudes.

  10. Temporal Patterns in the Abundance and Species Composition of Spiders on Host Plants of the Invasive Moth Epiphyas postvittana (Lepidoptera: Tortricidae).

    Science.gov (United States)

    Hogg, Brian N; Mills, Nicholas J; Daane, Kent M

    2017-06-01

    Generalist predators such as spiders may help mitigate the spread and impact of exotic herbivores. The lack of prey specificity and long generation times of spiders may allow them to persist when pests are scarce, and to limit the growth of pest populations before they reach damaging levels. We examined whether resident spiders are likely to play a role in maintaining populations of the invasive light brown apple moth, Epiphyas postvittana (Walker) (Lepidoptera: Tortricidae), below outbreak levels in California. We surveyed the spider community on two E. postvittana host plants, the ornamental Australian tea tree, Leptospermum laevigatum, and the weed French broom, Genista monspessulana, to characterize spider and larval E. postvittana abundance and spider species composition throughout the year. Spider densities and species composition showed slight seasonal changes. Spiders were present during periods of high and low E. postvittana abundance. Anyphaenid hunting spiders, Anyphaena aperta Banks in Australian tea tree and Anyphaena pacifica Banks in French broom, dominated spider species composition at four of five sampled sites, and underwent only slight seasonal variation in abundance. Adult A. aperta were rare at all times of the year, suggesting that high mortality among juvenile A. aperta limits the potential of this species as a predator of E. postvittana. Nevertheless, the continued presence of spiders throughout the year indicates that the resident spider community is likely to play a key role in reducing E. postvittana populations in California. Published by Oxford University Press on behalf of Entomological Society of America 2017. This work is written by US Government employees and is in the public domain in the US.

  11. Revisiting the Continuing Bonds Theory: The Cultural Uniqueness of the Bei Dao Phenomenon in Taiwanese Widows/Widowers.

    Science.gov (United States)

    Lee, Wan-Lin; Hou, Yi-Chen; Lin, Yaw-Sheng

    2017-10-01

    In the present study, we used the phenomenological approach to rediscover the ontological meaning of relationships with the deceased in Taiwanese widows/widowers. We first revised the original Western definitions of grief, bereavement, and mourning to fit Taiwanese culture. We used the word bei dao to indicate the mixed nature of grief and mourning in the Taiwanese bereavement process. Then we reanalyzed data from a previous study, which was conducted in 2006. In the previous qualitative research, each subject was interviewed 3 to 4 times in the mourning state over an 18-month interval that began at the point of the spouse's death. Results showed that two main themes emerged in the present analysis: (a) a blurred boundary of life and death and (b) a transformation of ethical bonds. The present study reveals the culturally unique aspects of the Taiwanese bei dao process. Limitations of the present study and future directions are discussed and reflected.

  12. Spiders from Mars?

    Science.gov (United States)

    2003-01-01

    MGS MOC Release No. MOC2-426, 19 July 2003No, this is not a picture of a giant, martian spider web. This Mars Global Surveyor (MGS) Mars Orbiter Camera (MOC) image shows a plethora of polygonal features on the floor of a northern hemisphere impact crater near 65.6oN, 327.7oW. The picture was acquired during spring, after the seasonal carbon dioxide frost cap had largely migrated through the region. At the time the picture was taken, remnants of seasonal frost remained on the crater rim and on the edges of the troughs that bound each of the polygons. Frost often provides a helpful hint as to where polygons and patterned ground occur. The polygons, if they were on Earth, would indicate the presence of freeze-thaw cycles in ground ice. Although uncertain, the same might be true of Mars. Sunlight illuminates the scene from the lower left.

  13. Tisaniba, a new genus of marpissoid jumping spiders from Borneo (Araneae: Salticidae).

    Science.gov (United States)

    Zhang, Jun-Xia; Maddison, Wayne P

    2014-08-14

    Six new species of marpissoid jumping spiders from Sarawak, Borneo, are described in the new genus Tisaniba Zhang & Maddison. They are the type species, T. mulu Zhang & Maddison sp. nov., as well as the species T. bijibijan Zhang & Maddison sp. nov., T. dik Zhang & Maddison sp. nov., T. kubah Zhang & Maddison sp. nov., T. selan Zhang & Maddison sp. nov., and T. selasi Zhang & Maddison sp. nov. The spiders are small and brown to black, living in leaf litter in the tropical forest. Phylogenetic analyses based on 28s and 16sND1 genes indicate that they are a distinctive group within the marpissoids. Diagnostic illustrations and photographs of living spiders are provided for all species.

  14. Sclerotherapy of Varicose Veins and Spider Veins

    Science.gov (United States)

    ... Index A-Z Sclerotherapy of Varicose Veins and Spider Veins Sclerotherapy uses injections from a very fine, ... Sclerotherapy? What is Sclerotherapy of Varicose Veins and Spider Veins? Sclerotherapy is a minimally invasive treatment used ...

  15. Application of 3 kinds of practical electromagnetic spiders in electromagnetic spider web

    OpenAIRE

    Jiang Min

    2016-01-01

    Electromagnetic spider web the launch circuit has introduced a lot, but in the center position of the utility of the spider generally have 3 kinds of circuits respectively, the use of single-chip microcomputer circuit of the low energy consumption spider by multi-channel transmission, single circuit receiver circuit. Direct use of the 3 channels of the spider and the use of PLC circuit spider, depending on the actual situation were placed.

  16. Application of 3 kinds of practical electromagnetic spiders in electromagnetic spider web

    Directory of Open Access Journals (Sweden)

    Jiang Min

    2016-01-01

    Full Text Available Electromagnetic spider web the launch circuit has introduced a lot, but in the center position of the utility of the spider generally have 3 kinds of circuits respectively, the use of single-chip microcomputer circuit of the low energy consumption spider by multi-channel transmission, single circuit receiver circuit. Direct use of the 3 channels of the spider and the use of PLC circuit spider, depending on the actual situation were placed.

  17. Spider phylogenomics: untangling the Spider Tree of Life

    Directory of Open Access Journals (Sweden)

    Nicole L. Garrison

    2016-02-01

    Full Text Available Spiders (Order Araneae are massively abundant generalist arthropod predators that are found in nearly every ecosystem on the planet and have persisted for over 380 million years. Spiders have long served as evolutionary models for studying complex mating and web spinning behaviors, key innovation and adaptive radiation hypotheses, and have been inspiration for important theories like sexual selection by female choice. Unfortunately, past major attempts to reconstruct spider phylogeny typically employing the “usual suspect” genes have been unable to produce a well-supported phylogenetic framework for the entire order. To further resolve spider evolutionary relationships we have assembled a transcriptome-based data set comprising 70 ingroup spider taxa. Using maximum likelihood and shortcut coalescence-based approaches, we analyze eight data sets, the largest of which contains 3,398 gene regions and 696,652 amino acid sites forming the largest phylogenomic analysis of spider relationships produced to date. Contrary to long held beliefs that the orb web is the crowning achievement of spider evolution, ancestral state reconstructions of web type support a phylogenetically ancient origin of the orb web, and diversification analyses show that the mostly ground-dwelling, web-less RTA clade diversified faster than orb weavers. Consistent with molecular dating estimates we report herein, this may reflect a major increase in biomass of non-flying insects during the Cretaceous Terrestrial Revolution 125–90 million years ago favoring diversification of spiders that feed on cursorial rather than flying prey. Our results also have major implications for our understanding of spider systematics. Phylogenomic analyses corroborate several well-accepted high level groupings: Opisthothele, Mygalomorphae, Atypoidina, Avicularoidea, Theraphosoidina, Araneomorphae, Entelegynae, Araneoidea, the RTA clade, Dionycha and the Lycosoidea. Alternatively, our results

  18. Spider phylogenomics: untangling the Spider Tree of Life

    Science.gov (United States)

    Garrison, Nicole L.; Rodriguez, Juanita; Agnarsson, Ingi; Coddington, Jonathan A.; Griswold, Charles E.; Hamilton, Christopher A.; Hedin, Marshal; Kocot, Kevin M.; Ledford, Joel M.

    2016-01-01

    Spiders (Order Araneae) are massively abundant generalist arthropod predators that are found in nearly every ecosystem on the planet and have persisted for over 380 million years. Spiders have long served as evolutionary models for studying complex mating and web spinning behaviors, key innovation and adaptive radiation hypotheses, and have been inspiration for important theories like sexual selection by female choice. Unfortunately, past major attempts to reconstruct spider phylogeny typically employing the “usual suspect” genes have been unable to produce a well-supported phylogenetic framework for the entire order. To further resolve spider evolutionary relationships we have assembled a transcriptome-based data set comprising 70 ingroup spider taxa. Using maximum likelihood and shortcut coalescence-based approaches, we analyze eight data sets, the largest of which contains 3,398 gene regions and 696,652 amino acid sites forming the largest phylogenomic analysis of spider relationships produced to date. Contrary to long held beliefs that the orb web is the crowning achievement of spider evolution, ancestral state reconstructions of web type support a phylogenetically ancient origin of the orb web, and diversification analyses show that the mostly ground-dwelling, web-less RTA clade diversified faster than orb weavers. Consistent with molecular dating estimates we report herein, this may reflect a major increase in biomass of non-flying insects during the Cretaceous Terrestrial Revolution 125–90 million years ago favoring diversification of spiders that feed on cursorial rather than flying prey. Our results also have major implications for our understanding of spider systematics. Phylogenomic analyses corroborate several well-accepted high level groupings: Opisthothele, Mygalomorphae, Atypoidina, Avicularoidea, Theraphosoidina, Araneomorphae, Entelegynae, Araneoidea, the RTA clade, Dionycha and the Lycosoidea. Alternatively, our results challenge the

  19. Approach and avoidance in fear of spiders

    NARCIS (Netherlands)

    Rinck, M.; Becker, E.S.

    2007-01-01

    We examined attitudes towards spiders by employing an Approach-Avoidance Task, in which participants respond to pictures by pulling a joystick towards themselves or by pushing it away from themselves. For spider fearfuls, this stimulus–response assignment is either compatible (push spiders away) or

  20. Spider and burnable poison rod combinations

    International Nuclear Information System (INIS)

    Edwards, G.T.; Schluderberg, D.C.

    1980-01-01

    An improved design of burnable poison rods and associated spiders used in fuel assemblies of pressurized water power reactor cores, is described. The rods are joined to the spider arms in a manner which is proof against the reactor core environment and yet allows the removal of the rods from the spider simply, swiftly and delicately. (U.K.)

  1. Diet-dependent fecundity of the spiders Atypena formosana and Pardosa pseudoannulata, predators in irrigated rice

    DEFF Research Database (Denmark)

    Sigsgaard, L.; Toft, S.; Villareal, S.

    2001-01-01

    The fecundity of the spiders Atypena formosana and Pardosa pseudoannulata was assessed on diets of brown planthopper Nilaparvata lugens (BPH), green leafhopper Nephotettix virescens (GLH), Collembola (Entomobryidae), Drosophila melanogaster and three prey mixtures; BPH-GLH, BPH-GLH-Collembola and......The fecundity of the spiders Atypena formosana and Pardosa pseudoannulata was assessed on diets of brown planthopper Nilaparvata lugens (BPH), green leafhopper Nephotettix virescens (GLH), Collembola (Entomobryidae), Drosophila melanogaster and three prey mixtures; BPH-GLH, BPH......-GLH-Collembola and a full mixed diet of BPH-GLH-Collembola-D. melanogaster. Egg production and hatching success was high in A. formosana except on the BPH, the GLH and the BPH-GLH diets. In P. pseudoannulata egg production and hatching success was lowest on diets of GLH and BPH-GLH, whereas this spider used BPH better....... Differences between offspring sizes were small. Survival of A. formosana females was lowest on the GLH and BPH-GLH diets. In P. pseudoannulata survival did not differ significantly. Food conversion efficiency was highest on the Collembola and the D. melanogaster diets for both spiders. Overall, diets...

  2. Molecular phylogeny of moth-specialized spider sub-family Cyrtarachninae, which includes bolas spiders.

    Science.gov (United States)

    Tanikawa, Akio; Shinkai, Akira; Miyashita, Tadashi

    2014-11-01

    The evolutionary process of the unique web architectures of spiders of the sub-family Cyrtarachninae, which includes the triangular web weaver, bolas spider, and webless spider, is thought to be derived from reduction of orbicular 'spanning-thread webs' resembling ordinal orb webs. A molecular phylogenetic analysis was conducted to explore this hypothesis using orbicular web spiders Cyrtarachne, Paraplectana, Poecilopachys, triangular web spider Pasilobus, bolas spiders Ordgarius and Mastophora, and webless spider Celaenia. The phylogeny inferred from partial sequences of mt-COI, nuclear 18S-rRNA and 28S-rRNA showed that the common ancestor of these spiders diverged into two clades: a spanning-thread web clade and a bolas or webless clade. This finding suggests that the triangular web evolved by reduction of an orbicular spanning web, but that bolas spiders evolved in the early stage, which does not support the gradual web reduction hypothesis.

  3. When Men Grieve: Widowers' Stories of Coping With Their Wives' Deaths.

    Science.gov (United States)

    Silverman, Phyllis R; Thomson, Susan

    2018-06-01

    To increase our understanding of the role gender plays in spousal loss, this qualitative study analyzes bereavement narratives of 33 recent widowers, aged 45-89 years, all of whom accessed the National Widowers' Organization website. In particular, we look at how these widowers' lives changed, the impact of changing gender norms, and coping strategies. To illuminate the temporal process evident in these narratives, we utilize Silverman's nonlinear characteristics of bereavement and the anthropological concept of liminality. In contrast to studies of widowers in earlier decades, our analysis reveals questioning and rejection of stereotypical masculine gender norms, a wide variety of creative responses to spousal loss, and the need for individualized support.

  4. Reconstitutable control rod spider assembly

    International Nuclear Information System (INIS)

    Shallenberger, J.M.; Ferian, S.J.

    1990-01-01

    A reconstitutable control rod/spider assembly includes a hollow connecting finger of the spider having a pair of opposing flat segments formed on the interior thereof and engaging a pair of opposing flat sectors formed on the exterior of a stem extending form the upper end of control rod. The stem also has an externally-threaded portion engaging a nut and a pilot aligning portion for the nut. The nut has a radially flexible and expandable thread-defining element captured in its bore. The segments and sectors allow the rod to be removed and reattached after turning through 180 0 to allow more even wear on the rod. (author)

  5. Insect bites and stings

    Science.gov (United States)

    ... widow spider bite; Brown recluse bite; Flea bite; Honey bee or hornet sting; Lice bites; Mite bite; ... Saunders; 2016:chap 359. Otten EJ. Venomous animal injuries. In: Walls RM, Hockberger RS, Gausche-Hill M, ...

  6. Browns Ferry

    International Nuclear Information System (INIS)

    Wood, J.

    1996-01-01

    In 1986, the US Nuclear Regulatory Commission (NRC) established a ''watch list'' of power reactors requiring special attention which included the three BWR units at Brown's Ferry owned by the Tennessee Valley Authority (TVA). The reactors has been closed down voluntarily by the TVA in 1985 in order to deal with a backlog of maintenance and regulatory issues. Intended as short-term, the shutdown was indefinitely extended when the nature and extent of the design changes, accompanying documentation and retrofitting required to satisfy the NRC became apparent. The recovery programme for Unit 2 was completed by 1991 and the reactor returned to service under a dedicated operating staff. Meanwhile, a separate, dedicated, recovery team was set up to manage Unit 3 which was returned to service in December 1995. Browns Ferry 2 was removed from the NRC watch list in June 1992 and Units 1 and 3 in June 1996. Units 2 and 3 have both operated successfully since restart but Unit 1 is currently mothballed and TVA has no plans to bring it back into service. (UK)

  7. THE EXECUTION OF PLANNED DETOURS BY SPIDER-EATING PREDATORS

    Science.gov (United States)

    Cross, Fiona R.; Jackson, Robert R.

    2016-01-01

    Many spiders from the salticid subfamily Spartaeinae specialize at preying on other spiders and they adopt complex strategies when targeting these dangerous prey. We tested 15 of these spider-eating spartaeine species for the capacity to plan detours ahead of time. Each trial began with the test subject on top of a tower from which it could view two boxes: one containing prey and the other not containing prey. The distance between the tower and the boxes was too far to reach by leaping and the tower sat on a platform surrounded by water. As the species studied are known to avoid water, the only way they could reach the prey without getting wet was by taking one of two circuitous walkways from the platform: one leading to the prey (‘correct’) and one not leading to the prey (‘incorrect’). After leaving the tower, the test subject could not see the prey and sometimes it had to walk past the incorrect walkway before reaching the correct walkway. Yet all 15 species chose the correct walkway significantly more often than the incorrect walkway. We propose that these findings exemplify genuine cognition based on representation. PMID:26781057

  8. The Spider and the Fly

    Science.gov (United States)

    Mellinger, Keith E.; Viglione, Raymond

    2012-01-01

    The Spider and the Fly puzzle, originally attributed to the great puzzler Henry Ernest Dudeney, and now over 100 years old, asks for the shortest path between two points on a particular square prism. We explore a generalization, find that the original solution only holds in certain cases, and suggest how this discovery might be used in the…

  9. B-ducted Heating of Black Widow Companions

    Energy Technology Data Exchange (ETDEWEB)

    Sanchez, Nicolas; Romani, Roger W., E-mail: rwr@astro.stanford.edu [Department of Physics, Stanford University, Stanford, CA 94305-4060 (United States)

    2017-08-10

    The companions of evaporating binary pulsars (black widows and related systems) show optical emission suggesting strong heating. In a number of cases, large observed temperatures and asymmetries are inconsistent with direct radiative heating for the observed pulsar spindown power and expected distance. Here we describe a heating model in which the pulsar wind sets up an intrabinary shock (IBS) against the companion wind and magnetic field, and a portion of the shock particles duct along this field to the companion magnetic poles. We show that a variety of heating patterns, and improved fits to the observed light curves, can be obtained at expected pulsar distances and luminosities, at the expense of a handful of model parameters. We test this “IBS-B” model against three well-observed binaries and comment on the implications for system masses.

  10. Violence Against Widows in Nepal: Experiences, Coping Behaviors, and Barriers in Seeking Help.

    Science.gov (United States)

    Sabri, Bushra; Sabarwal, Shrutika; Decker, Michele R; Shrestha, Abina; Sharma, Kunda; Thapa, Lily; Surkan, Pamela J

    2016-05-01

    Widows are a vulnerable population in Nepal. This study examined Nepalese widows' experiences of violence, their coping strategies, and barriers faced in seeking help. Study participants were recruited from Women for Human Rights, an NGO in Nepal. A stratified purposive sampling approach was used to select 51 widows and 5 staff members for in-depth interviews. Twenty-seven women who experienced violence were included in this analysis. Data were analyzed and synthesized using a thematic analysis procedure. Widows reported a range of violent experiences perpetrated by family and community members that spanned psychological, physical, and sexual abuse. Women dealt with abusive experiences using both adaptive (e.g., attempting to move ahead, seeking social support, using verbal confrontation) and maladaptive coping strategies (e.g., suicidal thoughts or self-medication). However, they faced barriers to seeking help such as insensitivity of the police, perceived discrimination, and general lack of awareness of widows' problems and needs. Findings highlight the need for interventions across the individual, family, community, and policy levels. Avenues for intervention include creating awareness about widows' issues and addressing cultural beliefs affecting widows' lives. Furthermore, efforts should focus on empowering widows, promoting healthy coping, and addressing their individual needs. © The Author(s) 2015.

  11. Specialised use of working memory by Portia africana, a spider-eating salticid.

    Science.gov (United States)

    Cross, Fiona R; Jackson, Robert R

    2014-03-01

    Using expectancy-violation methods, we investigated the role of working memory in the predatory strategy of Portia africana, a salticid spider from Kenya that preys by preference on other spiders. One of this predator's tactics is to launch opportunistic leaping attacks on to other spiders in their webs. Focussing on this particular tactic, our experiments began with a test spider on a ramp facing a lure (dead prey spider mounted on a cork disc) that could be reached by leaping. After the test spider faced the lure for 30 s, we blocked the test spider's view of the lure by lowering an opaque shutter before the spider leapt. When the shutter was raised 90 s later, either the same lure came into view again (control) or a different lure came into view (experimental: different prey type in same orientation or same prey type in different orientation). We recorded attack frequency (number of test spiders that leapt at the lure) and attack latency (time elapsing between shutter being raised and spiders initiating a leap). Attack latencies in control trials were not significantly different from attack latencies in experimental trials, regardless of whether it was prey type or prey orientation that changed in the experimental trials. However, compared with test spiders in the no-change control trials, significantly fewer test spiders leapt when prey type changed. There was no significant effect on attack frequency when prey orientation changed. These findings suggest that this predator represents prey type independently of prey orientation.

  12. The evolution of sociality in spiders

    DEFF Research Database (Denmark)

    Lubin, Yael; Bilde, T.

    2007-01-01

    . Anelosimus (Theridiidae) C. Sociality in Spiders: An Evolutionary Dead End? V. Evolution and Maintenance of Sociality in Spiders: Relevant Models A. Kin Selection 1. Kin Recognition 2. Inbreeding and Kin Selection B. Multilevel Selection (Group Selection) C. Ecological Benefits D. Ecological Constraints E......I. Introducing Social Spiders II. Social and Subsocial Species: A Survey of Behavioral Traits III. Inbred Sociality in Spiders A. Cooperation Versus Competition: A Balancing Act B. Do Social Spiders Have Division of Labor? C. Colony Foundation: Propagule Dispersal Versus Fission D. Female......-Biased Colony Sex Ratios: Primary and Operational Sex Ratios E. Mating System: Inbreeding and Its Population-Genetic Consequences F. "Boom and Bust" Colony Dynamics IV. Phylogenetic Relationships Among Social Spider Species A. Common Features of Social Evolution B. Case Studies 1. Stegodyphus (Eresidae) 2...

  13. Radiation effect onto biodiversity of spiders

    International Nuclear Information System (INIS)

    Mehrabova, M.A.; Naghiyev, J.A; Huseynov, N.I; Topchiyeva, Sh.A.; Hasanov, N.H.

    2010-01-01

    At present time spiders are one of the considerably diverse groups of living organisms in fauna of Azerbayjan Republic. They play an important in environmental chain, being the main group of wild arthropodas in most biocoenoses. Therefore, it's not surprised that recently an increased interest has being observed to the study of spiders as indicators of environmental conditions. Spiders have been collected in polluted areas, their identification and sampling of soil, water and plants has been conducted. The degree of radionuclides' impact on the number and distribution of spiders and their venom in the observed zones of Azerbaijan has been revealed and preliminarily predicted. The number of the collected spiders equals to 292 which has been determined later at an electronic identifier Spinnen Mitteleuropas. The radionuclides in spiders have been determined at Canberra facility. Different natural radioactive elements were revealed in the investigated samples.

  14. Debt, shame, and survival: becoming and living as widows in rural Kerala, India.

    Science.gov (United States)

    Mohindra, Katia Sarla; Haddad, Slim; Narayana, Delampady

    2012-11-06

    The health and well-being of widows in India is an important but neglected issue of public health and women's rights. We investigate the lives of Indian women as they become widows, focussing on the causes of their husband's mortality and the ensuing consequences of these causes on their own lives and identify the opportunities and challenges that widows face in living healthy and fulfilling lives. Data were collected in a Gram Panchayat (lowest level territorial decentralised unit) in the south Indian state of Kerala. Interviews were undertaken with key informants in order to gain an understanding of local constructions of 'widowhood' and the welfare and social opportunities for widows. Then we conducted semi-structured interviews with widows in the community on issues related to health and vulnerability, enabling us to hear perspectives from widows. Data were analysed for thematic content and emerging patterns. We synthesized our findings with theoretical understandings of vulnerability and Amartya Sen's entitlements theory to develop a conceptual framework. Two salient findings of the study are: first, becoming a widow can be viewed as a type of 'shock' that operates similarly to other 'economic shocks' or 'health shocks' in poor countries except that the burden falls disproportionately on women. Second, widowhood is not a static phenomenon, but rather can be viewed as a multi-phased process with different public health implications at each stage. More research on widows in India and other countries will help to both elucidate the challenges faced by widows and encourage potential solutions. The framework developed in this paper could be used to guide future research on widows.

  15. Debt, shame, and survival: becoming and living as widows in rural Kerala, India

    Directory of Open Access Journals (Sweden)

    Mohindra Katia

    2012-11-01

    Full Text Available Abstract Background The health and well-being of widows in India is an important but neglected issue of public health and women’s rights. We investigate the lives of Indian women as they become widows, focussing on the causes of their husband’s mortality and the ensuing consequences of these causes on their own lives and identify the opportunities and challenges that widows face in living healthy and fulfilling lives. Methods Data were collected in a Gram Panchayat (lowest level territorial decentralised unit in the south Indian state of Kerala. Interviews were undertaken with key informants in order to gain an understanding of local constructions of ‘widowhood’ and the welfare and social opportunities for widows. Then we conducted semi-structured interviews with widows in the community on issues related to health and vulnerability, enabling us to hear perspectives from widows. Data were analysed for thematic content and emerging patterns. We synthesized our findings with theoretical understandings of vulnerability and Amartya Sen’s entitlements theory to develop a conceptual framework. Results Two salient findings of the study are: first, becoming a widow can be viewed as a type of ‘shock’ that operates similarly to other ‘economic shocks’ or ‘health shocks’ in poor countries except that the burden falls disproportionately on women. Second, widowhood is not a static phenomenon, but rather can be viewed as a multi-phased process with different public health implications at each stage. Conclusion More research on widows in India and other countries will help to both elucidate the challenges faced by widows and encourage potential solutions. The framework developed in this paper could be used to guide future research on widows.

  16. Debt, shame, and survival: becoming and living as widows in rural Kerala, India

    Science.gov (United States)

    2012-01-01

    Background The health and well-being of widows in India is an important but neglected issue of public health and women’s rights. We investigate the lives of Indian women as they become widows, focussing on the causes of their husband’s mortality and the ensuing consequences of these causes on their own lives and identify the opportunities and challenges that widows face in living healthy and fulfilling lives. Methods Data were collected in a Gram Panchayat (lowest level territorial decentralised unit) in the south Indian state of Kerala. Interviews were undertaken with key informants in order to gain an understanding of local constructions of ‘widowhood’ and the welfare and social opportunities for widows. Then we conducted semi-structured interviews with widows in the community on issues related to health and vulnerability, enabling us to hear perspectives from widows. Data were analysed for thematic content and emerging patterns. We synthesized our findings with theoretical understandings of vulnerability and Amartya Sen’s entitlements theory to develop a conceptual framework. Results Two salient findings of the study are: first, becoming a widow can be viewed as a type of ‘shock’ that operates similarly to other ‘economic shocks’ or ‘health shocks’ in poor countries except that the burden falls disproportionately on women. Second, widowhood is not a static phenomenon, but rather can be viewed as a multi-phased process with different public health implications at each stage. Conclusion More research on widows in India and other countries will help to both elucidate the challenges faced by widows and encourage potential solutions. The framework developed in this paper could be used to guide future research on widows. PMID:23126457

  17. Predictors of Health-Related Quality of Life Perspectives, Self-Esteem, and Life Satisfactions of Older Adults Following Spousal Loss: An 18-Month Follow-Up Study of Widows and Widowers.

    Science.gov (United States)

    Fry, P. S.

    2001-01-01

    This study examined the relationship between widowed persons' baseline assessments of self-efficacy beliefs and their ratings of perceived health-related quality of life, life sanctions, and self-esteem obtained in an 18-month follow-up. Results revealed widows and widowers differ significantly with respect to self-efficacy and perceived quality…

  18. Ethno-cultural diversity in the experience of widowhood in later life: Chinese widows in Canada.

    Science.gov (United States)

    Martin-Matthews, Anne; Tong, Catherine E; Rosenthal, Carolyn J; McDonald, Lynn

    2013-12-01

    This paper utilizes Helena Znaniecka Lopata's concept of life frameworks as a lens through which to understand the experience of widowhood amongst elderly Chinese immigrant women living in Toronto, Canada. While Lopata defined life frameworks as including social supports, social relations and social roles, for these widows, personal resources (framed in Chinese cultural context) were also important aspects of life frameworks. In-depth interviews with 20 widows contacted through a Chinese community center were conducted in Mandarin and Cantonese and then transcribed and interpreted through team-based qualitative analyses. These women ranged in age from 69 to 93 years and had been in Canada an average of 17 years, with over half of them widowed following immigration. Our analysis framed the widows' narratives in terms of four types of supports defined by Lopata: social, service, financial and emotional supports. They had fairly extensive social and service supports focused primarily around family and the Chinese community. Although norms of filial piety traditionally dictate sons as primary supports, daughters predominated as providers of supports to these widows. Interpreted from a life course perspective, financial supports were deemed sufficient, despite overall limited financial means. Emotional support was more nuanced and complex for these widows. Loneliness and feelings of social isolation were prevalent. Nevertheless, themes of acceptance and satisfaction dominated our findings, as did reciprocity and exchange. The narrative accounts of these widows depict a complexity of experience rooted in their biographies as Chinese women and as immigrants, rather than primarily in widowhood itself. © 2013.

  19. Living with Suffering: Buddhist Wisdom Illustrated by a Widow

    Directory of Open Access Journals (Sweden)

    Fung Kei Cheng

    2015-12-01

    Full Text Available Available literature, largely based on Western theories, investigates suffering from spousal loss, which can threaten an individual’s physical health and psychological well-being; however, limited studies examine how Buddhists overcome this difficulty. This case study, by in-depth semi-structured interviews, explores the lived experience of a Buddhist surviving spouse who underwent the sudden loss of her husband. Qualitative data were analysed by interpretative phenomenological analysis, with the aid of ATLAS.ti 7, a software package. In order to enhance the trustworthiness, peer analysis (inter-rater reliability=92% and member-checking were adopted. Findings revealed that the bereaved Buddhist was living with feelings of guilt, but when she applied Buddhist wisdom, including the teachings of impermanence and cause-and-effect, hopes of a reunion in future lives due to the cycle of birth and death, living in the present moment, self-awareness, and strengthening capabilities to deal with afflictions, this widow could let the sense of guilt peacefully coexist with her being. Her living with suffering hints at tackling distress through a deeper understanding of the formation of the phenomenal world, and mind management, implying that Buddhist philosophy not only offers alternative views to interpret the continual relationship between survivors and the deceased, but also inspires helping professionals to extend the horizons of their therapeutic services.

  20. Science Education Resources on the Web--Spiders.

    Science.gov (United States)

    Thirunarayanan, M. O.

    1997-01-01

    Lists Web sites containing information on spiders and offers brief descriptions of the information available at those sites. The 11 sites provide information on taxonomy of spiders, anatomy, different ways spiders use silk, Internet mailing lists, folk literature and art, bibliographies, night collection, and spiders commonly found in the state of…

  1. Tangled in a sparse spider web

    DEFF Research Database (Denmark)

    Dimitrov, Dimitar Stefanov; Lopardo, Lara; Giribet, Gonzalo

    2012-01-01

    In order to study the tempo and the mode of spider orb web evolution and diversification, we conducted a phylogenetic analysis using six genetic markers along with a comprehensive taxon sample. The present analyses are the first to recover the monophyly of orb-weaving spiders based solely on DNA ...

  2. Verified spider bites in Oregon (USA) with the intent to assess hobo spider venom toxicity.

    Science.gov (United States)

    McKeown, Nathanael; Vetter, Richard S; Hendrickson, Robert G

    2014-06-01

    This study compiled 33 verified spider bites from the state of Oregon (USA). The initial goal was to amass a series of bites by the hobo spider to assess whether it possesses toxic venom, a supposition which is currently in a contested state. None of the 33 bites from several spider species developed significant medical symptoms nor did dermonecrosis occur. The most common biters were the yellow sac spider, Cheiracanthium mildei (N = 10) and orb-weavers of the genus Araneus (N = 6). There were 10 bites from three genera of funnel web spiders of the family Agelenidae including one hobo spider bite and one from the congeneric giant house spider which is readily confused as a hobo spider. The hobo spider bite resulted in pain, redness, twitching in the calf muscle and resolved in 12 h. Also generated from this study were possibly the first records of bites from spiders of the genera Callobius (Amaurobiidae) and Antrodiaetus (Antrodiaetidae), both with minor manifestations. Published by Elsevier Ltd.

  3. Widow cleansing and inheritance among the Luo in Kenya: the need for additional women-centred HIV prevention options.

    Science.gov (United States)

    Perry, Brian; Oluoch, Lennah; Agot, Kawango; Taylor, Jamilah; Onyango, Jacob; Ouma, Lilian; Otieno, Caroline; Wong, Christina; Corneli, Amy

    2014-01-01

    The customs of widow cleansing and widow inheritance are practiced in several communities throughout sub-Saharan Africa. In the Nyanza Province of Kenya, according to tradition, Luo widows are expected to engage in sexual intercourse with a "cleanser," without the use of a condom, in order to remove the impurity ascribed to her after her husband's death. Luo couples, including widows, are also expected to engage in sex preceding specific agricultural activities, building homes, funerals, weddings, and other significant cultural and social events. Widows who are inherited for the purpose of fulfilling cultural obligation have a higher prevalence of HIV than those who remain un-inherited or are inherited for the purpose of companionship. As part of a larger descriptive qualitative study to inform study procedures for FEM-PrEP, an HIV prevention pre-exposure prophylaxis clinical trial, we conducted 15 semi-structured interviews (SSIs) with widows, 15 SSIs with inheritors, and four focus group discussions with widows in the Bondo and Rarieda districts in Nyanza Province to explore the HIV risk context within widow cleansing and inheritance practices. Thematic qualitative analysis was used to analyze the data. The majority of widows reported in the demographic questionnaire being inherited, and most widows in the SSIs described participating in the cleansing ritual. We identified two main themes related to HIV prevention within the context of widow cleansing and inheritance: 1) widows must balance limiting their risk for HIV infection with meeting cultural expectations and ensuring that their livelihood needs are met, and 2) sexual abstinence undermines cultural expectations in widowhood while the use of condoms is deemed inappropriate in fulfilling culturally prescribed sexual rituals, and is often beyond the widow's ability to negotiate. Women-controlled HIV prevention methods such as antiretroviral-based oral pre-exposure prophylaxis, vaginal gels, and vaginal rings

  4. A contribution key for the first recorded spider (Arachnidae: Aranae fauna from Sheringal, Khyber Pakhtunkhwa, Pakistan

    Directory of Open Access Journals (Sweden)

    Farzana Khan Perveen

    2016-03-01

    Full Text Available The spiders (Arthropoda: Arachnida have a hard cephalothorax and soft abdomen. They are environmental indicators and play an important role in biological control of pests and vectors. The present study was conducted to prepare the key for the first recorded spider fauna during June 2013-July 2014 in 6 quadrates of Sheringal, i.e., Daramdala, Doki, Guryaal, Samang, Shahoor and Sia-Sheringal, Dir Upper (DU, Khyber Pakhtunkhwa (KP, Pakistan. During the present research, 10 species belong to 7 families, and 10 genera were recorded. The family Sparassidae was the largest among collected families (nSparassidae=19, its body was larger than others, abdomen was narrow at posterior, cephalothorax region was broad and brown, chelicearae were forwarded, legs were strong, body have hairs grey to brown and they were harmless and speedy. Gnphosidae family was the smallest among collected families (nGnphosidae=3, their eyes were heterogeneous, their inner margin of chelicerae were with a wide serrated lamina, posterior row of eyes were much longer than anterior, with lateral rounded maxillae. While the family Hersiliidae was the unique in collected families (nHersiliidae=6, as they are known as two-tail spiders, they have enlarged spinnerets, their male grow up to 8 mm and female up to 10 mm, they have 2 tails and are mimic with host plants. It was concluded that the majority of the collected species belong to the family Sparassidae. It is recommended that further research may be conducted on arboreal and aquatic species of spiders in Sheringal, KP, Pakistan.

  5. A Cocoon Found Inside the Black Widow's Web

    Science.gov (United States)

    2003-02-01

    NASA's Chandra X-ray Observatory image of the mysterious "Black Widow" pulsar reveals the first direct evidence of an elongated cocoon of high-energy particles. This discovery shows that this billion-year-old rejuvenated pulsar is an extremely efficient generator of a high-speed flow of matter and antimatter particles. Known officially as pulsar B1957+20, the Black Widow received its nickname because it is emitting intense high-energy radiation that is destroying its companion through evaporation. B1957+20, which completes one rotation every 1.6-thousandths of a second, belongs to a class of extremely rapidly rotating neutron stars called millisecond pulsars. The motion of B1957+20 through the galaxy -- at a high speed of almost a million kilometers per hour -- creates a bow shock wave visible to optical telescopes. The Chandra observation shows what cannot be seen in visible light: a second shock wave. This secondary shock wave is created from pressure that sweeps the wind back from the pulsar to form the cocoon of high-energy particles, visible for the first time in the Chandra data. "This is the first detection of a double-shock structure around a pulsar," said Benjamin Stappers, of the Dutch Organization for Research in Astronomy (ASTRON), lead author on a paper describing the research that will appear in the Feb. 28, 2003, issue of Science magazine. "It should enable astronomers to test theories of the dynamics of pulsar winds and their interaction with their environment." B1957+20 X-ray-only image of B1957+20 Scientists believe millisecond pulsars are very old neutron stars that have been spun up by accreting material from their companions. The steady push of the infalling matter on the neutron star spins it up in much the same way as pushing on a merry-go-round makes it rotate faster. The result is an object about 1.5 times as massive as the Sun and ten miles in diameter that rotates hundreds of times per second. The advanced age, very rapid rotation rate

  6. Daily Emotional and Physical Reactivity to Stressors Among Widowed and Married Older Adults

    Science.gov (United States)

    2014-01-01

    Objectives. Widowhood may result in declines in health and potentially stressful changes to daily routines. However, little research has examined how daily stressors contribute to physical and emotional well-being in widowhood. The objectives of the current study were to examine daily stressor exposure and reactivity in widowed versus married older adults. Method. Participants included all 100 widowed and 342 married adults aged 65 and older from the National Study of Daily Experiences, a daily diary study from the second wave of the Midlife in the United States. Daily stressors were measured using the Daily Inventory of Stressful Events; multilevel modeling assessed daily reactivity to stressors using daily negative affect (emotional reactivity) and daily physical symptoms (physical reactivity) as outcomes. Results. Married participants reported more stressors in general, and specifically more interpersonal stressors (e.g., arguments). Both married and widowed participants were reactive to daily stressors. Married participants were physically and emotionally reactive to interpersonal stressors. Widowed participants were more physically reactive to home-related stressors. Discussion. Attention to the types of daily stressors that widowed older adults experience in daily life and the potential physical effects of daily stressors during widowhood may help to alleviate some of the physical distress that widowed older adults may experience. PMID:23685921

  7. Daily emotional and physical reactivity to stressors among widowed and married older adults.

    Science.gov (United States)

    Hahn, Elizabeth A; Cichy, Kelly E; Small, Brent J; Almeida, David M

    2014-01-01

    Widowhood may result in declines in health and potentially stressful changes to daily routines. However, little research has examined how daily stressors contribute to physical and emotional well-being in widowhood. The objectives of the current study were to examine daily stressor exposure and reactivity in widowed versus married older adults. Participants included all 100 widowed and 342 married adults aged 65 and older from the National Study of Daily Experiences, a daily diary study from the second wave of the Midlife in the United States. Daily stressors were measured using the Daily Inventory of Stressful Events; multilevel modeling assessed daily reactivity to stressors using daily negative affect (emotional reactivity) and daily physical symptoms (physical reactivity) as outcomes. Married participants reported more stressors in general, and specifically more interpersonal stressors (e.g., arguments). Both married and widowed participants were reactive to daily stressors. Married participants were physically and emotionally reactive to interpersonal stressors. Widowed participants were more physically reactive to home-related stressors. Attention to the types of daily stressors that widowed older adults experience in daily life and the potential physical effects of daily stressors during widowhood may help to alleviate some of the physical distress that widowed older adults may experience.

  8. Teaching Widowed Women, Community, and Devotion in Quattrocento Florence with Lucrezia Tornabuoni and Antonia Tanini Pulci

    Directory of Open Access Journals (Sweden)

    Anna Wainwright

    2018-03-01

    Full Text Available In the Middle Ages and the early modern period, a woman’s social identity changed when her husband died. She became both a symbol of his loss, and a living monument to his legacy—an ambassador between the living and the dead. Responsible not only for preserving his memory on earth, a widow was also expected to pray on behalf of her husband’s soul, to work to rescue him from the torments of Purgatory through her dutiful appeals. Widows were at once asked to pray quietly alone, and tasked with work central to society: the salvation of souls after death. This dual identity—sometimes isolated, yet of fundamental importance—makes the widow an opportune subject for students of early modern conceptions of the relationship between religion and gender. In this essay, I look at widows in Lucrezia Tornabuoni’s Judith, Hebrew Widow and Antonia Tanini Pulci’s The Destruction of Saul and the Lament of David. Taught side-by-side, these texts provide students with multiple, interconnected ports of entry into the early modern world, encouraging an investigation of how the two women writers worked to place widows at the center of their respective stories, rather than relegated to the margins.

  9. Maternal care and subsocial behaviour in spiders.

    Science.gov (United States)

    Yip, Eric C; Rayor, Linda S

    2014-05-01

    While most spiders are solitary and opportunistically cannibalistic, a variety of social organisations has evolved in a minority of spider species. One form of social organisation is subsociality, in which siblings remain together with their parent for some period of time but disperse prior to independent reproduction. We review the literature on subsocial and maternal behaviour in spiders to highlight areas in which subsocial spiders have informed our understanding of social evolution and to identify promising areas of future research. We show that subsocial behaviour has evolved independently at least 18 times in spiders, across a wide phylogenetic distribution. Subsocial behaviour is diverse in terms of the form of care provided by the mother, the duration of care and sibling association, the degree of interaction and cooperation among siblings, and the use of vibratory and chemical communication. Subsocial spiders are useful model organisms to study various topics in ecology, such as kin recognition and the evolution of cheating and its impact on societies. Further, why social behaviour evolved in some lineages and not others is currently a topic of debate in behavioural ecology, and we argue that spiders offer an opportunity to untangle the ecological causes of parental care, which forms the basis of many other animal societies. © 2013 The Authors. Biological Reviews © 2013 Cambridge Philosophical Society.

  10. Learned predation risk management by spider mites

    Directory of Open Access Journals (Sweden)

    Thomas eHackl

    2014-09-01

    Full Text Available Predation is a prime selective force shaping prey behavior. Investment in anti-predator behavior is traded-off against time and energy for other fitness-enhancing activities such as foraging or reproduction. To optimize this benefit/cost trade-off, prey should be able to innately and/or by experience modulate their behavior to the level of predation risk. Here, we assessed learned predation risk management in the herbivorous two-spotted spider mite Tetranychus urticae. We exposed spider mites coming from benign (naïve or high immediate predation risk (experienced environments to latent and/or no risk and assessed their site choice, activity and oviposition. Benign environments were characterized by the absence of any predator cues, high immediate risk environments by killed spider mites, physical presence of the predatory mite Phytoseiulus persimilis and associated chemosensory traces left on the surface, and latent risk environments by only predator traces. In the no-choice experiment both naïve and experienced spider mites laid their first egg later on leaves with than without predator traces. Irrespective of predator traces presence/absence, experienced mites laid their first egg earlier than naïve ones did. Naïve spider mites were more active, indicating higher restlessness, and laid fewer eggs on leaves with predator traces, whereas experienced mites were less active and laid similar numbers of eggs on leaves with and without predator traces. In the choice experiment both naïve and experienced spider mites preferentially resided and oviposited on leaves without predator traces but experienced mites were less active than naïve ones. Overall, our study suggests that spider mites experienced with high predation risk behave bolder under latent risk than naïve spider mites. Since predator traces alone do not indicate immediate risk, we argue that the attenuated anti-predator response of experienced spider mites represents adaptive learned

  11. [Human brown adipose tissue].

    Science.gov (United States)

    Virtanen, Kirsi A; Nuutila, Pirjo

    2015-01-01

    Adult humans have heat-producing and energy-consuming brown adipose tissue in the clavicular region of the neck. There are two types of brown adipose cells, the so-called classic and beige adipose cells. Brown adipose cells produce heat by means of uncoupler protein 1 (UCP1) from fatty acids and sugar. By applying positron emission tomography (PET) measuring the utilization of sugar, the metabolism of brown fat has been shown to multiply in the cold, presumably influencing energy consumption. Active brown fat is most likely present in young adults, persons of normal weight and women, least likely in obese persons.

  12. Understanding Spider-Man: Your Everyday Superhero

    OpenAIRE

    Falk, Nicklas; Blomsterberg, Sofie Amalie; Suciu, Alice Sabrina; Pedersen, Mads Peter; Lucas, Vilhelm

    2014-01-01

    This project focuses on the understanding of Spider-Man, and the morals and ethics that lie behind the choices he makes. Through the Dimensions Philosophy & Science/Text & Sign, this understanding is concluded by looking at ethical theories and comic book analysis. Based on the Ultimate Spider-Man comic book series, the aim is to clarify who Spider-Man is and what causes him to act in certain ways; before and after his realization of power. Some theories used to investigate these area...

  13. Non-webbuilding spiders: prey specialists or generalists?

    Science.gov (United States)

    Nentwig, Wolfgang

    1986-07-01

    Feeding experiments were performed with seven species of non-webbuilding spiders and a variety of prey taxa. Some species were generally polyphagous whereas other spiders restricted their prey to a few groups. At one end of the spectrum of prey specialization the thomisid Misumena vatia is limited to a few taxa of possible prey (Table 1). The literature of prey records of non-webbuilding spiders is reviewed (Table 2) with special emphasis on oligophagous or monophagous spiders. Monophagous spiders are generally rare and have specialized on only a few prey taxa: social insects (ants, bees, termites) and spiders.

  14. Almost a spider: a 305-million-year-old fossil arachnid and spider origins.

    Science.gov (United States)

    Garwood, Russell J; Dunlop, Jason A; Selden, Paul A; Spencer, Alan R T; Atwood, Robert C; Vo, Nghia T; Drakopoulos, Michael

    2016-03-30

    Spiders are an important animal group, with a long history. Details of their origins remain limited, with little knowledge of their stem group, and no insights into the sequence of character acquisition during spider evolution. We describe a new fossil arachnid, Idmonarachne brasierigen. et sp. nov. from the Late Carboniferous (Stephanian,ca 305-299 Ma) of Montceau-les-Mines, France. It is three-dimensionally preserved within a siderite concretion, allowing both laboratory- and synchrotron-based phase-contrast computed tomography reconstruction. The latter is a first for siderite-hosted fossils and has allowed us to investigate fine anatomical details. Although distinctly spider-like in habitus, this remarkable fossil lacks a key diagnostic character of Araneae: spinnerets on the underside of the opisthosoma. It also lacks a flagelliform telson found in the recently recognized, spider-related, Devonian-Permian Uraraneida. Cladistic analysis resolves our new fossil as sister group to the spiders: the spider stem-group comprises the uraraneids and I. brasieri While we are unable to demonstrate the presence of spigots in this fossil, the recovered phylogeny suggests the earliest character to evolve on the spider stem-group is the secretion of silk. This would have been followed by the loss of a flagelliform telson, and then the ability to spin silk using spinnerets. This last innovation defines the true spiders, significantly post-dates the origins of silk, and may be a key to the group's success. The Montceau-les-Mines locality has previously yielded a mesothele spider (with spinnerets). Evidently, Late Palaeozoic spiders lived alongside Palaeozoic arachnid grades which approached the spider condition, but did not express the full suite of crown-group autapomorphies. © 2016 The Authors.

  15. Edge effect on weevils and spiders

    OpenAIRE

    Horváth, R.; Magura, T.; Péter, G.; Tóthmérész, B.

    2002-01-01

    The edge effect on weevils and spiders was tested along oak forest – meadow transects using sweep-net samples at the Síkfökút Project in Hungary. For spiders the species richness was significantly higher in the forest edge than either in the meadow or the forest interior. For weevils the species richness of the forest edge was higher than that of the meadow, but the difference was not statistically significant whereas the species richness of the forest...

  16. Cultural care of older Greek Canadian widows within Leininger's theory of culture care.

    Science.gov (United States)

    Rosenbaum, J N

    1990-01-01

    Cultural care themes were abstracted from a large scale study of older Greek Canadian widows conceptualized within Leininger's theory of Cultural Care Diversity and Universality. Ethnonursing, ethnographic, and life health-care history methods were used. Data were collected using observation-participation and interviews in three Greek Canadian communities with 12 widowed key informants and 30 general informants. Enabling tools used were interview inquiry guides, Leininger's Life History Health Care Protocol, Leininger's Acculturation Rating and Profile Scale of Traditional and Non-Traditional Lifeways, and field journal recordings. Data were analyzed using Leininger's phases of analysis for qualitative data. The two major cultural care themes which were abstracted from the raw data and patterns were: (1) Cultural care for Greek Canadian widows meant responsibility for, reciprocation, concern, love, companionship, family protection, hospitality, and helping, primarily derived from their kinship, religious, and cultural beliefs, and values, and (2) Cultural care continuity diminished the spousal care void and contributed to the health of Greek Canadian widows. These findings will stimulate future nursing research related to cultural care of diverse populations and guide nursing practice to provide culturally congruent care which will assist widows to reduce their spousal care void. The author thanks Dr. Madeleine Leininger, Dr. Judith Floyd, Dr. Marjorie Isenberg, and Dr. Bernice Kaplan for their guidance in completing the large scale study on which this article is based.

  17. Levirate marriage amongst the Hebrews and widow's inheritance amongst the Yoruba: A comparative investigation

    Directory of Open Access Journals (Sweden)

    Samson O. Olanisebe

    2014-01-01

    Full Text Available In ancient Israel, even though widowhood was not something people were praying for, when it came, the people involved were protected by the legal and customary structures already in place. One of those structures in the Old Testament is the institution of the levirate marriage where the right and the possession due to a widow without a son for her late husband could be protected and appropriated. A similar custom was also found amongst the pre-colonial Yoruba people through the widow�s inheritance which guarantees the welfare of the widow after the demise of her husband. However, these structures have been dismantled by Christianity, thereby exposing the majority of present-day widows to untold hardship. This article, therefore, through historical, descriptive and comparative methods, examines the customs of the levirate marriage and widow�s inheritance in the two cultures, ascertains how effective they were in addressing the welfare and protection of the rights and privileges of widows and recommends how the church can better see to the welfare of the widows in the society.

  18. Spiders do have melanin after all.

    Science.gov (United States)

    Hsiung, Bor-Kai; Blackledge, Todd A; Shawkey, Matthew D

    2015-11-01

    Melanin pigments are broadly distributed in nature - from bacteria to fungi to plants and animals. However, many previous attempts to identify melanins in spiders were unsuccessful, suggesting that these otherwise ubiquitous pigments were lost during spider evolution. Yet, spiders exhibit many dark colours similar to those produced by melanins in other organisms, and the low solubility of melanins makes isolation and characterization difficult. Therefore, whether melanins are truly absent or have simply not yet been detected is an open question. Raman spectroscopy provides a reliable way to detect melanins in situ, without the need for isolation. In this study, we document the presence of eumelanin in diverse species of spiders using confocal Raman microspectroscopy. Comparisons of spectra with theoretically calculated data falsify the previous hypothesis that dark colours are produced solely by ommochromes in spiders. Our data indicate that melanins are present in spiders and further supporting that they are present in most living organisms. © 2015. Published by The Company of Biologists Ltd.

  19. Genus-specificity of araneophagy of linyphiid spiders and spiders of other families (Arachnida, Araneae)

    NARCIS (Netherlands)

    Heuts, B.; Brunt, T.

    2009-01-01

    We found genus specificity of predation by spiders on other spiders in captivity which surpass them in body size (araneophagy). Adult specimens of three species of the linyphiid genus Walckenaeria which were successively tested for araneophagy (in the laboratory) in the order of first species

  20. Ant mimicry lessens predation on a North American jumping spider by larger salticid spiders.

    Science.gov (United States)

    Durkee, Caitlin A; Weiss, Martha R; Uma, Divya B

    2011-10-01

    Ant-like appearance (myrmecomorphy) has evolved >70 times in insects and spiders, accounting for >2,000 species of myrmecomorphic arthropods. Most myrmecomorphic spiders are considered to be Batesian mimics; that is, a palatable spider avoids predation through resemblance to an unpalatable ant-although this presumption has been tested in relatively few cases. Here we explicitly examined the extent to which Peckhamia picata (Salticidae), a North American ant-mimicking jumping spider, is protected from four species of jumping spider predators, relative to nonmimetic salticids and model ants. In addition, we conducted focused behavioral observations on one salticid predator, Thiodina puerpera, to determine the point at which the predators' behaviors toward model, mimic, and nonmimic diverge. We also examined the behaviors of Peckhamia in the presence of Thiodina. We found that mimetic jumping spiders were consumed less than a third as often as nonmimetic jumping spiders, suggesting that Peckhamia does indeed gain protection as a result of its resemblance to ants, and so can be considered a Batesian mimic. Furthermore, our focal predator did not consume any ant-mimicking spiders, and seemed to categorize Peckhamia with its model ant early in the hunting sequence. Such early determination of prey versus nonprey may be the result of speed-accuracy trade-offs in predator decision-making.

  1. Cognitive bias in spider-phobic children: Comparison of a pictorial and a linguistic spider Stroop.

    NARCIS (Netherlands)

    Kindt, M.; Brosschot, J.F.

    1999-01-01

    Examined the relation between spider fear in children and cognitive processing bias toward threatening information. It was investigated whether spider fear in children is related to a cognitive bias for threatening pictures and words. Pictorial and linguistic Stroop stimuli were administered to 28

  2. The health meanings and practices of older Greek-Canadian widows.

    Science.gov (United States)

    Rosenbaum, J N

    1991-11-01

    Folk health and illness beliefs and practices were abstracted from a large-scale study of older Greek-Canadian widows conceptualized within Leininger's theory of Cultural Care Diversity and Universality using ethnographic, ethnonursing, and life health-care history methods. Data were collected using observation-participation and interviews in three Greek-Canadian communities with 12 widowed key informants and 30 general informants. Interview inquiry guides, Leininger's Life History Health Care Protocol, and field journal recordings assisted data collection. Data were analysed using Leininger's phases of analysis for qualitative data. A major health theme which was abstracted from the raw data and patterns was: health for Greek-Canadian widows meant a state of well-being, ability to perform daily role activities, and avoidance of pain and illness. The findings, which also included folk health care and illness beliefs and practices, will stimulate future nursing research related to health and nursing care of people of diverse cultures.

  3. Energetics, scaling and sexual size dimorphism of spiders.

    Science.gov (United States)

    Grossi, B; Canals, M

    2015-03-01

    The extreme sexual size dimorphism in spiders has motivated studies for many years. In many species the male can be very small relative to the female. There are several hypotheses trying to explain this fact, most of them emphasizing the role of energy in determining spider size. The aim of this paper is to review the role of energy in sexual size dimorphism of spiders, even for those spiders that do not necessarily live in high foliage, using physical and allometric principles. Here we propose that the cost of transport or equivalently energy expenditure and the speed are traits under selection pressure in male spiders, favoring those of smaller size to reduce travel costs. The morphology of the spiders responds to these selective forces depending upon the lifestyle of the spiders. Climbing and bridging spiders must overcome the force of gravity. If bridging allows faster dispersal, small males would have a selective advantage by enjoying more mating opportunities. In wandering spiders with low population density and as a consequence few male-male interactions, high speed and low energy expenditure or cost of transport should be favored by natural selection. Pendulum mechanics show the advantages of long legs in spiders and their relationship with high speed, even in climbing and bridging spiders. Thus small size, compensated by long legs should be the expected morphology for a fast and mobile male spider.

  4. Spider diffraction: a comparison of curved and straight legs

    International Nuclear Information System (INIS)

    Richter, J.L.

    1984-01-01

    It has been known for some time that, if curved legs rather than the usual straight ones are used in the spider that supports the secondary optics in certain telescopes, the visible diffraction effect is reduced. Fraunhofer theory is used to calculate the diffraction effects due to the curved leg spider. Calculated and photographic diffraction patterns are compared for straight and curved leg spiders

  5. Acute Generalized Exanthematous Pustulosis (AGEP Triggered by a Spider Bite

    Directory of Open Access Journals (Sweden)

    Michael Makris

    2009-01-01

    Discussion: A spider bite may represent a possible causative factor of AGEP. A spider's venom contains sphingomyelinase that stimulates the release of IL8 and GM-CSF, which are involved in AGEP pathogenesis. Whether or not the con-current use of antibiotics has an effect in AGEP appearance when combined with a spider's venom, cannot be excluded.

  6. Brown adipocyte function

    DEFF Research Database (Denmark)

    Winther, Sally

    . The first part of this thesis explores this by identifying and investigating two novel kinase regulators of brown adipocyte function. Study 1 demonstrates that spleen tyrosine kinase is a hitherto undescribed regulator of brown adipocyte differentiation and activation. Study 2 identifies glycogen synthase...

  7. African traditional widowhood rites and their benefits and/or detrimental effects on widows in a context of African Christianity

    Directory of Open Access Journals (Sweden)

    Matsobane Manala

    2015-10-01

    Full Text Available Traditional Africans teach ubuntu principles of communality, mutual respect, caring and so forth, but they do not walk the talk with regard to the treatment of widows. In the footsteps of Jesus of Nazareth, Christian communities preach unconditional love, especially for the poor, marginalised and vulnerable. Implementation is, however, grossly lacking in respect of the treatment of widows. There is thus an apparent deliberate uncaring, disrespectful, discriminatory, impolite and unjust treatment of widows in African communities in spite of the ubuntu values and Christian teaching that emphasise love and caring, especially towards the grieving and thus vulnerable widows. Widows seem to be neglected and even oppressed in our time. The aim of this research is to critically examine African traditional widowhood rites and practices with special reference to the comfort or pain to which they subject African widows. The research further aims to examine the behaviour of some African Christians belonging to three congregations of one mainline church to determine whether their treatment of widows resonates with Jesus’ teaching regarding the requisite care of widows. The issue of widowhood in Africa, in terms of the apparent plight of these bereaved and grieving women, needs to be urgently addressed for change in the 21st century. A critical literature study of relevant sources and a newspaper article will be used for this research. My personal experiences and continuing observation as an insider will also inform the research in useful ways.

  8. 38 CFR 10.37 - Claim of widow not living with veteran at time of veteran's death.

    Science.gov (United States)

    2010-07-01

    ... 38 Pensions, Bonuses, and Veterans' Relief 1 2010-07-01 2010-07-01 false Claim of widow not living with veteran at time of veteran's death. 10.37 Section 10.37 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF VETERANS AFFAIRS ADJUSTED COMPENSATION Adjusted Compensation; General § 10.37 Claim of widow not living with veteran at time of...

  9. Remembering the object you fear: brain potentials during recognition of spiders in spider-fearful individuals.

    Science.gov (United States)

    Michalowski, Jaroslaw M; Weymar, Mathias; Hamm, Alfons O

    2014-01-01

    In the present study we investigated long-term memory for unpleasant, neutral and spider pictures in 15 spider-fearful and 15 non-fearful control individuals using behavioral and electrophysiological measures. During the initial (incidental) encoding, pictures were passively viewed in three separate blocks and were subsequently rated for valence and arousal. A recognition memory task was performed one week later in which old and new unpleasant, neutral and spider pictures were presented. Replicating previous results, we found enhanced memory performance and higher confidence ratings for unpleasant when compared to neutral materials in both animal fearful individuals and controls. When compared to controls high animal fearful individuals also showed a tendency towards better memory accuracy and significantly higher confidence during recognition of spider pictures, suggesting that memory of objects prompting specific fear is also facilitated in fearful individuals. In line, spider-fearful but not control participants responded with larger ERP positivity for correctly recognized old when compared to correctly rejected new spider pictures, thus showing the same effects in the neural signature of emotional memory for feared objects that were already discovered for other emotional materials. The increased fear memory for phobic materials observed in the present study in spider-fearful individuals might result in an enhanced fear response and reinforce negative beliefs aggravating anxiety symptomatology and hindering recovery.

  10. Flee or fight: ontogenetic changes in the behavior of cobweb spiders in encounters with spider-hunting wasps.

    Science.gov (United States)

    Uma, Divya B; Weiss, Martha R

    2012-12-01

    An animal's body size plays a predominant role in shaping its interspecific interactions, and, in encounters between two predators, often determines which shall be predator and which shall be prey. Spiders are top predators of insects, yet can fall prey to mud-dauber wasps that provision their larval nests with paralyzed spiders. Here we examined predator-prey interactions between Chalybion californicum (Saussure) (Sphecidae), a mud-dauber wasp, and Parasteatoda tepidariorum C. L. Koch (Theridiidae), a cobweb spider. We examined whether a spider's size influences its response to an attacking wasp, and report a size-dependent change in spider behavior: small-sized spiders fled, whereas medium- and large-sized spiders fought in response to wasp attacks. From the wasps' perspective, we examined whether spider size influences a wasp's hunting behavior and capture success. We found that wasps commonly approached small spiders, but were much less likely to approach medium and large spiders. However, wasp capture success did not vary with spider size. We also report a strategy used by Chalybion wasps toward cobweb spiders that is consistent with an interpretation of aggressive mimicry.

  11. Fish predation by semi-aquatic spiders: a global pattern.

    Directory of Open Access Journals (Sweden)

    Martin Nyffeler

    Full Text Available More than 80 incidences of fish predation by semi-aquatic spiders--observed at the fringes of shallow freshwater streams, rivers, lakes, ponds, swamps, and fens--are reviewed. We provide evidence that fish predation by semi-aquatic spiders is geographically widespread, occurring on all continents except Antarctica. Fish predation by spiders appears to be more common in warmer areas between 40° S and 40° N. The fish captured by spiders, usually ranging from 2-6 cm in length, are among the most common fish taxa occurring in their respective geographic area (e.g., mosquitofish [Gambusia spp.] in the southeastern USA, fish of the order Characiformes in the Neotropics, killifish [Aphyosemion spp.] in Central and West Africa, as well as Australian native fish of the genera Galaxias, Melanotaenia, and Pseudomugil. Naturally occurring fish predation has been witnessed in more than a dozen spider species from the superfamily Lycosoidea (families Pisauridae, Trechaleidae, and Lycosidae, in two species of the superfamily Ctenoidea (family Ctenidae, and in one species of the superfamily Corinnoidea (family Liocranidae. The majority of reports on fish predation by spiders referred to pisaurid spiders of the genera Dolomedes and Nilus (>75% of observed incidences. There is laboratory evidence that spiders from several more families (e.g., the water spider Argyroneta aquatica [Cybaeidae], the intertidal spider Desis marina [Desidae], and the 'swimming' huntsman spider Heteropoda natans [Sparassidae] predate fish as well. Our finding of such a large diversity of spider families being engaged in fish predation is novel. Semi-aquatic spiders captured fish whose body length exceeded the spiders' body length (the captured fish being, on average, 2.2 times as long as the spiders. Evidence suggests that fish prey might be an occasional prey item of substantial nutritional importance.

  12. Fish predation by semi-aquatic spiders: a global pattern.

    Science.gov (United States)

    Nyffeler, Martin; Pusey, Bradley J

    2014-01-01

    More than 80 incidences of fish predation by semi-aquatic spiders--observed at the fringes of shallow freshwater streams, rivers, lakes, ponds, swamps, and fens--are reviewed. We provide evidence that fish predation by semi-aquatic spiders is geographically widespread, occurring on all continents except Antarctica. Fish predation by spiders appears to be more common in warmer areas between 40° S and 40° N. The fish captured by spiders, usually ranging from 2-6 cm in length, are among the most common fish taxa occurring in their respective geographic area (e.g., mosquitofish [Gambusia spp.] in the southeastern USA, fish of the order Characiformes in the Neotropics, killifish [Aphyosemion spp.] in Central and West Africa, as well as Australian native fish of the genera Galaxias, Melanotaenia, and Pseudomugil). Naturally occurring fish predation has been witnessed in more than a dozen spider species from the superfamily Lycosoidea (families Pisauridae, Trechaleidae, and Lycosidae), in two species of the superfamily Ctenoidea (family Ctenidae), and in one species of the superfamily Corinnoidea (family Liocranidae). The majority of reports on fish predation by spiders referred to pisaurid spiders of the genera Dolomedes and Nilus (>75% of observed incidences). There is laboratory evidence that spiders from several more families (e.g., the water spider Argyroneta aquatica [Cybaeidae], the intertidal spider Desis marina [Desidae], and the 'swimming' huntsman spider Heteropoda natans [Sparassidae]) predate fish as well. Our finding of such a large diversity of spider families being engaged in fish predation is novel. Semi-aquatic spiders captured fish whose body length exceeded the spiders' body length (the captured fish being, on average, 2.2 times as long as the spiders). Evidence suggests that fish prey might be an occasional prey item of substantial nutritional importance.

  13. Change and Continuity in Kin-Based Support Systems for Widows ...

    African Journals Online (AJOL)

    Change and Continuity in Kin-Based Support Systems for Widows and Orphans among the Luo in Western Kenya. Erick Otieno Nyambedha. Abstract. No Abstract Available African Sociological Review 8, (1), 2004, pp. 139-153. Full Text: EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT ...

  14. When culture clashes with individual human rights: A practical theological reflection on the dignity of widows

    Directory of Open Access Journals (Sweden)

    Gift T. Baloyi

    2017-01-01

    Full Text Available This article discusses the nature of human beings (men and women as an egalitarian one even beyond cultural expectations. It argues against some cultural practices on women, especially widows, which claim supremacy and bind the widows to its ritual processes among the Tsonga people. It stresses the importance of human individual that overtakes everything from God�s creation, including cultural rituals which are created by human beings. It claims that the existence of culture depends solely on the existence or presence of human beings and their communities. Therefore, culture cannot use humans to shape itself and to transform the community. It is humans themselves who use culture to identify themselves and ultimately change their communities. Although the paper is theological in its approach, it argues for individual human rights to be respected and weighed above all cultural practices. It further concludes that such cultural practices are not static and that they can be removed from the rest of culture.Intradisciplinary and/or interdisciplinary implications: This article, from a practical theological view, challenges the African cultural rituals that claim authority over women�s rights and dignity. The interdisciplinary nature of this article indicates the sanctity of human individuals especially widows and thereby calls for paradigm shift to deconstruct certain oppressive teachings and practices against widows among African women. This article concludes thus, cultural deconstruction is possible.

  15. Economic Well-Being Following Marital Termination: A Comparison of Widowed and Divorced Women.

    Science.gov (United States)

    Morgan, Leslie A.

    1989-01-01

    Used data from National Longitudinal Surveys cohort of mature women to examine probability of becoming poor after widowhood or divorce among midlife women, and factors that seem to influence economic well-being. Found that 40 percent of widows and over 25 percent of divorced women fell into poverty for some time during first five years after…

  16. Daily Emotional and Physical Reactivity to Stressors Among Widowed and Married Older Adults

    OpenAIRE

    Hahn, Elizabeth A.; Cichy, Kelly E.; Small, Brent J.; Almeida, David M.

    2013-01-01

    Objectives. Widowhood may result in declines in health and potentially stressful changes to daily routines. However, little research has examined how daily stressors contribute to physical and emotional well-being in widowhood. The objectives of the current study were to examine daily stressor exposure and reactivity in widowed versus married older adults.

  17. Inbreeding avoidance in spiders: evidence for rescue effect in fecundity of female spiders with outbreeding opportunity

    DEFF Research Database (Denmark)

    Bilde, T.; Maklakov, A.A.; Schilling, Nadia

    2007-01-01

    avoidance can be because of low risk of inbreeding, variation in tolerance to inbreeding or high costs of outbreeding. We examined the relationship between inbreeding depression and inbreeding avoidance adaptations under two levels of inbreeding in the spider Oedothorax apicatus, asking whether preference...... for unrelated sperm via pre- and/or post-copulatory mechanisms could restore female fitness when inbreeding depression increases. Using inbred isofemale lines we provided female spiders with one or two male spiders of different relatedness in five combinations: one male sib; one male nonsib; two male sibs; two...

  18. Optically probing torsional superelasticity in spider silks

    Energy Technology Data Exchange (ETDEWEB)

    Kumar, Bhupesh; Thakur, Ashish; Panda, Biswajit; Singh, Kamal P. [Department of Physical Sciences, IISER Mohali, Sector 81, Manauli, Mohali 140306 (India)

    2013-11-11

    We investigate torsion mechanics of various spider silks using a sensitive optical technique. We find that spider silks are torsionally superelastic in that they can reversibly withstand great torsion strains of over 10{sup 2−3} rotations per cm before failure. Among various silks from a spider, we find the failure twist-strain is greatest in the sticky capture silk followed by dragline and egg-case silk. Our in situ laser-diffraction measurements reveal that torsional strains on the silks induce a nano-scale transverse compression in its diameter that is linear and reversible. These unique torsional properties of the silks could find applications in silk-based materials and devices.

  19. SPIDER: A Framework for Understanding Driver Distraction.

    Science.gov (United States)

    Strayer, David L; Fisher, Donald L

    2016-02-01

    The objective was to identify key cognitive processes that are impaired when drivers divert attention from driving. Driver distraction is increasingly recognized as a significant source of injuries and fatalities on the roadway. A "SPIDER" model is developed that identifies key cognitive processes that are impaired when drivers divert attention from driving. SPIDER is an acronym standing for scanning, predicting, identifying, decision making, and executing a response. When drivers engage in secondary activities unrelated to the task of driving, SPIDER-related processes are impaired, situation awareness is degraded, and the ability to safely operate a motor vehicle may be compromised. The pattern of interference helps to illuminate the sources of driver distraction and may help guide the integration of new technology into the automobile. © 2015, Human Factors and Ergonomics Society.

  20. Optically probing torsional superelasticity in spider silks

    International Nuclear Information System (INIS)

    Kumar, Bhupesh; Thakur, Ashish; Panda, Biswajit; Singh, Kamal P.

    2013-01-01

    We investigate torsion mechanics of various spider silks using a sensitive optical technique. We find that spider silks are torsionally superelastic in that they can reversibly withstand great torsion strains of over 10 2−3 rotations per cm before failure. Among various silks from a spider, we find the failure twist-strain is greatest in the sticky capture silk followed by dragline and egg-case silk. Our in situ laser-diffraction measurements reveal that torsional strains on the silks induce a nano-scale transverse compression in its diameter that is linear and reversible. These unique torsional properties of the silks could find applications in silk-based materials and devices

  1. Edge effect on weevils and spiders

    Directory of Open Access Journals (Sweden)

    R. Horváth

    2002-05-01

    Full Text Available The edge effect on weevils and spiders was tested along oak forest – meadow transects using sweep-net samples at the Síkfökút Project in Hungary. For spiders the species richness was significantly higher in the forest edge than either in the meadow or the forest interior. For weevils the species richness of the forest edge was higher than that of the meadow, but the difference was not statistically significant whereas the species richness of the forest interior was significantly lower than that of the forest edge and the meadow. The composition of the spider assemblage of the edge was more similar to the forest, while the composition of weevils in the edge was more similar to the meadow. Our results based on two invertebrate groups operating on different trophic levels suggest that there is a significant edge effect for the studied taxa resulting in higher species richness in the edge.

  2. Persistent Complex Bereavement Disorder and Culture: Early and Prolonged Grief in Nepali Widows.

    Science.gov (United States)

    Kim, Jane; Tol, Wietse A; Shrestha, Abina; Kafle, Hari Maya; Rayamajhi, Rajin; Luitel, Nagendra P; Thapa, Lily; Surkan, Pamela J

    2017-01-01

    Persistent complex bereavement disorder (PCBD) in the Diagnostic and Statistical Manual of Mental Disorders, Fifth Edition (DSM-5), has not been well studied in socioculturally diverse populations. Thus, this qualitative study examined (a) how widows in Nepal understand grief, (b) whether a local construct of PCBD exists, and (c) its comparability with the Diagnostic and Statistical Manual of Mental Disorders, Fifth Edition (DSM-5), terminology. Using an adapted Explanatory Model Interview Catalogue (EMIC) framework, semistructured interviews with 25 widows and 12 key informants, as well as three focus-group discussions (n = 20), were conducted between October 2014 and April 2015. Through an inductive grounded theory-based approach, we used the constant comparative method, iteratively coding transcripts to identify themes and patterns in the data. Also, we created two lists of grief responses, one of early reactions and another all reactions to grief, based on the frequency of mention. No single term for grief was reported. Widows reported a local construct of PCBD, which was broadly compatible with DSM-5 terminology but with important variation reflecting societal influence. Surviving torture during conflict, economic and family stressors, and discrimination were mentioned as important determinants that prolong and complicate grief. Suicidal ideation was common, with about 31% and 62% of widows reporting past-year and lifetime suicidality, respectively. Findings may not be generalizable to all Nepali widows; participants were recruited from a non-governmental organization, from Kathmandu and its neighboring districts, and were primarily of reproductive age. While PCBD symptoms proposed in DSM-5 were mentioned as relevant by study participants, some components may need adaptation for use in non-Western settings, such as Nepal.

  3. Aquatic subsidies transport anthropogenic nitrogen to riparian spiders

    Energy Technology Data Exchange (ETDEWEB)

    Akamatsu, Fumikazu, E-mail: f-akamt55@pwri.go.jp [Department of Environmental Sciences, Shinshu University, 3-1-1 Asahi, Matsumoto, Nagano 390-8621 (Japan); Toda, Hideshige [Department of Environmental Sciences, Shinshu University, 3-1-1 Asahi, Matsumoto, Nagano 390-8621 (Japan)

    2011-05-15

    Stable nitrogen isotopic composition ({delta}{sup 15}N) of aquatic biota increases with anthropogenic N inputs such as sewage and livestock waste downstream. Increase in {delta}{sup 15}N of riparian spiders downstream may reflect the anthropogenic pollution exposure through predation on aquatic insects. A two-source mixing model based on stable carbon isotopic composition showed the greatest dependence on aquatic insects (84%) by horizontal web-building spiders, followed by intermediate (48%) and low (31%) dependence by cursorial and vertical web-building spiders, respectively. The spider body size was negatively correlated with the dietary proportion of aquatic insects and spider {delta}{sup 15}N. The aquatic subsidies transported anthropogenic N to smaller riparian spiders downstream. This transport of anthropogenic N was regulated by spider's guild designation and body size. - Highlights: > {delta}{sup 15}N of aquatic insects increases downstream with anthropogenic nitrogen inputs. > {delta}{sup 15}N of riparian spiders increases with a high dietary proportion of aquatic insects and smaller spider body size. > The aquatic subsidies transport anthropogenic nitrogen to smaller riparian spiders downstream. - Smaller spiders assimilate anthropogenic nitrogen through the predation on aquatic subsides.

  4. Aquatic subsidies transport anthropogenic nitrogen to riparian spiders

    International Nuclear Information System (INIS)

    Akamatsu, Fumikazu; Toda, Hideshige

    2011-01-01

    Stable nitrogen isotopic composition (δ 15 N) of aquatic biota increases with anthropogenic N inputs such as sewage and livestock waste downstream. Increase in δ 15 N of riparian spiders downstream may reflect the anthropogenic pollution exposure through predation on aquatic insects. A two-source mixing model based on stable carbon isotopic composition showed the greatest dependence on aquatic insects (84%) by horizontal web-building spiders, followed by intermediate (48%) and low (31%) dependence by cursorial and vertical web-building spiders, respectively. The spider body size was negatively correlated with the dietary proportion of aquatic insects and spider δ 15 N. The aquatic subsidies transported anthropogenic N to smaller riparian spiders downstream. This transport of anthropogenic N was regulated by spider's guild designation and body size. - Highlights: → δ 15 N of aquatic insects increases downstream with anthropogenic nitrogen inputs. → δ 15 N of riparian spiders increases with a high dietary proportion of aquatic insects and smaller spider body size. → The aquatic subsidies transport anthropogenic nitrogen to smaller riparian spiders downstream. - Smaller spiders assimilate anthropogenic nitrogen through the predation on aquatic subsides.

  5. Disentangling the phylogenetic and ecological components of spider phenotypic variation.

    Science.gov (United States)

    Gonçalves-Souza, Thiago; Diniz-Filho, José Alexandre Felizola; Romero, Gustavo Quevedo

    2014-01-01

    An understanding of how the degree of phylogenetic relatedness influences the ecological similarity among species is crucial to inferring the mechanisms governing the assembly of communities. We evaluated the relative importance of spider phylogenetic relationships and ecological niche (plant morphological variables) to the variation in spider body size and shape by comparing spiders at different scales: (i) between bromeliads and dicot plants (i.e., habitat scale) and (ii) among bromeliads with distinct architectural features (i.e., microhabitat scale). We partitioned the interspecific variation in body size and shape into phylogenetic (that express trait values as expected by phylogenetic relationships among species) and ecological components (that express trait values independent of phylogenetic relationships). At the habitat scale, bromeliad spiders were larger and flatter than spiders associated with the surrounding dicots. At this scale, plant morphology sorted out close related spiders. Our results showed that spider flatness is phylogenetically clustered at the habitat scale, whereas it is phylogenetically overdispersed at the microhabitat scale, although phylogenic signal is present in both scales. Taken together, these results suggest that whereas at the habitat scale selective colonization affect spider body size and shape, at fine scales both selective colonization and adaptive evolution determine spider body shape. By partitioning the phylogenetic and ecological components of phenotypic variation, we were able to disentangle the evolutionary history of distinct spider traits and show that plant architecture plays a role in the evolution of spider body size and shape. We also discussed the relevance in considering multiple scales when studying phylogenetic community structure.

  6. Uncovering the structure-function relationship in spider silk

    Science.gov (United States)

    Yarger, Jeffery L.; Cherry, Brian R.; van der Vaart, Arjan

    2018-03-01

    All spiders produce protein-based biopolymer fibres that we call silk. The most studied of these silks is spider dragline silk, which is very tough and relatively abundant compared with other types of spider silks. Considerable research has been devoted to understanding the relationship between the molecular structure and mechanical properties of spider dragline silks. In this Review, we overview experimental and computational studies that have provided a wealth of detail at the molecular level on the highly conserved repetitive core and terminal regions of spider dragline silk. We also discuss the role of the nanocrystalline β-sheets and amorphous regions in determining the properties of spider silk fibres, endowing them with strength and elasticity. Additionally, we outline imaging techniques and modelling studies that elucidate the importance of the hierarchical structure of silk fibres at the molecular level. These insights into structure-function relationships can guide the reverse engineering of spider silk to enable the production of superior synthetic fibres.

  7. Checklist of spider fauna of FR Peshawar, FATA, Pakistan

    Directory of Open Access Journals (Sweden)

    F. Perveen

    2012-03-01

    Full Text Available The spiders are known as poisonous arthropods, but they also act as the predator or biological pests control agent. Their 23 species belonging to 15 genera and 09 families were reported during 2009-2010 from FR Peshawar, FATA, Pakistan. The reported families Clubionidae, Scytodidae and Sprassidae covered each 4%, Araneidae, Gnaphosidae, Pholicidae and Salticidae each 9%, Thomisidae 13% and Lycosidae 43% biodiversity of spiders of FATA. However, the largest spider collected was huntsman, Isopoda tuhodnigra (Barrion with total body length 15.80+-0.83 mm. Moreover, the smallest spider was wolf spider, Pardosa birmanica (Simon with total body length 4.20+-1.30 mm. Further, the crab spiders, Thomisus pugilis (Stoliczka, T. spectabilis (Doleschall and Diaea evanida (Thorell were the most colorful species belonging to family Thomisidae. A detail study is required for further exploration of spider fauna of FATA.

  8. Fucoidans from brown seaweeds

    DEFF Research Database (Denmark)

    Ale, Marcel Tutor; Meyer, Anne S.

    2013-01-01

    -proliferative effects on cancer cells. Recent work has revealed distinct structural features of fucoidans obtained from different brown seaweed sources. Fucoidans are classically obtained from brown seaweeds by multi-step, hot acid extraction, but the structural and compositional traits, and possibly the bioactivity......Fucoidan or fucoidans cover a family of sulfated fucose-rich polysaccharides, built of a backbone of L-fucose units, and characteristically found in brown seaweeds. Fucoidans have potential therapeutic properties, including anti-inflammatory and anti-coagulant activities, as well as anti...

  9. Recombinant DNA production of spider silk proteins.

    Science.gov (United States)

    Tokareva, Olena; Michalczechen-Lacerda, Valquíria A; Rech, Elíbio L; Kaplan, David L

    2013-11-01

    Spider dragline silk is considered to be the toughest biopolymer on Earth due to an extraordinary combination of strength and elasticity. Moreover, silks are biocompatible and biodegradable protein-based materials. Recent advances in genetic engineering make it possible to produce recombinant silks in heterologous hosts, opening up opportunities for large-scale production of recombinant silks for various biomedical and material science applications. We review the current strategies to produce recombinant spider silks. © 2013 The Authors. Microbial Biotechnology published by John Wiley & Sons Ltd and Society for Applied Microbiology.

  10. Programming spiders, bots, and aggregators in Java

    CERN Document Server

    Heaton, Jeff

    2006-01-01

    The content and services available on the web continue to be accessed mostly through direct human control. But this is changing. Increasingly, users rely on automated agents that save them time and effort by programmatically retrieving content, performing complex interactions, and aggregating data from diverse sources. Programming Spiders, Bots, and Aggregators in Java teaches you how to build and deploy a wide variety of these agents-from single-purpose bots to exploratory spiders to aggregators that present a unified view of information from multiple user accounts. You will quickly build on

  11. Understanding Brown Dwarf Variability

    Science.gov (United States)

    Marley, Mark S.

    2013-01-01

    Surveys of brown dwarf variability continue to find that roughly half of all brown dwarfs are variable. While variability is observed amongst all types of brown dwarfs, amplitudes are typically greatest for L-T transition objects. In my talk I will discuss the possible physical mechanisms that are responsible for the observed variability. I will particularly focus on comparing and contrasting the effects of changes in atmospheric thermal profile and cloud opacity. The two different mechanisms will produce different variability signatures and I will discuss the extent to which the current datasets constrain both mechanisms. By combining constraints from studies of variability with existing spectral and photometric datasets we can begin to construct and test self-consistent models of brown dwarf atmospheres. These models not only aid in the interpretation of existing objects but also inform studies of directly imaged giant planets.

  12. Spider and burnable poison rod combinations

    International Nuclear Information System (INIS)

    Walton, L.A.

    1980-01-01

    A description is given of an improved design of burnable poison rods and their associated spiders used in the fuel assemblies of pressurized water power reactor cores which allows the rods to be installed and removed more quickly, simply and gently than in previously described systems. (U.K.)

  13. Silk Spinning in Silkworms and Spiders.

    Science.gov (United States)

    Andersson, Marlene; Johansson, Jan; Rising, Anna

    2016-08-09

    Spiders and silkworms spin silks that outcompete the toughness of all natural and manmade fibers. Herein, we compare and contrast the spinning of silk in silkworms and spiders, with the aim of identifying features that are important for fiber formation. Although spiders and silkworms are very distantly related, some features of spinning silk seem to be universal. Both spiders and silkworms produce large silk proteins that are highly repetitive and extremely soluble at high pH, likely due to the globular terminal domains that flank an intermediate repetitive region. The silk proteins are produced and stored at a very high concentration in glands, and then transported along a narrowing tube in which they change conformation in response primarily to a pH gradient generated by carbonic anhydrase and proton pumps, as well as to ions and shear forces. The silk proteins thereby convert from random coil and alpha helical soluble conformations to beta sheet fibers. We suggest that factors that need to be optimized for successful production of artificial silk proteins capable of forming tough fibers include protein solubility, pH sensitivity, and preservation of natively folded proteins throughout the purification and initial spinning processes.

  14. The aerodynamic signature of running spiders.

    Directory of Open Access Journals (Sweden)

    Jérôme Casas

    Full Text Available Many predators display two foraging modes, an ambush strategy and a cruising mode. These foraging strategies have been classically studied in energetic, biomechanical and ecological terms, without considering the role of signals produced by predators and perceived by prey. Wolf spiders are a typical example; they hunt in leaf litter either using an ambush strategy or by moving at high speed, taking over unwary prey. Air flow upstream of running spiders is a source of information for escaping prey, such as crickets and cockroaches. However, air displacement by running arthropods has not been previously examined. Here we show, using digital particle image velocimetry, that running spiders are highly conspicuous aerodynamically, due to substantial air displacement detectable up to several centimetres in front of them. This study explains the bimodal distribution of spider's foraging modes in terms of sensory ecology and is consistent with the escape distances and speeds of cricket prey. These findings may be relevant to the large and diverse array of arthropod prey-predator interactions in leaf litter.

  15. SPiDer: Smart Pill Dispenser

    OpenAIRE

    Moreno Vázquez, Jonatan

    2013-01-01

    Aquest projecte proposa el sistema SPiDer el qual te l'objectiu d'assistir a la gent gran en el procés de medicar-se evitant els problemes associats amb la baixa adherència existent actualment amb els calendaris farmacològics receptats pels doctors.

  16. Status of the CNESM diagnostic for SPIDER

    International Nuclear Information System (INIS)

    Muraro, A.; Croci, G.; Albani, G.; Cazzaniga, C.; Claps, G.; Cavenago, M.; Grosso, G.; Palma, M. Dalla; Fincato, M.; Murtas, F.; Pasqualotto, R.; Cippo, E. Perelli; Rebai, M.; Tollin, M.; Tardocchi, M.; Gorini, G.

    2015-01-01

    Highlights: • We have finished the design of the detector box of the CNESM diagnostic for SPIDER. • We have constructed the GEM detector of the CNESM detector for SPIDER. • We have tested the detector under fast neutron irradiation. - Abstract: The ITER neutral beam test facility under construction in Padova will host two experimental devices: SPIDER, a 100 kV negative H/D RF source, and MITICA, a full scale, 1 MeV deuterium beam injector. A detection system called close-contact neutron emission surface mapping (CNESM) is under development with the aim to resolve the horizontal beam intensity profile in MITICA and one of the eight beamlet groups in SPIDER, with a spatial resolution of 1.5 and 2.5 cm respectively. This is achieved by the evaluation of the map of the neutron emission due to interaction of the deuterium beam with the deuterons implanted in the beam dump surface. CNESM uses nGEM detectors, i.e. GEM detectors equipped with a cathode that also serves as neutron–proton converter foil. The diagnostic will be placed right behind the SPIDER and MITICA beam dump, i.e. in an UHV environment, but the nGEM detectors need to operate at atmospheric pressure: in order to maintain the detector at atmospheric pressure, a vacuum sealed box, that will be mounted inside the vacuum, has been designed. The box design was driven by the need to minimize the neutron attenuation and the distance between the beam dump surface and the detector active area. This paper presents the status of the CNESM diagnostic describing the design of the detector, the design of the sealed box and reporting the results obtained with the first full-size prototype under fast neutron irradiation.

  17. Old Age, Widows, and Rural Solitude in the Eighteenth Century Central-Southern Spain

    Directory of Open Access Journals (Sweden)

    Francisco GARCÍA GONZÁLEZ

    2016-12-01

    Full Text Available Current research about old age during the Ancient Regime in Spain is insufficient. And the same is the case with women, despite the large number of studies about gender and family history in the past decades. Taking, as a starting point, the analysis of widow women which became heads of households, this paper aims to know which specific characteristics had those households during their old age, composition, size, typology and the tendency to solitude; which activities and livelihood they had, paying attention to those differences as an expression of inequality; and which mechanisms and social reproduction strategies they followed to deal with the effects of aging. This paper is geografically focused in a wide rural area of central-southern Spain and aims to review the assumption that single and widow women in preindustrial age had subordinted lives. 

  18. [The social relegation of widows living with HIV in the time of ART in Senegal].

    Science.gov (United States)

    Desclaux, A; Boye, S; Taverne, B

    2014-10-01

    While prolonged widowhood is unusual in Senegalese society, some women living with HIV receiving antiretroviral therapy for ten years remained widows. Are they maintained in this situation for refusing or being unable to remarry? To understand the conditions and the reasons for this lack of "matrimonial normalization", a qualitative interview study was conducted in Dakar with 31 widows. Their living conditions are mostly marked by economic difficulties, dependence on host families, and responsibilities visà-vis their children. They refuse to remarry, regret not being able to, or wish to without success, despite the existence locally of social forms of marital union that would respond to their situation. The refusal to disclose their HIV status combined with self-stigma prevent them from improving their condition. This form of social vulnerability that remains beyond the restoration of health is ignored by public policy and HIV/AIDS community based organizations claims. It should be acknowledged and considered for defending PLWAs' rights.

  19. ‘He wasn’t in that chair’: what loneliness means to widowed older people

    Directory of Open Access Journals (Sweden)

    Kate Mary Bennet

    2012-06-01

    Full Text Available We have little robust empirical evidence that articulates what being lonely means to older people and even less knowledge about what loneliness means to older widows and widowers; this article addresses that deficit. We undertook a re-analysis of 125 interviews with older people (aged 55-98 that explored their experiences of widowhood. In this article, we focus on those interviews in which participants described themselves as experiencing loneliness by the spontaneous use of terms such as ‘‘lonely’’, ‘‘loneliness’’ or ‘‘lonesome’’. Almost half of the participants (42% described themselves in that way without any prompting from the interviewer. In terms of understanding and describing the meaning of loneliness, 50% explained loneliness in terms of absence of either their spouse, a physical presence in the house or people. One-third (34% discussed loneliness in relation to time and place: night, weekends and home, and 4% described the emotional impact of loneliness. Fifteen per cent just said they were lonely without elaboration, assuming a common understanding of what loneliness means. Our findings suggest that widowed people’s understanding and experience of loneliness resonates with the concept of ‘‘emotional’’ loneliness, resulting from the loss of significant social and emotional attachment. This has important implications for the types of interventions that may be appropriate for remediating loneliness in this group.

  20. Impact of Living Alone on Depressive Symptoms in Older Korean Widows

    Directory of Open Access Journals (Sweden)

    Gyeong-Suk Jeon

    2017-10-01

    Full Text Available We examined the relationship between living alone and the prevalence of depressive symptoms in older Korean widows and assessed the individual contributions of health, social ties, and socioeconomic factors to the development of depressive symptoms. The study was a secondary analysis using data from widows, 65 years of age and older, who participated in the Living Profiles of Older People Survey (LPOPS. A logistic regression analysis was used to evaluate the contributions of health, social ties, and socioeconomic factors to the development of depressive symptoms. Working status and equivalent household income were significantly associated with depressive symptoms in both those living with others and those living alone. Adjustment for health status and social ties did not change the impact of living alone on the prevalence of depressive symptoms. However, adjustment for equivalent household income eliminated the negative association between living alone and depressive symptoms. Our findings indicate that economic resources are more important than health and social ties for alleviating the negative impact of living alone on the development of depressive symptoms in older widows.

  1. A novel neurotoxin from venom of the spider, Brachypelma albopilosum.

    Directory of Open Access Journals (Sweden)

    Yunhua Zhong

    Full Text Available Spiders have evolved highly selective toxins for insects. There are many insecticidal neurotoxins in spider venoms. Although a large amount of work has been done to focus on neurotoxicity of spider components, little information, which is related with effects of spider toxins on tumor cell proliferation and cytotoxicity, is available for Brachypelma albopilosum venom. In this work, a novel spider neurotoxin (brachyin was identified and characterized from venoms of the spider, Brachypelma albopilosum. Brachyin is composed of 41 amino acid residues with the sequence of CLGENVPCDKDRPNCCSRYECLEPTGYGWWYASYYCYKKRS. There are six cysteines in this sequence, which form three disulfided bridges. The serine residue at the C-terminus is amidated. Brachyin showed strong lethal effects on American cockroaches (Periplaneta americana and Tenebrio molitor (common mealbeetle. This neurotoxin also showed significant analgesic effects in mice models including abdominal writhing induced by acetic acid and formalin-induced paw licking tests. It was interesting that brachyin exerted marked inhibition on tumor cell proliferation.

  2. Poverty reduction in Bangladesh: A qualitative analysis of the "Allowance Scheme for Widowed and Husband-deserted Distressed Women"

    OpenAIRE

    Islam, K.M. Kabirul

    2007-01-01

    Mastergradsoppgave i "Comparative social work" - Høgskolen i Bodø, 2007 While Bangladesh has been persistently trying to overcome the poverty regime, yet most of the distressed widowed, divorced and husband-deserted women are struggling hard to subsist due to impoverished economic condition. The Government of Bangladesh has given due attention in the recent past to empower these disadvantaged groups of people. The “Allowance Scheme for Widowed and Husband-deserted Distressed Wo...

  3. Attention and amygdala activity: an fMRI study with spider pictures in spider phobia.

    Science.gov (United States)

    Alpers, Georg W; Gerdes, Antje B M; Lagarie, Bernadette; Tabbert, Katharina; Vaitl, Dieter; Stark, Rudolf

    2009-06-01

    Facilitated detection of threatening visual cues is thought to be adaptive. In theory, detection of threat cues should activate the amygdala independently from allocation of attention. However, previous studies using emotional facial expressions as well as phobic cues yielded contradictory results. We used fMRI to examine whether the allocation of attention to components of superimposed spider and bird displays modulates amygdala activation. Nineteen spider-phobic women were instructed to identify either a moving or a stationary animal in briefly presented double-exposure displays. Amygdala activation followed a dose-response relationship: Compared to congruent neutral displays (two birds), amygdala activation was most pronounced in response to congruent phobic displays (two spiders) and less but still significant in response to mixed displays (spider and bird) when attention was focused on the phobic component. When attention was focused on the neutral component, mixed displays did not result in significant amygdala activation. This was confirmed in a significant parametric graduation of the amygdala activation in the order of congruent phobic displays, mixed displays with attention focus on the spider, mixed displays with focus on the bird and congruent neutral displays. These results challenge the notion that amygdala activation in response to briefly presented phobic cues is independent from attention.

  4. What you fear will appear: detection of schematic spiders in spider fear.

    Science.gov (United States)

    Peira, Nathalie; Golkar, Armita; Larsson, Maria; Wiens, Stefan

    2010-01-01

    Various experimental tasks suggest that fear guides attention. However, because these tasks often lack ecological validity, it is unclear to what extent results from these tasks can be generalized to real-life situations. In change detection tasks, a brief interruption of the visual input (i.e., a blank interval or a scene cut) often results in undetected changes in the scene. This setup resembles real-life viewing behavior and is used here to increase ecological validity of the attentional task without compromising control over the stimuli presented. Spider-fearful and nonfearful women detected schematic spiders and flowers that were added to one of two identical background pictures that alternated with a brief blank in between them (i.e., flicker paradigm). Results showed that spider-fearful women detected spiders (but not flowers) faster than did nonfearful women. Because spiders and flowers had similar low-level features, these findings suggest that fear guides attention on the basis of object features rather than simple low-level features.

  5. Learning to avoid spiders: fear predicts performance, not competence.

    Science.gov (United States)

    Luo, Xijia; Becker, Eni S; Rinck, Mike

    2018-01-05

    We used an immersive virtual environment to examine avoidance learning in spider-fearful participants. In 3 experiments, participants were asked to repeatedly lift one of 3 virtual boxes, under which either a toy car or a spider appeared and then approached the participant. Participants were not told that the probability of encountering a spider differed across boxes. When the difference was large (Exps. 1 and 2), spider-fearfuls learned to avoid spiders by lifting the few-spiders-box more often and the many-spiders-box less often than non-fearful controls did. However, they hardly managed to do so when the probability differences were small (Exp. 3), and they did not escape from threat more quickly (Exp. 2). In contrast to the observed performance differences, spider-fearfuls and non-fearfuls showed equal competence, that is comparable post-experimental knowledge about the probability to encounter spiders under the 3 boxes. The limitations and implications of the present study are discussed.

  6. Sex-specific kleptoparasitic foraging in ant-eating spiders

    DEFF Research Database (Denmark)

    Martisová, Martina; Bilde, T.; Pekar, Stano

    2009-01-01

    . To investigate this hypothesis, we studied the effect of sex and life history stage on the frequency of kleptoparasitism in ant-eating spiders of the genus Zodarion in the field. These spiders use a special capture technique involving a quick attack on an ant that is left unguarded by spiders for several minutes......, providing ample opportunities for kleptoparasitism. We found that adult females consistently hunted actively, while adult males ceased active prey capture and instead engaged in kleptoparasitism. Juvenile spiders were active hunters irrespective of sex. Consistent with an ontogenetic shift in foraging...

  7. Second-order nonlinear optical microscopy of spider silk

    Science.gov (United States)

    Zhao, Yue; Hien, Khuat Thi Thu; Mizutani, Goro; Rutt, Harvey N.

    2017-06-01

    Asymmetric β-sheet protein structures in spider silk should induce nonlinear optical interaction such as second harmonic generation (SHG) which is experimentally observed for a radial line and dragline spider silk using an imaging femtosecond laser SHG microscope. By comparing different spider silks, we found that the SHG signal correlates with the existence of the protein β-sheets. Measurements of the polarization dependence of SHG from the dragline indicated that the β-sheet has a nonlinear response depending on the direction of the incident electric field. We propose a model of what orientation the β-sheet takes in spider silk.

  8. Tune Your Brown Clustering, Please

    DEFF Research Database (Denmark)

    Derczynski, Leon; Chester, Sean; Bøgh, Kenneth Sejdenfaden

    2015-01-01

    Brown clustering, an unsupervised hierarchical clustering technique based on ngram mutual information, has proven useful in many NLP applications. However, most uses of Brown clustering employ the same default configuration; the appropriateness of this configuration has gone predominantly...

  9. Natural Inhibitors of Maillard Browning

    Science.gov (United States)

    2013-12-01

    BREAD COLORING CHEESE SPREAD CHEMICAL REACTIONS FLAVOR OXIDATION DAIRY PRODUCTS...nutritional intake, and decrease waste due to non-consumption of sensory degraded ration components. 1.1 Maillard Browning Maillard browning, also

  10. Araneae Sloveniae: a national spider species checklist.

    Science.gov (United States)

    Kostanjšek, Rok; Kuntner, Matjaž

    2015-01-01

    The research of the spider fauna of Slovenia dates back to the very beginning of binomial nomenclature, and has gone through more and less prolific phases with authors concentrating on taxonomy, faunistics, ecology and zoogeographic reviews. Although the body of published works is remarkable for a small nation, the faunistic data has remained too scattered for a thorough understanding of regional biotic diversity, for comparative and ecological research, and for informed conservation purposes. A national checklist is long overdue. Here, a critical review of all published records in any language is provided. The species list currently comprises 738 species, is published online at http://www.bioportal.si/katalog/araneae.php under the title Araneae Sloveniae, and will be updated in due course. This tool will fill the void in cataloguing regional spider faunas and will facilitate further araneological research in central and southern Europe.

  11. Logic circuits based on molecular spider systems.

    Science.gov (United States)

    Mo, Dandan; Lakin, Matthew R; Stefanovic, Darko

    2016-08-01

    Spatial locality brings the advantages of computation speed-up and sequence reuse to molecular computing. In particular, molecular walkers that undergo localized reactions are of interest for implementing logic computations at the nanoscale. We use molecular spider walkers to implement logic circuits. We develop an extended multi-spider model with a dynamic environment wherein signal transmission is triggered via localized reactions, and use this model to implement three basic gates (AND, OR, NOT) and a cascading mechanism. We develop an algorithm to automatically generate the layout of the circuit. We use a kinetic Monte Carlo algorithm to simulate circuit computations, and we analyze circuit complexity: our design scales linearly with formula size and has a logarithmic time complexity. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.

  12. Araneae Sloveniae: a national spider species checklist

    Directory of Open Access Journals (Sweden)

    Rok Kostanjšek

    2015-01-01

    Full Text Available The research of the spider fauna of Slovenia dates back to the very beginning of binomial nomenclature, and has gone through more and less prolific phases with authors concentrating on taxonomy, faunistics, ecology and zoogeographic reviews. Although the body of published works is remarkable for a small nation, the faunistic data has remained too scattered for a thorough understanding of regional biotic diversity, for comparative and ecological research, and for informed conservation purposes. A national checklist is long overdue. Here, a critical review of all published records in any language is provided. The species list currently comprises 738 species, is published online at http://www.bioportal.si/katalog/araneae.php under the title Araneae Sloveniae, and will be updated in due course. This tool will fill the void in cataloguing regional spider faunas and will facilitate further araneological research in central and southern Europe.

  13. Browns Ferry fire

    International Nuclear Information System (INIS)

    Harkleroad, J.R.

    1983-01-01

    A synopsis of the March 22, 1975 fire at Browns Ferry Nuclear Plant is discussed. Emphasis is placed on events prior to and during the fire. How the fire started, fire fighting activities, fire and smoke development, and restoration activities are discussed

  14. Nanofibre production in spiders without electric charge.

    Science.gov (United States)

    Joel, Anna-Christin; Baumgartner, Werner

    2017-06-15

    Technical nanofibre production is linked to high voltage, because nanofibres are typically produced by electrospinning. In contrast, spiders have evolved a way to produce nanofibres without high voltage. These spiders are called cribellate spiders and produce nanofibres within their capture thread production. It is suggested that their nanofibres become frictionally charged when brushed over a continuous area on the calamistrum, a comb-like structure at the metatarsus of the fourth leg. Although there are indications that electrostatic charges are involved in the formation of the thread structure, final proof is missing. We proposed three requirements to validate this hypothesis: (1) the removal of any charge during or after thread production has an influence on the structure of the thread; (2) the characteristic structure of the thread can be regenerated by charging; and (3) the thread is attracted to or repelled from differently charged objects. None of these three requirements were proven true. Furthermore, mathematical calculations reveal that even at low charges, the calculated structural assembly of the thread does not match the observed reality. Electrostatic forces are therefore not involved in the production of cribellate capture threads. © 2017. Published by The Company of Biologists Ltd.

  15. Progress on development of SPIDER diagnostics

    Science.gov (United States)

    Pasqualotto, R.; Agostini, M.; Barbisan, M.; Bernardi, M.; Brombin, M.; Cavazzana, R.; Croci, G.; Palma, M. Dalla; Delogu, R. S.; Gorini, G.; Lotto, L.; Muraro, A.; Peruzzo, S.; Pimazzoni, A.; Pomaro, N.; Rizzolo, A.; Serianni, G.; Spolaore, M.; Tardocchi, M.; Zaniol, B.; Zaupa, M.

    2017-08-01

    SPIDER experiment, the full size prototype of the beam source for the ITER heating neutral beam injector, has to demonstrate extraction and acceleration to 100 kV of a large negative ion hydrogen or deuterium beam with co-extracted electron fraction e-/D- SPIDER plant systems are being installed, the different diagnostic systems are in the procurement phase. Their final design is described here with a focus on some key solutions and most original and cost effective implementations. Thermocouples used to measure the power load distribution in the source and over the beam dump front surface will be efficiently fixed with proven technique and acquired through commercial and custom electronics. Spectroscopy needs to use well collimated lines of sight and will employ novel design spectrometers with higher efficiency and resolution and filtered detectors with custom built amplifiers. The electrostatic probes will be operated through electronics specifically developed to cope with the challenging environment of the RF source. The instrumented calorimeter STRIKE will use new CFC tiles, still under development. Two linear cameras, one built in house, have been tested as suitable for optical beam tomography. Some diagnostic components are off the shelf, others are custom developed: some of these are being prototyped or are under test before final production and installation, which will be completed before start of SPIDER operation.

  16. Rates of trauma spectrum disorders and risks of posttraumatic stress disorder in a sample of orphaned and widowed genocide survivors

    Directory of Open Access Journals (Sweden)

    Susanne Schaal

    2011-06-01

    Full Text Available During the Rwandan genocide of 1994, nearly one million people were killed within a period of 3 months.The objectives of this study were to investigate the levels of trauma exposure and the rates of mental health disorders and to describe risk factors of posttraumatic stress reactions in Rwandan widows and orphans who had been exposed to the genocide.Trained local psychologists interviewed orphans (n=206 and widows (n=194. We used the PSS-I to assess posttraumatic stress disorder (PTSD, the Hopkins Symptom Checklist to assess depression and anxiety symptoms, and the M.I.N.I. to assess risk of suicidality.Subjects reported having been exposed to a high number of different types of traumatic events with a mean of 11 for both groups. Widows displayed more severe mental health problems than orphans: 41% of the widows (compared to 29% of the orphans met symptom criteria for PTSD and a substantial proportion of widows suffered from clinically significant depression (48% versus 34% and anxiety symptoms (59% versus 42% even 13 years after the genocide. Over one-third of respondents of both groups were classified as suicidal (38% versus 39%. Regression analysis indicated that PTSD severity was predicted mainly by cumulative exposure to traumatic stressors and by poor physical health status. In contrast, the importance given to religious/spiritual beliefs and economic variables did not correlate with symptoms of PTSD.While a significant portion of widows and orphans continues to display severe posttraumatic stress reactions, widows seem to constitute a particularly vulnerable survivor group. Our results point to the chronicity of mental health problems in this population and show that PTSD may endure over time if not addressed by clinical intervention. Possible implications of poor mental health and the need for psychological intervention are discussed.

  17. Bachelors, divorcees, and widowers: does marriage protect men from type 2 diabetes?

    Science.gov (United States)

    Cornelis, Marilyn C; Chiuve, Stephanie E; Glymour, M Maria; Chang, Shun-Chiao; Tchetgen Tchetgen, Eric J; Liang, Liming; Koenen, Karestan C; Rimm, Eric B; Kawachi, Ichiro; Kubzansky, Laura D

    2014-01-01

    While research has suggested that being married may confer a health advantage, few studies to date have investigated the role of marital status in the development of type 2 diabetes. We examined whether men who are not married have increased risk of incident type 2 diabetes in the Health Professionals Follow-up Study. Men (n = 41,378) who were free of T2D in 1986, were followed for ≤22 years with biennial reports of T2D, marital status and covariates. Cox proportional hazard models were used to compare risk of incident T2D by marital status (married vs unmarried and married vs never married, divorced/separated, or widowed). There were 2,952 cases of incident T2D. Compared to married men, unmarried men had a 16% higher risk of developing T2D (95%CI:1.04,1.30), adjusting for age, family history of diabetes, ethnicity, lifestyle and body mass index (BMI). Relative risks (RR) for developing T2D differed for divorced/separated (1.09 [95%CI: 0.94,1.27]), widowed (1.29 [95%CI:1.06,1.57]), and never married (1.17 [95%CI:0.91,1.52]) after adjusting for age, family history of diabetes and ethnicity. Adjusting for lifestyle and BMI, the RR for T2D associated with widowhood was no longer significant (RR:1.16 [95%CI:0.95,1.41]). When allowing for a 2-year lag period between marital status and disease, RRs of T2D for widowers were augmented and borderline significant (RR:1.24 [95%CI:1.00,1.54]) after full adjustment. In conclusion, not being married, and more specifically, widowhood was more consistently associated with an increased risk of type 2 diabetes in men and this may be mediated, in part, through unfavorable changes in lifestyle, diet and adiposity.

  18. Bachelors, divorcees, and widowers: does marriage protect men from type 2 diabetes?

    Directory of Open Access Journals (Sweden)

    Marilyn C Cornelis

    Full Text Available While research has suggested that being married may confer a health advantage, few studies to date have investigated the role of marital status in the development of type 2 diabetes. We examined whether men who are not married have increased risk of incident type 2 diabetes in the Health Professionals Follow-up Study. Men (n = 41,378 who were free of T2D in 1986, were followed for ≤22 years with biennial reports of T2D, marital status and covariates. Cox proportional hazard models were used to compare risk of incident T2D by marital status (married vs unmarried and married vs never married, divorced/separated, or widowed. There were 2,952 cases of incident T2D. Compared to married men, unmarried men had a 16% higher risk of developing T2D (95%CI:1.04,1.30, adjusting for age, family history of diabetes, ethnicity, lifestyle and body mass index (BMI. Relative risks (RR for developing T2D differed for divorced/separated (1.09 [95%CI: 0.94,1.27], widowed (1.29 [95%CI:1.06,1.57], and never married (1.17 [95%CI:0.91,1.52] after adjusting for age, family history of diabetes and ethnicity. Adjusting for lifestyle and BMI, the RR for T2D associated with widowhood was no longer significant (RR:1.16 [95%CI:0.95,1.41]. When allowing for a 2-year lag period between marital status and disease, RRs of T2D for widowers were augmented and borderline significant (RR:1.24 [95%CI:1.00,1.54] after full adjustment. In conclusion, not being married, and more specifically, widowhood was more consistently associated with an increased risk of type 2 diabetes in men and this may be mediated, in part, through unfavorable changes in lifestyle, diet and adiposity.

  19. Structure–Activity Relationship Study of Spider Polyamine Toxins as Inhibitors of Ionotropic Glutamate Receptors

    DEFF Research Database (Denmark)

    Xiong, Xiaofeng; Poulsen, Mette H; Hussein, Rama A

    2014-01-01

    The spider polyamine toxins Joro spider toxin-3 (JSTX-3) and Nephila polyamine toxins-1 and -8 (NPTX-1 and NPTX-8) are isolated from the venom of the orb-weaver spider Nephila clavata (Joro spider). They share a high degree of structural resemblance, their aromatic head groups being the only...

  20. Who is afraid of a black Spider(-Man)?

    OpenAIRE

    Ora C. McWilliams

    2013-01-01

    An Internet post asking about Spider-Man's race in a film turned into an Internet campaign about an actor that led fans to interact with each other as well as with the actor, which in turn led to the attention of media producers, which resulted in a change in Spider-Man's race in a print comic book.

  1. Who is afraid of a black Spider(-Man?

    Directory of Open Access Journals (Sweden)

    Ora C. McWilliams

    2013-06-01

    Full Text Available An Internet post asking about Spider-Man's race in a film turned into an Internet campaign about an actor that led fans to interact with each other as well as with the actor, which in turn led to the attention of media producers, which resulted in a change in Spider-Man's race in a print comic book.

  2. Spider diversity in relation to habitat heterogeneity and an altitudinal ...

    African Journals Online (AJOL)

    Using pitfall traps, wandering spiders (Arachnida: Araneae) were sampled in a nested design from three different localities in the mountainous arid ecosystem of South Sinai at low, middle, and high altitudes. Habitat type and altitude were clearly different among the three localities. Spider diversity per trap varied spatially ...

  3. Time-dependent motor properties of multipedal molecular spiders.

    Science.gov (United States)

    Samii, Laleh; Blab, Gerhard A; Bromley, Elizabeth H C; Linke, Heiner; Curmi, Paul M G; Zuckermann, Martin J; Forde, Nancy R

    2011-09-01

    Molecular spiders are synthetic biomolecular walkers that use the asymmetry resulting from cleavage of their tracks to bias the direction of their stepping motion. Using Monte Carlo simulations that implement the Gillespie algorithm, we investigate the dependence of the biased motion of molecular spiders, along with binding time and processivity, on tunable experimental parameters, such as number of legs, span between the legs, and unbinding rate of a leg from a substrate site. We find that an increase in the number of legs increases the spiders' processivity and binding time but not their mean velocity. However, we can increase the mean velocity of spiders with simultaneous tuning of the span and the unbinding rate of a spider leg from a substrate site. To study the efficiency of molecular spiders, we introduce a time-dependent expression for the thermodynamic efficiency of a molecular motor, allowing us to account for the behavior of spider populations as a function of time. Based on this definition, we find that spiders exhibit transient motor function over time scales of many hours and have a maximum efficiency on the order of 1%, weak compared to other types of molecular motors.

  4. Evidence for competition between carnivorous plants and spiders.

    Science.gov (United States)

    Jennings, David E; Krupa, James J; Raffel, Thomas R; Rohr, Jason R

    2010-10-07

    Several studies have demonstrated that competition between disparate taxa can be important in determining community structure, yet surprisingly, to our knowledge, no quantitative studies have been conducted on competition between carnivorous plants and animals. To examine potential competition between these taxa, we studied dietary and microhabitat overlap between pink sundews (Drosera capillaris) and wolf spiders (Lycosidae) in the field, and conducted a laboratory experiment examining the effects of wolf spiders on sundew fitness. In the field, we found that sundews and spiders had a high dietary overlap with each other and with the available arthropod prey. Associations between sundews and spiders depended on spatial scale: both sundews and spiders were found more frequently in quadrats with more abundant prey, but within quadrats, spiders constructed larger webs and located them further away from sundews as the total sundew trapping area increased, presumably to reduce competition. Spiders also constructed larger webs when fewer prey were available. In the laboratory, our experiment revealed that spiders can significantly reduce sundew fitness. Our findings suggest that members of the plant and animal kingdoms can and do compete.

  5. Are temperate canopy spiders tree-species specific?

    Science.gov (United States)

    Mupepele, Anne-Christine; Müller, Tobias; Dittrich, Marcus; Floren, Andreas

    2014-01-01

    Arboreal spiders in deciduous and coniferous trees were investigated on their distribution and diversity. Insecticidal knock-down was used to comprehensively sample spiders from 175 trees from 2001 to 2003 in the Białowieża forest and three remote forests in Poland. We identified 140 species from 9273 adult spiders. Spider communities were distinguished between deciduous and coniferous trees. The richest fauna was collected from Quercus where beta diversity was also highest. A tree-species-specific pattern was clearly observed for Alnus, Carpinus, Picea and Pinus trees and also for those tree species that were fogged in only four or three replicates, namely Betula and Populus. This hitherto unrecognised association was mainly due to the community composition of common species identified in a Dufrene-Legendre indicator species analysis. It was not caused by spatial or temporal autocorrelation. Explaining tree-species specificity for generalist predators like spiders is difficult and has to involve physical and ecological tree parameters like linkage with the abundance of prey species. However, neither did we find a consistent correlation of prey group abundances with spiders nor could differences in spider guild composition explain the observed pattern. Our results hint towards the importance of deterministic mechanisms structuring communities of generalist canopy spiders although the casual relationship is not yet understood.

  6. Camel spider (Solifugae) use of prairie dog colonies

    Science.gov (United States)

    Solifugids (camel spiders) are widespread throughout arid regions of western North America and are thought to be important in structuring desert arthropod communities. Despite the ubiquity of camel spiders, little is known about their ecology. Black-tailed prairie dogs (Cynomys ludovicianus) are als...

  7. Brain systems underlying encounter expectancy bias in spider phobia.

    Science.gov (United States)

    Aue, Tatjana; Hoeppli, Marie-Eve; Piguet, Camille; Hofstetter, Christoph; Rieger, Sebastian W; Vuilleumier, Patrik

    2015-06-01

    Spider-phobic individuals are characterized by exaggerated expectancies to be faced with spiders (so-called encounter expectancy bias). Whereas phobic responses have been linked to brain systems mediating fear, little is known about how the recruitment of these systems relates to exaggerated expectancies of threat. We used fMRI to examine spider-phobic and control participants while they imagined visiting different locations in a forest after having received background information about the likelihood of encountering different animals (spiders, snakes, and birds) at these locations. Critically, imagined encounter expectancies modulated brain responses differently in phobics as compared with controls. Phobics displayed stronger negative modulation of activity in the lateral prefrontal cortex, precuneus, and visual cortex by encounter expectancies for spiders, relative to snakes or birds (within-participants analysis); these effects were not seen in controls. Between-participants correlation analyses within the phobic group further corroborated the hypothesis that these phobia-specific modulations may underlie irrationality in encounter expectancies (deviations of encounter expectancies from objective background information) in spider phobia; the greater the negative modulation a phobic participant displayed in the lateral prefrontal cortex, precuneus, and visual cortex, the stronger was her bias in encounter expectancies for spiders. Interestingly, irrationality in expectancies reflected in frontal areas relied on right rather than left hemispheric deactivations. Our data accord with the idea that expectancy biases in spider phobia may reflect deficiencies in cognitive control and contextual integration that are mediated by right frontal and parietal areas.

  8. Spider mite control and resistance management: does a genome help?

    NARCIS (Netherlands)

    Van Leeuwen, T.; Dermauw, W.; Grbic, M.; Tirry, L.; Feyereisen, R.

    2012-01-01

    The complete genome of the two-spotted spider mite, Tetranychus urticae, has been reported. This is the first sequenced genome of a highly polyphagous and resistant agricultural pest. The question as to what the genome offers the community working on spider mite control is addressed.

  9. Three newly recorded Linyphiid spiders (Araneae: Linyphiidae from Korea

    Directory of Open Access Journals (Sweden)

    Sue Yeon Lee

    2018-03-01

    Full Text Available Three Linyphiid spiders, Caviphantes pseudosaxetorum Wunderlich, 1979, Erigone edentata Saito and Ono, 2001, and Savignia kawachiensis Oi, 1960, are reported for the first time from Korea with taxonomic illustrations and redescription. In this study, the genus Caviphantes Oi, 1960 is also newly recorded to Korean spider fauna.

  10. SPIDER: CMB Polarimetry from the Edge of Space

    Energy Technology Data Exchange (ETDEWEB)

    Gualtieri, R.; et al.

    2017-11-28

    SPIDER is a balloon-borne instrument designed to map the polarization of the millimeter-wave sky at large angular scales. SPIDER targets the B-mode signature of primordial gravitational waves in the cosmic microwave background (CMB), with a focus on mapping a large sky area with high fidelity at multiple frequencies. SPIDER's first longduration balloon (LDB) flight in January 2015 deployed a total of 2400 antenna-coupled Transition Edge Sensors (TESs) at 90 GHz and 150 GHz. In this work we review the design and in-flight performance of the SPIDER instrument, with a particular focus on the measured performance of the detectors and instrument in a space-like loading and radiation environment. SPIDER's second flight in December 2018 will incorporate payload upgrades and new receivers to map the sky at 285 GHz, providing valuable information for cleaning polarized dust emission from CMB maps.

  11. Nutrient regulation in a predator, the wolf spider Pardosa prativaga

    DEFF Research Database (Denmark)

    Jensen, Kim; Mayntz, David; Toft, Søren

    2011-01-01

    Nutrient balancing is well known in herbivores and omnivores, but has only recently been demonstrated in predators. To test how a predator might regulate nutrients when the prey varies in nutrient composition, we restricted juvenile Pardosa prativaga wolf spiders to diets of one of six fruit fly......, Drosophila melanogaster, prey types varying in lipid:protein composition during their second instar. We collected all fly remnants to estimate food and nutrient intake over each meal. The spiders adjusted their capture rate and nutrient extraction in response to prey mass and nutrient composition...... irrespective of energy intake. Intake was initially regulated to a constant lipid plus protein mass, but later spiders fed on prey with high proportions of protein increased consumption relative to spiders fed on other prey types. This pattern indicates that the spiders were prepared to overconsume vast...

  12. Spiders of Kerala Agricultural University Campus, Thrissur, Kerala, India

    Directory of Open Access Journals (Sweden)

    C. K. Adarsh

    2015-12-01

    Full Text Available A total of 86 species of spiders belonging to 56 genera of 20 families have been recorded from the Kerala Agricultural University (KAU campus, Thrissur, Kerala, southern India.  This represents 5.1% of the total spiders’ species and 33.33% of the total families of spiders recorded in India.  The dominant spider family at KAU campus is Araneidae with 18 species of nine genera. Salticidae is represented by 14 species of 13 genera.  Out of 252 endemic spiders of India, 16 have been reported from KAU campus.  Guild structure analysis shows spiders belonging to seven types of feeding guilds present in KAU campus.  Orb-web builders are the dominant feeding guild accounting for 34%, followed by stalkers (22%, ground runners (20%, ambushers (8%, scattered line weavers (8%, foliage runners (7% and sheet-web builders (1%. 

  13. Specific predictive power of automatic spider-related affective associations for controllable and uncontrollable fear responses toward spiders

    NARCIS (Netherlands)

    Huijdlng, J; de Jong, PJ; Huijding, J.

    This study examined the predictive power of automatically activated spider-related affective associations for automatic and controllable fear responses. The Extrinsic Affective Simon Task (EAST; De Houwer, 2003) was used to indirectly assess automatic spider fear-related associations. The EAST and

  14. And along Came a Spider: An Attentional Bias for the Detection of Spiders in Young Children and Adults

    Science.gov (United States)

    LoBue, Vanessa

    2010-01-01

    Spiders are among the most common targets of fears and phobias in the world. In visual search tasks, adults detect their presence more rapidly than other kinds of stimuli. Reported here is an investigation of whether young children share this attentional bias for the detection of spiders. In a series of experiments, preschoolers and adults were…

  15. Solubilization of spider silk proteins and its structural analysis using Fourier transform infrared spectroscopy

    Science.gov (United States)

    Osbin, K.; Jayan, Manuel; Bhadrakumari, S.; Predeep, P.

    2017-06-01

    This study investigates the presence of various amide bands present in different spider silk species, which provides extraordinary physical properties. Three different spider silks were collected from Western Ghats region. The collected spider silks samples belonging to the spider Heteropoda venatoria (species 1), Hersilia savignyi (species 2) and Pholcus phalangioides (species 3). Fourier transform infrared (FTIR) spectra reveals the protein peaks in the amide I, II, and III regions in all the three types of spider silk species.

  16. Widowers' accounts of maternal mortality among women of low socioeconomic status in Nigeria.

    Science.gov (United States)

    Nwokocha, Ezebunwa Ethelbert

    2012-09-01

    The research is based on information collected on 50 deceased Nigerian women of low socioeconomic status in different locations of the country including Lagos, Ibadan, Kaduna, Zaria, Minna, Enugu, and Port-Harcourt among others. They had some common characteristics such as low levels of education, involvement in petty trading and were clients of a microfinance bank as small loan receivers. Primary data were generated mainly through verbal autopsy with widowers employing in-depth interviews and key informant interviews. In addition, unobtrusive observation was carried out in these locations to ascertain in some instances the distance between the deceased homes and health facilities patronised by the women. Secondary data were specific to death certificates of the deceased supplied by the widowers. Both ethnographic summaries and content analysis were employed in data analysis to account for contextual differences, especially in a multicultural society like Nigeria. The findings implicated several issues that are taken for granted at the micro-family and macro-society levels. It specifically revealed that small loans alone are not sufficient to empower poor women to make meaningful contributions to their own reproductive health in a patriarchal society like Nigeria. Results also indicated that cultural differences as well as rural-urban dichotomy were not proximate determinants of maternal behaviour; the latter rather finds expression in low socioeconomic status. Consequently, policy relevant recommendations that could contribute to significant maternal mortality reduction were proffered.

  17. The psychosocial effects of "La Violencia" on widows of El Quiche, Guatemala.

    Science.gov (United States)

    Zur, J

    1993-06-01

    In Guatemala, government-sponsored terrorism directed at Mayan villagers resulted in at least 122,000 deaths and 18,000 "disappearances" during the period 1975-85. Even today, "low intensity warfare" in the form of random acts of terrorism continue. Thus, in the past 20 years, 120,000 women have been widowed, 11,000 in the province of El Quiche alone. This violence extended to threats of death directed toward women who joined a human rights organization, to the rape of women by their husbands' murderers and the further murder or kidnapping of their relatives. Groups of women were split between widows and married women, and women had to recreate their roles in society. The resulting reformation of family life led to an irretrievably altered relationship with the past. Survivors had to cope with pervasive fear, with a new understanding of their vulnerability, and with an inability to fulfill their obligations towards the dead who were buried in clandestine graves. The women who coped the best were those who learned to comprehend the violence in political terms through participation in human rights and women's groups and those who lived in villages where the dead were exhumed and properly buried. The psychological pain suffered by the women often manifested itself in physical ways and added to the suffering they realized from overwork and poor nutrition.

  18. Ecopsychosocial Aspects of Human–Tiger Conflict: An Ethnographic Study of Tiger Widows of Sundarban Delta, India

    Science.gov (United States)

    Chowdhury, Arabinda N.; Mondal, Ranajit; Brahma, Arabinda; Biswas, Mrinal K.

    2016-01-01

    AIMS Human–tiger conflict (HTC) is a serious public health issue in Sundarban Reserve Forest, India. HTC is a continued concern for the significant mortality and morbidity of both human and tiger population. This is the first comprehensive report on Sundarban tiger–human conflicts and its impact on widows whose husbands were killed by tigers. The study attempts to explore the situation analysis of HTC and the aftermath of the incident including bereavement and coping, the cultural stigma related to being killed by a tiger and the consequent discrimination, deprivation, and social rejection, and the impact on the mental health of the tiger-widows. METHODS This is a three-phase ethnographic research with a mix of quantitative and qualitative methods. In the first phase, a door-to-door village survey (3,084 households) was carried out in two villages of Sundarban, which are adjacent to the Reserve Forest, in which the incidents of human–animal conflicts and the 65 tiger-widows identified were documented. In the second phase, the 65 tiger-widows were studied to explore the ecodemography of tiger attacks and tiger-widows alongside the stigma issue by using a stigma questionnaire (n = 49). The stigma burden was compared with normal widows (n = 21) and snake-bite widows (n = 18). In the third phase, the psychosocial and cultural dimensions related to tiger attacks were studied by using in-depth interviews (IDI) of the tiger-widows, focus-group discussions (FGD), and participatory mapping in the community. Clinical examinations of the mental health of the widows were also carried out in this phase. RESULTS The mean age of the 65 widows was 43.49 ± 9.58 years. Of this, 12.3% of the widows had remarried and only 4.6% of the widows were literate. In all, 67.2% of all tiger attacks occurred as a result of illegal forest entry. The main livelihood of the former husbands of the widows were 43.8% wood cutting, 28.1% fishing, 10.9% crab catching, 9.4% tiger prawn seed

  19. Ecopsychosocial Aspects of Human-Tiger Conflict: An Ethnographic Study of Tiger Widows of Sundarban Delta, India.

    Science.gov (United States)

    Chowdhury, Arabinda N; Mondal, Ranajit; Brahma, Arabinda; Biswas, Mrinal K

    2016-01-01

    Human-tiger conflict (HTC) is a serious public health issue in Sundarban Reserve Forest, India. HTC is a continued concern for the significant mortality and morbidity of both human and tiger population. This is the first comprehensive report on Sundarban tiger-human conflicts and its impact on widows whose husbands were killed by tigers. The study attempts to explore the situation analysis of HTC and the aftermath of the incident including bereavement and coping, the cultural stigma related to being killed by a tiger and the consequent discrimination, deprivation, and social rejection, and the impact on the mental health of the tiger-widows. This is a three-phase ethnographic research with a mix of quantitative and qualitative methods. In the first phase, a door-to-door village survey (3,084 households) was carried out in two villages of Sundarban, which are adjacent to the Reserve Forest, in which the incidents of human-animal conflicts and the 65 tiger-widows identified were documented. In the second phase, the 65 tiger-widows were studied to explore the ecodemography of tiger attacks and tiger-widows alongside the stigma issue by using a stigma questionnaire (n = 49). The stigma burden was compared with normal widows (n = 21) and snake-bite widows (n = 18). In the third phase, the psychosocial and cultural dimensions related to tiger attacks were studied by using in-depth interviews (IDI) of the tiger-widows, focus-group discussions (FGD), and participatory mapping in the community. Clinical examinations of the mental health of the widows were also carried out in this phase. The mean age of the 65 widows was 43.49 ± 9.58 years. Of this, 12.3% of the widows had remarried and only 4.6% of the widows were literate. In all, 67.2% of all tiger attacks occurred as a result of illegal forest entry. The main livelihood of the former husbands of the widows were 43.8% wood cutting, 28.1% fishing, 10.9% crab catching, 9.4% tiger prawn seed (juvenile prawn), and 4.7% honey

  20. The Transmission Line for the SPIDER experiment

    International Nuclear Information System (INIS)

    Boldrin, Marco; De Lorenzi, Antonio; Recchia, Mauro; Toigo, Vanni; Bonicelli, Tullio; Simon, Muriel

    2011-01-01

    The 100 keV Ion Source Test facility - Source for the Production of Ions of Deuterium Extracted from RF plasma (SPIDER) - is aimed to test the full scale prototype of the Ion Source for the ITER 1 MeV Neutral Beam Injector (NBI). The SPIDER facility requires the construction of a High Voltage Deck (HVD) and of a High Voltage Transmission Line (TL) respectively to host the Ion Source Power Supplies system polarized at 100 kV and to carry the power and signal conductors to the beam accelerator. In already existing NBI systems with beam energy above 100 keV, the TL is realized with the SF 6 Gas Insulated Line technology. In the SPIDER TL case, the presence of a large inner conductor (half meter diameter), would make the pressurized TL a complex and costly component; therefore a free air insulated solution has been proposed. The paper focuses on the design of this TL, which has to host inside the complex high potential (100 kV) inner electrode a number of power and measuring conductors and has to minimize the Electro Magnetic Interferences (EMI) produced by the frequent grids breakdowns. Finite Element (FE) analyses have been performed to verify the configuration from the electrostatic point of view, to evaluate EMI screening effectiveness and to assess the impact of the relatively high thermal dissipation of power conductors located inside the high potential electrode. Moreover, an experimental test campaign has been carried out on a TL mockup to validate the TL electrostatic configuration under DC voltage. Finally, the paper reports on the status of procurement activities for the Transmission Line.

  1. Wayanad widows: A study of sustainable rural economic development using renewable energy technology for micro enterprise in Kerala, India

    Science.gov (United States)

    Voorhees, Maire Claire

    This thesis examines the situation of the farmer widows of Wayanad, Kerala through exploration of the underlying agricultural and economic issues leading to farmers' suicides, the current state of the environment in the Wayanad District of Kerala, India, and an economic model of micro-entrepreneurship to address economic and social issues of the surviving widows. Quantitative and qualitative research methods were performed through the assessment and document analysis of archive, newspaper, and published reports to gain a macro perspective. The Environmental Vulnerability Index was used as a tool to evaluate and organize findings of the current environmental conditions in the region. This thesis supports the sustainability concept of considering the economic, ecological, and social impacts when identifying economic development pathways. The goal was to explore the appropriateness of small household solar systems as vehicle in the micro-enterprise model to be a sustainable alternative economic pathway to agriculture for the farmer widows of Wayanad.

  2. Assassin bug uses aggressive mimicry to lure spider prey.

    Science.gov (United States)

    Wignall, Anne E; Taylor, Phillip W

    2011-05-07

    Assassin bugs (Stenolemus bituberus) hunt web-building spiders by invading the web and plucking the silk to generate vibrations that lure the resident spider into striking range. To test whether vibrations generated by bugs aggressively mimic the vibrations generated by insect prey, we compared the responses of spiders to bugs with how they responded to prey, courting male spiders and leaves falling into the web. We also analysed the associated vibrations. Similar spider orientation and approach behaviours were observed in response to vibrations from bugs and prey, whereas different behaviours were observed in response to vibrations from male spiders and leaves. Peak frequency and duration of vibrations generated by bugs were similar to those generated by prey and courting males. Further, vibrations from bugs had a temporal structure and amplitude that were similar to vibrations generated by leg and body movements of prey and distinctly different to vibrations from courting males or leaves, or prey beating their wings. To be an effective predator, bugs do not need to mimic the full range of prey vibrations. Instead bugs are general mimics of a subset of prey vibrations that fall within the range of vibrations classified by spiders as 'prey'.

  3. Cuticular antifungals in spiders: density- and condition dependence.

    Directory of Open Access Journals (Sweden)

    Daniel González-Tokman

    Full Text Available Animals living in groups face a high risk of disease contagion. In many arthropod species, cuticular antimicrobials constitute the first protective barrier that prevents infections. Here we report that group-living spiders produce cuticular chemicals which inhibit fungal growth. Given that cuticular antifungals may be costly to produce, we explored whether they can be modulated according to the risk of contagion (i.e. under high densities. For this purpose, we quantified cuticular antifungal activity in the subsocial crab spider Diaea ergandros in both natural nests and experimentally manipulated nests of varying density. We quantified the body-condition of spiders to test whether antifungal activity is condition dependent, as well as the effect of spider density on body-condition. We predicted cuticular antifungal activity to increase and body-condition to decrease with high spider densities, and that antifungal activity would be inversely related to body-condition. Contrary to our predictions, antifungal activity was neither density- nor condition-dependent. However, body-condition decreased with density in natural nests, but increased in experimental nests. We suggest that pathogen pressure is so important in nature that it maintains high levels of cuticular antifungal activity in spiders, impacting negatively on individual energetic condition. Future studies should identify the chemical structure of the isolated antifungal compounds in order to understand the physiological basis of a trade-off between disease prevention and energetic condition caused by group living, and its consequences in the evolution of sociality in spiders.

  4. Silk elasticity as a potential constraint on spider body size.

    Science.gov (United States)

    Rodríguez-Gironés, Miguel A; Corcobado, Guadalupe; Moya-Laraño, Jordi

    2010-10-07

    Silk is known for its strength and extensibility and has played a key role in the radiation of spiders. Individual spiders use different glands to produce silk types with unique sets of proteins. Most research has studied the properties of major ampullate and capture spiral silks and their ecological implications, while little is known about minor ampullate silk, the type used by those spider species studied to date for bridging displacements. A biomechanical model parameterised with available data shows that the minimum radius of silk filaments required for efficient bridging grows with the square root of the spider's body mass, faster than the radius of minor ampullate silk filaments actually produced by spiders. Because the morphology of spiders adapted to walking along or under silk threads is ill suited for moving on a solid surface, for these species there is a negative relationship between body mass and displacement ability. As it stands, the model suggests that spiders that use silk for their displacements are prevented from attaining a large body size if they must track their resources in space. In particular, silk elasticity would favour sexual size dimorphism because males that must use bridging lines to search for females cannot grow large. 2010 Elsevier Ltd. All rights reserved.

  5. Cuticular antifungals in spiders: density- and condition dependence.

    Science.gov (United States)

    González-Tokman, Daniel; Ruch, Jasmin; Pulpitel, Tamara; Ponton, Fleur

    2014-01-01

    Animals living in groups face a high risk of disease contagion. In many arthropod species, cuticular antimicrobials constitute the first protective barrier that prevents infections. Here we report that group-living spiders produce cuticular chemicals which inhibit fungal growth. Given that cuticular antifungals may be costly to produce, we explored whether they can be modulated according to the risk of contagion (i.e. under high densities). For this purpose, we quantified cuticular antifungal activity in the subsocial crab spider Diaea ergandros in both natural nests and experimentally manipulated nests of varying density. We quantified the body-condition of spiders to test whether antifungal activity is condition dependent, as well as the effect of spider density on body-condition. We predicted cuticular antifungal activity to increase and body-condition to decrease with high spider densities, and that antifungal activity would be inversely related to body-condition. Contrary to our predictions, antifungal activity was neither density- nor condition-dependent. However, body-condition decreased with density in natural nests, but increased in experimental nests. We suggest that pathogen pressure is so important in nature that it maintains high levels of cuticular antifungal activity in spiders, impacting negatively on individual energetic condition. Future studies should identify the chemical structure of the isolated antifungal compounds in order to understand the physiological basis of a trade-off between disease prevention and energetic condition caused by group living, and its consequences in the evolution of sociality in spiders.

  6. First report of clinical presentation of a bite by a running spider, Philodromus sp. (Araneae: Philodromidae), with recommendations for spider bite management.

    Science.gov (United States)

    Coetzee, Maureen; Dippenaar, Ansie; Frean, John; Hunt, Richard H

    2017-06-30

    This article describes the clinical progression of symptoms over a period of 5 days of a bite inflicted by a Philodromus sp. spider. Commonly known as 'running spiders', these are not considered to be harmful to humans. This report, however, is the first description of an actual bite by a member of this group of spiders showing cytotoxic envenomation. Management of the bites should be as recommended for other cytotoxic spider bites.

  7. Structure-function-property-design interplay in biopolymers: spider silk.

    Science.gov (United States)

    Tokareva, Olena; Jacobsen, Matthew; Buehler, Markus; Wong, Joyce; Kaplan, David L

    2014-04-01

    Spider silks have been a focus of research for almost two decades due to their outstanding mechanical and biophysical properties. Recent advances in genetic engineering have led to the synthesis of recombinant spider silks, thus helping to unravel a fundamental understanding of structure-function-property relationships. The relationships between molecular composition, secondary structures and mechanical properties found in different types of spider silks are described, along with a discussion of artificial spinning of these proteins and their bioapplications, including the role of silks in biomineralization and fabrication of biomaterials with controlled properties. Copyright © 2013 Acta Materialia Inc. Published by Elsevier Ltd. All rights reserved.

  8. Inhibition of the spider heartbeat by gravity and vibration

    Science.gov (United States)

    Finck, A.

    1984-01-01

    The rate and vigor of the spider heartbeat is controlled by an external pacemaker. A mechanical feature of the spider cardio-vascular system is the production of high serum pressure in the prosoma and the legs. This appears to be the source for leg extension. The lyriform organ on the patella of the leg is sensitive to vibratory and kinesthetic stimuli. This sensitivity depends upon the degree of leg extension. Thus the activity of the heart and the response characteristics of the sense receptor are related. The effect of a supra-threshold vibratory or gravitational stimulus is to produce an inhibition and a tachycardia of the spider heartbeat.

  9. Spider silk reinforced by graphene or carbon nanotubes

    Science.gov (United States)

    Lepore, Emiliano; Bosia, Federico; Bonaccorso, Francesco; Bruna, Matteo; Taioli, Simone; Garberoglio, Giovanni; Ferrari, Andrea C.; Pugno, Nicola Maria

    2017-09-01

    Spider silk has promising mechanical properties, since it conjugates high strength (~1.5 GPa) and toughness (~150 J g-1). Here, we report the production of silk incorporating graphene and carbon nanotubes by spider spinning, after feeding spiders with the corresponding aqueous dispersions. We observe an increment of the mechanical properties with respect to pristine silk, up to a fracture strength ~5.4 GPa and a toughness modulus ~1570 J g-1. This approach could be extended to other biological systems and lead to a new class of artificially modified biological, or ‘bionic’, materials.

  10. Colonization of subterranean habitats by spiders in Central Europe

    Directory of Open Access Journals (Sweden)

    Vlastimil Růžička

    2013-05-01

    Full Text Available Using data from the Czech Republic, we studied the distribution of spiders in soils, crevice systems, scree and caves, i.e. subterranean habitats at depths spanning from 10 cm to 100 m. In total, we found 161 species. The number of species declines with increasing habitat depth, with a major drop in species richness at the depth of 10 meters. Thirteen species exhibit morphological adaptations to life in subterranean habitats. At depths greater than 10 meters, spider assemblages are almost exclusively composed of troglomorphic species. We propose a hypothesis of evolution of troglomorphisms at spiders during Quaternary climatic cycles.

  11. Venomous snake bites, scorpions, and spiders.

    Science.gov (United States)

    Kularatne, S A M; Senanayake, Nimal

    2014-01-01

    Neurologic dysfunction due to natural neurotoxins is an important, but neglected, public health hazard in many parts of the world, particularly in the tropics. These toxins are produced by or found among a variety of live forms that include venomous snakes, arthropods such as scorpions, spiders, centipedes, stinging insects (Hymenoptera), ticks, certain poisonous fish, shellfish, crabs, cone shells, skin secretions of dart-poison frogs, and bacterial poisons such as botulinum toxin. These toxins commonly act on neuromuscular transmission at the neuromuscular junction where acetylcholine is the neurotransmitter, but in certain situations the toxins interfere with neurotransmitters such as GABA, noradrenaline, adrenaline, dopamine, and γ-aminobutyrate. Of the toxins, α-toxins and κ-toxins (e.g., Chinese krait, Bungarus multicinctus) act on the postsynaptic membrane, blocking the receptors, whilst β-toxin (e.g., common krait, B. caeruleus) acts on the presynaptic membrane, causing impairment of acetylcholine release. Conversely, dendrotoxins of the African mamba enhance acetylcholine release. The toxins of scorpions and spiders commonly interfere with voltage-gated ion channels. Clinically, the cardinal manifestation is muscle paralysis. In severe cases respiratory paralysis could be fatal. Effective antivenoms are the mainstay of treatment of envenoming, but their lack of availability is the major concern in the regions of the globe where they are desperately needed. Interestingly, some toxins have proved to be valuable pharmaceutical agents, while some others are widely exploited to study neuromuscular physiology and pathology. © 2014 Elsevier B.V. All rights reserved.

  12. Free amino acids in spider hemolymph.

    Science.gov (United States)

    Tillinghast, Edward K; Townley, Mark A

    2008-11-01

    We examined the free amino acid composition of hemolymph from representatives of five spider families with an interest in knowing if the amino acid profile in the hemolymph of orb-web-building spiders reflects the high demands for small organic compounds in the sticky droplets of their webs. In nearly all analyses, on both orb and non-orb builders, glutamine was the most abundant free amino acid. Glycine, taurine, proline, histidine, and alanine also tended to be well-represented in orb and non-orb builders. While indications of taxon-specific differences in amino acid composition were observed, it was not apparent that two presumptive precursors (glutamine, taurine) of orb web sticky droplet compounds were uniquely enriched in araneids (orb builders). However, total amino acid concentrations were invariably highest in the araneids and especially so in overwintering juveniles, even as several of the essential amino acids declined during this winter diapause. Comparing the data from this study with those from earlier studies revealed a number of discrepancies. The possible origins of these differences are discussed.

  13. Intracellular recording from a spider vibration receptor.

    Science.gov (United States)

    Gingl, Ewald; Burger, Anna-M; Barth, Friedrich G

    2006-05-01

    The present study introduces a new preparation of a spider vibration receptor that allows intracellular recording of responses to natural mechanical or electrical stimulation of the associated mechanoreceptor cells. The spider vibration receptor is a lyriform slit sense organ made up of 21 cuticular slits located on the distal end of the metatarsus of each walking leg. The organ is stimulated when the tarsus receives substrate vibrations, which it transmits to the organ's cuticular structures, reducing the displacement to about one tenth due to geometrical reasons. Current clamp recording was used to record action potentials generated by electrical or mechanical stimuli. Square pulse stimulation identified two groups of sensory cells, the first being single-spike cells which generated only one or two action potentials and the second being multi-spike cells which produced bursts of action potentials. When the more natural mechanical sinusoidal stimulation was applied, differences in adaptation rate between the two cell types remained. In agreement with prior extracellular recordings, both cell types showed a decrease in the threshold tarsus deflection with increasing stimulus frequency. Off-responses to mechanical stimuli have also been seen in the metatarsal organ for the first time.

  14. Spectral sensitivity of a colour changing spider.

    Science.gov (United States)

    Defrize, Jérémy; Lazzari, Claudio R; Warrant, Eric J; Casas, Jérôme

    2011-04-01

    Vision plays a paramount role in some spider families such as the Salticidae, Lycosidae and Thomisidae, as it is involved in prey hunting, orientation or choice of substrate. In the thomisid Misumena vatia, for which the substrate colour affects the body colour, vision seems to mediate morphological colour changes. However, nothing is known about which component of visual signals from the substrate might be perceived, nor whether M. vatia possesses the physiological basis for colour vision. The aim of this study is thus to investigate the vision of this spider species by measuring the spectral sensitivities of the different pairs of eyes using electrophysiological methods. Extra- and intracellular electrophysiological recordings combined with selective adaptation revealed the presence of two classes of photoreceptor cells, one sensitive in the UV region of the spectrum (around 340 nm) and one sensitive in the green (around 520 nm) regions in the four pairs of eyes. We conclude that M. vatia possesses the physiological potential to perceive both chromatic and achromatic components of the environment. Copyright © 2011 Elsevier Ltd. All rights reserved.

  15. Spiders (Araneae) Found in Bananas and Other International Cargo Submitted to North American Arachnologists for Identification.

    Science.gov (United States)

    Vetter, Richard S; Crawford, Rodney L; Buckle, Donald J

    2014-11-01

    Spiders found in international cargo brought into North America are sometimes submitted to arachnologists for identification. Often, these spiders are presumed to be of medical importance because of size or a submitter's familiarity with a toxic spider genus from the continent of origin. Starting in 2006, requests were made for spiders found in international cargo brought into North America, in addition to the specimens from similar cargo shipments already in our museum collections. This was an ad hoc study that allowed us to focus on spiders of concern to the discoverer. We identified 135 spiders found in international cargo. A key for the most common species is provided. The most frequently submitted spiders were the pantropical huntsman spider, Heteropoda venatoria (L.) (Sparassidae), and the redfaced banana spider, Cupiennius chiapanensis Medina Soriano (Ctenidae). Spiders of medical importance were rare. The most common cargo from which spiders were submitted was bananas with most specimens coming from Central America, Ecuador, or Colombia. Lack of experience with nonnative fauna caused several experienced American arachnologists to misidentify harmless ctenid spiders (C. chiapanensis, spotlegged banana spider, Cupiennius getazi Simon) as highly toxic Phoneutria spiders. These misidentifications could have led to costly, unwarranted prophylactic eradication measures, unnecessary employee health education, heightened employee anxiety and spoilage when perishable goods are left unloaded due to safety concerns. © 2014 Entomological Society of America.

  16. Phylogenomics resolves a spider backbone phylogeny and rejects a prevailing paradigm for orb web evolution.

    Science.gov (United States)

    Bond, Jason E; Garrison, Nicole L; Hamilton, Chris A; Godwin, Rebecca L; Hedin, Marshal; Agnarsson, Ingi

    2014-08-04

    Spiders represent an ancient predatory lineage known for their extraordinary biomaterials, including venoms and silks. These adaptations make spiders key arthropod predators in most terrestrial ecosystems. Despite ecological, biomedical, and biomaterial importance, relationships among major spider lineages remain unresolved or poorly supported. Current working hypotheses for a spider "backbone" phylogeny are largely based on morphological evidence, as most molecular markers currently employed are generally inadequate for resolving deeper-level relationships. We present here a phylogenomic analysis of spiders including taxa representing all major spider lineages. Our robust phylogenetic hypothesis recovers some fundamental and uncontroversial spider clades, but rejects the prevailing paradigm of a monophyletic Orbiculariae, the most diverse lineage, containing orb-weaving spiders. Based on our results, the orb web either evolved much earlier than previously hypothesized and is ancestral for a majority of spiders or else it has multiple independent origins, as hypothesized by precladistic authors. Cribellate deinopoid orb weavers that use mechanically adhesive silk are more closely related to a diverse clade of mostly webless spiders than to the araneoid orb-weaving spiders that use adhesive droplet silks. The fundamental shift in our understanding of spider phylogeny proposed here has broad implications for interpreting the evolution of spiders, their remarkable biomaterials, and a key extended phenotype--the spider web. Copyright © 2014 Elsevier Ltd. All rights reserved.

  17. X-RAY STUDIES OF THE BLACK WIDOW PULSAR PSR B1957+20

    International Nuclear Information System (INIS)

    Huang, R. H. H.; Kong, A. K. H.; Takata, J.; Cheng, K. S.; Hui, C. Y.; Lin, L. C. C.

    2012-01-01

    We report on Chandra observations of the black widow pulsar, PSR B1957+20. Evidence for a binary-phase dependence of the X-ray emission from the pulsar is found with a deep observation. The binary-phase-resolved spectral analysis reveals non-thermal X-ray emission of PSR B1957+20, confirming the results of previous studies. This suggests that the X-rays are mostly due to intra-binary shock emission, which is strongest when the pulsar wind interacts with the ablated material from the companion star. The geometry of the peak emission is determined in our study. The marginal softening of the spectrum of the non-thermal X-ray tail may indicate that particles injected at the termination shock are dominated by synchrotron cooling.

  18. The Language of Revolution and the Power of Storytelling in The Pregnant Widow

    Directory of Open Access Journals (Sweden)

    Alaa Alghamdi

    2014-01-01

    Full Text Available Martin Amis uses the language of revolution to describe the newly altered social circumstances at the height of the sexual revolution in his semi-autobiographical novel The Pregnant Widow. The concept of a ‘language of revolution’ as well as second- and third-wave feminist scholarship is applied to a textual analysis of the novel. Amis’s brand of satire creates a sense of displacement and challenges existing perceptions about gender, culture and sexuality, exposing them as constructed and changeable norms. Moreover, it becomes clear that the author is skeptical about the benefits of the sexual revolution for either gender, and that he views its liberating aspects as unfulfilled, particularly for women. Given that Amis names one of his characters Scheherazade, evoking the legendary heroine of The Arabian Nights, the importance of storytelling in the novel is also examined and found to be a potentially redeeming force.

  19. Rates and risks for prolonged grief disorder in a sample of orphaned and widowed genocide survivors.

    Science.gov (United States)

    Schaal, Susanne; Jacob, Nadja; Dusingizemungu, Jean-Pierre; Elbert, Thomas

    2010-07-06

    The concept of Prolonged Grief Disorder (PGD) has been defined in recent years by Prigerson and co-workers, who have developed and empirically tested consensus and diagnostic criteria for PGD. Using these most recent criteria defining PGD, the aim of this study was to determine rates of and risks for PGD in survivors of the 1994 Rwandan genocide who had lost a parent and/or the husband before, during or after the 1994 events. The PG-13 was administered to 206 orphans or half orphans and to 194 widows. A regression analysis was carried out to examine risk factors of PGD. 8.0% (n = 32) of the sample met criteria for PGD with an average of 12 years post-loss. All but one person had faced multiple losses and the majority indicated that their grief-related loss was due to violent death (70%). Grief was predicted mainly by time since the loss, by the violent nature of the loss, the severity of symptoms of posttraumatic stress disorder (PTSD) and the importance given to religious/spiritual beliefs. By contrast, gender, age at the time of bereavement, bereavement status (widow versus orphan), the number of different types of losses reported and participation in the funeral ceremony did not impact the severity of prolonged grief reactions. A significant portion of the interviewed sample continues to experience grief over interpersonal losses and unresolved grief may endure over time if not addressed by clinical intervention. Severity of grief reactions may be associated with a set of distinct risk factors. Subjects who lose someone through violent death seem to be at special risk as they have to deal with the loss experience as such and the traumatic aspects of the loss. Symptoms of PTSD may hinder the completion of the mourning process. Religious beliefs may facilitate the mourning process and help to find meaning in the loss. These aspects need to be considered in the treatment of PGD.

  20. Depression and anxiety among war-widows of Nepal: a post-civil war cross-sectional study.

    Science.gov (United States)

    Basnet, Syaron; Kandel, Pragya; Lamichhane, Prabhat

    2018-02-01

    Thousands of Nepalese women were widowed as a consequence of a decade (1996-2006) long civil war in Nepal. These women are at grave risk of mental health problems due to both traumatic experiences and violation of natural order of widowhood. The present study explores the depression and anxiety among war-widows. In 2012, a cross-sectional study was designed to interview 358 war-widows using validitated Beck Depression Inventory and Beck Anxiety Inventory in four districts of Nepal - Bardiya, Surkhet, Sindhupalchowk and Kavrepalanchowk with history of high conflict intensity. The prevalence of depression and anxiety was 53% and 63% respectively. Financial stress was significantly associated with depression (2.67, 95% CI: 1.40-5.07) and anxiety (2.37, 95% CI: 1.19-4.72). High autonomy of women as compared to low autonomy, high social support as compared to low social support and literacy as opposed to illiteracy was associated with less likelihood of depression and anxiety. Our results suggest high magnitude of depression and anxiety among war-widows in Nepal. Future policy efforts should be directed at providing mental health services to identify mental health issues among conflict affected individuals with focus on education, employment and activities to promote social support and autonomy at community.

  1. 'People insult her as a sexy woman': sexuality, stigma and vulnerability among widowed and divorced women in Oromiya, Ethiopia.

    Science.gov (United States)

    Newton-Levinson, Anna; Winskell, Kate; Abdela, Berissa; Rubardt, Marcie; Stephenson, Rob

    2014-01-01

    Widowed and divorced women, sometimes referred to as 'female heads of household', are one of the most impoverished and marginalised groups in the world. Widowed and divorced women are often overlooked in the literature or are seen primarily as economically or socially marginalised beings; their sexuality is rarely addressed. In an effort to understand the experiences and challenges faced by such women, we conducted and analysed four focus-group discussions, seven in-depth interviews and four interactive activities with 32 widowed and divorced women and with 25 other community members in Oromiya, Ethiopia. Findings indicate that women experienced high levels of community stigma in relation to their sexuality. Participants' fear of community stigma, and the actions they took to avert it, further served to marginalise them within their community and had negative impact on their economic, social and health support systems and, ultimately, on their overall well-being. Future interventions need to acknowledge sexual stigma as a driving force in the many challenges these women face. Further programmatic work is needed to reduce stigma related to widowed and divorced women's sexuality and to decrease their vulnerability to rape.

  2. Vision in the nocturnal wandering spider Leucorchestris arenicola (Araneae: Sparassidae)

    DEFF Research Database (Denmark)

    Nørgaard, Thomas; Nilsson, Dan-Eric; Henschel, Joh R

    2008-01-01

    At night the Namib Desert spider Leucorchestris arenicola performs long-distance homing across its sand dune habitat. By disabling all or pairs of the spiders' eight eyes we found that homing ability was severely reduced when vision was fully abolished. Vision, therefore, seems to play a key role...... in the posterior and anteriomedian eyes, and at approximately 540 nm in the anteriolateral eyes. Theoretical calculations of photon catches showed that the eyes are likely to employ a combination of spatial and temporal pooling in order to function at night. Under starlit conditions, the raw spatial and temporal...... resolution of the eyes is insufficient for detecting any visual information on structures in the landscape, and bright stars would be the only objects visible to the spiders. However, by summation in space and time, the spiders can rescue enough vision to detect coarse landscape structures. We show that L...

  3. 46 SPIDER WEBS AS INDICATORS OF COBALT AND LEAD ...

    African Journals Online (AJOL)

    Spider webs were collected from the indoor and outdoor of 120 sampling sites of 10 zones of Kano ... diet, cobalt containing ceramic is administered into ... significant human and environmental health risk. ..... Evaluation of Health Workers.

  4. Genetic diversity analysis of various red spider mite- resistant ...

    African Journals Online (AJOL)

    User

    2011-05-02

    May 2, 2011 ... 3Key Laboratory of Plant Breeding and Genetics, Sichuan Agricultural University, Ya'an, 625014, P. R. ... Random amplified polymorphic DNA (RAPD) is a DNA ..... spider mite-resistant, bumper, high-quality and disease-.

  5. Optical surface profiling of orb-web spider capture silks

    Energy Technology Data Exchange (ETDEWEB)

    Kane, D M; Joyce, A M; Staib, G R [Department of Physics, Macquarie University, Sydney, NSW 2109 (Australia); Herberstein, M E, E-mail: deb.kane@mq.edu.a [Department of Biological Sciences, Macquarie University, Sydney, NSW 2109 (Australia)

    2010-09-15

    Much spider silk research to date has focused on its mechanical properties. However, the webs of many orb-web spiders have evolved for over 136 million years to evade visual detection by insect prey. It is therefore a photonic device in addition to being a mechanical device. Herein we use optical surface profiling of capture silks from the webs of adult female St Andrews cross spiders (Argiope keyserlingi) to successfully measure the geometry of adhesive silk droplets and to show a bowing in the aqueous layer on the spider capture silk between adhesive droplets. Optical surface profiling shows geometric features of the capture silk that have not been previously measured and contributes to understanding the links between the physical form and biological function. The research also demonstrates non-standard use of an optical surface profiler to measure the maximum width of a transparent micro-sized droplet (microlens).

  6. Biotechnological Trends in Spider and Scorpion Antivenom Development

    DEFF Research Database (Denmark)

    Laustsen, Andreas Hougaard; Solà, Mireia; Jappe, Emma Christine

    2016-01-01

    in using bioactive toxins from spiders and scorpions for drug discovery purposes and for solving crystal structures of membrane-embedded receptors. Additionally, the identification and isolation of a myriad of spider and scorpion toxins has allowed research within next generation antivenoms to progress...... at an increasingly faster pace. In this review, the current knowledge of spider and scorpion venoms is presented, followed by a discussion of all published biotechnological efforts within development of spider and scorpion antitoxins based on small molecules, antibodies and fragments thereof, and next generation...... immunization strategies. The increasing number of discovery and development efforts within this field may point towards an upcoming transition from serum-based antivenoms towards therapeutic solutions based on modern biotechnology....

  7. Biomimetic calcium phosphate coatings on recombinant spider silk fibres

    NARCIS (Netherlands)

    Yang, Liang; Hedhammar, My; Blom, Tobias; Leifer, Klaus; Johansson, Jan; Habibovic, Pamela; van Blitterswijk, Clemens

    2010-01-01

    Calcium phosphate ceramic coatings, applied on surfaces of metallic and polymeric biomaterials, can improve their performance in bone repair and regeneration. Spider silk is biocompatible, strong and elastic, and hence an attractive biomaterial for applications in connective tissue repair. Recently,

  8. Peculiar torsion dynamical response of spider dragline silk

    Science.gov (United States)

    Liu, Dabiao; Yu, Longteng; He, Yuming; Peng, Kai; Liu, Jie; Guan, Juan; Dunstan, D. J.

    2017-07-01

    The torsional properties of spider dragline silks from Nephila edulis and Nephila pilipes spiders are investigated by using a torsion pendulum technique. A permanent torsional deformation is observed after even small torsional strain. This behaviour is quite different from that of the other materials tested here, i.e., carbon fiber, thin metallic wires, Kevlar fiber, and human hair. The spider dragline thus displays a strong energy dissipation upon the initial excitation (around 75% for small strains and more for a larger strain), which correspondingly reduces the amplitude of subsequent oscillations around the new equilibrium position. The variation of torsional stiffness in relaxation dynamics of spider draglines for different excitations is also determined. The experimental result is interpreted in the light of the hierarchical structure of dragline silk.

  9. Optical surface profiling of orb-web spider capture silks

    International Nuclear Information System (INIS)

    Kane, D M; Joyce, A M; Staib, G R; Herberstein, M E

    2010-01-01

    Much spider silk research to date has focused on its mechanical properties. However, the webs of many orb-web spiders have evolved for over 136 million years to evade visual detection by insect prey. It is therefore a photonic device in addition to being a mechanical device. Herein we use optical surface profiling of capture silks from the webs of adult female St Andrews cross spiders (Argiope keyserlingi) to successfully measure the geometry of adhesive silk droplets and to show a bowing in the aqueous layer on the spider capture silk between adhesive droplets. Optical surface profiling shows geometric features of the capture silk that have not been previously measured and contributes to understanding the links between the physical form and biological function. The research also demonstrates non-standard use of an optical surface profiler to measure the maximum width of a transparent micro-sized droplet (microlens).

  10. SPIDER: Probing the dawn of time from above the clouds

    Science.gov (United States)

    Moncelsi, Lorenzo; Spider Collaboration

    2017-11-01

    SPIDER is a balloon-borne microwave polarimeter designed to measure cosmological B-modes on degree angular scales in the presence of Galactic foregrounds. With six independent telescopes housing a total of 2000 detectors in the 90 GHz and 150 GHz frequency bands, SPIDER is the most instantaneously-sensitive CMB polarimeter deployed on the sky to date. SPIDER was successfully launched from McMurdo Station, Antarctica in January 2015 and acquired science data for 16 days. We cover the in-flight performance and present highlights from the ongoing data-analysis. After a successful recovery, the SPIDER team is planning the next flight, featuring one foreground-optimized channel at 280GHz, which will allow us constrain the primordial tensor-mode amplitude at the level of r < 0.03 (99% CL), in the presence of foregrounds.

  11. Evolution of stenophagy in spiders (Araneae): evidence based on the comparative analysis of spider diets.

    Science.gov (United States)

    Pekár, Stano; Coddington, Jonathan A; Blackledge, Todd A

    2012-03-01

    Stenophagy (narrow diet breadth) represents an extreme of trophic specialization in carnivores, but little is known about the forces driving its evolution. We used spiders, the most diversified group of terrestrial predators, to investigate whether stenophagy (1) promoted diversification; (2) was phylogenetically conserved and evolutionarily derived state; and (3) was determined either by geographical distribution and foraging guild. We used published data on the prey of almost 600 species. Six categories of stenophagy were found: myrmecophagy, araneophagy, lepidopterophagy, termitophagy, dipterophagy, and crustaceophagy. We found that the species diversity of euryphagous genera and families was similar to stenophagous genera and families. At the family level, stenophagy evolved repeatedly and independently. Within families, the basal condition was oligophagy or euryphagy. Most types of stenophagy were clearly derived: myrmecophagy in Zodariidae; lepidopterophagy in Araneidae; dipterophagy in Theridiidae. In contrast, araneophagy was confined to basal and intermediate lineages, suggesting its ancestral condition. The diet breadth of species from the tropics and subtropics was less diverse than species from the temperate zone. Diet breadth was lower in cursorial spiders compared to web-building species. Thus, the evolution of stenophagy in spiders appears to be complex and governed by phylogeny as well as by ecological determinants. © 2011 The Author(s). Evolution© 2011 The Society for the Study of Evolution.

  12. Thin Film Assembly of Spider Silk-like Block Copolymers

    Science.gov (United States)

    2011-01-01

    Shipley, N. H.; Lewis, R. V. Int. J. Biol.Macromol. 1999, 24, 271. (c) Thiel, B. L.; Guess, K. B.; Viney, C. Biopolymers 1997, 41, 703. (13) Silk ...Film Assembly of Spider Silk -like Block Copolymers Sreevidhya T. Krishnaji,†,‡ Wenwen Huang,§ Olena Rabotyagova,†,‡ Eugenia Kharlampieva, ) Ikjun Choi...Received November 26, 2010 We report the self-assembly of monolayers of spider silk -like block copolymers. Langmuir isotherms were obtained for a series of

  13. Early Cretaceous greenhouse pumped higher taxa diversification in spiders.

    Science.gov (United States)

    Shao, Lili; Li, Shuqiang

    2018-05-24

    The Cretaceous experienced one of the most remarkable greenhouse periods in geological history. During this time, ecosystem reorganizations significantly impacted the diversification of many groups of organisms. The rise of angiosperms marked a major biome turnover. Notwithstanding, relatively little remains known about how the Cretaceous global ecosystem impacted the evolution of spiders, which constitute one of the most abundant groups of predators. Herein, we evaluate the transcriptomes of 91 taxa representing more than half of the spider families. We add 23 newly sequenced taxa to the existing database to obtain a robust phylogenomic assessment. Phylogenetic reconstructions using different datasets and methods obtain novel placements of some groups, especially in the Synspermiata and the group having a retrolateral tibial apophysis (RTA). Molecular analyses indicate an expansion of the RTA clade at the Early Cretaceous with a hunting predatory strategy shift. Fossil analyses show a 7-fold increase of diversification rate at the same period, but this likely owes to the first occurrences spider in amber deposits. Additional analyses of fossil abundance show an accumulation of spider lineages in the Early Cretaceous. We speculate that the establishment of a warm greenhouse climate pumped the diversification of spiders, in particular among webless forms tracking the abundance of insect prey. Our study offers a new pathway for future investigations of spider phylogeny and diversification. Copyright © 2018. Published by Elsevier Inc.

  14. Impact of prescribed burning on a heathland inhabiting spider community

    Directory of Open Access Journals (Sweden)

    Krause, Rolf Harald

    2016-04-01

    Full Text Available Heathlands can provide refuge for many stenotopic and endangered arthropods, if habitat management practices are applied. A management measure that is rarely being used today, but which has the potential to support diversity of arthropod communities, is prescribed burning. In this study we investigated the effects of prescribed burning on spider assemblages on a burned site with Calluna vulgaris in the nature reserve Lueneburg Heath, northwest Germany. We used pitfall trapping with a sampling design of 39 traps over a period of one year and 17 sampling intervals on a burned and a control site. We compared overall species richness, activity abundance patterns and community composition of the two sites, with a particular focus on stenotopic and endangered species. We collected 5116 adult spiders and 99 species altogether in a relatively small sampling area. This number of species represents nearly one third of the regional species pool of heathland spider species. Twelve species occurred exclusively on the burned site in contrast to 28 species exclusively found on the unburned site. Although we found more than twice as many spider individuals and higher mean species richness on the control site than on the burned site, the species richness of red-listed spiders was higher on the burned site. Especially the fact that we found 24 endangered species on the burned site and only 20 on the control site indicates that the applied measure of prescribed burning can foster certain endangered spider species and contribute to preserving the overall biodiversity of heathland ecosystems.

  15. Nutrient Deprivation Induces Property Variations in Spider Gluey Silk

    Science.gov (United States)

    Blamires, Sean J.; Sahni, Vasav; Dhinojwala, Ali; Blackledge, Todd A.; Tso, I-Min

    2014-01-01

    Understanding the mechanisms facilitating property variability in biological adhesives may promote biomimetic innovations. Spider gluey silks such as the spiral threads in orb webs and the gumfoot threads in cobwebs, both of which comprise of an axial thread coated by glue, are biological adhesives that have variable physical and chemical properties. Studies show that the physical and chemical properties of orb web gluey threads change when spiders are deprived of food. It is, however, unknown whether gumfoot threads undergo similar property variations when under nutritional stress. Here we tested whether protein deprivation induces similar variations in spiral and gumfoot thread morphology and stickiness. We manipulated protein intake for the orb web spider Nephila clavipes and the cobweb spider Latrodectus hesperus and measured the diameter, glue droplet volume, number of droplets per mm, axial thread width, thread stickiness and adhesive energy of their gluey silks. We found that the gluey silks of both species were stickier when the spiders were deprived of protein than when the spiders were fed protein. In N. clavipes a concomitant increase in glue droplet volume was found. Load-extension curves showed that protein deprivation induced glue property variations independent of the axial thread extensions in both species. We predicted that changes in salt composition of the glues were primarily responsible for the changes in stickiness of the silks, although changes in axial thread properties might also contribute. We, additionally, showed that N. clavipes' glue changes color under protein deprivation, probably as a consequence of changes to its biochemical composition. PMID:24523902

  16. Atmospheres of Brown Dwarfs

    Science.gov (United States)

    Wang, Ruoyan; Seay, Christopher

    2018-01-01

    We construct a grid of brown dwarf model atmospheres spanning a wide range of atmospheric metallicity (0.3x ≤ met ≤ 100x), C/O ratios (0.25x ≤ C/O ≤ 2.5x), and cloud properties, encompassing atmospheres of effective temperatures 200 ≤ Teff ≤ 2400 K and gravities 2.5 ≤ log g ≤ 5.5. We produce the expected temperature-pressure profiles and emergent spectra from an atmosphere in radiative-convective equilibrium. We can then compare our predicted spectra to observations and retrieval results to aid in their predictions and influence future missions and telescopic observations. In our poster we briefly describe our modeling methodology and present our progress on model grid construction, spanning solar and subsolar C/O and metallicity.

  17. Phobic spider fear is associated with enhanced attentional capture by spider pictures: a rapid serial presentation event-related potential study.

    Science.gov (United States)

    Van Strien, Jan W; Franken, Ingmar H A; Huijding, Jorg

    2009-03-04

    The early posterior negativity (EPN) reflects early selective visual processing of emotionally significant information. This study explored the association between fear of spiders and the EPN for spider pictures. Fifty women completed a Spider Phobia Questionnaire and watched the random rapid serial presentation of 600 neutral, 600 negatively valenced emotional, and 600 spider pictures (three pictures per second). The EPN was scored as the mean activity in the 225-300-ms time window at lateral occipital electrodes. Participants with higher scores on the phobia questionnaire showed larger (i.e. more negative) EPN amplitudes in response to spider pictures. The results suggest that the attentional capture of spider-related stimuli is an automatic response, which is modulated by the extent of spider fear.

  18. Atomistic model of the spider silk nanostructure

    Science.gov (United States)

    Keten, Sinan; Buehler, Markus J.

    2010-04-01

    Spider silk is an ultrastrong and extensible self-assembling biopolymer that outperforms the mechanical characteristics of many synthetic materials including steel. Here we report atomic-level structures that represent aggregates of MaSp1 proteins from the N. Clavipes silk sequence based on a bottom-up computational approach using replica exchange molecular dynamics. We discover that poly-alanine regions predominantly form distinct and orderly beta-sheet crystal domains while disorderly structures are formed by poly-glycine repeats, resembling 31-helices. These could be the molecular source of the large semicrystalline fraction observed in silks, and also form the basis of the so-called "prestretched" molecular configuration. Our structures are validated against experimental data based on dihedral angle pair calculations presented in Ramachandran plots, alpha-carbon atomic distances, as well as secondary structure content.

  19. The phylogeny of fossil whip spiders.

    Science.gov (United States)

    Garwood, Russell J; Dunlop, Jason A; Knecht, Brian J; Hegna, Thomas A

    2017-04-21

    Arachnids are a highly successful group of land-dwelling arthropods. They are major contributors to modern terrestrial ecosystems, and have a deep evolutionary history. Whip spiders (Arachnida, Amblypygi), are one of the smaller arachnid orders with ca. 190 living species. Here we restudy one of the oldest fossil representatives of the group, Graeophonus anglicus Pocock, 1911 from the Late Carboniferous (Duckmantian, ca. 315 Ma) British Middle Coal Measures of the West Midlands, UK. Using X-ray microtomography, our principal aim was to resolve details of the limbs and mouthparts which would allow us to test whether this fossil belongs in the extant, relict family Paracharontidae; represented today by a single, blind species Paracharon caecus Hansen, 1921. Tomography reveals several novel and significant character states for G. anglicus; most notably in the chelicerae, pedipalps and walking legs. These allowed it to be scored into a phylogenetic analysis together with the recently described Paracharonopsis cambayensis Engel & Grimaldi, 2014 from the Eocene (ca. 52 Ma) Cambay amber, and Kronocharon prendinii Engel & Grimaldi, 2014 from Cretaceous (ca. 99 Ma) Burmese amber. We recovered relationships of the form ((Graeophonus (Paracharonopsis + Paracharon)) + (Charinus (Stygophrynus (Kronocharon (Charon (Musicodamon + Paraphrynus)))))). This tree largely reflects Peter Weygoldt's 1996 classification with its basic split into Paleoamblypygi and Euamblypygi lineages; we were able to score several of his characters for the first time in fossils. Our analysis draws into question the monophyly of the family Charontidae. Our data suggest that Graeophonus is a crown group amblypygid, and falls within a monophyletic Paleoamblypgi clade, but outside the family Paracharontidae (= Paracharonopsis + Paracharon). Our results also suggest a new placement for the Burmese amber genus Kronocharon, a node further down from its original position. Overall, we offer a

  20. Riparian spiders as sentinels of PCB contamination across heterogeneous aquatic ecosystems

    Science.gov (United States)

    Riparian spiders are being used increasingly to track spatial patterns of contaminants in and fluxing from aquatic ecosystems. However, our understanding of the circumstances under which spiders are effective sentinels of aquatic pollution is limited. The present study tests the ...

  1. Research on Artificial Spider Web Model for Farmland Wireless Sensor Network

    OpenAIRE

    Jun Wang; Song Gao; Shimin Zhao; Guang Hu; Xiaoli Zhang; Guowang Xie

    2018-01-01

    Through systematic analysis of the structural characteristics and invulnerability of spider web, this paper explores the possibility of combining the advantages of spider web such as network robustness and invulnerability with farmland wireless sensor network. A universally applicable definition and mathematical model of artificial spider web structure are established. The comparison between artificial spider web and traditional networks is discussed in detail. The simulation result shows tha...

  2. Science 101: Why Don't Spiders Stick to Their Own Webs?

    Science.gov (United States)

    Robertson, Bill

    2011-01-01

    This article explains why spiders don't stick to their webs. Spiders don't get stuck in their own webs (and they aren't immune to their own glue) because they use a combination of sticky and nonsticky threads (different glands for producing those), and the glue is in droplets that the spider can avoid but the prey can't. The spider's nervous…

  3. 7 CFR 29.3505 - Brown colors.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 2 2010-01-01 2010-01-01 false Brown colors. 29.3505 Section 29.3505 Agriculture... Type 95) § 29.3505 Brown colors. A group of colors ranging from a light brown to a dark brown. These colors vary from medium to low saturation and from medium to very low brillance. As used in these...

  4. 7 CFR 29.2504 - Brown colors.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 2 2010-01-01 2010-01-01 false Brown colors. 29.2504 Section 29.2504 Agriculture...-Cured Tobacco (u.s. Types 22, 23, and Foreign Type 96) § 29.2504 Brown colors. A group of colors ranging from a reddish brown to yellowish brown. These colors vary from low to medium saturation and from very...

  5. Ineffective crypsis in a crab spider: a prey community perspective.

    Science.gov (United States)

    Brechbühl, Rolf; Casas, Jérôme; Bacher, Sven

    2010-03-07

    Cryptic coloration is assumed to be beneficial to predators because of an increased encounter rate with unwary prey. This hypothesis is, however, very rarely, if ever, studied in the field. The aim of this study was to quantify the encounter rate and capture success of an ambush predator, in the field, as a function of its level of colour-matching with the background. We used the crab spider Misumena vatia, which varies its body colour and can thereby match the colour of the flower it hunts upon. We carried out a manipulative field experiment using a complete factorial design resulting in six different colour combinations of crab spiders and flowers differing in their degree of colour-matching. A rich and diverse set of naturally occurring insects visited the flowers while we continuously video-recorded the spider's foraging activity. This enabled us to test the crypsis, the spider avoidance and the flower visitor attraction hypotheses, all three supported by previous studies. Flower visitors of different groups either avoided crab spiders independent of colour-matching, such as solitary bees and syrphid flies, or ignored them, such as bumble-bees and honeybees. Moreover, colour-matched spiders did not have a higher encounter rate and capture success compared to the visually apparent ones. Thus, our results support the spider avoidance hypothesis, reject the two other hypotheses and uncovered a fourth behaviour: indifference to predators. Because flower visitors reacted differently, a community approach is mandatory in order to understand the function of background colour-matching in generalist predators. We discuss our results in relation to the size and sociality of the prey and in relation to the functional significance of colour change in this predator.

  6. Molecular Evolution of Spider Vision: New Opportunities, Familiar Players.

    Science.gov (United States)

    Morehouse, Nathan I; Buschbeck, Elke K; Zurek, Daniel B; Steck, Mireille; Porter, Megan L

    2017-08-01

    Spiders are among the world's most species-rich animal lineages, and their visual systems are likewise highly diverse. These modular visual systems, composed of four pairs of image-forming "camera" eyes, have taken on a huge variety of forms, exhibiting variation in eye size, eye placement, image resolution, and field of view, as well as sensitivity to color, polarization, light levels, and motion cues. However, despite this conspicuous diversity, our understanding of the genetic underpinnings of these visual systems remains shallow. Here, we review the current literature, analyze publicly available transcriptomic data, and discuss hypotheses about the origins and development of spider eyes. Our efforts highlight that there are many new things to discover from spider eyes, and yet these opportunities are set against a backdrop of deep homology with other arthropod lineages. For example, many (but not all) of the genes that appear important for early eye development in spiders are familiar players known from the developmental networks of other model systems (e.g., Drosophila). Similarly, our analyses of opsins and related phototransduction genes suggest that spider photoreceptors employ many of the same genes and molecular mechanisms known from other arthropods, with a hypothesized ancestral spider set of four visual and four nonvisual opsins. This deep homology provides a number of useful footholds into new work on spider vision and the molecular basis of its extant variety. We therefore discuss what some of these first steps might be in the hopes of convincing others to join us in studying the vision of these fascinating creatures.

  7. First report of clinical presentation of a bite by a running spider ...

    African Journals Online (AJOL)

    This article describes the clinical progression of symptoms over a period of 5 days of a bite inflicted by a Philodromus sp. spider. Commonly known as 'running spiders', these are not considered to be harmful to humans. This report, however, is the first description of an actual bite by a member of this group of spiders ...

  8. Salticid predation as one potential driving force of ant mimicry in jumping spiders

    Science.gov (United States)

    Huang, Jin-Nan; Cheng, Ren-Chung; Li, Daiqin; Tso, I-Min

    2011-01-01

    Many spiders possess myrmecomorphy, and species of the jumping spider genus Myrmarachne exhibit nearly perfect ant mimicry. Most salticids are diurnal predators with unusually high visual acuity that prey on various arthropods, including conspecifics. In this study, we tested whether predation pressure from large jumping spiders is one possible driving force of perfect ant mimicry in jumping spiders. The results showed that small non-ant-mimicking jumping spiders were readily treated as prey by large ones (no matter whether heterospecific or conspecific) and suffered high attack and mortality rates. The size difference between small and large jumping spiders significantly affected the outcomes of predatory interactions between them: the smaller the juvenile jumping spiders, the higher the predation risk from large ones. The attack and mortality rates of ant-mimicking jumping spiders were significantly lower than those of non-ant-mimicking jumping spiders, indicating that a resemblance to ants could provide protection against salticid predation. However, results of multivariate behavioural analyses showed that the responses of large jumping spiders to ants and ant-mimicking salticids differed significantly. Results of this study indicate that predation pressure from large jumping spiders might be one selection force driving the evolution of nearly perfect myrmecomorphy in spiders and other arthropods. PMID:20961898

  9. High School Students' Attitudes towards Spiders: A Cross-Cultural Comparison

    Science.gov (United States)

    Prokop, Pavol; Tolarovicova, Andrea; Camerik, Anne M.; Peterkova, Viera

    2010-01-01

    Spiders are traditionally considered to be among the least popular of animals. Current evidence suggests that a negative attitude towards spiders could be influenced by both cultural and evolutionary pressures. Some researchers suggest that science education activities could positively influence students' perceptions of spiders. Their evidence is,…

  10. Radurization of brown shrimps

    International Nuclear Information System (INIS)

    Ehlermann, D.; Muenzner, R.

    1976-01-01

    Brown shrimps (Crangon vulgaris) from the North sea coast were blanched on board, and irradiated with cobalt-60 gamma-rays at a minimum dose of 130 krad either before or after peeling. Other samples were irradiated before and after peeling. Control samples remained untreated or were preserved with benzoic acid. Irradiation before peeling did not result in a lasting improvement of keeping quality. However, irradiation of the peeled shrimp meat resulted in a reduction of the total bacterial load by up to 4 orders of magnitude. Shelf life until the initial microbial count was reached was 9 days for chemically treated samples, 18 days for samples irradiated after peeling, and 20 days for samples irradiated before and after peeling. Sensory evaluation and determination of volatile basic nitrogen gave similar results. The obtained diminution of the counts of staphylococci, enterococci and enterobacteriaceae reduces the hygienic hazard. Radurization of shrimp meat proved to be a satisfactory means of preservation. Introduction of the product into the market and best presentation and packaging require further investigations. (orig.) [de

  11. [Stones crushing lives: victims and their widows in the marble industry in Itaoca (ES)].

    Science.gov (United States)

    Moulin, Maria das Graças Barbosa; Minayo-Gomez, Carlos

    2008-01-01

    This text based on an ethnographic survey presents the social impact on the families of victims of fatal work accidents in the ornamental stone industry in Itaoca, district of Cachoeiro de Itapemirim, Espírito Santo, Brazil. The following elements are analyzed: family culture; living with fatal accidents; experiences of family grief; the way the companies and the union deal with worker rights; material, symbolic, and emotional resources used by the families to face hardship caused by accidents. Authoritarian management appealing to masculinity and improvisation are factors that favor work accidents. The need to earn their living, the fact of valuing work as an attribute of honorableness and lack of options render the workers subject to domination. Most of the widows are highly religious and receive emotional, symbolic and material support from their families, the community and the union. There is a notable lack of concern and support for the families on the part of managers and public institutions. Advances in the organization of the union and improvement of the working conditions forced by the demands of export buyers have occurred recently.

  12. The business of death: a qualitative study of financial concerns of widowed older women.

    Science.gov (United States)

    DiGiacomo, Michelle; Lewis, Joanne; Phillips, Jane; Nolan, Marie; Davidson, Patricia M

    2015-04-18

    The feminisation of ageing and increasing number of widowed women in contemporary society has significant implications. Older women are at risk of poor health, social, and economic outcomes upon widowhood. The aim of the study was to describe women's experiences in the period soon after their husbands' death, including their financial issues and concerns, and the ways in which these experiences impacted on the transition to widowhood late in life. This was a longitudinal study using serial in-depth semi-structured interviews with 21 community-dwelling women over the age of 65 in Australia. Verbatim transcripts underwent Interpretive Phenomenological Analysis. Thematic analysis revealed: 1) administrative burden increases vulnerability; 2) gender roles impact on transitions; and 3) financial adjustments render housing insecurity and health risk. High administrative burden within the context of significant grief and mourning was a defining feature of the early bereavement period. Complicated protracted administrative processes, insensitive interactions, and reminders of loss contributed to distress, anxiety and feelings of demoralisation. Several women identified assumption of household financial management as the most difficult aspect of coping with their husband's death. Older women may have unmet needs for assistance with administrative, financial, and legal issues immediately following spousal death and potentially for years afterward. Lack of familiarity and absence of instrumental support with financial and legal issues signal the need for policy reform, resources to improve financial literacy in women throughout the life course, increased advocacy, and consideration of different support and service models.

  13. The low-frequency radio eclipses of the black widow pulsar J1810+1744

    Science.gov (United States)

    Polzin, E. J.; Breton, R. P.; Clarke, A. O.; Kondratiev, V. I.; Stappers, B. W.; Hessels, J. W. T.; Bassa, C. G.; Broderick, J. W.; Grießmeier, J.-M.; Sobey, C.; ter Veen, S.; van Leeuwen, J.; Weltevrede, P.

    2018-05-01

    We have observed and analysed the eclipses of the black widow pulsar J1810+1744 at low radio frequencies. Using LOw-Frequency ARray (LOFAR) and Westerbork Synthesis Radio Telescope observations between 2011 and 2015, we have measured variations in flux density, dispersion measure, and scattering around eclipses. High-time resolution, simultaneous beamformed, and interferometric imaging LOFAR observations show concurrent disappearance of pulsations and total flux from the source during the eclipses, with a 3σ upper limit of 36 mJy ( duration scaling as ∝ ν-0.41 ± 0.03. The results are discussed in the context of the physical parameters of the system, and an examination of eclipse mechanisms reveals cyclotron-synchrotron absorption as the most likely primary cause, although non-linear scattering mechanisms cannot be quantitatively ruled out. The inferred mass-loss rate is a similar order of magnitude to the mean rate required to fully evaporate the companion in a Hubble time.

  14. Discovery of an Unidentified Fermi Object as a Black Widow-Like Millisecond Pulsar

    Science.gov (United States)

    Kong, A. K. H.; Huang, R. H. H.; Cheng, K. S.; Takata, J.; Yatsu, Y.; Cheung, C. C.; Donato, D.; Lin, L. C. C.; Kataoka, J.; Takahashi, Y.; hide

    2012-01-01

    The Fermi Gamma-ray Space Telescope has revolutionized our knowledge of the gamma-ray pulsar population, leading to the discovery of almost 100 gamma-ray pulsars and dozens of gamma-ray millisecond pulsars (MSPs). Although the outer-gap model predicts different sites of emission for the radio and gamma-ray pulsars, until now all of the known gamma-ray MSPs have been visible in the radio. Here we report the discovery of a radio-quiet" gamma-ray emitting MSP candidate by using Fermi, Chandra, Swift, and optical observations. The X-ray and gamma-ray properties of the source are consistent with known gamma-ray pulsars. We also found a 4.63-hr orbital period in optical and X-ray data. We suggest that the source is a black widow-like MSP with a approx. 0.1 Stellar Mass late-type companion star. Based on the profile of the optical and X-ray light-curves, the companion star is believed to be heated by the pulsar while the X-ray emissions originate from pulsar magnetosphere and/or from intra-binary shock. No radio detection of the source has been reported yet and although no gamma-ray/radio pulsation has been found, we estimated that the spin period of the MSP is approx. 3-5 ms based on the inferred gamma-ray luminosity.

  15. DISCOVERY OF GAMMA-RAY ORBITAL MODULATION IN THE BLACK WIDOW PSR J1311–3430

    Energy Technology Data Exchange (ETDEWEB)

    Xing, Yi; Wang, Zhongxiang [Key Laboratory for Research in Galaxies and Cosmology, Shanghai Astronomical Observatory, Chinese Academy of Sciences, 80 Nandan Road, Shanghai 200030 (China)

    2015-05-10

    We report our discovery of orbitally modulated γ-ray emission from the black widow system PSR J1311−3430. We analyze the Fermi Large Area Telescope data during the off-pulse phase interval of the pulsar and find the orbital modulation signal at a ∼3σ confidence level. Further spectral analysis shows no significant differences for the spectra obtained during the bright and faint orbital phase ranges. A simple sinusoid-like function can describe the modulation. Given these properties, we suggest that the intrabinary γ-ray emission arises from the region close to the companion and the modulation is caused by the occultation of the emitting region by the companion, similar to that is seen in the transitional millisecond pulsar binary (MSP) PSR J1023+0038. Considering the X-ray detection of intrabinary shock emission from eclipsing MSP binaries recently reported, this discovery further suggests the general existence of intrabinary γ-ray emission from them.

  16. SPIDER: Probing the Early Universe with a Suborbital Polarimeter

    Science.gov (United States)

    Fraisse, Aurélien A.; SPIDER Collaboration

    2012-01-01

    SPIDER is a balloon-borne polarimeter designed to detect a divergence-free polarization pattern ("B-modes") in the Cosmic Microwave Background (CMB). In the inflationary scenario, the spectrum of the tensor perturbations that generate this signal is proportional to that of the primordial scalar perturbations through the tensor-to-scalar ratio r. The expected level of systematic error in the SPIDER instrument is significantly below the amplitude of an interesting cosmological B-mode signal with r=0.03. An optimized scanning strategy enables us to minimize uncertainty in the reconstruction of the Stokes parameters used to characterize the CMB, while providing access to a relatively wide range of angular scales. In the SPIDER field, the polarized emission from interstellar dust is as bright or brighter than the cosmological r=0.03 B-mode signal at all SPIDER frequencies (90, 150, and 280 GHz), a situation similar to that found in the "Southern Hole." Despite this foreground contamination, two 20-day flights of the SPIDER instrument will constrain the amplitude of the B-mode signal to rAPRA-NNX07AL64G), the National Science Foundation (ANT-1043515), the Gordon and Betty Moore Foundation, and the David and Lucile Packard Foundation. Support in Canada is provided by NSERC, the Canadian Space Agency, the Canada Foundation for Innovation, and CIFAR.

  17. Spider Silk as Guiding Biomaterial for Human Model Neurons

    Directory of Open Access Journals (Sweden)

    Frank Roloff

    2014-01-01

    Full Text Available Over the last years, a number of therapeutic strategies have emerged to promote axonal regeneration. An attractive strategy is the implantation of biodegradable and nonimmunogenic artificial scaffolds into injured peripheral nerves. In previous studies, transplantation of decellularized veins filled with spider silk for bridging critical size nerve defects resulted in axonal regeneration and remyelination by invading endogenous Schwann cells. Detailed interaction of elongating neurons and the spider silk as guidance material is unknown. To visualize direct cellular interactions between spider silk and neurons in vitro, we developed an in vitro crossed silk fiber array. Here, we describe in detail for the first time that human (NT2 model neurons attach to silk scaffolds. Extending neurites can bridge gaps between single silk fibers and elongate afterwards on the neighboring fiber. Culturing human neurons on the silk arrays led to an increasing migration and adhesion of neuronal cell bodies to the spider silk fibers. Within three to four weeks, clustered somata and extending neurites formed ganglion-like cell structures. Microscopic imaging of human neurons on the crossed fiber arrays in vitro will allow for a more efficient development of methods to maximize cell adhesion and neurite growth on spider silk prior to transplantation studies.

  18. Biomimetic calcium phosphate coatings on recombinant spider silk fibres

    Energy Technology Data Exchange (ETDEWEB)

    Yang Liang; Habibovic, Pamela; Van Blitterswijk, Clemens A [Department of Tissue Regeneration, University of Twente, PO Box 217, 7500 AE Enschede (Netherlands); Hedhammar, My; Johansson, Jan [Department of Anatomy, Physiology and Biochemistry, Swedish University of Agricultural Sciences, the Biomedical Centre, Box 575, 751 23 Uppsala (Sweden); Blom, Tobias; Leifer, Klaus [Department of Engineering Sciences, Uppsala University, Box 534, S-751 21 Uppsala (Sweden)

    2010-08-01

    Calcium phosphate ceramic coatings, applied on surfaces of metallic and polymeric biomaterials, can improve their performance in bone repair and regeneration. Spider silk is biocompatible, strong and elastic, and hence an attractive biomaterial for applications in connective tissue repair. Recently, artificial spider silk, with mechanical and structural characteristics similar to those of native spider silk, has been produced from recombinant minispidroins. In the present study, supersaturated simulated body fluid was used to deposit calcium phosphate coatings on recombinant spider silk fibres. The mineralization process was followed in time using scanning electron microscopy equipped with an energy dispersive x-ray (EDX) detector and Raman spectroscope. Focused ion beam technology was used to produce a cross section of a coated fibre, which was further analysed by EDX. Preliminary in vitro experiments using a culture of bone marrow-derived human mesenchymal stem cells (hMSCs) on coated fibres were also performed. This study showed that recombinant spider silk fibres were successfully coated with a homogeneous and thick crystalline calcium phosphate layer. In the course of the mineralization process from modified simulated body fluid, sodium chloride crystals were first deposited on the silk surface, followed by the deposition of a calcium phosphate layer. The coated silk fibres supported the attachment and growth of hMSCs.

  19. Biomimetic calcium phosphate coatings on recombinant spider silk fibres

    International Nuclear Information System (INIS)

    Yang Liang; Habibovic, Pamela; Van Blitterswijk, Clemens A; Hedhammar, My; Johansson, Jan; Blom, Tobias; Leifer, Klaus

    2010-01-01

    Calcium phosphate ceramic coatings, applied on surfaces of metallic and polymeric biomaterials, can improve their performance in bone repair and regeneration. Spider silk is biocompatible, strong and elastic, and hence an attractive biomaterial for applications in connective tissue repair. Recently, artificial spider silk, with mechanical and structural characteristics similar to those of native spider silk, has been produced from recombinant minispidroins. In the present study, supersaturated simulated body fluid was used to deposit calcium phosphate coatings on recombinant spider silk fibres. The mineralization process was followed in time using scanning electron microscopy equipped with an energy dispersive x-ray (EDX) detector and Raman spectroscope. Focused ion beam technology was used to produce a cross section of a coated fibre, which was further analysed by EDX. Preliminary in vitro experiments using a culture of bone marrow-derived human mesenchymal stem cells (hMSCs) on coated fibres were also performed. This study showed that recombinant spider silk fibres were successfully coated with a homogeneous and thick crystalline calcium phosphate layer. In the course of the mineralization process from modified simulated body fluid, sodium chloride crystals were first deposited on the silk surface, followed by the deposition of a calcium phosphate layer. The coated silk fibres supported the attachment and growth of hMSCs.

  20. Arachnid aloft: directed aerial descent in neotropical canopy spiders.

    Science.gov (United States)

    Yanoviak, Stephen P; Munk, Yonatan; Dudley, Robert

    2015-09-06

    The behaviour of directed aerial descent has been described for numerous taxa of wingless hexapods as they fall from the tropical rainforest canopy, but is not known in other terrestrial arthropods. Here, we describe similar controlled aerial behaviours for large arboreal spiders in the genus Selenops (Selenopidae). We dropped 59 such spiders from either canopy platforms or tree crowns in Panama and Peru; the majority (93%) directed their aerial trajectories towards and then landed upon nearby tree trunks. Following initial dorsoventral righting when necessary, falling spiders oriented themselves and then translated head-first towards targets; directional changes were correlated with bilaterally asymmetric motions of the anterolaterally extended forelegs. Aerial performance (i.e. the glide index) decreased with increasing body mass and wing loading, but not with projected surface area of the spider. Along with the occurrence of directed aerial descent in ants, jumping bristletails, and other wingless hexapods, this discovery of targeted gliding in selenopid spiders further indicates strong selective pressures against uncontrolled falls into the understory for arboreal taxa. © 2015 The Author(s).

  1. Detection and phylogenetic analysis of bacteriophage WO in spiders (Araneae).

    Science.gov (United States)

    Yan, Qian; Qiao, Huping; Gao, Jin; Yun, Yueli; Liu, Fengxiang; Peng, Yu

    2015-11-01

    Phage WO is a bacteriophage found in Wolbachia. Herein, we represent the first phylogenetic study of WOs that infect spiders (Araneae). Seven species of spiders (Araneus alternidens, Nephila clavata, Hylyphantes graminicola, Prosoponoides sinensis, Pholcus crypticolens, Coleosoma octomaculatum, and Nurscia albofasciata) from six families were infected by Wolbachia and WO, followed by comprehensive sequence analysis. Interestingly, WO could be only detected Wolbachia-infected spiders. The relative infection rates of those seven species of spiders were 75, 100, 88.9, 100, 62.5, 72.7, and 100 %, respectively. Our results indicated that both Wolbachia and WO were found in three different body parts of N. clavata, and WO could be passed to the next generation of H. graminicola by vertical transmission. There were three different sequences for WO infected in A. alternidens and two different WO sequences from C. octomaculatum. Only one sequence of WO was found for the other five species of spiders. The discovered sequence of WO ranged from 239 to 311 bp. Phylogenetic tree was generated using maximum likelihood (ML) based on the orf7 gene sequences. According to the phylogenetic tree, WOs in N. clavata and H. graminicola were clustered in the same group. WOs from A. alternidens (WAlt1) and C. octomaculatum (WOct2) were closely related to another clade, whereas WO in P. sinensis was classified as a sole cluster.

  2. Endemic harvestmen and spiders of Austria (Arachnida: Opiliones, Araneae

    Directory of Open Access Journals (Sweden)

    Komposch, Christian

    2011-01-01

    Full Text Available A comprehensive overview of plant, fungus and animal species of Austria revealed a total of 748 endemic and subendemic species, including, 11 harvestman and 46 spider species. Altogether two endemic harvestmen (Nemastoma bidentatum relictum, Nemastoma schuelleri and 8 endemic spiders (Abacoproeces molestus, Collinsia (caliginosa nemenziana, Mughiphantes severus, Mughiphantes styriacus, Pelecopsis alpica, Scotophaeus nanus, Troglohyphantes novicordis, Troglohyphantes tauriscus, beside 9 subendemic harvestman and 38 subendemic spider species have been recorded from Austria. Hot-spots of endemism in the Eastern Alps are the north-eastern (Ennstaler Alps and southern Calcareous Alps (Karawanken, Karnische Alps and the Central Alps (Hohe Tauern, Gurktaler Alps, Ötztaler and Stubaier Alps. Most of the endemic arachnid species occur from the nival down to the montane zone. Important habitats are rocky areas, caves and woodlands. High absolute numbers and percentages of endemics can be found within the harvestman families Cladonychiidae, Ischyropsalididae and Nemastomatidae and in the spider genera Lepthyphantes s. l. and Troglohyphantes. The conservation status of these highly endangered taxa – 85 % of the spider species and 100 % of the harvestman taxa are endangered in Austria – is poor.

  3. Radiation Safety System for SPIDER Neutral Beam Accelerator

    International Nuclear Information System (INIS)

    Sandri, S.; Poggi, C.; Coniglio, A.; D'Arienzo, M.

    2011-01-01

    SPIDER (Source for Production of Ion of Deuterium Extracted from RF Plasma only) and MITICA (Megavolt ITER Injector Concept Advanced) are the ITER neutral beam injector (NBI) testing facilities of the PRIMA (Padova Research Injector Megavolt Accelerated) Center. Both injectors accelerate negative deuterium ions with a maximum energy of 1 MeV for MITICA and 100 keV for SPIDER with a maximum beam current of 40 A for both experiments. The SPIDER facility is classified in Italy as a particle accelerator. At present, the design of the radiation safety system for the facility has been completed and the relevant reports have been presented to the Italian regulatory authorities. Before SPIDER can operate, approval must be obtained from the Italian Regulatory Authority Board (IRAB) following a detailed licensing process. In the present work, the main project information and criteria for the SPIDER injector source are reported together with the analysis of hypothetical accidental situations and safety issues considerations. Neutron and photon nuclear analysis is presented, along with special shielding solutions designed to meet Italian regulatory dose limits. The contribution of activated corrosion products (ACP) to external exposure of workers has also been assessed. Nuclear analysis indicates that the photon contribution to worker external exposure is negligible, and the neutron dose can be considered by far the main radiation protection issue. Our results confirm that the injector has no important radiological impact on the population living around the facility.

  4. Effects of attention manipulations on motivated attention to feared and nonfeared negative distracters in spider fear.

    Science.gov (United States)

    Norberg, Joakim; Wiens, Stefan

    2013-11-09

    When people view emotional and neutral pictures, the emotional pictures capture more attention than do neutral pictures. In support, studies with event-related potentials have shown that the early posterior negativity (EPN) and the late positive potential (LPP) to emotional versus neutral pictures are enhanced when pictures are attended. However, this motivated attention decreases when voluntary attention is directed away from the pictures. Most previous studies included only generally emotional pictures of either negative or positive valence. Because people with spider fear report intense fear of spiders, we examined whether directing attention away from emotional pictures at fixation decreases motivated attention less strongly for spiders than for generally negative distracters. We recorded event-related potentials from 128 channels to study whether manipulations of attention (i.e., spatial attention and perceptual load) decrease the EPN and the LPP to emotional distracters less strongly for spiders than for fear-irrelevant negative pictures in people with spider fear. Results confirmed that the EPN and the LPP to spiders (vs. neutral pictures) were particularly enhanced in participants with spider fear compared to participants without spider fear. When attention was directed away from the pictures, the EPN and the LPP to spiders (vs. neutral pictures) decreased similarly in fearful and nonfearful participants. Further, in fearful participants, the decrease in the EPN and the LPP was similar for spiders and for fear-irrelevant negative pictures. Our findings suggest that for people with spider fear, directing attention away from emotional pictures at fixation decreases motivated attention to these distracters similarly for spiders as for fear-irrelevant negative pictures. These findings imply that attention to spiders in spider fear does not exceed the level of attention expected from the spider pictures' high arousal and negative valence (i.e., their intrinsic

  5. Reversed sex change by widowed males in polygynous and protogynous fishes: female removal experiments in the field

    Science.gov (United States)

    Kuwamura, Tetsuo; Suzuki, Shohei; Kadota, Tatsuru

    2011-12-01

    Sex change, either protogyny (female to male) or protandry (male to female), is well known among fishes, but evidence of bidirectional sex change or reversed sex change in natural populations is still very limited. This is the first report on female removal experiments for polygnous and protogynous fish species to induce reversed sex change in the widowed males in the field. We removed all of the females and juveniles from the territories of dominant males in the cleaner wrasse Labroides dimidiatus (Labridae) and the rusty angelfish Centropyge ferrugata (Pomacanthidae) on the coral reefs of Okinawa. In both species, if new females or juveniles did not immigrate into the territories of the widowed males, some of them emigrated to form male-male pairs. When a male-male pair formed, the smaller, subordinate partner began to perform female sexual behaviours ( n = 4 in L. dimidiatus; n = 2 in C. ferrugata) and, finally, released eggs ( n = 1, respectively). Thus, the reversed sex change occurred in the widowed males according to the change of their social status. These results suggest that such female removal experiments will contribute to the discovery of reversed sex change in the field also in other polygnous and protogynous species.

  6. Worry about not having a caregiver and depressive symptoms among widowed older adults in China: the role of family support.

    Science.gov (United States)

    Xu, Ling; Li, Yawen; Min, Joohong; Chi, Iris

    2017-08-01

    Using the stress-coping framework, this study examined whether worry about not having a caregiver in old age was associated with depressive symptoms among widowed Chinese older adults, including the moderating effects of self-perceived family support. Using a sample of 5331 widowed adults aged 60 years old or older from the 2006 National Sample Survey of the Aged Population in Urban/Rural China, we regressed measures of depressive symptoms on worry about not having a caregiver. We also tested moderation effects of family support. Individuals who were worried about not having a caregiver reported significantly higher levels of depressive symptoms. Feeling that their children are filial, having instrumental support from children, and having only daughters moderated the effects of worry about not having a caregiver on depressive symptoms. Our findings indicate the detrimental effects of worry about not having a caregiver on the psychological well-being of widowed older adults. This study also highlights some forms of family support that may help reduce such negative effects of widowhood.

  7. Subsocial behaviour and brood adoption in mixed-species colonies of two theridiid spiders

    DEFF Research Database (Denmark)

    Grinsted, Lena; Agnarsson, Ingi; Bilde, Trine

    2012-01-01

    Cooperation and group living often evolves through kin selection. However, associations between unrelated organisms, such as different species, can evolve if both parties benefit from the interaction. Group living is rare in spiders, but occurs in cooperative, permanently social spiders, as well...... as in territorial, colonial spiders. Mixed species spider colonies, involving closely related species, have rarely been documented. We examined social interactions in newly discovered mixed-species colonies of theridiid spiders on Bali, Indonesia. Our aim was to test the degree of intra- and interspecific tolerance...

  8. Influence of spider silk on refugia preferences of the recluse spiders Loxosceles reclusa and Loxosceles laeta (Araneae: Sicariidae).

    Science.gov (United States)

    Vetter, Richard S; Rust, Michael K

    2010-06-01

    In a previous experimental study, recluse spiders Loxosceles reclusa Gertsch and Mulaik and Loxosceles laeta (Nicolet) (Araneae: Sicariidae) preferred small cardboard refugia covered with conspecific silk compared with never-occupied refugia. Herein, we investigated some factors that might be responsible for this preference using similar cardboard refugia. When the two Loxosceles species were given choices between refugia previously occupied by their own and by the congeneric species, neither showed a species-specific preference; however, each chose refugia coated with conspecific silk rather than those previously inhabited by a distantly related cribellate spider, Metaltella simoni (Keyserling). When L. laeta spiders were offered refugia that were freshly removed from silk donors compared with heated, aged refugia from the same silk donor, older refugia were preferred. Solvent extracts of L. laeta silk were chosen approximately as often as control refugia when a range of solvents (methylene chloride:methanol, water, and hexane) were used. However, when acetone was used on similar silk, there was a statistical preference for the control, indicating that there might be a mildly repellent aspect to acetone-washed silk. Considering the inability to show attraction to chemical aspects of fresh silk, it seems that physical attributes may be more important for selection and that there might be repellency to silk of a recently vacated spider. These findings are discussed in regard to pest management strategies to control recluse spiders.

  9. Prey interception drives web invasion and spider size determines successful web takeover in nocturnal orb-web spiders.

    Science.gov (United States)

    Gan, Wenjin; Liu, Shengjie; Yang, Xiaodong; Li, Daiqin; Lei, Chaoliang

    2015-09-24

    A striking feature of web-building spiders is the use of silk to make webs, mainly for prey capture. However, building a web is energetically expensive and increases the risk of predation. To reduce such costs and still have access to abundant prey, some web-building spiders have evolved web invasion behaviour. In general, no consistent patterns of web invasion have emerged and the factors determining web invasion remain largely unexplored. Here we report web invasion among conspecifics in seven nocturnal species of orb-web spiders, and examined the factors determining the probability of webs that could be invaded and taken over by conspecifics. About 36% of webs were invaded by conspecifics, and 25% of invaded webs were taken over by the invaders. A web that was built higher and intercepted more prey was more likely to be invaded. Once a web was invaded, the smaller the size of the resident spider, the more likely its web would be taken over by the invader. This study suggests that web invasion, as a possible way of reducing costs, may be widespread in nocturnal orb-web spiders. © 2015. Published by The Company of Biologists Ltd.

  10. Prey interception drives web invasion and spider size determines successful web takeover in nocturnal orb-web spiders

    Directory of Open Access Journals (Sweden)

    Wenjin Gan

    2015-10-01

    Full Text Available A striking feature of web-building spiders is the use of silk to make webs, mainly for prey capture. However, building a web is energetically expensive and increases the risk of predation. To reduce such costs and still have access to abundant prey, some web-building spiders have evolved web invasion behaviour. In general, no consistent patterns of web invasion have emerged and the factors determining web invasion remain largely unexplored. Here we report web invasion among conspecifics in seven nocturnal species of orb-web spiders, and examined the factors determining the probability of webs that could be invaded and taken over by conspecifics. About 36% of webs were invaded by conspecifics, and 25% of invaded webs were taken over by the invaders. A web that was built higher and intercepted more prey was more likely to be invaded. Once a web was invaded, the smaller the size of the resident spider, the more likely its web would be taken over by the invader. This study suggests that web invasion, as a possible way of reducing costs, may be widespread in nocturnal orb-web spiders.

  11. Multivariable control of a rolling spider drone

    Science.gov (United States)

    Lyu, Haifeng

    The research and application of Unmanned Aerial Vehicles (UAVs) has been a hot topic recently. A UAV is dened as an aircraft which is designed not to carry a human pilot or operated with remote electronic input by the flight controller. In this thesis, the design of a control system for a quadcopter named Rolling Spider Drone is conducted. The thesis work presents the design of two kinds of controllers that can control the Drone to keep it balanced and track different kinds of input trajectories. The nonlinear mathematical model for the Drone is derived by the Newton-Euler method. The rotational subsystem and translational system are derived to describe the attitude and position motion of Drone. Techniques from linear control theory are employed to linearize the highly coupled and nonlinear quadcopter plant around equilibrium points and apply the linear feedback controller to stabilize the system. The controller is a digital tracking system that deploys LQR for system stability design. Fixed gain and adaptive gain scheduled controllers are developed and compared with different LQR weights. Step references and reference trajectories involving signicant variation for the yaw angle in the xy-plane and three-dimensional spaces are tracked in the simulation. The physical implementation and an output feedback controller are considered for future work.

  12. Efficient Journaling for the Spider Storage System

    Energy Technology Data Exchange (ETDEWEB)

    Oral, H Sarp [ORNL; Wang, Feiyi [ORNL; Shipman, Galen M [ORNL; Dillow, David A [ORNL; Miller, Ross G [ORNL; Drokin, Oleg [ORNL

    2003-01-01

    Journaling is a widely used technique to increase file system robustness against meta data and/or data corruptions. While the overhead of journaling can be negligible for small-scale file systems, we found that two aspects of local back-end file system journaling significantly lower the overall performance of a large-scale parallel file system such as Lustre: extra head seeks and serialization of incoming client requests. Journal transactions reside on a separate area of the disk that the file data, and each commit of the journal requires a head seek. Incoming client requests become serialized and take a latency hit by waiting for a commit to occur before the reply is sent. In this paper we present two different approaches to increase the local back-end file system journaling efficiency, thus increasing the overall aggregate parallel file system efficiency. First, we present a hardware-based solution where a solid-state device is used as an external journaling device to minimize the disk head seek. Second, we introduce a software-based optimization to allow asynchronously commit multiple journal transactions on the local back-end file system to minimize the penalty of serialization. Both our solutions are experimentally tested on Oak Ridge National Laboratory's large-scale Spider storage system and our tests show that both methods nearly double the overall parallel write performance.

  13. Recombinant Spider Silks—Biopolymers with Potential for Future Applications

    Directory of Open Access Journals (Sweden)

    Thomas Scheibel

    2011-03-01

    Full Text Available Nature has evolved a range of materials that compete with man-made materials in physical properties; one of these is spider silk. Silk is a fibrous material that exhibits extremely high strength and toughness with regard to its low density. In this review we discuss the molecular structure of spider silk and how this understanding has allowed the development of recombinant silk proteins that mimic the properties of natural spider silks. Additionally, we will explore the material morphologies and the applications of these proteins. Finally, we will look at attempts to combine the silk structure with chemical polymers and how the structure of silk has inspired the engineering of novel polymers.

  14. Synthetic Adhesive Attachment Discs based on Spider Pyriform Silk Architecture

    Science.gov (United States)

    Jain, Dharamdeep; Sahni, Vasav; Dhinojwala, Ali

    2014-03-01

    Among the variety of silks produced by spiders, pyriform silk is used in conjunction with the dragline silk to attach webs to different surfaces. Cob weaver spiders employ different architectural patterns to utilize the pyriform silk and form attachment joints with each pattern having a characteristic adhesive performance. The staple pin architecture is a one of the strongest attachment designs employed by spiders to attach their webs. Here we use a synthetic approach to create the a similar patterned architecture attachment discs on aluminum substrate using thermoplastic polyurethane. Measurable pull off forces are generated when the synthetic discs are peeled off a surface. This innovative adhesive strategy can be a source of design in various biomedical applications. Financial Support from National Science Foundation.

  15. Final design of thermal diagnostic system in SPIDER ion source

    Energy Technology Data Exchange (ETDEWEB)

    Brombin, M., E-mail: matteo.brombin@igi.cnr.it; Dalla Palma, M.; Pasqualotto, R.; Pomaro, N. [Consorzio RFX, Corso Stati Uniti 4, I-35127 Padova (Italy)

    2016-11-15

    The prototype radio frequency source of the ITER heating neutral beams will be first tested in SPIDER test facility to optimize H{sup −} production, cesium dynamics, and overall plasma characteristics. Several diagnostics will allow to fully characterise the beam in terms of uniformity and divergence and the source, besides supporting a safe and controlled operation. In particular, thermal measurements will be used for beam monitoring and system protection. SPIDER will be instrumented with mineral insulated cable thermocouples, both on the grids, on other components of the beam source, and on the rear side of the beam dump water cooled elements. This paper deals with the final design and the technical specification of the thermal sensor diagnostic for SPIDER. In particular the layout of the diagnostic, together with the sensors distribution in the different components, the cables routing and the conditioning and acquisition cubicles are described.

  16. Small Molecules from Spiders Used as Chemical Probes

    DEFF Research Database (Denmark)

    Olsen, Christian Adam; Kristensen, Anders S.; Strømgaard, Kristian

    2011-01-01

    Spiders are important species in ecological systems and as major predators of insects they are endowed with a plethora of low‐molecular‐weight natural products having intriguing biological activities. The isolation and biological characterization of these entities are well established, however......, only very recently have these compounds been used as templates for the design, synthesis, and biological evaluation of synthetic analogues. In contrast, the investigation of compounds responsible for chemical communication between spiders is far less developed, but recently new light has been shed onto...... the area of pheromones and allomones from spiders. Herein, we recapitulate these recent results, put them into perspective with previous findings, and provide an outlook for future studies of these chemotypes....

  17. Spider Silk Processing for Spidroin Recovery from Crossopriza Lyoni Web

    Science.gov (United States)

    Mohtar, J. A.; Ooi, W. L.; Yusuf, F.

    2018-03-01

    Spider silk is a potential biomaterial that can be used in various applications for its outstanding physicomechanical properties attributed by the spidroin composition. Efforts for commercializing spider silks have been mainly focused on the characterization of spidroins from the Entelegyne spiders for exceptional fibre construction. Hence, studies on silk proteins from the Haplogyne species remain neglected. The aim of this study is to isolate spidroin from Crossopriza lyoni web. Silk processing involved the pretreatment of fibres for the shell layer removal from the surface. A screening study was conducted to analyze the effect of temperature, incubation time and agitation speed on spidroin extraction using Ajisawa’s reagent by OFAT analysis followed by statistical optimization of the extraction process via RSM for maximal protein recovery. All parameters exerted significant effect on spidroin recovery (pspider silk to meet the demand for a variety of silk-based products in the near future.

  18. Final design of thermal diagnostic system in SPIDER ion source

    International Nuclear Information System (INIS)

    Brombin, M.; Dalla Palma, M.; Pasqualotto, R.; Pomaro, N.

    2016-01-01

    The prototype radio frequency source of the ITER heating neutral beams will be first tested in SPIDER test facility to optimize H"− production, cesium dynamics, and overall plasma characteristics. Several diagnostics will allow to fully characterise the beam in terms of uniformity and divergence and the source, besides supporting a safe and controlled operation. In particular, thermal measurements will be used for beam monitoring and system protection. SPIDER will be instrumented with mineral insulated cable thermocouples, both on the grids, on other components of the beam source, and on the rear side of the beam dump water cooled elements. This paper deals with the final design and the technical specification of the thermal sensor diagnostic for SPIDER. In particular the layout of the diagnostic, together with the sensors distribution in the different components, the cables routing and the conditioning and acquisition cubicles are described.

  19. Analysis for the brazing deformation of AFA3G spider

    International Nuclear Information System (INIS)

    Lin Feng

    2015-01-01

    Spider, the key component of the AFA3G cluster control assemblies (RCCA), is brazed with body, vanes and fingers. Vacuum brazing is crucial in the spider process and it is directly relevant to the final product quality. This paper analyze the deformation of the AFA3G spider in vacuum brazing procedure based on a large amount of data. The results indicate that the parallelism of the finger is most affected by the brazing and its deformation has obvious regularity. Deformation is mainly caused by the different contraction directions of components along with the interactions among them during cooling process. An optimized design of the brazing fixture based on the regularity and the value of the deformation greatly improves the parallelism of the fingers. Besides, the vacuum brazing procedure also affects the hole diameter of the finger, however, we could reduce the deformation by using columnar pin on the brazing fixture. (author)

  20. Spider fauna of semiarid eastern Colorado agroecosystems: diversity, abundance, and effects of crop intensification.

    Science.gov (United States)

    Kerzicnik, Lauren M; Peairs, Frank B; Cushing, Paula E; Draney, Michael L; Merrill, Scott C

    2013-02-01

    Spiders are critical predators in agroecosystems. Crop management practices can influence predator density and diversity, which, in turn, can influence pest management strategies. Crop intensification is a sustainable agricultural technique that can enhance crop production although optimizing soil moisture. To date, there is no information on how crop intensification affects natural enemy populations, particularly spiders. This study had two objectives: to characterize the abundance and diversity of spiders in eastern Colorado agroecosystems, and to test the hypothesis that spider diversity and density would be higher in wheat (Triticum aestivum L.) in crop-intensified rotations compared with wheat in conventional rotations. We collected spiders through pitfall, vacuum, and lookdown sampling from 2002 to 2007 to test these objectives. Over 11,000 spiders in 19 families from 119 species were captured from all sampling techniques. Interestingly, the hunting spider guild represented 89% of the spider fauna captured from all sites with the families Gnaphosidae and Lycosidae representing 75% of these spiders. Compared with European agroecosystems, these agroecosystems had greater diversity, which can be beneficial for the biological control of pests. Overall, spider densities were low in these semiarid cropping systems, and crop intensification effects on spider densities were not evident at this scale.

  1. Brown coal gasification made easy

    International Nuclear Information System (INIS)

    Hamilton, Chris

    2006-01-01

    Few Victorians will be aware that gas derived from coal was first used in 1849 to provide lighting in a baker's shop in Swanston Street, long before electric lighting came to the State. The first commercial 'gas works' came on stream in 1856 and Melbourne then had street lighting run on gas. By 1892 there were 50 such gas works across the State. Virtually all were fed with black coal imported from New South Wales. Brown coal was first discovered west of Melbourne in 1857, and the Latrobe Valley deposits were identified in the early 1870s. Unfortunately, such wet brown coal did not suit the gas works. Various attempts to commercialise Victorian brown coal met with mixed success as it struggled to compete with imported New South Wales black coal. In June 1924 Yallourn A transmitted the first electric power to Melbourne, and thus began the Latrobe Valley's long association with generating electric power from brown coal. Around 1950, the Metropolitan Gas Company applied for financial assistance to build a towns gas plant using imported German gasification technology which had been originally designed for a brown coal briquette feed. The State Government promptly acquired the company and formed the Gas and Fuel Corporation. The Morwell Gasification Plant was opened on 9 December 1956 and began supplying Melbourne with medium heating value towns gas

  2. An image filtering technique for SPIDER visible tomography

    Energy Technology Data Exchange (ETDEWEB)

    Fonnesu, N., E-mail: nicola.fonnesu@igi.cnr.it; Agostini, M.; Brombin, M.; Pasqualotto, R.; Serianni, G. [Consorzio RFX, Associazione EURATOM-ENEA sulla Fusione, Corso Stati Uniti 4, I-35127 Padova (Italy)

    2014-02-15

    The tomographic diagnostic developed for the beam generated in the SPIDER facility (100 keV, 50 A prototype negative ion source of ITER neutral beam injector) will characterize the two-dimensional particle density distribution of the beam. The simulations described in the paper show that instrumental noise has a large influence on the maximum achievable resolution of the diagnostic. To reduce its impact on beam pattern reconstruction, a filtering technique has been adapted and implemented in the tomography code. This technique is applied to the simulated tomographic reconstruction of the SPIDER beam, and the main results are reported.

  3. An image filtering technique for SPIDER visible tomography

    International Nuclear Information System (INIS)

    Fonnesu, N.; Agostini, M.; Brombin, M.; Pasqualotto, R.; Serianni, G.

    2014-01-01

    The tomographic diagnostic developed for the beam generated in the SPIDER facility (100 keV, 50 A prototype negative ion source of ITER neutral beam injector) will characterize the two-dimensional particle density distribution of the beam. The simulations described in the paper show that instrumental noise has a large influence on the maximum achievable resolution of the diagnostic. To reduce its impact on beam pattern reconstruction, a filtering technique has been adapted and implemented in the tomography code. This technique is applied to the simulated tomographic reconstruction of the SPIDER beam, and the main results are reported

  4. Volatile compounds from leaves of the African spider plant (Gynandropsis gynandra) with bioactivity against spider mite (Tetranychus urticae)

    DEFF Research Database (Denmark)

    Nyalala, Samuel Odeyo; Petersen, Mikael Agerlin; Grout, Brian William Wilson

    2013-01-01

    Previous studies have demonstrated that Gynandropsis gynandra emits acetonitrile as a foliar volatile from intact plants and isolated leaves, and that this compound is an effective spider mite repellent. This study has used gas chromatography–mass spectrometry to investigate volatile compounds...... emitted from homogenised G. gynandra leaves to evaluate their tissue acetonitrile content and to look for other compounds that might be exploited for the management of spider mites. Acetonitrile was absent from the homogenised tissues of five lines of G. gynandra, studied over two seasons. Thirteen...... volatile compounds were emitted by G. gynandra at significantly higher levels than mite-susceptible pot roses, including isothiocyanates, aldehydes, esters, alcohols and terpenes. Six representative compounds were selected to assess bioactivity. Spider mite populations were completely inactive after a 2¿h...

  5. Browns Ferry charcoal adsorber incident

    International Nuclear Information System (INIS)

    Mays, G.T.

    1979-01-01

    The article reviews the temperature excursion in the charcoal adsorber beds of the Browns Ferry Unit 3 off-gas system that occurred on July 17, 1977. Significant temperature increases were experienced in the charcoal adsorber beds when charcoal fines were ignited by the ignition of a combustible mixture of hydrogen and oxygen in the off-gas system. The Browns Ferry off-gas system is described, and events leading up to and surrounding the incident are discussed. The follow-up investigation by Tennessee Valley Authority and General Electric Company personnel and their recommendations for system and operational modifications are summarized

  6. variability in condensed tannins and bitterness in spider plant ...

    African Journals Online (AJOL)

    ACSS

    Spider plant (Cleome gynandra L.) contributes considerably to the nutrition and medicines of communities in southern Africa. However, its utilisation is limited by its bitterness caused by condensed tannins. Unfortunately, processing options that reduce the bitterness also remove nutritionally and medicinally useful ...

  7. Crab spiders (Araeneae: Philodromidae, Thomisidae) of Ramsey County, Minnesota.

    Science.gov (United States)

    Daniel. T. Jennings; Bruce Cutler

    1996-01-01

    Crab spiders of 2 families, 10 genera, and 35 species were collected over a 31-year period in Ramsey County, Minnesota. Rarely collected species included Philodromus keyserlingi, Xysticus pellax, X. chippewa, X. banksi and X. alboniger. Identification source(s), season and collection frequency, and biology are summarized for each species.

  8. Biological control of fruit-tree red spider mite

    NARCIS (Netherlands)

    Rabbinge, R.

    1976-01-01

    During the last decade, integrated pest control systems have been developed for several crops. One of the main fields of research in integrated control has been the control of orchard pests. Experience with modified spraying programmes in apple orchards, the increasing resistance of spider

  9. Effects of Packaging and Storage Conditions on Quality of Spider ...

    African Journals Online (AJOL)

    African Journal of Food, Agriculture, Nutrition and Development ... However, quality of spider plant seed is affected by one or more factors that cause negative ... The purpose of this research was to increase insight into how the seed quality of ...

  10. Biotechnological Trends in Spider and Scorpion Antivenom Development

    DEFF Research Database (Denmark)

    Laustsen, Andreas Hougaard; Solà, Mireia; Jappe, Emma Christine

    2016-01-01

    Spiders and scorpions are notorious for their fearful dispositions and their ability to inject venom into prey and predators, causing symptoms such as necrosis, paralysis, and excruciating pain. Information on venom composition and the toxins present in these species is growing due to an interest...

  11. Spiders (Araneae) as polyphagous natural enemies in orchards

    NARCIS (Netherlands)

    Bogya, S.

    1999-01-01

    Spiders (Araneae) occur in high abundance in all terrestrial ecosystems including agro-ecosystems. They are a very heterogeneous group of animals with different hunting tactics and therefore they play very different ecological roles. At family level these tactics are rather similar thus

  12. Competition between introduced and native spiders (Araneae: Linyphiidae)

    Science.gov (United States)

    Houser, J.D.; Ginsberg, Howard S.; Jakob, Elizabeth M.

    2014-01-01

    The European sheet-web spider Linyphia triangularis (Araneae: Linyphiidae) has become established in Maine, where it often reaches very high densities. Two lines of evidence from previous work suggest that L. triangularis affects populations of the native linyphiid spider Frontinella communis. First, F. communis individuals are relatively scarce in both forest and coastal habitat where L. triangularis is common, but more common where L. triangularis is at low density. Second, in field experiments, F. communis species are less likely to settle in experimental plots when L. triangularis is present, and F. communis disappears from study plots when L. triangularis is introduced. Here we test two mechanisms that may underlie these patterns. First, we tested whether L. triangularis invades and usurps the webs of F. communis. When spiders were released onto webs of heterospecifics, L. triangularis was more likely to take over or share webs of F. communis than the reverse. We also observed natural takeovers of F. communis webs. Second, we explored the hypothesis that L. triangularis reduces prey availability for native species. We sampled flying prey in areas with L. triangularis and those where it had been removed, and found no effect of spider presence on measured prey density. We also found no effect of prey supplementation on web tenacity in F. communis, suggesting that F. communis movements are not highly dependent on prey availability. We conclude that web takeover is likely more important than prey reduction in driving negative effects of L. triangularis on F. communis.

  13. Determination of PCDDs in spider webs: preliminary studies

    Science.gov (United States)

    Rybak, Justyna; Rutkowski, Radosław

    2018-01-01

    The application of spider webs for determination of polichlorinated dibenzo-para-dioxins (PCDDs) has been studied for the first time. The aim of the studies was to find out if spider webs are suitable for such examinations as it was proved in the previous research they are excellent indicators of air pollutants. Spiders are ubiquitous, thus collection of samples is easy and non-invasive. Studies were conducted within the city of Wrocław and surroundings, one of the biggest and at the same time heaviest polluted city in Poland. Five research sites have been chosen, where spider webs were collected after 60 days of continuous exposure time. Webs belonging to two genera Tegenaria sylvestris and Tegenaria ferruginea (family Agelenidae) have been chosen as they are large and very dense, thus they are very suitable for such examinations. Webs were found to retain dioxins probably mainly by external exposure. These promising results should be continued and expanded in the future research.

  14. The ITER Neutral Beam Test Facility towards SPIDER operation

    Science.gov (United States)

    Toigo, V.; Dal Bello, S.; Gaio, E.; Luchetta, A.; Pasqualotto, R.; Zaccaria, P.; Bigi, M.; Chitarin, G.; Marcuzzi, D.; Pomaro, N.; Serianni, G.; Agostinetti, P.; Agostini, M.; Antoni, V.; Aprile, D.; Baltador, C.; Barbisan, M.; Battistella, M.; Boldrin, M.; Brombin, M.; Dalla Palma, M.; De Lorenzi, A.; Delogu, R.; De Muri, M.; Fellin, F.; Ferro, A.; Gambetta, G.; Grando, L.; Jain, P.; Maistrello, A.; Manduchi, G.; Marconato, N.; Pavei, M.; Peruzzo, S.; Pilan, N.; Pimazzoni, A.; Piovan, R.; Recchia, M.; Rizzolo, A.; Sartori, E.; Siragusa, M.; Spada, E.; Spagnolo, S.; Spolaore, M.; Taliercio, C.; Valente, M.; Veltri, P.; Zamengo, A.; Zaniol, B.; Zanotto, L.; Zaupa, M.; Boilson, D.; Graceffa, J.; Svensson, L.; Schunke, B.; Decamps, H.; Urbani, M.; Kushwah, M.; Chareyre, J.; Singh, M.; Bonicelli, T.; Agarici, G.; Garbuglia, A.; Masiello, A.; Paolucci, F.; Simon, M.; Bailly-Maitre, L.; Bragulat, E.; Gomez, G.; Gutierrez, D.; Mico, G.; Moreno, J.-F.; Pilard, V.; Chakraborty, A.; Baruah, U.; Rotti, C.; Patel, H.; Nagaraju, M. V.; Singh, N. P.; Patel, A.; Dhola, H.; Raval, B.; Fantz, U.; Fröschle, M.; Heinemann, B.; Kraus, W.; Nocentini, R.; Riedl, R.; Schiesko, L.; Wimmer, C.; Wünderlich, D.; Cavenago, M.; Croci, G.; Gorini, G.; Rebai, M.; Muraro, A.; Tardocchi, M.; Hemsworth, R.

    2017-08-01

    SPIDER is one of two projects of the ITER Neutral Beam Test Facility under construction in Padova, Italy, at the Consorzio RFX premises. It will have a 100 keV beam source with a full-size prototype of the radiofrequency ion source for the ITER neutral beam injector (NBI) and also, similar to the ITER diagnostic neutral beam, it is designed to operate with a pulse length of up to 3600 s, featuring an ITER-like magnetic filter field configuration (for high extraction of negative ions) and caesium oven (for high production of negative ions) layout as well as a wide set of diagnostics. These features will allow a reproduction of the ion source operation in ITER, which cannot be done in any other existing test facility. SPIDER realization is well advanced and the first operation is expected at the beginning of 2018, with the mission of achieving the ITER heating and diagnostic NBI ion source requirements and of improving its performance in terms of reliability and availability. This paper mainly focuses on the preparation of the first SPIDER operations—integration and testing of SPIDER components, completion and implementation of diagnostics and control and formulation of operation and research plan, based on a staged strategy.

  15. Remote monitoring of vibrational information in spider webs

    Science.gov (United States)

    Mortimer, B.; Soler, A.; Siviour, C. R.; Vollrath, F.

    2018-06-01

    Spiders are fascinating model species to study information-acquisition strategies, with the web acting as an extension of the animal's body. Here, we compare the strategies of two orb-weaving spiders that acquire information through vibrations transmitted and filtered in the web. Whereas Araneus diadematus monitors web vibration directly on the web, Zygiella x-notata uses a signal thread to remotely monitor web vibration from a retreat, which gives added protection. We assess the implications of these two information-acquisition strategies on the quality of vibration information transfer, using laser Doppler vibrometry to measure vibrations of real webs and finite element analysis in computer models of webs. We observed that the signal thread imposed no biologically relevant time penalty for vibration propagation. However, loss of energy (attenuation) was a cost associated with remote monitoring via a signal thread. The findings have implications for the biological use of vibrations by spiders, including the mechanisms to locate and discriminate between vibration sources. We show that orb-weaver spiders are fascinating examples of organisms that modify their physical environment to shape their information-acquisition strategy.

  16. Multiple origins of subsociality in crab spiders (Thomisidae).

    Science.gov (United States)

    Ruch, Jasmin; Riehl, Torben; May-Collado, Laura J; Agnarsson, Ingi

    2015-01-01

    Determining factors that facilitate the transition from a solitary to a social lifestyle is a major challenge in evolutionary biology, especially in taxa that are usually aggressive towards conspecifics. Most spiders live solitarily and few species are known to be social. Nevertheless, sociality has evolved multiple times across several families and nearly all studied social lineages have originated from a periodically social (subsocial) ancestor. Group-living crab spiders (Thomisidae) are exclusively found in Australia and differ from most other social spiders because they lack a communal capture web. Three of the group-living species were placed in the genus Diaea and another in the genus Xysticus. Most Australian thomisids are, however, difficult to identify as most descriptions are old and of poor quality, and the genera Diaea and Xysticus may not correspond to monophyletic groups. Here, we clarify the phylogenetic relationships of the four group-living Australian thomisids and conclude that amongst these subsociality has evolved two to three times independently. The subsocial Xysticus bimaculatus is not closely related to any of the social Diaea and an independent origin of subsociality is likely in this case. The presented data indicates that within Diaea two origins of subsociality are possible. Our results help to understand the evolution of sociality in thomisids and support the hypothesis that permanent sociality in spiders has evolved multiple times relatively recently from subsocial ancestors. Copyright © 2014 Elsevier Inc. All rights reserved.

  17. Preservice Teachers' Conceptions about Animals and Particularly about Spiders

    Science.gov (United States)

    Jambrina, Carmen Urones; Vacas, Jose Manuel; Sanchez-Barbudo, Miguel

    2010-01-01

    Introduction: This article explores the scientific ideas and alternative conceptions that pre-service teachers have regarding animal classification and spiders in particular. Method: The study involved 40 pre-service teachers of elementary education in Spain and the data was collected by means of questionnaires, descriptions and drawings. The…

  18. Untangling the web...spiders in Arizona fields

    Science.gov (United States)

    Many kinds of arthropod natural enemies (predators and parasitoids) inhabit crop fields in Arizona and can have a large negative impact on several pest insect species that also infest these crops. Many different species of spiders are common in cotton, alfalfa and other crops in Arizona. Among the ...

  19. The sejugal furrow in camel spiders and acariform mites

    Directory of Open Access Journals (Sweden)

    Dunlop, Jason A.

    2012-07-01

    Full Text Available Camel spiders (Arachnida: Solifugae are one of the arachnid groups characterised by a prosomal dorsal shield composed of three distinct elements: the pro-, meso- and metapeltidium. These are associated respectively with prosomal appendages one to four, five, and six. What is less well known, although noted in the historical literature, is that the coxae of the 4th and 5th prosomal segments (i.e. walking legs 2 and 3 of camel spiders are also separated ventrally by a distinct membranous region, which is absent between the coxae of the other legs. We suggest that this essentially ventral division of the prosoma specifically between coxae 2 and 3 is homologous with the so-called sejugal furrow (the sejugal interval sensu van der Hammen. This division constitutes a fundamental part of the body plan in acariform mites (Arachnida: Acariformes. If homologous, this sejugal furrow could represent a further potential synapomorphy for (Solifugae + Acariformes; a relationship with increasing morphological and molecular support. Alternatively, outgroup comparison with sea spiders (Pycnogonida and certain early Palaeozoic fossils could imply that the sejugal furrow defines an older tagma, derived from a more basal grade of organisation. In this scenario the (still divided prosoma of acariform mites and camel spiders would be plesiomorphic. This interpretation challenges the textbook arachnid character of a peltidium (or ‘carapace’ covering an undivided prosoma.

  20. Taxonomic revision of the spider family Penestomidae (Araneae, Entelegynae)

    NARCIS (Netherlands)

    Miller, J.A.; Griswold, C.E.; Haddad, C.R.

    2010-01-01

    Conflicting character evidence and a scarcity of male specimens has historically made placement of the spider subfamily Penestominae Simon problematic. The Penestominae was recently removed from the family Eresidae and promoted to family rank based on the results of a molecular phylogenetic study; a

  1. SPIDER OPTIMIZATION. II. OPTICAL, MAGNETIC, AND FOREGROUND EFFECTS

    International Nuclear Information System (INIS)

    O'Dea, D. T.; Clark, C. N.; Contaldi, C. R.; Ade, P. A. R.; Amiri, M.; Burger, B.; Davis, G.; Benton, S. J.; Bock, J. J.; Crill, B. P.; Dore, O.; Filippini, J. P.; Bond, J. R.; Farhang, M.; Bonetti, J. A.; Bryan, S.; Chiang, H. C.; Fraisse, A. A.; Fissel, L. M.; Gandilo, N. N.

    2011-01-01

    SPIDER is a balloon-borne instrument designed to map the polarization of the cosmic microwave background (CMB) with degree-scale resolution over a large fraction of the sky. SPIDER's main goal is to measure the amplitude of primordial gravitational waves through their imprint on the polarization of the CMB if the tensor-to-scalar ratio, r, is greater than 0.03. To achieve this goal, instrumental systematic errors must be controlled with unprecedented accuracy. Here, we build on previous work to use simulations of SPIDER observations to examine the impact of several systematic effects that have been characterized through testing and modeling of various instrument components. In particular, we investigate the impact of the non-ideal spectral response of the half-wave plates, coupling between focal-plane components and Earth's magnetic field, and beam mismatches and asymmetries. We also present a model of diffuse polarized foreground emission based on a three-dimensional model of the Galactic magnetic field and dust, and study the interaction of this foreground emission with our observation strategy and instrumental effects. We find that the expected level of foreground and systematic contamination is sufficiently low for SPIDER to achieve its science goals.

  2. Czech Republic – the type material of spiders (Araneae)

    Czech Academy of Sciences Publication Activity Database

    Růžička, Vlastimil; Kůrka, A.; Buchar, J.; Řezáč, M.

    2005-01-01

    Roč. 174, 1-4 (2005), s. 13-64 ISSN 0139-9543 R&D Projects: GA AV ČR(CZ) IAA6007401 Institutional research plan: CEZ:AV0Z50070508 Keywords : spider s * type material * Czech Republic Subject RIV: EG - Zoology

  3. On the Colours of Spider Orb-Webs

    Science.gov (United States)

    Suhr, Wilfried; Schlichting, H. Joachim

    2011-01-01

    A sticky capture thread from the spiral element of spider orb-webs is formed of almost regularly spaced droplets that surround a supporting axial fibre. From the perspective of physical optics it represents a periodic linear array of scattering elements that acts as a diffraction grating. This is a novel aspect, which is of vital importance for…

  4. Central European habitats inhabited by spiders with disjunctive distributions

    Czech Academy of Sciences Publication Activity Database

    Růžička, Vlastimil

    2011-01-01

    Roč. 59, č. 2 (2011), s. 367-380 ISSN 1505-2249 Institutional research plan: CEZ:AV0Z50070508 Keywords : spider s * glacial relicts * boreomontane species Subject RIV: EH - Ecology, Behaviour Impact factor: 0.506, year: 2011

  5. Ballooning behavior in the golden orbweb spider Nephilapilipes (Araneae: Nephilidae

    Directory of Open Access Journals (Sweden)

    Vanessa M.J. Lee

    2015-01-01

    Full Text Available Ballooning, a mode of aerial dispersal in spiders, is an innate behavior that requires appropriate physiological and meteorological conditions. Although only rarely reported in the golden orbweb spiders, family Nephilidae, the large geographic distributions of most nephilids—in particular of Nephila species—would imply that these spiders likely routinely disperse by ballooning in spite of giant female sizes. Here we study ballooning behavior in the golden orbweb spider Nephila pilipes (Fabricius, 1793. Specifically, we test for the propensity of spiderlings to deploy ballooning as a dispersal mechanism. We subjected a total of 59 first-instar spiderlings to a wind experiment at two wind speeds (2.17 ± 0.02 m s-1 and 3.17 ± 0.02 m s-1 under laboratory conditions. Under an average wind speed of 3.17 m s-1, none of the spiderlings exhibited pre-ballooning or ballooning behavior. However, at an average wind speed of 2.17 m s-1, 53 (89.8% spiderlings showed pre-ballooning behavior, and 17 (32.1% of the pre-ballooners ultimately ballooned. Our results concur with prior reports on spiderlings of other families that pre-ballooning behavior is a requirement for ballooning to occur. Furthermore, although we cannot rule out other dispersal mechanisms such as synanthropic spread, our findings suggest that the widespread N. pilipes uses ballooning to colonize remote oceanic islands.

  6. Mating duration and sperm precedence in the spider Linyphia triangularis

    DEFF Research Database (Denmark)

    Weldingh, Ditte L.; Toft, Søren; Larsen, Ole Næsbye

    2011-01-01

    , especially the males, are able to influence the outcome of mating for their own benefit. We studied the linyphiid spider Linyphia triangularis in which mating follows a strict sequence during which the male inducts two droplets of sperm and transfers them to the female. We performed sperm competition...

  7. Spider diversity in coffee agroecosystems: the influence of agricultural intensification and aggressive ants.

    Science.gov (United States)

    Marín, Linda; Perfecto, Ivette

    2013-04-01

    Spiders are a very diverse group of invertebrate predators found in agroecosystems and natural systems. However, spider distribution, abundance, and eventually their ecological function in ecosystems can be influenced by abiotic and biotic factors such as agricultural intensification and dominant ants. Here we explore the influence of both agricultural intensification and the dominant arboreal ant Azteca instabilis on the spider community in coffee agroecosystems in southern Mexico. To measure the influence of the arboreal ant Azteca instabilis (F. Smith) on the spider community inhabiting the coffee layer of coffee agroecosystems, spiders were collected from coffee plants that were and were not patrolled by the ant in sites differing in agricultural intensification. For 2008, generalized linear mixed models showed that spider diversity was affected positively by agricultural intensification but not by the ant. However, results suggested that some spider species were associated with A. instabilis. Therefore, in 2009 we concentrated our research on the effect of A. instabilis on spider diversity and composition. For 2009, generalized linear mixed models show that spider richness and abundance per plant were significantly higher in the presence of A. instabilis. In addition, analyses of visual counts of insects and sticky traps data show that more resources were present in plants patrolled by the ant. The positive effect of A. instabilis on spiders seems to be caused by at least two mechanisms: high abundance of insects and protection against predators.

  8. Characteristics of the first recorded spider (Arthropoda: Arachnida fauna from Sheringal, Khyber Pakhtunkhwa, Pakistan

    Directory of Open Access Journals (Sweden)

    Farzana Khan Perveen

    2015-12-01

    Full Text Available The spiders (order: Aranae are an important environmental indicator and play a significant role as predators in biological control of the most of the key insect pests. The present study was conducted to establish the characteristics of the first recorded spider fauna from Sheringal, Dir Upper (DU, Khyber Pakhtunkhwa (KP, Pakistan during June 2013-July 2014. Their 10 species belong to 7 families, and 10 genera (nt=123: total; ni=77: identified; nui=46: unidentified were recorded in the 6 quadrates, i.e., Daramdala, Doki, Guryaal, Samang, Shahoor and Sia-Sheringal of Sheringal. The largest family was Lycosidae (wolf spiders with respect to size and numbers of specimens collected (n=20, which contained Arctosa littorali Simon, 1897; Hippasa partita Takidar, 1970; Pardosa distincta Backwall, 1867, while the smallest family was Gnphosidae (ground spiders (n=3 with Gnaphosa eucalyptus Ghafoor and Beg, 2002; while other families Sparassidae (huntsman spiders (n=19 Halconia insignis Thorell, 1836, and Isopeda tuhogniga Barrion and Litsinger, 1995, Opilionidae (harvestmen spiders (n=12 Hadrobunus grandis Sundevall, 1833; Pholcidae (cellar spider (n=10 have Crossopriza lyoni Blackwall, 1867; Hersiliidae (two-tailed spiders (n=6 is having Harsilia savignyi Lucas, 1836; (n=5 with Araneus diadematus Clerck, 1757 were recorded. It was concluded that 50% of the spiders collected from the study area were venomous. A detail study is required for further exploration of spider fauna of Sheringal, KP, Pakistan with special reference to their taxonomical, physiological and ecological characteristics.

  9. Agaricus bisporus browning: a review

    NARCIS (Netherlands)

    Jolivet, S.; Arpin, N.; Wichers, H.J.; Pellon, G.

    1998-01-01

    Agaricus bisporus browning is a common and economically detrimental phenomenon, in which melanogenic phenols are enzymically processed into quinones, which evolve eventually to melanins. This review deals with the two fundamental sides of this process, enzyme(s) and phenolic substrates. Mushroom

  10. Cleanup at Browns Ferry 3

    International Nuclear Information System (INIS)

    Mitchell, Brad; Janvrin, R.W.

    1995-01-01

    When major work had to be done in the drywell of Browns Ferry 3, the utility, Tennessee Valley Authority (TVA), decided that it made sense to make it ''street clothes clean'' for workers. This not only made work easier, it saved time and millions of dollars. (author)

  11. 7 CFR 29.2254 - Brown colors.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 2 2010-01-01 2010-01-01 false Brown colors. 29.2254 Section 29.2254 Agriculture Regulations of the Department of Agriculture AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing... colors. A group of colors ranging from a reddish brown to yellowish brown. These colors vary from low to...

  12. The brown dwarf kinematics project

    Science.gov (United States)

    Faherty, Jackie K.

    2010-10-01

    Brown dwarfs are a recent addition to the plethora of objects studied in Astronomy. With theoretical masses between 13 and 75 MJupiter , they lack sustained stable Hydrogen burning so they never join the stellar main sequence. They have physical properties similar to both planets and low-mass stars so studies of their population inform on both. The distances and kinematics of brown dwarfs provide key statistical constraints on their ages, moving group membership, absolute brightnesses, evolutionary trends, and multiplicity. Yet, until my thesis, fundamental measurements of parallax and proper motion were made for only a relatively small fraction of the known population. To address this deficiency, I initiated the Brown Dwarf Kinematics (BDKP). Over the past four years I have re-imaged the majority of spectroscopically confirmed field brown dwarfs (or ultracool dwarfs---UCDs) and created the largest proper motion catalog for ultracool dwarfs to date. Using new astrometric information I examined population characteristics such as ages calculated from velocity dispersions and correlations between kinematics and colors. Using proper motions, I identified several new wide co-moving companions and investigated binding energy (and hence formation) limitations as well as the frequency of hierarchical companions. Concurrently over the past four years I have been conducting a parallax survey of 84 UCDs including those showing spectral signatures of youth, metal-poor brown dwarfs, and those within 20 pc of the Sun. Using absolute magnitude relations in J,H, and K, I identified overluminous binary candidates and investigated known flux-reversal binaries. Using current evolutionary models, I compared the MK vs J-K color magnitude diagram to model predictions and found that the low-surface gravity dwarfs are significantly red-ward and underluminous of predictions and a handful of late-type T dwarfs may require thicker clouds to account for their scatter.

  13. Synthetic Spider Silk Production on a Laboratory Scale

    Science.gov (United States)

    Hsia, Yang; Gnesa, Eric; Pacheco, Ryan; Kohler, Kristin; Jeffery, Felicia; Vierra, Craig

    2012-01-01

    As society progresses and resources become scarcer, it is becoming increasingly important to cultivate new technologies that engineer next generation biomaterials with high performance properties. The development of these new structural materials must be rapid, cost-efficient and involve processing methodologies and products that are environmentally friendly and sustainable. Spiders spin a multitude of different fiber types with diverse mechanical properties, offering a rich source of next generation engineering materials for biomimicry that rival the best manmade and natural materials. Since the collection of large quantities of natural spider silk is impractical, synthetic silk production has the ability to provide scientists with access to an unlimited supply of threads. Therefore, if the spinning process can be streamlined and perfected, artificial spider fibers have the potential use for a broad range of applications ranging from body armor, surgical sutures, ropes and cables, tires, strings for musical instruments, and composites for aviation and aerospace technology. In order to advance the synthetic silk production process and to yield fibers that display low variance in their material properties from spin to spin, we developed a wet-spinning protocol that integrates expression of recombinant spider silk proteins in bacteria, purification and concentration of the proteins, followed by fiber extrusion and a mechanical post-spin treatment. This is the first visual representation that reveals a step-by-step process to spin and analyze artificial silk fibers on a laboratory scale. It also provides details to minimize the introduction of variability among fibers spun from the same spinning dope. Collectively, these methods will propel the process of artificial silk production, leading to higher quality fibers that surpass natural spider silks. PMID:22847722

  14. Global patterns of guild composition and functional diversity of spiders.

    Directory of Open Access Journals (Sweden)

    Pedro Cardoso

    Full Text Available The objectives of this work are: (1 to define spider guilds for all extant families worldwide; (2 test if guilds defined at family level are good surrogates of species guilds; (3 compare the taxonomic and guild composition of spider assemblages from different parts of the world; (4 compare the taxonomic and functional diversity of spider assemblages and; (5 relate functional diversity with habitat structure. Data on foraging strategy, prey range, vertical stratification and circadian activity was collected for 108 families. Spider guilds were defined by hierarchical clustering. We searched for inconsistencies between family guild placement and the known guild of each species. Richness and abundance per guild before and after correcting guild placement were compared, as were the proportions of each guild and family between all possible pairs of sites. Functional diversity per site was calculated based on hierarchical clustering. Eight guilds were discriminated: (1 sensing, (2 sheet, (3 space, and (4 orb web weavers; (5 specialists; (6 ambush, (7 ground, and (8 other hunters. Sixteen percent of the species richness corresponding to 11% of all captured individuals was incorrectly attributed to a guild by family surrogacy; however, the correlation of uncorrected vs. corrected guilds was invariably high. The correlation of guild richness or abundances was generally higher than the correlation of family richness or abundances. Functional diversity was not always higher in the tropics than in temperate regions. Families may potentially serve as ecological surrogates for species. Different families may present similar roles in the ecosystems, with replacement of some taxa by other within the same guild. Spiders in tropical regions seem to have higher redundancy of functional roles and/or finer resource partitioning than in temperate regions. Although species and family diversity were higher in the tropics, functional diversity seems to be also

  15. SPIDERS (ARANEI OF THE REPUBLIC OF SOUTH OSSETIA

    Directory of Open Access Journals (Sweden)

    Alexander V. Ponomarev

    2015-01-01

    Full Text Available Aim. Until recently, spider fauna of the Republic of South Ossetia has been the least studied among the regional araneofaunas of the Caucasus. According to the literature data, as little as 30 spider species have been known from the republic’s territory (Mkheidze, 1997, Mikhailov, 1990; Ponomarev, Dvadnenko, 2013; Trilicauscas, Komarov, 2014. Therefore, the aim of the present article is to summarize available data on the spider fauna of South Ossetia.Location. Republic of South Ossetia.Methods. The material was collected in various districts of South Ossetia in 2011-2014 by Yu.E. Komarov. Mainly, the collecting was performed in the city of Tskhinvali and its environs, and in the South Ossetian State Reserve. Spiders were sampled with pitfall traps and sweep netting. The time of traps’ exposure is April–December.Results and main conclusions. To date, the spider fauna of the Republic of South Ossetia includes 230 species from 29 families. 222 species were registered by the authors, eight species (Clubiona pseudosimilis, Gnaphosa lugubris, Linyphia hortensis, Neriene peltata, Geolycosa vultuosa, Pardosa azerifalcata, Ero aphana, and Philodromus rufus are known from the literature only. Seven species are new to the Caucasus (Clubiona pseudosimilis, Gnaphosa lugubris, Linyphia hortensis, Neriene peltata, Geolycosa vultuosa, Pardosa azerifalcata, Ero aphana, and Philodromus rufus. Of these, two species were known earlier only from Turkey (Pardosa consimilis, Ozyptila spirembolus, and one species (Tegenaria pseudolyncea only from Azerbaijan. Against the background of the widespread species predominance, the Caucasian element is small and presented by twelve species (Tegenaria pseudolyncea, Dysdera tkibuliensis, Haplodrassus caucasius, Zelotes khostensis, Mansuphantes ovalis, Sintula oseticus, Tenuiphantes teberdaensis, Pardosa azerifalcata, P. caucasica, Piratula hurkai, Trochosa cachetiensis, and Xysticus ukrainicus.

  16. Physical model of a floating trash boom to control aquatic weeds at the TVA Widows Creek Fossil Plant

    International Nuclear Information System (INIS)

    Hopping, P.N.

    1991-01-01

    This paper reports that the Tennessee Valley Authority (TVA) Widows Creek Fossil plant seasonally encounters adverse accumulations of aquatic weeds at the intakes of the condenser cooling water pumps. To reduce the accumulations, a floating trash boom has been proposed for the intakes. To evaluate the hydraulic feasibility of a boom, a physical model of the intakes has been built at the TVA Engineering Laboratory. The model was used to determine the boom alignment and depth of skimming needed to successfully deflect weeds away from the intakes and provide self-cleaning

  17. Competitive interactions between a native spider (Frontinella communis, Araneae: Linyphiidae) and an invasive spider (Linyphia triangularis, Araneae: Linyphiidae)

    Science.gov (United States)

    Bednarski, Julie V.; Ginsberg, Howard S.; Jakob, Elizabeth M.

    2010-01-01

    There are numerous reports of spiders that have become established outside of their native ranges, but few studies examine their impact on native spiders. We examined the effect of the European hammock spider Linyphia triangularis (Araneae, Linyphiidae) on the native bowl-and-doily spider Frontinella communis (Araneae, Linyphiidae) in Acadia National Park, Maine, USA. First, we added L. triangularis to established plots of F. communis. Significantly more F. communis abandoned their webs when L. triangularis were added compared to control plots. Second, we tested whether F. communis were deterred from building webs in areas where L. triangularis was established. Significantly fewer F. communis built webs on plots with L. triangularis than on control plots. In both experiments, L. triangularis sometimes took over webs of F. communis or incorporated F. communis webs into their own webs, but F. communisnever took over or incorporated L. triangularis webs. Competition between L. triangularis and F. communis for both webs and web sites may contribute to the decline of F. communis.

  18. Invited review current progress and limitations of spider silk for biomedical applications.

    Science.gov (United States)

    Widhe, Mona; Johansson, Jan; Hedhammar, My; Rising, Anna

    2012-06-01

    Spider silk is a fascinating material combining remarkable mechanical properties with low density and biodegradability. Because of these properties and historical descriptions of medical applications, spider silk has been proposed to be the ideal biomaterial. However, overcoming the obstacles to produce spider silk in sufficient quantities and in a manner that meets regulatory demands has proven to be a difficult task. Also, there are relatively few studies of spider silk in biomedical applications available, and the methods and materials used vary a lot. Herein we summarize cell culture- and in vivo implantation studies of natural and synthetic spider silk, and also review the current status and future challenges in the quest for a large scale production of spider silk for medical applications. Copyright © 2011 Wiley Periodicals, Inc.

  19. Research on Artificial Spider Web Model for Farmland Wireless Sensor Network

    Directory of Open Access Journals (Sweden)

    Jun Wang

    2018-01-01

    Full Text Available Through systematic analysis of the structural characteristics and invulnerability of spider web, this paper explores the possibility of combining the advantages of spider web such as network robustness and invulnerability with farmland wireless sensor network. A universally applicable definition and mathematical model of artificial spider web structure are established. The comparison between artificial spider web and traditional networks is discussed in detail. The simulation result shows that the networking structure of artificial spider web is better than that of traditional networks in terms of improving the overall reliability and invulnerability of communication system. A comprehensive study on the advantage characteristics of spider web has important theoretical and practical significance for promoting the invulnerability research of farmland wireless sensor network.

  20. How informative are case studies of spider bites in the medical literature?

    Science.gov (United States)

    Stuber, Marielle; Nentwig, Wolfgang

    2016-05-01

    We analyzed the reliability and information content of 134 medical case studies on spider bites, published in 91 journal articles. Overall, we found that only 22% of these studies fulfilled the criteria for a verified spider bite. This means that the majority of such case studies cannot be attributed to a given spider species and usually not even to a spider. Their scientific value is negligible, moreover, such publications are even dangerous because they suggest incorrect conclusions. Secondly, we found that such case studies usually do not follow an obvious structure and many details on the development of symptoms, therapy and healing process are widely lacking. So even for verified spider bites, the comparability of case studies is limited. We discuss the obvious failure of a reviewing process for case studies and give recommendations how to increase the currently low information content of medical case studies on spider bites. Copyright © 2016 Elsevier Ltd. All rights reserved.

  1. Plastic material investment in load-bearing silk attachments in spiders.

    Science.gov (United States)

    Wolff, Jonas O; Jones, Braxton; Herberstein, Marie E

    2018-05-17

    The nature and size of attachments is a fundamental element of animal constructions. Presumably, these adhesive structures are plastically deployed to balance material investment and attachment strength. Here we studied plasticity in dragline anchorages of the golden orb web spider, Nephila plumipes. Specifically, we predict that spiders adjust the size and structure of dragline anchorages with load, i.e. spider mass. Mass was manipulated by attaching lead pieces to the spider's abdomen resulting in a 50 percent increase in mass. Loaded spiders spun larger but structurally similar thread anchorages than unloaded spiders. Thus, the spinning program that determines the overall anchor structure is highly stereotypic, and flexibility is introduced through varying the anchor size by increasing material investment. Our study showcases substrate attachments as suitable models to investigate the interplay between innate and changeable elements in the economy of building behaviours. Copyright © 2018 Elsevier GmbH. All rights reserved.

  2. Rapid visuomotor processing of phobic images in spider- and snake-fearful participants.

    Science.gov (United States)

    Haberkamp, Anke; Schmidt, Filipp; Schmidt, Thomas

    2013-10-01

    This study investigates enhanced visuomotor processing of phobic compared to fear-relevant and neutral stimuli. We used a response priming design to measure rapid, automatic motor activation by natural images (spiders, snakes, mushrooms, and flowers) in spider-fearful, snake-fearful, and control participants. We found strong priming effects in all tasks and conditions; however, results showed marked differences between groups. Most importantly, in the group of spider-fearful individuals, spider pictures had a strong and specific influence on even the fastest motor responses: Phobic primes entailed the largest priming effects, and phobic targets accelerated responses, both effects indicating speeded response activation by phobic images. In snake-fearful participants, this processing enhancement for phobic material was less pronounced and extended to both snake and spider images. We conclude that spider phobia leads to enhanced processing capacity for phobic images. We argue that this is enabled by long-term perceptual learning processes. © 2013.

  3. Evolutionary morphology of the hemolymph vascular system of basal araneomorph spiders (Araneae: Araneomorphae).

    Science.gov (United States)

    Huckstorf, Katarina; Michalik, Peter; Ramírez, Martín; Wirkner, Christian S

    2015-11-01

    The superfamily Austrochiloidea (Austrochilidae and Gradungulidae) take a pivotal position in araneomorph spider phylogeny. In this discussion crevice weaver spiders (Filistatidae) are of equal interest. Especially data from these phylogenetically uncertain yet basal off branching groups can enlighten our understanding on the evolution of organ systems. In the course of a survey on the evolutionary morphology of the circulatory system in spiders we therefore investigated the hemolymph vascular system in two austrochiloid and one filistatid species. Additionally some data on a hypochilid and a gradungulid species are included. Using up-to-date morphological methods, the vascular systems in these spiders are visualized three dimensionally. Ground pattern features of the circulatory systems in austrochiloid spiders are presented and the data discussed along recent lines of phylogenetic hypotheses. Special topics highlighted are the intraspecific variability of the origins of some prosomal arteries and the evolutionary correlation of respiratory and circulatory systems in spiders. Copyright © 2015 Elsevier Ltd. All rights reserved.

  4. Induction of direct and indirect plant responses by jasmonic acid, low spider mite densities, or a combination of jasmonic acid treatment and spider mite infestation.

    Science.gov (United States)

    Gols, Rieta; Roosjen, Mara; Dijkman, Herman; Dicke, Marcel

    2003-12-01

    Jasmonic acid (JA) and the octadecanoid pathway are involved in both induced direct and induced indirect plant responses. In this study, the herbivorous mite, Tetranychus urticae, and its predator, Phytoseiulus persimilis, were given a choice between Lima bean plants induced by JA or spider mites and uninduced control plants. Infestation densities resulting in the induction of predator attractants were much lower than thus far assumed, i.e., predatory mites were significantly attracted to plants that were infested for 2 days with only one or four spider mites per plant. Phytoseiulus persimilis showed a density-dependent response to volatiles from plants that were infested with different numbers of spider mites. Similarly, treating plants with increasing concentrations of JA also led to increased attraction of P. persimilis. Moreover, the duration of spider mite infestation was positively correlated with the proportion of predators that were attracted to mite-infested plants. A pretreatment of the plants with JA followed by a spider mite infestation enhanced the attraction of P. persimilis to plant volatiles compared to attraction to volatiles from plants that were only infested with spider mites and did not receive a pretreatment with JA. The herbivore, T. urticae preferred leaf tissue that previously had been infested with conspecifics to uninfested leaf tissue. In the case of choice tests with JA-induced and control leaf tissue, spider mites slightly preferred control leaf tissue. When spider mites were given a choice between leaf discs induced by JA and leaf discs damaged by spider mite feeding, they preferred the latter. The presence of herbivore induced chemicals and/or spider mite products enhanced settlement of the mites, whereas treatment with JA seemed to impede settlement.

  5. Novel nuances of human brown fat

    DEFF Research Database (Denmark)

    Scheele, Camilla; Larsen, Therese Juhlin; Nielsen, Søren

    2014-01-01

    the types of thermogenic adipocytes in humans. We recently published a contradictory mRNA expression signature of human supraclavicular fat defined by an upregulation of the brite marker TBX1 along with the classical brown markers ZIC1 and LHX8, as well as genes indicating brown fat activity including UCP1......, there was no difference in UCP1, PGC-1α, PRDM16, suggesting both depots had equal brown fat potency. Taken together, supraclavicular brown fat derived from adult humans seems to represent a type of brown fat with distinct features from both subcutaneous white/brite and interscapular brown fat. Therefore......There is a current debate in the literature on whether human fat derived from the supraclavicular region should be classified as brown, or as the white fat-derived less potent, brite/beige. This commentary addresses whether the existing classification defined in mice is sufficient to describe...

  6. Brown dwarfs as dark galactic halos

    International Nuclear Information System (INIS)

    Adams, F.C.; Walker, T.P.

    1990-01-01

    The possibility that the dark matter in galactic halos can consist of brown dwarf stars is considered. The radiative signature for such halos consisting solely of brown dwarfs is calculated, and the allowed range of brown dwarf masses, the initial mass function (IMF), the stellar properties, and the density distribution of the galactic halo are discussed. The prediction emission from the halo is compared with existing observations. It is found that, for any IMF of brown dwarfs below the deuterium burning limit, brown dwarf halos are consistent with observations. Brown dwarf halos cannot, however, explain the recently observed near-IR background. It is shown that future satellite missions will either detect brown dwarf halos or place tight constraints on the allowed range of the IMF. 30 refs

  7. Ontogenesis, gender, and molting influence the venom yield in the spider Coremiocnemis tropix (Araneae, Theraphosidae)

    OpenAIRE

    Herzig, Volker

    2010-01-01

    The demand for spider venom increases along with the growing popularity of venoms-based research. A deeper understanding of factors that influence the venom yield in spiders would therefore be of interest to both commercial venom suppliers and research facilities. The present study addresses the influence of several factors on the venom yield by systematically analyzing the data obtained from 1773 electrical milkings of the Australian theraphosid spider Coremiocnemis tropix. Gender and ontoge...

  8. On the predation of fly, Chrysomya rufifacies (Macquart) by a spider, Oxyopes sp. Latreille (Oxyopidae).

    Science.gov (United States)

    Heo, C C; Mohamad, A M; John, J; Baharudin, O

    2008-04-01

    During a forensic entomological study conducted in a palm oil plantation in Tg.Sepat, Selangor in September 2007, a spider (Arachnida), Oxyopes sp. (Oxyopidae) was found to predate on a calliphorid fly (Chrysomya rufifacies). The female spider laid a silk thread, or "drag line", behind it as it moved. This spider bites its prey by using a pairs of chelicerae, and injecting venom into the fly. The fly was moving its wing trying to escape, however, it succumbed to the deadly bite.

  9. Exploring of the first recorded spider (Arachenida: Aranae) species of Sheringal, Khyber Pakhtunkhwa, Pakistan

    OpenAIRE

    Farzana Perveen; Numan Khan

    2015-01-01

    The spiders (Arthropoada: Arachenida) are one of the groups of grasping animals. Their carapaces are found on the dorsal side of the cephalothorax, which is an important characteristic of spiders. The present study was conducted to explore the first recorded spider species (nti=75) of Sheringal, Dir Upper (DU), Khyber Pakhtunkhwa (KP), Dir Upper, Khyber Pakhtunkhwa, Pakistan. The 10 genera with 10 species under 7 families were recorded from June 2013-July 2014. According to length of legs, th...

  10. Cuticular bacteria appear detrimental to social spiders in mixed but not monoculture exposure

    Science.gov (United States)

    Keiser, Carl N.; Shearer, Taylor A.; DeMarco, Alexander E.; Brittingham, Hayley A.; Knutson, Karen A.; Kuo, Candice; Zhao, Katherine; Pruitt, Jonathan N.

    2016-01-01

    Abstract Much of an animal’s health status, life history, and behavior are dictated by interactions with its endogenous and exogenous bacterial communities. Unfortunately, interactions between hosts and members of their resident bacterial community are often ignored in animal behavior and behavioral ecology. Here, we aim to identify the nature of host–microbe interactions in a nonmodel organism, the African social spider Stegodyphus dumicola. We collected and identified bacteria from the cuticles of spiders in situ and then exposed spiders to bacterial monocultures cultures via topical application or injection. We also topically inoculated spiders with a concomitant “cocktail” of bacteria and measured the behavior of spiders daily for 24 days after inoculation. Lastly, we collected and identified bacteria from the cuticles of prey items in the capture webs of spiders, and then fed spiders domestic crickets which had been injected with these bacteria. We also injected 1 species of prey-borne bacteria into the hemolymph of spiders. Only Bacillus thuringiensis caused increased mortality when injected into the hemolymph of spiders, whereas no bacterial monocultures caused increased mortality when applied topically, relative to control solutions. However, a bacterial cocktail of cuticular bacteria caused weight loss and mortality when applied topically, yet did not detectibly alter spider behavior. Consuming prey injected with prey-borne bacteria was associated with an elongated lifespan in spiders. Thus, indirect evidence from multiple experiments suggests that the effects of these bacteria on spider survivorship appear contingent on their mode of colonization and whether they are applied in monoculture or within a mixed cocktail. We urge that follow-up studies should test these host–microbe interactions across different social contexts to determine the role that microbes play in colony performance. PMID:29491926

  11. Exploring of the first recorded spider (Arachenida: Aranae species of Sheringal, Khyber Pakhtunkhwa, Pakistan

    Directory of Open Access Journals (Sweden)

    Farzana Perveen

    2015-09-01

    Full Text Available The spiders (Arthropoada: Arachenida are one of the groups of grasping animals. Their carapaces are found on the dorsal side of the cephalothorax, which is an important characteristic of spiders. The present study was conducted to explore the first recorded spider species (nti=75 of Sheringal, Dir Upper (DU, Khyber Pakhtunkhwa (KP, Dir Upper, Khyber Pakhtunkhwa, Pakistan. The 10 genera with 10 species under 7 families were recorded from June 2013-July 2014. According to length of legs, the largest spider was the huntsman spider, Halconia insignis Thorell having length of the first leg was 1.9±0.20, however, the same of the last leg was 1.44±0.25 (n=9. In the same contest, the smallest spider was the ground spider, Gnaphosa eucalyptus Ghafoor and Beg having length of the first leg was 0.4±0.08, while the same of the last leg was 0.4±0.08 (n=3. According to length of cephalothorax and abdomen, the largest spider was the wolf spider, Hippasa partita Takidar having length of the cephalothorax was 1.1±0.01, however, the same of the abdomen was 0.7±0.1 (n=6. In the same contest, the smallest spider was the harvestmen, Hadrobunus grandis Sundevall having length of the cephalothorax was 0.1±0.04, while the same of the abdomen was 0.3±0.04 (n=12. During present research, 10 spider species of Sheringal with different sizes were explored. The present research will be useful to educate and create awareness about spiders in the people of Sheringal.

  12. Ecosystem services in the face of invasion: the persistence of native and nonnative spiders in an agricultural landscape.

    Science.gov (United States)

    Hogg, Brian N; Daane, Kent M

    2011-03-01

    The presence of intact natural ecosystems in agricultural landscapes can mitigate losses in the diversity of natural enemies and enhance ecosystem services. However, native natural enemies may fail to persist in agroecosystems if invaders dominate species interactions. In this study, native and nonnative spiders were sampled along transects that extended from oak woodland and riparian zones into surrounding California vineyards, to assess the role of natural habitat as a source for spider biodiversity in the vineyard landscape, and to compare the dominance of exotic Cheiracanthium spiders between habitats. Many spider species were more abundant in natural habitat than in vineyards, and numbers of spiders and spider species within vineyards were higher at the vineyard edge adjacent to oak woodland. These results suggest that natural habitat is a key source for spiders in vineyards. The positive effect of oak woodland on the vineyard spider community extended only to the vineyard edge, however. Proportions of Cheiracanthium spiders increased dramatically in the vineyard, while numbers of native wandering spiders (the native ecological homologues of Cheiracanthium spiders) decreased. Dispersal limitation and strong habitat preferences may have prevented native wandering spiders from establishing far from the vineyard edge. Exotic Cheiracanthium spiders, in contrast, may possess specific adaptations to vineyards or to a wide range of habitats. Results suggest that the ecosystem services provided by intact natural habitat may be limited in agricultural landscapes that are dominated by invasive species.

  13. Information processing biases in spider phobia: application of the Stroop and "White Noise" Paradigm.

    Science.gov (United States)

    Olatunji, Bunmi O; Sawchuk, Craig N; Lee, Thomas C; Lohr, Jeffrey M; Tolin, David F

    2008-06-01

    The present study examines attentional and implicit memory biases in spider phobic and nonphobic participants. The results showed that spider phobics demonstrated increased interference for neutral, negative, and spider-relevant words on a computerized Stroop task. However, no group differences emerged when adjusting for differences in color-naming speed. Prior exposure to a dead spider did result in higher overall Stroop interference in spider phobics and this appeared to be mostly pronounced for spider-relevant words. Implicit memory bias for threat was examined with a noise judgment task. Participants first heard neutral and spider-relevant sentences and implicit memory for these sentences was evaluated by having participants rate the volume of noise accompanying the presentation of old sentences intermixed with new sentences. An implicit memory bias is indicated if participants rate noise accompanying old sentences as less loud than noise accompanying new sentences. No evidence was found for an implicit memory bias in spider phobics. These findings are discussed in relation to the role of information processing biases in spider phobia.

  14. Biased interpretation and memory in children with varying levels of spider fear.

    Science.gov (United States)

    Klein, Anke M; Titulaer, Geraldine; Simons, Carlijn; Allart, Esther; de Gier, Erwin; Bögels, Susan M; Becker, Eni S; Rinck, Mike

    2014-01-01

    This study investigated multiple cognitive biases in children simultaneously, to investigate whether spider-fearful children display an interpretation bias, a recall bias, and source monitoring errors, and whether these biases are specific for spider-related materials. Furthermore, the independent ability of these biases to predict spider fear was investigated. A total of 121 children filled out the Spider Anxiety and Disgust Screening for Children (SADS-C), and they performed an interpretation task, a memory task, and a Behavioural Assessment Test (BAT). As expected, a specific interpretation bias was found: Spider-fearful children showed more negative interpretations of ambiguous spider-related scenarios, but not of other scenarios. We also found specific source monitoring errors: Spider-fearful children made more fear-related source monitoring errors for the spider-related scenarios, but not for the other scenarios. Only limited support was found for a recall bias. Finally, interpretation bias, recall bias, and source monitoring errors predicted unique variance components of spider fear.

  15. Body burdens of metals in spiders from the Lidice coal dump near Ostrava (Czech Republic)

    Energy Technology Data Exchange (ETDEWEB)

    Wilczek, G.; Babczynska, A.; Majkus, Z. [Silesian University, Katowice (Poland)

    2005-09-01

    Spiders' feeding behaviour and external digestion expose them to man-made pollutants, especially those easily transferred along the food chain. The problem for this study was whether the levels of heavy metals in selected species of spiders from the Lidice coal dump reflect adaptation to environmental pollutants. We used flameless and flame AAS to measure the whole-body concentrations of Cd, Pb, Cu, Zn, Fe, Ni and Mg in male and female spiders differing in their hunting strategies, type of web construction, prey, and taxonomic position (Araneidae, Agelenidae, Linyphiidae, Theridiidae, Tetragnathidae, Lycosidae, Salticidae, Pisauridae, Clubionidae, Philodromidae). The levels of metals found in the spiders were species-dependent, indicating differences related to the hunting strategy and type of prey. Accumulation of Pb, Cu and Zn was always higher in ground spiders than in web-constructing species. Sheet-web spiders Linyphia triangularis and wandering spiders Clubiona lutescens had the lowest Cd, Mg and Cu content of all the studied species. Web-building spiders of the Tetragnathidae family showed the highest Cd, Cu and Pb content, even in species with feeding behaviour similar to spiders of other families. There were no interspecific differences in accumulation only for Fe and Mg. The concentrations of Cd, Ni and Pb were lower in females than in males, irrespective of their taxonomic position and the intensity of their hunting activity. This may suggest that females have better metal-excretion ability than males.

  16. Methods of assembling and disassembling spider and burnable poison rod structures for nuclear reactors

    International Nuclear Information System (INIS)

    Edwards, G.T.; Schluderberg, D.C.

    1981-01-01

    A technique is provided for engaging and disengaging burnable poison rods from a spider in a nuclear reactor fuel assembly. A cap on the end of each of the burnable poison rods is provided with a shank or stem that is received in a respective bore formed in the spider. A frangible flange secures the shank and rod to the spider. Pressing the shank in the direction of the bore axis by means, e.g., of a plate ruptures the frangible flange to release the rod from the spider. (author)

  17. Spiders do not evoke greater early posterior negativity in the event-related potential as snakes.

    Science.gov (United States)

    He, Hongshen; Kubo, Kenta; Kawai, Nobuyuki

    2014-09-10

    It has been long believed that both snakes and spiders are archetypal fear stimuli for humans. Furthermore, snakes have been assumed as stronger threat cues for nonhuman primates. However, it is still unclear whether spiders hold a special status in human perception. The current study explored to what extent spider pictures draw early visual attention [as assessed with early posterior negativity (EPN)] when compared with insects similar to spiders. To measure the EPN, participants watched a random rapid serial presentation of pictures, which consisted of two conditions: spider condition (spider, wasp, bumblebee, beetle) and snake condition (snake, bird). EPN amplitudes revealed no significant difference between spider, wasp, bumblebee, and beetle pictures, whereas EPN amplitudes were significantly larger for snake pictures relative to bird pictures. In addition, EPN amplitudes were significantly larger for snake pictures relative to spider pictures. These results suggest that the early visual attentional capture of animate objects is stronger for snakes, whereas spiders do not appear to hold special early attentional value.

  18. Risk of spider predation alters food web structure and reduces local herbivory in the field.

    Science.gov (United States)

    Bucher, Roman; Menzel, Florian; Entling, Martin H

    2015-06-01

    Predators can indirectly enhance plant performance via herbivore suppression, with both prey consumption and changes in prey traits (e.g. changes in foraging behaviour) contributing to the reduction in herbivory. We performed a field experiment to determine the extent of such non-consumptive effects which consisted of repeatedly placing spiders (Pisaura mirabilis) on enclosed plants (Urtica dioica) for cue deposition. Control plants were enclosed in the same way but without spiders. After cue deposition, the enclosures were removed to allow arthropods to colonize the plants and feed on them. Arthropods were removed from the plants before the subsequent spider deposition or control enclosure. During six cycles of enclosure, we quantified leaf damage on the plants. After a seventh cycle, the colonizing arthropods were sampled to determine community composition in relation to the presence/absence of spider cues. We found that the presence of chemotactile spider cues reduced leaf damage by 50 %. In addition, spider cues led to changes in the arthropod community: smaller spiders avoided plants with spider cues. In contrast, the aphid-tending ant Myrmica rubra showed higher recruitment of workers on cue-bearing plants, possibly to protect aphids. Our results show that the risk of spider predation can reduce herbivory on wild plants and also demonstrate that non-consumptive effects can be particularly strong within the predator guild.

  19. Spider (Araneae) predations on white-backed planthopper Sogatella furcifera in subtropical rice ecosystems, China.

    Science.gov (United States)

    Wang, Xue-Qin; Wang, Guang-Hua; Zhu, Zeng-Rong; Tang, Qi-Yi; Hu, Yang; Qiao, Fei; Heong, Kong Luen; Cheng, Jia-An

    2017-06-01

    Spiders are effective biological control agents in rice ecosystems, but the comparative study of predations among main spider species under field conditions has not been fully explored owing to a lack of practical methodology. In this study, more than 6000 spiders of dominant species were collected from subtropical rice ecosystems to compare their predations on Sogatella furcifera (Horváth) (white-backed planthopper, WBPH) using DNA-based gut content analysis. The positive rates for all spider taxa were closely related to prey densities, as well as their behaviors and niches. The relationships of positive rates to prey planthopper densities for Pardosa pseudoannulata (Böes. et Str.), Coleosoma octomaculata (Böes. et Str.), Tetragnatha maxillosa Thorell and Ummeliata insecticeps (Böes. et Str.) under field conditions could be described using saturated response curves. Quantitative comparisons of predations among the four spider species confirmed that P. pseudoannulata and C. octomaculata were more rapacious than U. insecticeps and T. maxillosa under field conditions. A comparison of ratio of spiders to WBPH and positive rates between fields revealed that biological control by spiders could be effectively integrated with variety resistance. Generalist spiders could follow up WBPH population timely, and assemblages of spiders coupled with variety resistance could effectively suppress WBPH population. © 2016 Society of Chemical Industry. © 2016 Society of Chemical Industry.

  20. A comparison of spider communities in Bt and non-Bt rice fields.

    Science.gov (United States)

    Lee, Sue Yeon; Kim, Seung Tae; Jung, Jong Kook; Lee, Joon-Ho

    2014-06-01

    To assess the potential adverse effects of a Bt rice line (Japonica rice cultivar, Nakdong) expressing a synthetic cry1Ac1 gene, C7-1-9-1-B, which was highly active against all larval stages of Cnaphalocrocis medinalis (Guenée) (Lepidoptera: Crambidae), we investigated the community structure of spiders in Bt and non-Bt rice fields during the rice-growing season in 2007 and 2008 in Chungcheongnam-do, Korea. Spiders were surveyed with a sweep net and suction device. Suction sampling captured more spiders, measured in terms of species level and abundance, than sweeping. Araneidae and Thomisidae were captured more by sweeping, and certain species were captured only by sweeping. These findings show that both suction and sweep sampling methods should be used because these methods are most likely complementary. In total, 29 species in 23 genera and nine families were identified from the 4,937 spiders collected, and both Bt and non-Bt rice fields showed a typical Korean spider assemblage. The temporal patterns of spider species richness and spider abundance were very similar between Bt and non-Bt rice, although significant differences in species richness were observed on a few occasions. Overall, spider community structure, including diversity, the dominant species, and abundance did not differ between Bt and non-Bt rice. The results of the study indicated that the transgenic Cry1Ac rice lines tested in this study had no adverse effects on the spider community structure of the rice fields.

  1. Functional Group of Spiders in Cultivated Landscape Dominated by Paddy Fields in West Java, Indonesia

    Directory of Open Access Journals (Sweden)

    I WAYAN SUANA

    2009-03-01

    Full Text Available Distribution of spiders in all colonized environments is limited by biotic and abiotic factors requiring adaptations with respect to, for example microhabitat choice and hunting behavior. These two factors were frequently used to group spiders into functional groups. In this study our objectives were to (i group of genera of spiders into functional group based on their microhabitat specificity, hunting behavior, and daily activity; and (ii compare the number and composition of functional group of spider at each habitat type and period of paddy growth. The study was conducted at a landscape dominated by paddy fields in Cianjur Watershed for a period of 9 months. Four different habitat types (paddy, vegetable, non-crop, and mixed garden, were sampled using five trapping techniques (pitfall traps, farmcop suction, sweep netting, yellow-pan traps, and sticky traps. The Unweighted Pair-Group Average and the Euclidean Distances were used to generate dendrogram of functional group of spider. We found 14 functional groups of spider at genus level. The number of functional group of spider at four habitat types was differing, but the composition was similar, because all habitats were closed to each other. Habitat structure diversity and disturbance level influenced the number of functional group of spider. Different architecture of vegetation and availability of differ prey during paddy growth, causing the composition of functional group of spider in each period of paddy growth was changed, although its number was unchanged.

  2. Brown dwarfs and black holes

    International Nuclear Information System (INIS)

    Tarter, J.C.

    1978-01-01

    The astronomical missing-mass problem (the discrepancy between the dynamical mass estimate and the sum of individual masses in large groupings) is considered, and possible explanations are advanced. The existence of brown dwarfs (stars not massive enough to shine by nuclear burning) and black holes (extremely high density matter contraction such that gravitation allows no light emission) thus far provides the most plausible solutions

  3. Spider-mediated flux of PCBs from contaminated sediments to terrestrial ecosystems and potential risks to arachnivorous birds

    Science.gov (United States)

    We investigated aquatic insect utilization and PCB exposure in riparian spiders at the Lake Hartwell superfund site (Clemson, SC , USA). We sampled sediments, adult chironomids, terrestrial insects, riparian spiders (Tetragnathidae, Araneidae, and Mecynogea lemniscata), and upla...

  4. Battre sa (super) coulpe : Spider-Man (1962)

    OpenAIRE

    Tomasovic, Dick

    2016-01-01

    L’édification est l'une des grandes fonctions traditionnelles de la littérature de jeunesse. Spider-Man, héros populaire s'il en est, s'est révélé bien sûr l'ambassadeur de nombreuses valeurs sociétales américaines (le do it yourself, l'esprit d'entreprise et d'indépendance, la tolérance, la fidélité , la célébration du système éducationnel, la transmission et la solidarité intergénérationnelle, le sens des responsabilités, évidemment, etc.). Spider-Man se bat moins qu'il ne se débat. Il est ...

  5. A Spider That Lays Its Eggs in Rows

    Directory of Open Access Journals (Sweden)

    Robert L. Edwards

    2000-01-01

    Full Text Available The small (2.5-3.0 mm, colorful metine spider, Homalometa nigritarsis Simon 1897, Family Tetragnathidae, has previously been reported from northern Mexico, Panama and the southern islands of the Lesser Antilles (Levi 1986. In the rain forest of northeastern Puerto Rico it is most frequently found with webbing on the larger outer concave surfaces of pendulous leaves. H. nigritarsis typically makes a circular, relatively flat retreat within which the female deposits two parallel rows of naked eggs. The rows are produced at intervals; as one row hatches another replaces it shortly thereafter. Evidence of up to four generations of rows has been observed. Above the retreat, and closely aligned with it, the spider builds a nearly invisible, delicate orb web, typically from edge to edge of the leaf (Fig. 1a and b. While retaining the traditional orb-web, H. nigritarsis has adopted a unique habitat and set of life history features.

  6.  “Spiders and Webs in American Literature”

    Directory of Open Access Journals (Sweden)

    Vincent Dussol

    2012-05-01

    Full Text Available From Jonathan Edwards to Jorie Graham, spiders are strikingly present in American literature. The purpose of this article is first to show how that theme may have become something of a national tradition as very different writers, all of them careful observers of aranae, answered one another through the years. It is very likely that the attention paid to spiders by American authors was increased by those Native American myths in which spiders are a central figure. More than occasionally, on the female side of the American counter-culture, especially among its feminist and lesbian exponents, simple activists and creative writers have harnessed the symbolic power invested in the spider by Native Americans.There may be deeper reasons accounting for American authors’ fascination with spiders. The country’s phobia of disunion is one; a nation of settlers’ acute consciousness of the precariousness of its occupation of the territory is another. In demonstrating outstanding skills for adjustment to unknown places, spiders epitomize a form of identity permanence. The predominantly positive character of spider symbols in American literature will occasionally be inverted. Following the national logic of checks and balances, any web covering the whole of the United States will tend to come under suspicion.This study ends with an inventory of cultural productions linked with spiders and webs and whose Americanness is yet to be clearly determined.De Jonathan Edwards à Jorie Graham, l’araignée apparaît dans un nombre frappant de textes littéraires américains. On a d’abord voulu tenter de montrer comment a pu se construire cette tradition thématique et faire la preuve que différents écrivains, réunis par un souci de l’observation, se sont répondus à travers elle. L’attention prêtée à l’araignée s’est certainement trouvée renforcée par les récits mythologiques des peuples premiers américains qui font de l’araignée une

  7. Gravity Reception and Cardiac Function in the Spider

    Science.gov (United States)

    Finck, A.

    1985-01-01

    The following features of the arachnid gravity system were studied. (1) the absolute threshold to hyper-gz is quite low indicating fine proprioreceptive properties of the lyriform organ, the Gz/vibration detector; (2) the neurogenic heart of the spider is a good dependent variable for assessing its behavior to Gz and other stimuli which produce mechanical effects on the exoskeleton; (3) Not only is the cardiac response useful but it is now understood to be an integral part of the system which compensates for the consequences of gravity in the spider (an hydraulic leg extension); and (4) a theoretical model was proposed in which a mechanical amplifier, the leg lever, converts a weak force (at the tarsus) to a strong force (at the patella), capable of compressing the exoskeleton and consequently the lyriform receptor.

  8. Environmental Engineering Approaches toward Sustainable Management of Spider Mites.

    Science.gov (United States)

    Suzuki, Takeshi

    2012-10-26

    Integrated pest management (IPM), which combines physical, biological, and chemical control measures to complementary effect, is one of the most important approaches to environmentally friendly sustainable agriculture. To expand IPM, we need to develop new pest control measures, reinforce existing measures, and investigate interactions between measures. Continued progress in the development of environmental control technologies and consequent price drops have facilitated their integration into plant production and pest control. Here I describe environmental control technologies for the IPM of spider mites through: (1) the disturbance of photoperiod-dependent diapause by artificial light, which may lead to death in seasonal environments; (2) the use of ultraviolet radiation to kill or repel mites; and (3) the use of water vapor control for the long-term cold storage of commercially available natural enemies. Such environmental control technologies have great potential for the efficient control of spider mites through direct physical effects and indirect effects via natural enemies.

  9. Prey capture by the crab spider Misumena calycina (Araneae: Thomisidae).

    Science.gov (United States)

    Morse, Douglass H

    1979-01-01

    Crab spiders Misumena calycina (L.) in pasture rose Rosa carolina flowers regularly attacked bumble bees, smaller bees, and syrphid flies that visited these flowers. Attacks reached a maximum rate of over 20/h during mid morning, but only 1.6% of the most important prey item, bumble bees, were captured. The next most important food source, the most frequently taken item, syrphid flies Toxomerus marginatus (Say), were captured in 39% of the attempts. Since these flies have a biomass only 1/60th that of bumble bees, they comprised a much less important food source than did bumble bees. Spiders would obtain over 7% more food by specializing on bumble bees than by attacking all insect visitors, and as much as 20% more food at certain times of the day. However, they did not show a tendency to specialize at any time.

  10. Spatial distribution of Madeira Island Laurisilva endemic spiders (Arachnida: Araneae)

    Science.gov (United States)

    2014-01-01

    Abstract Madeira island presents a unique spider diversity with a high number of endemic species, many of which are still poorly known. A recent biodiversity survey on the terrestrial arthropods of the native forest, Laurisilva, provided a large set of standardized samples from various patches throughout the island. Out of the fifty two species recorded, approximately 33.3% are Madeiran endemics, many of which had not been collected since their original description. Two new species to science are reported – Ceratinopsis n. sp. and Theridion n. sp. – and the first records of Poeciloneta variegata (Blackwall, 1841) and Tetragnatha intermedia Kulczynski, 1891 are reported for the first time for Madeira island. Considerations on species richness and abundance from different Laurisilva locations are presented, together with distribution maps for endemic species. These results contribute to a better understanding of spider diversity patterns and endemic species distribution in the native forest of Madeira island. PMID:24855443

  11. Structure to function: Spider silk and human collagen

    Science.gov (United States)

    Rabotyagova, Olena S.

    Nature has the ability to assemble a variety of simple molecules into complex functional structures with diverse properties. Collagens, silks and muscles fibers are some examples of fibrous proteins with self-assembling properties. One of the great challenges facing Science is to mimic these designs in Nature to find a way to construct molecules that are capable of organizing into functional supra-structures by self-assembly. In order to do so, a construction kit consisting of molecular building blocks along with a complete understanding on how to form functional materials is required. In this current research, the focus is on spider silk and collagen as fibrous protein-based biopolymers that can shed light on how to generate nanostructures through the complex process of self-assembly. Spider silk in fiber form offers a unique combination of high elasticity, toughness, and mechanical strength, along with biological compatibility and biodegrability. Spider silk is an example of a natural block copolymer, in which hydrophobic and hydrophilic blocks are linked together generating polymers that organize into functional materials with extraordinary properties. Since silks resemble synthetic block copolymer systems, we adopted the principles of block copolymer design from the synthetic polymer literature to build block copolymers based on spider silk sequences. Moreover, we consider spider silk to be an important model with which to study the relationships between structure and properties in our system. Thus, the first part of this work was dedicated to a novel family of spider silk block copolymers, where we generated a new family of functional spider silk-like block copolymers through recombinant DNA technology. To provide fundamental insight into relationships between peptide primary sequence, block composition, and block length and observed morphological and structural features, we used these bioengineered spider silk block copolymers to study secondary structure

  12. Hamiltonian Dynamics of Spider-Type Multirotor Rigid Bodies Systems

    International Nuclear Information System (INIS)

    Doroshin, Anton V.

    2010-01-01

    This paper sets out to develop a spider-type multiple-rotor system which can be used for attitude control of spacecraft. The multirotor system contains a large number of rotor-equipped rays, so it was called a 'Spider-type System', also it can be called 'Rotary Hedgehog'. These systems allow using spinups and captures of conjugate rotors to perform compound attitude motion of spacecraft. The paper describes a new method of spacecraft attitude reorientation and new mathematical model of motion in Hamilton form. Hamiltonian dynamics of the system is investigated with the help of Andoyer-Deprit canonical variables. These variables allow obtaining exact solution for hetero- and homoclinic orbits in phase space of the system motion, which are very important for qualitative analysis.

  13. VIPR III VADR SPIDER Structural Design and Analysis

    Science.gov (United States)

    Li, Wesley; Chen, Tony

    2016-01-01

    In support of the National Aeronautics and Space Administration (NASA) Vehicle Integrated Propulsion Research (VIPR) Phase III team to evaluate the volcanic ash environment effects on the Pratt & Whitney F117-PW-100 turbofan engine, NASA Armstrong Flight Research Center has successfully performed structural design and analysis on the Volcanic Ash Distribution Rig (VADR) and the Structural Particulate Integration Device for Engine Research (SPIDER) for the ash ingestion test. Static and dynamic load analyses were performed to ensure no structural failure would occur during the test. Modal analysis was conducted, and the results were used to develop engine power setting avoidance zones. These engine power setting avoidance zones were defined to minimize the dwell time when the natural frequencies of the VADR/SPIDER system coincided with the excitation frequencies of the engine which was operating at various revolutions per minute. Vortex-induced vibration due to engine suction air flow during the ingestion test was also evaluated, but was not a concern.

  14. [Transcatheter embolization for huge pulmonary arteriovenous fistula using metallic "spider" and spring embolus--application of hand-made metallic "spider" using partial monorail technique].

    Science.gov (United States)

    Hirota, S; Sako, M; Fujita, Y; Hasegawa, Y; Sugimoto, K; Suzuki, Y; Kono, M

    1992-07-25

    We performed transcatheter embolization in two cases with huge pulmonary arteriovenous fistula (AVF) using a metallic "spider" and spring embolus. Conventional spring embolus or detachable balloon could not be used in these cases. Metallic spider was indicated for pulmonary AVF with a feeding artery diameter of more than 16 mm to prevent embolus passing through the AVF. In the first case, we used large handmade metallic spiders of 25 mm in diameter followed by embolization by numerous spring coils. At that time, a partial monorail technique was newly devised to carry the large metallic spider into the feeding artery, otherwise the spider could not pass into a 9F catheter. After embolization, symptoms and PaO2 in arterial blood improved remarkably in both cases. In the second case, a spring coil migrated into the normal pulmonary artery, but no infarction resulted. In conclusion, the metallic spider was very useful for embolization of hugee pulmonary AVF to avoid the embolus passing through and to tangle spring coils together with it. If commercially available "spiders" are too small, ones can be made easily.

  15. A troglomorphic spider from Java (Araneae, Ctenidae, Amauropelma)

    Science.gov (United States)

    Miller, Jeremy; Rahmadi, Cahyo

    2012-01-01

    Abstract A new troglomorphic spider from caves in Central Java, Indonesia, is described and placed in the ctenid genus Amauropelma Raven, Stumkat & Gray, until now containing only species from Queensland, Australia. Only juveniles and mature females of the new species are known. We give our reasons for placing the new species in Amauropelma, discuss conflicting characters, and make predictions about the morphology of the as yet undiscovered male that will test our taxonomic hypothesis. The description includes DNA barcode sequence data. PMID:22303127

  16. Signal conflict in spider webs driven by predators and prey

    OpenAIRE

    Blackledge, T. A.

    1998-01-01

    Variation in the sensory physiologies of organisms can bias the receptions of signals, driving the direction of signal evolution. Sensory drive in the evolution of signals may be particularly important for organisms that confront trade-offs in signal design between the need for conspicuousness to allow effective transfer of information and the need for crypsis of the signal to unintended receivers. Several genera of orb-weaving spiders include conspicuous silk designs, stabilimenta, in the ce...

  17. On the colours of spider orb-webs

    Energy Technology Data Exchange (ETDEWEB)

    Suhr, Wilfried; Schlichting, H Joachim, E-mail: wilfried.suhr@uni-muenster.de, E-mail: schlichting@uni-muenster.de [Institut fuer Didaktik der Physik, University of Muenster, 48149 Muenster (Germany)

    2011-03-15

    A sticky capture thread from the spiral element of spider orb-webs is formed of almost regularly spaced droplets that surround a supporting axial fibre. From the perspective of physical optics it represents a periodic linear array of scattering elements that acts as a diffraction grating. This is a novel aspect, which is of vital importance for the understanding of the overall scattering pattern. To demonstrate its significance, we present our experimental findings and compare them with results of a simplified model.

  18. The effect of age on encounters between male crab spiders

    OpenAIRE

    Helen H. Hu; Douglass H. Morse

    2004-01-01

    In males that compete aggressively for females, size and age may determine which males obtain access to these females. In the present study, we use the crab spider, Misumena vatia, a species with males that do not grow after becoming sexually mature adults, to test the hypothesis that age affects the success of males competing for access to females. M. vatia is an excellent species to test this hypothesis because it is possible to disentangle age from size, characters that typically vary toge...

  19. Antenna-coupled TES bolometers for the SPIDER experiment

    Energy Technology Data Exchange (ETDEWEB)

    Kuo, C.L. [Jet Propulsion Laboratory, 4800 Oak Grove Drive, Pasadena, CA 91109 (United States)]|[California Institute of Technology, 1200 E California Boulevard, Pasadena, CA 91125 (United States)]. E-mail: clkuo@astro.caltech.edu; Ade, P. [University of Wales, Cardiff, 5 The Parade, Cardiff, CF24 3YB, Wales (United Kingdom); Bock, J.J. [Jet Propulsion Laboratory, 4800 Oak Grove Drive, Pasadena, CA 91109 (United States)]|[California Institute of Technology, 1200 E California Boulevard, Pasadena, CA 91125 (United States); Day, P. [Jet Propulsion Laboratory, 4800 Oak Grove Drive, Pasadena, CA 91109 (United States)]|[California Institute of Technology, 1200 E California Boulevard, Pasadena, CA 91125 (United States); Goldin, A.; Golwala, S.; Hristov, V.; Jones, W.C.; Lange, A.E.; Rossinot, P.; Vayonakis, A.; Wang, G. [California Institute of Technology, 1200 E California Boulevard, Pasadena, CA 91125 (United States); Halpern, M. [University of British Columbia, 2329 West Mall, Vancouver, BC, V6T 1Z4 (Canada); Hilton, G.; Irwin, K. [National Institute of Standards and Technology, 325 Broadway, Boulder, CO (United States); Holmes, W.; Kenyon, M.; LeDuc, H.G. [Jet Propulsion Laboratory, 4800 Oak Grove Drive, Pasadena, CA 91109 (United States); MacTavish, C. [University of Toronto, 60 St. George Street, Toronto, ON, M5S 1A7 (Canada); Montroy, T.; Ruhl, J. [Case Western Reserve University, 10900 Euclid Avenue, Cleveland, OH 44106 (United States); Netterfield, C.B. [University of Toronto, 60 St. George Street, Toronto, ON, M5S 1A7 (Canada); Yun, M. [Jet Propulsion Laboratory, 4800 Oak Grove Drive, Pasadena, CA 91109 (United States)]|[University of Pittsburgh, 348 Benedum Engineering Hall, Pittsburgh, PA 15261 (United States); Zmuidzinas, J. [Jet Propulsion Laboratory, 4800 Oak Grove Drive, Pasadena, CA 91109 (United States)]|[California Institute of Technology, 1200 E California Boulevard, Pasadena, CA 91125 (United States)

    2006-04-15

    SPIDER is a proposed balloon-borne experiment designed to search for the imprints of gravity waves on the polarization of the cosmic microwave background radiation. The required wide frequency coverage, large number of sensitive detectors, and the stringent power constraints on a balloon are made possible by antenna-coupled TES bolometers. Several prototype devices have been fabricated and optically characterized. Their spectral and angular responses agree well with the theoretical expectations.

  20. Innate pattern recognition and categorization in a jumping spider.

    Directory of Open Access Journals (Sweden)

    Yinnon Dolev

    Full Text Available The East African jumping spider Evarcha culicivora feeds indirectly on vertebrate blood by preferentially preying upon blood-fed Anopheles mosquitoes, the vectors of human malaria1, using the distinct resting posture and engorged abdomen characteristic of these specific prey as key elements for their recognition. To understand perceptual categorization of objects by these spiders, we investigated their predatory behavior toward different digital stimuli--abstract 'stick figure' representations of Anopheles constructed solely by known key identification elements, disarranged versions of these, as well as non-prey items and detailed images of alternative prey. We hypothesized that the abstract images representing Anopheles would be perceived as potential prey, and would be preferred to those of non-preferred prey. Spiders perceived the abstract stick figures of Anopheles specifically as their preferred prey, attacking them significantly more often than non-preferred prey, even when the comprising elements of the Anopheles stick figures were disarranged and disconnected from each other. However, if the relative angles between the elements of the disconnected stick figures of Anopheles were altered, the otherwise identical set of elements was no longer perceived as prey. These data show that E. culicivora is capable of making discriminations based on abstract concepts, such as the hypothetical angle formed by discontinuous elements. It is this inter-element angle rather than resting posture that is important for correct identification of Anopheles. Our results provide a glimpse of the underlying processes of object recognition in animals with minute brains, and suggest that these spiders use a local processing approach for object recognition, rather than a holistic or global approach. This study provides an excellent basis for a comparative analysis on feature extraction and detection by animals as diverse as bees and mammals.

  1. Reproductive Seasonality in Nesticus (Araneae: Nesticidae) Cave Spiders.

    Science.gov (United States)

    Carver, Linnea M; Perlaky, Patricia; Cressler, Alan; Zigler, Kirk S

    2016-01-01

    Spiders of the family Nesticidae are members of cave communities around the world with cave-obligate (troglobiotic) species known from North America, Europe, Asia and the Indo-Pacific. A radiation of Nesticus (Araneae: Nesticidae) in the southern Appalachians includes ten troglobiotic species. Many of these species are of conservation interest due to their small ranges, with four species being single-cave endemics. Despite conservation concerns and their important role as predators in cave communities, we know little about reproduction and feeding in this group. We addressed this knowledge gap by examining populations of two species on a monthly basis for one year. We made further observations on several other species and populations, totaling 671 individual spider observations. This more than doubled the reported observations of reproduction and feeding in troglobiotic Nesticus. Female Nesticus carry egg sacs, facilitating the determination of the timing and frequency of reproduction. We found that Nesticus exhibit reproductive seasonality. Females carried egg sacs from May through October, with a peak in frequency in June. These spiders were rarely observed with prey; only 3.3% (22/671) of individuals were observed with prey items. The frequency at which prey items were observed did not vary by season. Common prey items were flies, beetles and millipedes. Troglobiotic species constituted approximately half of all prey items observed. This result represents a greater proportion of troglobiotic prey than has been reported for various troglophilic spiders. Although our findings shed light on the life history of troglobiotic Nesticus and on their role in cave ecosystems, further work is necessary to support effective conservation planning for many of these rare species.

  2. Spiders in mountain habitats of the Giant Mountains

    Czech Academy of Sciences Publication Activity Database

    Růžička, Vlastimil; Vaněk, J.; Šmilauer, P.

    2012-01-01

    Roč. 43, č. 4 (2012), s. 341-347 ISSN 1067-4136 Institutional research plan: CEZ:AV0Z50070508 Keywords : Giant Mountains (Krkonoše, Karkonosze) * spider s * anemo-orographic systems Subject RIV: EH - Ecology, Behaviour Impact factor: 0.236, year: 2012 http://www.springerlink.com/content/0k5g721q1155r146/fulltext.pdf

  3. Innate Pattern Recognition and Categorization in a Jumping Spider

    Science.gov (United States)

    Dolev, Yinnon; Nelson, Ximena J.

    2014-01-01

    The East African jumping spider Evarcha culicivora feeds indirectly on vertebrate blood by preferentially preying upon blood-fed Anopheles mosquitoes, the vectors of human malaria1, using the distinct resting posture and engorged abdomen characteristic of these specific prey as key elements for their recognition. To understand perceptual categorization of objects by these spiders, we investigated their predatory behavior toward different digital stimuli - abstract ‘stick figure’ representations of Anopheles constructed solely by known key identification elements, disarranged versions of these, as well as non-prey items and detailed images of alternative prey. We hypothesized that the abstract images representing Anopheles would be perceived as potential prey, and would be preferred to those of non-preferred prey. Spiders perceived the abstract stick figures of Anopheles specifically as their preferred prey, attacking them significantly more often than non-preferred prey, even when the comprising elements of the Anopheles stick figures were disarranged and disconnected from each other. However, if the relative angles between the elements of the disconnected stick figures of Anopheles were altered, the otherwise identical set of elements was no longer perceived as prey. These data show that E. culicivora is capable of making discriminations based on abstract concepts, such as the hypothetical angle formed by discontinuous elements. It is this inter-element angle rather than resting posture that is important for correct identification of Anopheles. Our results provide a glimpse of the underlying processes of object recognition in animals with minute brains, and suggest that these spiders use a local processing approach for object recognition, rather than a holistic or global approach. This study provides an excellent basis for a comparative analysis on feature extraction and detection by animals as diverse as bees and mammals. PMID:24893306

  4. On the colours of spider orb-webs

    International Nuclear Information System (INIS)

    Suhr, Wilfried; Schlichting, H Joachim

    2011-01-01

    A sticky capture thread from the spiral element of spider orb-webs is formed of almost regularly spaced droplets that surround a supporting axial fibre. From the perspective of physical optics it represents a periodic linear array of scattering elements that acts as a diffraction grating. This is a novel aspect, which is of vital importance for the understanding of the overall scattering pattern. To demonstrate its significance, we present our experimental findings and compare them with results of a simplified model.

  5. Colonization of subterranean habitats by spiders in Central Europe

    Czech Academy of Sciences Publication Activity Database

    Růžička, Vlastimil; Šmilauer, P.; Mlejnek, R.

    2013-01-01

    Roč. 42, č. 2 (2013), s. 133-140 ISSN 0392-6672 Grant - others:GA JU(CZ) GAJU 04-142/2010/P Institutional support: RVO:60077344 Keywords : superficial and deep subterranean habitats * caves * spider s Subject RIV: EH - Ecology, Behaviour Impact factor: 1.275, year: 2013 http://scholarcommons.usf.edu/cgi/viewcontent.cgi?article=1288&context=ijs

  6. Early environmental conditions shape personality types in a jumping spider

    Directory of Open Access Journals (Sweden)

    Jannis eLiedtke

    2015-12-01

    Full Text Available Individuals of many species across the animal kingdom are found to be less plastic than expected, even in behavioral traits. The existence of consistent behavioral differences between individuals, termed personality differences, is puzzling, since plastic behavior is considered ideal to enable animals to adaptively respond to changes in environmental conditions. In order to elucidate which mechanisms are important for the evolution of personality differences, it is crucial to understand which aspects of the environment are important for the development of personality differences. Here, we tested whether physical or social aspects of the environment during development influence individual differentiation (mean level of behavior using the jumping spider Marpissa muscosa. Furthermore, we assessed whether those behaviors were repeatable, i.e. whether personalities existed. We applied a split-brood design and raised spider siblings in three different environments: a deprived environment with no enrichment, a socially and a physically enriched environment. We focused on exploratory behavior and repeatedly assessed individual behavior in a novel environment and a novel object test. Results show that the environment during development influenced spiders’ exploratory tendencies: spiders raised in enriched environments tended to be more exploratory. Most investigated behaviors were repeatable (i.e. personalities existed across all individuals tested, whereas only few behaviors were also repeatable across individuals that had experienced the same environmental condition. Taken together, our results indicate that external stimuli can influence the development of one aspect of personality, the inter-individual variation (mean level of behavior, in a jumping spider. We also found family by environment interactions on behavioral traits potentially suggesting genetic variation in developmental plasticity.

  7. A New Limit on CMB Circular Polarization from SPIDER

    Science.gov (United States)

    Nagy, J. M.; Ade, P. A. R.; Amiri, M.; Benton, S. J.; Bergman, A. S.; Bihary, R.; Bock, J. J.; Bond, J. R.; Bryan, S. A.; Chiang, H. C.; Contaldi, C. R.; Doré, O.; Duivenvoorden, A. J.; Eriksen, H. K.; Farhang, M.; Filippini, J. P.; Fissel, L. M.; Fraisse, A. A.; Freese, K.; Galloway, M.; Gambrel, A. E.; Gandilo, N. N.; Ganga, K.; Gudmundsson, J. E.; Halpern, M.; Hartley, J.; Hasselfield, M.; Hilton, G.; Holmes, W.; Hristov, V. V.; Huang, Z.; Irwin, K. D.; Jones, W. C.; Kuo, C. L.; Kermish, Z. D.; Li, S.; Mason, P. V.; Megerian, K.; Moncelsi, L.; Morford, T. A.; Netterfield, C. B.; Nolta, M.; Padilla, I. L.; Racine, B.; Rahlin, A. S.; Reintsema, C.; Ruhl, J. E.; Runyan, M. C.; Ruud, T. M.; Shariff, J. A.; Soler, J. D.; Song, X.; Trangsrud, A.; Tucker, C.; Tucker, R. S.; Turner, A. D.; Van Der List, J. F.; Weber, A. C.; Wehus, I. K.; Wiebe, D. V.; Young, E. Y.

    2017-08-01

    We present a new upper limit on cosmic microwave background (CMB) circular polarization from the 2015 flight of Spider, a balloon-borne telescope designed to search for B-mode linear polarization from cosmic inflation. Although the level of circular polarization in the CMB is predicted to be very small, experimental limits provide a valuable test of the underlying models. By exploiting the nonzero circular-to-linear polarization coupling of the half-wave plate polarization modulators, data from Spider's 2015 Antarctic flight provide a constraint on Stokes V at 95 and 150 GHz in the range 33< {\\ell }< 307. No other limits exist over this full range of angular scales, and Spider improves on the previous limit by several orders of magnitude, providing 95% C.L. constraints on {\\ell }({\\ell }+1){C}{\\ell }{VV}/(2π ) ranging from 141 to 255 μK2 at 150 GHz for a thermal CMB spectrum. As linear CMB polarization experiments become increasingly sensitive, the techniques described in this paper can be applied to obtain even stronger constraints on circular polarization.

  8. A New Limit on CMB Circular Polarization from SPIDER

    Energy Technology Data Exchange (ETDEWEB)

    Nagy, J. M.; Ade, P. A. R.; Amiri, M.; Benton, S. J.; Bergman, A. S.; Bihary, R.; Bock, J. J.; Bond, J. R.; Bryan, S. A.; Chiang, H. C.; Contaldi, C. R.; Doré, O.; Duivenvoorden, A. J.; Eriksen, H. K.; Farhang, M.; Filippini, J. P.; Fissel, L. M.; Fraisse, A. A.; Freese, K.; Galloway, M.; Gambrel, A. E.; Gandilo, N. N.; Ganga, K.; Gudmundsson, J. E.; Halpern, M.; Hartley, J.; Hasselfield, M.; Hilton, G.; Holmes, W.; Hristov, V. V.; Huang, Z.; Irwin, K. D.; Jones, W. C.; Kuo, C. L.; Kermish, Z. D.; Li, S.; Mason, P. V.; Megerian, K.; Moncelsi, L.; Morford, T. A.; Netterfield, C. B.; Nolta, M.; Padilla, I. L.; Racine, B.; Rahlin, A. S.; Reintsema, C.; Ruhl, J. E.; Runyan, M. C.; Ruud, T. M.; Shariff, J. A.; Soler, J. D.; Song, X.; Trangsrud, A.; Tucker, C.; Tucker, R. S.; Turner, A. D.; List, J. F. Van Der; Weber, A. C.; Wehus, I. K.; Wiebe, D. V.; Young, E. Y.

    2017-08-01

    We present a new upper limit on CMB circular polarization from the 2015 flight of SPIDER, a balloon-borne telescope designed to search for $B$-mode linear polarization from cosmic inflation. Although the level of circular polarization in the CMB is predicted to be very small, experimental limits provide a valuable test of the underlying models. By exploiting the non-zero circular-to-linear polarization coupling of the HWP polarization modulators, data from SPIDER's 2015 Antarctic flight provides a constraint on Stokes $V$ at 95 and 150 GHz from $33<\\ell<307$. No other limits exist over this full range of angular scales, and SPIDER improves upon the previous limit by several orders of magnitude, providing 95% C.L. constraints on $\\ell (\\ell+1)C_{\\ell}^{VV}/(2\\pi)$ ranging from 141 $\\mu K ^2$ to 203 $\\mu K ^2$ at 150 GHz for a thermal CMB spectrum. As linear CMB polarization experiments become increasingly sensitive, the techniques described in this paper can be applied to obtain stronger constraints on circular polarization.

  9. Detail design of the beam source for the SPIDER experiment

    International Nuclear Information System (INIS)

    Marcuzzi, D.; Agostinetti, P.; Dalla Palma, M.; Degli Agostini, F.; Pavei, M.; Rizzolo, A.; Tollin, M.; Trevisan, L.

    2010-01-01

    The ITER Neutral Beam Test Facility (PRIMA-Padova Research on Injector Megavolt Accelerated) is planned to be built at Consorzio RFX (Padova, Italy). PRIMA includes two experimental devices: a full size plasma source with low voltage extraction called SPIDER (Source for Production of Ion of Deuterium Extracted from RF plasma) and a full size neutral beam injector at full beam power called MITICA (Megavolt ITER Injector Concept Advancement). SPIDER is the first experimental device to be built and operated, aiming at testing the extraction of a negative ion beam (made of H - and in a later stage D - ions) from an ITER size ion source. The main requirements of this experiment are a H - /D - current of approximately 70 A/50 A and an energy of 100 keV. This paper presents an overview of the SPIDER beam source design, with a particular focus on the main design choices, aiming at reaching the best compromise between physics, optics, thermo-mechanical, cooling, assembly and electrical requirements.

  10. Jewelled spiders manipulate colour-lure geometry to deceive prey.

    Science.gov (United States)

    White, Thomas E

    2017-03-01

    Selection is expected to favour the evolution of efficacy in visual communication. This extends to deceptive systems, and predicts functional links between the structure of visual signals and their behavioural presentation. Work to date has primarily focused on colour, however, thereby understating the multicomponent nature of visual signals. Here I examined the relationship between signal structure, presentation behaviour, and efficacy in the context of colour-based prey luring. I used the polymorphic orb-web spider Gasteracantha fornicata , whose yellow- or white-and-black striped dorsal colours have been broadly implicated in prey attraction. In a manipulative assay, I found that spiders actively control the orientation of their conspicuous banded signals in the web, with a distinct preference for near-diagonal bearings. Further field-based study identified a predictive relationship between pattern orientation and prey interception rates, with a local maximum at the spiders' preferred orientation. There were no morph-specific effects on capture success, either singularly or via an interaction with pattern orientation. These results reveal a dynamic element in a traditionally 'static' signalling context, and imply differential functions for chromatic and geometric signal components across visual contexts. More broadly, they underscore how multicomponent signal designs and display behaviours may coevolve to enhance efficacy in visual deception. © 2017 The Author(s).

  11. Epigeic spiders of the pastures of northern Wielkopolska

    Directory of Open Access Journals (Sweden)

    Woźny, Marek

    2000-10-01

    Full Text Available The fauna of epigeic spiders (Araneae occurring on three different types of pastures in northern Wielkopolska was analysed. Studies were conducted from May 1992 to October 1993. The 18,995 specimens collected were classified as belonging to 137 species and 17 families. The family Linyphiidae proved the richest in species while Lycosidae was the most abundantly in terms of number of specimens. Zoocenological analysis of spider communities showed their differentiation testifying to differences in the sites studied. The dominants were: 1 Osowo Stare (Site 1: Pardosa palustris, 2 Sycyn Dolny (Site 2: Xerolycosa miniata, P. palustris, Xysticus kochi, 3 Braczewo (Site 3: Erigone dentipalpis, P. palustris. Seasonal changes of dominance of the species at each site were established. A comparison of changes of the species’ dominances in the years 1992 and 1993 disclosed similar values of the individual dominance coefficient at the sites in Osowo Stare and Braczewo. This result indicates the occurrence of the process of stabilization of these biocenoses and a tendency to equilibrium in the environment. The least stable proved to be the site at Sycyn Dolny. Analysis of the seasonal dynamics of epigeic spider communities was also made by determining the mean number of species at each site in the two years of study. The highest number of species was noted in spring. It is interesting to note the appearance of species which are rare or very rare in Poland such as: Lepthyphantes insignis, Ostearius melanopygius, Enoplognatha mordax and Enoplognatha oelandica.

  12. Architecture of SPIDER control and data acquisition system

    International Nuclear Information System (INIS)

    Luchetta, A.; Manduchi, G.; Taliercio, C.; Soppelsa, A.; Barbalace, A.; Paolucci, F.; Sartori, F.; Barbato, P.; Breda, M.; Capobianco, R.; Molon, F.; Moressa, M.; Polato, S.; Simionato, P.; Zampiva, E.

    2012-01-01

    The ITER Heating Neutral Beam injectors will be implemented in three steps: development of the ion source prototype, development of the full injector prototype, and, finally, construction of up to three ITER injectors. The first two steps will be carried out in the ITER neutral beam test facility under construction in Italy. The ion source prototype, referred to as SPIDER, which is currently in the development phase, is a complex experiment involving more than 20 plant units and operating with beam-on pulses lasting up to 1 h. As for control and data acquisition it requires fast and slow control (cycle time around 0.1 ms and 10 ms, respectively), synchronization (10 ns resolution), and data acquisition for about 1000 channels (analogue and images) with sampling frequencies up to tens of MS/s, data throughput up to 200 MB/s, and data storage volume of up to tens of TB/year. The paper describes the architecture of the SPIDER control and data acquisition system, discussing the SPIDER requirements and the ITER CODAC interfaces and specifications for plant system instrumentation and control.

  13. Seasonal variation of ground spiders in a Brazilian Savanna

    Directory of Open Access Journals (Sweden)

    Marina Farcic Mineo

    2010-06-01

    Full Text Available The Brazilian Savanna Ecoregion (Cerrado is one of the richest biomes in the world, with a characteristic highly seasonal climate a dry season between May and September and a rainy season from October through April. Ground-dwelling spiders from three Cerrado phytophysiognomies, "campo cerrado", "cerrado" and "cerrad��o", were sampled using pitfall traps during two years, totaling 111 species and 3,529 individuals. The abundance of individuals and species richness was higher during the wet season. Fifty-eight species were captured exclusively during that period, whereas only nineteen were restricted to the dry season. Only two species were found in all samples. The number of juveniles was higher than the number of adults in all phytophysiognomies and in all species during both seasons. The highest abundance was registered in October and the lowest in April. Overall sex ratio was male-biased in all vegetation types sampled. Distinct climate variables affected the abundance of spiders depending on sex, age and vegetal physiognomy where they were sampled. This study involved the longest sampling of spider abundance and diversity on the ground of a Brazilian Savanna.

  14. Silkworms transformed with chimeric silkworm/spider silk genes spin composite silk fibers with improved mechanical properties

    Science.gov (United States)

    The development of a spider silk manufacturing process is of great interest. piggyBac vectors were used to create transgenic silkworms encoding chimeric silkworm/spider silk proteins. The silk fibers produced by these animals were composite materials that included chimeric silkworm/spider silk prote...

  15. Differential predictive power of self report and implicit measures on behavioural and physiological fear responses to spiders

    NARCIS (Netherlands)

    van Bockstaele, B.; Verschuere, B.; Koster, E.H.W.; Tibboel, H.; de Houwer, J.; Crombez, G.

    2011-01-01

    In this study, we investigated to what extent indirect measures predict behavioural and physiological fear responses towards spiders. Implicit attitudes towards spiders were assessed using an implicit association test and attentional bias towards spiders was assessed using a dot probe task and a

  16. An insect-feeding guild of carnivorous plants and spiders: does optimal foraging lead to competition or facilitation?

    Science.gov (United States)

    Crowley, Philip H; Hopper, Kevin R; Krupa, James J

    2013-12-01

    Carnivorous plants and spiders, along with their prey, are main players in an insect-feeding guild found on acidic, poorly drained soils in disturbed habitat. Darwin's notion that these plants must actively attract the insects they capture raises the possibility that spiders could benefit from proximity to prey hotspots created by the plants. Alternatively, carnivorous plants and spiders may deplete prey locally or (through insect redistribution) more widely, reducing each other's gain rates from predation. Here, we formulate and analyze a model of this guild, parameterized for carnivorous sundews and lycosid spiders, under assumptions of random movement by insects and optimal foraging by predators. Optimal foraging here involves gain maximization via trap investment (optimal web sizes and sundew trichome densities) and an ideal free distribution of spiders between areas with and without sundews. We find no facilitation: spiders and sundews engage in intense exploitation competition. Insect attraction by plants modestly increases sundew gain rates but slightly decreases spider gain rates. In the absence of population size structure, optimal spider redistribution between areas with and without sundews yields web sizes that are identical for all spiders, regardless of proximity to sundews. Web-building spiders have higher gain rates than wandering spiders in this system at high insect densities, but wandering spiders have the advantage at low insect densities. Results are complex, indicating that predictions to be tested empirically must be based on careful quantitative assessment.

  17. Untangling spider silk evolution with spidroin terminal domains

    Directory of Open Access Journals (Sweden)

    Garb Jessica E

    2010-08-01

    Full Text Available Abstract Background Spidroins are a unique family of large, structural proteins that make up the bulk of spider silk fibers. Due to the highly variable nature of their repetitive sequences, spidroin evolutionary relationships have principally been determined from their non-repetitive carboxy (C-terminal domains, though they offer limited character data. The few known spidroin amino (N-terminal domains have been difficult to obtain, but potentially contain critical phylogenetic information for reconstructing the diversification of spider silks. Here we used silk gland expression data (ESTs from highly divergent species to evaluate the functional significance and phylogenetic utility of spidroin N-terminal domains. Results We report 11 additional spidroin N-termini found by sequencing ~1,900 silk gland cDNAs from nine spider species that shared a common ancestor > 240 million years ago. In contrast to their hyper-variable repetitive regions, spidroin N-terminal domains have retained striking similarities in sequence identity, predicted secondary structure, and hydrophobicity. Through separate and combined phylogenetic analyses of N-terminal domains and their corresponding C-termini, we find that combined analysis produces the most resolved trees and that N-termini contribute more support and less conflict than the C-termini. These analyses show that paralogs largely group by silk gland type, except for the major ampullate spidroins. Moreover, spidroin structural motifs associated with superior tensile strength arose early in the history of this gene family, whereas a motif conferring greater extensibility convergently evolved in two distantly related paralogs. Conclusions A non-repetitive N-terminal domain appears to be a universal attribute of spidroin proteins, likely retained from the origin of spider silk production. Since this time, spidroin N-termini have maintained several features, consistent with this domain playing a key role in silk

  18. The spider Harpactea sadistica: co-evolution of traumatic insemination and complex female genital morphology in spiders.

    Science.gov (United States)

    Rezác, Milan

    2009-08-07

    The males of invertebrates from a few phyla, including arthropods, have been reported to practise traumatic insemination (TI; i.e. injecting sperm by using the copulatory organ to penetrate the female's body wall). As all previously reported arthropod examples have been insects, there is considerable interest in whether TI might have evolved independently in other arthropods. The research reported here demonstrates the first case of TI in the arthropod subphylum Chelicerata, in particular how the genital morphology and mating behaviour of Harpactea sadistica (Rezác 2008), a spider from Israel, has become adapted specifically for reproduction based on TI. Males have needle-like intromittent organs and females have atrophied spermathecae. In other spiders, eggs are fertilized simultaneously with oviposition, but the eggs of H. sadistica are fertilized in the ovaries (internal fertilization) and develop as embryos before being laid. Sperm-storage organs of phylogenetically basal groups to H. sadistica provide males with last male sperm priority and allow removal of sperm by males that mate later, suggesting that TI might have evolved as an adaptive strategy to circumvent an unfavourable structure of the sperm-storage organs, allowing the first male to mate with paternity advantage. Understanding the functional significance of TI gives us insight into factors underlying the evolution of the genital and sperm-storage morphology in spiders.

  19. Sperm dynamics in spiders (Araneae): ultrastructural analysis of the sperm activation process in the garden spider Argiope bruennichi (Scopoli, 1772).

    Science.gov (United States)

    Vöcking, Oliver; Uhl, Gabriele; Michalik, Peter

    2013-01-01

    Storage of sperm inside the female genital tract is an integral phase of reproduction in many animal species. The sperm storage site constitutes the arena for sperm activation, sperm competition and female sperm choice. Consequently, to understand animal mating systems information on the processes that occur from sperm transfer to fertilization is required. Here, we focus on sperm activation in spiders. Male spiders produce sperm whose cell components are coiled within the sperm cell and that are surrounded by a proteinaceous sheath. These inactive and encapsulated sperm are transferred to the female spermathecae where they are stored for later fertilization. We analyzed the ultrastructural changes of sperm cells during residency time in the female genital system of the orb-web spider Argiope bruennichi. We found three clearly distinguishable sperm conditions: encapsulated sperm (secretion sheath present), decapsulated (secretion sheath absent) and uncoiled sperm (cell components uncoiled, presumably activated). After insemination, sperm remain in the encapsulated condition for several days and become decapsulated after variable periods of time. A variable portion of the decapsulated sperm transforms rapidly to the uncoiled condition resulting in a simultaneous occurrence of decapsulated and uncoiled sperm. After oviposition, only decapsulated and uncoiled sperm are left in the spermathecae, strongly suggesting that the activation process is not reversible. Furthermore, we found four different types of secretion in the spermathecae which might play a role in the decapsulation and activation process.

  20. Enzymatic Browning: a practical class

    Directory of Open Access Journals (Sweden)

    Maria Teresa Pedrosa Silva Clerici

    2014-10-01

    Full Text Available This paper presents a practical class about the enzymes polyphenol oxidases, which have been shown to be responsible for the enzymatic browning of fruits and vegetables. Vegetables samples were submitted to enzymatic inactivation process with chemical reagents, as well as by bleaching methods of applying heat by conventional oven and microwave oven. Process efficiency was assessed qualitatively by both observing the guaiacol peroxidase activity and after the storage period under refrigeration or freezing. The practical results obtained in this class allow exploring multidisciplinary knowledge in food science, with practical applications in everyday life.

  1. X-ray and Optical Explorations of Spiders

    Science.gov (United States)

    Roberts, M.; Al Noori, H.; Torres, R.; Russell, D.; Mclaughlin, M.; Gentile, P.

    2017-10-01

    Black widows and redbacks are binary systems consisting of a millisecond pulsar in a close binary with a companion which is having matter driven off of its surface by the pulsar wind. X-rays due to an intrabinary shock have been observed from many of these systems, as well as orbital variations in the optical emission from the companion due to heating and tidal distortion. We have been systematically studying these systems in radio, optical and X-rays. Here we will present an overview of X-ray and optical studies of these systems, including new XMM-Newton data obtained from several of these systems, along with new optical photometry.

  2. The age and evolution of sociality in Stegodyphus spiders: a molecular phylogenetic perspective

    DEFF Research Database (Denmark)

    Johannesen, Jes; Lubin, Yael; Smith, Deborah R.

    2007-01-01

    suggested to be unstable in evolutionary time, and hence sociality a rare phenomenon in spiders. Based on a partial molecular phylogeny of the genus Stegodyphus, we address the hypothesis that social spiders in this genus are evolutionary transient. We estimate the age of the three social species, test...

  3. Contamination vs. harm-relevant outcome expectancies and covariation bias in spider phobia

    NARCIS (Netherlands)

    de Jong, Peter J.; Peters, Madelon L.

    There is increasing evidence that spiders are not feared because of harmful outcome expectancies but because of disgust and contamination-relevant outcome expectancies. This study investigated the relative strength of contamination- and harm-relevant UCS expectancies and covariation bias in spider

  4. Phylogenomics, Diversification Dynamics, and Comparative Transcriptomics across the Spider Tree of Life.

    Science.gov (United States)

    Fernández, Rosa; Kallal, Robert J; Dimitrov, Dimitar; Ballesteros, Jesús A; Arnedo, Miquel A; Giribet, Gonzalo; Hormiga, Gustavo

    2018-05-07

    Dating back to almost 400 mya, spiders are among the most diverse terrestrial predators [1]. However, despite considerable effort [1-9], their phylogenetic relationships and diversification dynamics remain poorly understood. Here, we use a synergistic approach to study spider evolution through phylogenomics, comparative transcriptomics, and lineage diversification analyses. Our analyses, based on ca. 2,500 genes from 159 spider species, reject a single origin of the orb web (the "ancient orb-web hypothesis") and suggest that orb webs evolved multiple times since the late Triassic-Jurassic. We find no significant association between the loss of foraging webs and increases in diversification rates, suggesting that other factors (e.g., habitat heterogeneity or biotic interactions) potentially played a key role in spider diversification. Finally, we report notable genomic differences in the main spider lineages: while araneoids (ecribellate orb-weavers and their allies) reveal an enrichment in genes related to behavior and sensory reception, the retrolateral tibial apophysis (RTA) clade-the most diverse araneomorph spider lineage-shows enrichment in genes related to immune responses and polyphenic determination. This study, one of the largest invertebrate phylogenomic analyses to date, highlights the usefulness of transcriptomic data not only to build a robust backbone for the Spider Tree of Life, but also to address the genetic basis of diversification in the spider evolutionary chronicle. Copyright © 2018 Elsevier Ltd. All rights reserved.

  5. Neural correlation of successful cognitive behaviour therapy for spider phobia: a magnetoencephalography study.

    Science.gov (United States)

    Wright, Barry; Alderson-Day, Ben; Prendergast, Garreth; Kennedy, Juliette; Bennett, Sophie; Docherty, Mary; Whitton, Clare; Manea, Laura; Gouws, Andre; Tomlinson, Heather; Green, Gary

    2013-12-30

    Cognitive behavioural therapy (CBT) can be an effective treatment for spider phobia, but the underlying neural correlates of therapeutic change are yet to be specified. The present study used magnetoencephalography (MEG) to study responses within the first half second, to phobogenic stimuli in a group of individuals with spider phobia prior to treatment (n=12) and then in nine of them following successful CBT (where they could touch and manage live large common house spiders) at least 9 months later. We also compared responses to a group of age-matched healthy control participants (n=11). Participants viewed static photographs of real spiders, other fear-inducing images (e.g. snakes, sharks) and neutral stimuli (e.g. kittens). Beamforming methods were used to localise sources of significant power changes in response to stimuli. Prior to treatment, participants with spider phobia showed a significant maximum response in the right frontal pole when viewing images of real spiders specifically. No significant frontal response was observed for either control participants or participants with spider phobia post-treatment. In addition, participants' subjective ratings of spider stimuli significantly predicted peak responses in right frontal regions. The implications for understanding brain-based effects of cognitive therapies are discussed. © 2013 Published by Elsevier Ireland Ltd.

  6. Biased interpretation and memory in children with varying levels of spider fear

    NARCIS (Netherlands)

    Klein, A.M.; Titulaer, G.; Simons, C.; Allart, E.; de Gier, E.; Bögels, S.M.; Becker, E.S.; Rinck, M.

    2014-01-01

    This study investigated multiple cognitive biases in children simultaneously, to investigate whether spider-fearful children display an interpretation bias, a recall bias, and source monitoring errors, and whether these biases are specific for spider-related materials. Furthermore, the independent

  7. Photoluminescent properties of spider silk coated with Eu-doped nanoceria

    Energy Technology Data Exchange (ETDEWEB)

    Dmitrović, Svetlana, E-mail: svetlana8@vin.bg.ac.rs [University of Belgrade, Vinča Institute of Nuclear Sciences (Serbia); Nikolić, Marko G.; Jelenković, Branislav [University of Belgrade, Institute of Physics (Serbia); Prekajski, Marija [University of Belgrade, Vinča Institute of Nuclear Sciences (Serbia); Rabasović, Mihailo [University of Belgrade, Institute of Physics (Serbia); Zarubica, Aleksandra [University of Niš, Department of Chemistry, Faculty of Science and Mathematics (Serbia); Branković, Goran [University of Belgrade, Institute for Multidisciplinary Research, Department of Material Science (Serbia); Matović, Branko [University of Belgrade, Vinča Institute of Nuclear Sciences (Serbia)

    2017-02-15

    Spider dragline silk was coated with pure as well as Eu-doped ceria nanopowders at the room temperature. The treatment was done by immersion of the spider silk mesh into aqueous solutions of cerium nitrate (Ce(NO{sub 3}){sub 3}) and ammonium hydroxide (NH{sub 4}OH). Depending on the relationship between Ce{sup 3+} ion and ammonium hydroxide concentration, coated fibers exhibited a different thickness. Obtained materials were studied by means of FESEM. It was found that ceria nanoparticles of average size of 3 nm were coated along spider thread. X-ray diffraction (XRD) and selected-area electron diffraction (SAED) confirmed crystal nature of nanoparticle coating of spider silk. By using Williamson-Hall plots, crystallite size and strain were estimated. EDS measurement confirmed the presence of Eu in spider-Eu-doped ceria composite, and according to FTIR analysis, the interaction between CeO2 and spider silk was proposed. The morphology of obtained composite was observed by TEM. The photoluminescence emission spectra of spider silk coated with Eu-doped ceria were measured with two different excitations of 385 and 466 nm. The two-photon excited auto-fluorescence of spider silk coated with Eu-doped ceria was detected using a nonlinear laser scanning microscope. Obtained composite has a potential as a fluorescent labeling material in diverse applications.

  8. Species richness and composition assessment of spiders in a Mediterranean scrubland

    DEFF Research Database (Denmark)

    Bondoso Cardoso, Pedro Miguel; Henriques, Sérgio S.; Gaspar, Clara

    2009-01-01

    Intensive fieldwork has been undertaken in Portugal in order to develop a standardized and optimized sampling protocol for Mediterranean spiders. The present study had the objectives of testing the use of semi-quantitative sampling for obtaining an exhaustive species richness assessment of spiders...

  9. In Vitro Evaluation of Spider Silk Meshes as a Potential Biomaterial for Bladder Reconstruction

    NARCIS (Netherlands)

    Steins, A.; Dik, P.; Müller, W.H.; Vervoort, S.J.; Reimers, K.; Kubhier, J.W.; Vogt, P.M.; van Apeldoorn, Aart A.; Coffer, P.J.; Schepers, K.

    2015-01-01

    Reconstruction of the bladder by means of both natural and synthetic materials remains a challenge due to severe adverse effects such as mechanical failure. Here we investigate the application of spider major ampullate gland-derived dragline silk from the Nephila edulis spider, a natural biomaterial

  10. Active optical sensor assessment of spider mite damage on greenhouse beans and cotton

    Science.gov (United States)

    The two-spotted spider mite, Tetranychus urticae Koch is an important pest of cotton in mid-southern United States and causes yield reduction, and deprivation in fiber fitness. A greenhouse colony of the spider mite was used to infest cotton and pinto beans at the three-leaf and trifoliate stages, r...

  11. Utility Assessment Report for SPIDERS Phase 2: Ft. Carson (Rev 1.0)

    Energy Technology Data Exchange (ETDEWEB)

    Barr, Jonathan L. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Tuffner, Francis K. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Hadley, Mark D. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Schneider, Kevin P. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States)

    2014-01-01

    This document contains the Utility Assessment Report (UAR) for the Phase 2 operational Demonstration (OD) of the Smart Power Infrastructure Demonstration for Energy Reliability and Security (SPIDERS) Joint Capability Technology Demonstration (JCTD). The UAR for Phase 2 shows that the SPIDERS system was able to meet the requirements of the Implementation Directive at Ft. Carson.

  12. High School Students' Attitudes Towards Spiders: A cross-cultural comparison

    Science.gov (United States)

    Prokop, Pavol; Tolarovičová, Andrea; Camerik, Anne M.; Peterková, Viera

    2010-08-01

    Spiders are traditionally considered to be among the least popular of animals. Current evidence suggests that a negative attitude towards spiders could be influenced by both cultural and evolutionary pressures. Some researchers suggest that science education activities could positively influence students' perceptions of spiders. Their evidence is, however, ambivalent. Using a five-point score Likert-type questionnaire in which the items were developed in a similar way to four of Kellert's categories of attitude (scientistic, negativistic, naturalistic, and ecologistic) towards invertebrates, we compared the level of knowledge of and attitudes towards spiders of high school students from two countries, Slovakia (n = 354) and South Africa (n = 382). The students represented different cultures and followed dissimilar science education curricula. Only among the Slovakian students there was a statistically significant but low correlation between knowledge and attitude (r = 0.30). The South African students scored higher in the categories of scientistic, naturalistic, and ecologistic attitudes. Comparison of attitude towards spiders of indigenous Africans from coeducational Catholic schools revealed that South African students have greater fear of spiders than Slovakian students, supporting the biological preparedness hypothesis. This hypothesis predicts a greater fear of spiders in South Africa than in Europe since several South African spiders possess venoms that are dangerous to humans. The results of this study are discussed from science education, cultural, and evolutionary perspectives.

  13. Pupils' Views about Spiders. Learning in Science Project (Primary). Working Paper No. 123.

    Science.gov (United States)

    Hawe, Eleanor

    The Learning in Science Project (Primary)--LISP(P)--investigated the ideas and interests about spiders held by 8- to 10-year-old children. Data included 303 questions--and answers to some of the questions--about spiders obtained from children in four classes and from responses obtained during individual interviews with 10 children from each age…

  14. Extended survival of spiders (Aranaeae) feeding on whitefly (Homoptera: Aleyrodidae) honeydew

    Science.gov (United States)

    Honeydew produced by homopteran insects such as aphids, whiteflies and mealybugs, can be abundant in some crops and may represent an important food resource for spiders and other honeydew feeding natural enemies. Woolly whiteflies are common in south Texas citrus, and spiders consistently make up a...

  15. Methods of assembling and disassembling spider and burnable poison rod structures for nuclear reactors

    International Nuclear Information System (INIS)

    Walton, L.A.

    1981-01-01

    A method is described of joining burnable poison rods to the spider arms of a pressurised water power reactor fuel assembly which is proof against the reactor core environment but permits these rods to be removed from the spider simply, swiftly and delicately. (U.K.)

  16. A Web of Learning: Beyond "Itsy Bitsy Spider," Preschool Students Learn Science Content Naturally

    Science.gov (United States)

    Evitt, Marie Faust

    2011-01-01

    One of the author's biggest challenges as a preschool teacher is helping children in a group see and touch and do. Hands-on explorations are important for everyone, but essential for young children. How can young children do hands-on explorations of spiders and their webs? Teachers do not want children handling all sorts of spiders. They worry…

  17. Spider foraging strategy affects trophic cascades under natural and drought conditions.

    Science.gov (United States)

    Liu, Shengjie; Chen, Jin; Gan, Wenjin; Schaefer, Douglas; Gan, Jianmin; Yang, Xiaodong

    2015-07-23

    Spiders can cause trophic cascades affecting litter decomposition rates. However, it remains unclear how spiders with different foraging strategies influence faunal communities, or present cascading effects on decomposition. Furthermore, increased dry periods predicted in future climates will likely have important consequences for trophic interactions in detritus-based food webs. We investigated independent and interactive effects of spider predation and drought on litter decomposition in a tropical forest floor. We manipulated densities of dominant spiders with actively hunting or sit-and-wait foraging strategies in microcosms which mimicked the tropical-forest floor. We found a positive trophic cascade on litter decomposition was triggered by actively hunting spiders under ambient rainfall, but sit-and-wait spiders did not cause this. The drought treatment reversed the effect of actively hunting spiders on litter decomposition. Under drought conditions, we observed negative trophic cascade effects on litter decomposition in all three spider treatments. Thus, reduced rainfall can alter predator-induced indirect effects on lower trophic levels and ecosystem processes, and is an example of how such changes may alter trophic cascades in detritus-based webs of tropical forests.

  18. Photoluminescent properties of spider silk coated with Eu-doped nanoceria

    International Nuclear Information System (INIS)

    Dmitrović, Svetlana; Nikolić, Marko G.; Jelenković, Branislav; Prekajski, Marija; Rabasović, Mihailo; Zarubica, Aleksandra; Branković, Goran; Matović, Branko

    2017-01-01

    Spider dragline silk was coated with pure as well as Eu-doped ceria nanopowders at the room temperature. The treatment was done by immersion of the spider silk mesh into aqueous solutions of cerium nitrate (Ce(NO_3)_3) and ammonium hydroxide (NH_4OH). Depending on the relationship between Ce"3"+ ion and ammonium hydroxide concentration, coated fibers exhibited a different thickness. Obtained materials were studied by means of FESEM. It was found that ceria nanoparticles of average size of 3 nm were coated along spider thread. X-ray diffraction (XRD) and selected-area electron diffraction (SAED) confirmed crystal nature of nanoparticle coating of spider silk. By using Williamson-Hall plots, crystallite size and strain were estimated. EDS measurement confirmed the presence of Eu in spider-Eu-doped ceria composite, and according to FTIR analysis, the interaction between CeO2 and spider silk was proposed. The morphology of obtained composite was observed by TEM. The photoluminescence emission spectra of spider silk coated with Eu-doped ceria were measured with two different excitations of 385 and 466 nm. The two-photon excited auto-fluorescence of spider silk coated with Eu-doped ceria was detected using a nonlinear laser scanning microscope. Obtained composite has a potential as a fluorescent labeling material in diverse applications.

  19. Spectral response of spider mite infested cotton: Mite density and miticide rate study

    Science.gov (United States)

    Two-spotted spider mites are important pests in many agricultural systems. Spider mites (Acari: Tetranychidae) have been found to cause economic damage in corn, cotton, and sorghum. Adult glass vial bioassays indicate that Temprano™ (abamectin) is the most toxic technical miticide for adult two-spot...

  20. Differences among plant species in acceptance by the spider mite Tetranychus urticae Koch

    NARCIS (Netherlands)

    Boom, van den C.E.M.; Beek, van T.A.; Dicke, M.

    2003-01-01

    The spider mite Tetranychus urticae Koch has a broad range of host plants. However, the spider mite does not accept all plants to the same degree because of differences in nutritive and toxic constituents. Other factors, such as the induction of secondary metabolites, the morphology of a leaf

  1. Parasitization of a huntsman spider (Arachnida: Araneae: Sparassidae: Heteropoda venatoria by a mermithid nematode (Nematoda: Mermithidae

    Directory of Open Access Journals (Sweden)

    Sachin P. Ranade

    2016-11-01

    Full Text Available The emergence of a mermithid worm from a huntsman spider Heteropoda venatoria was witnessed at Buxa Tiger Reserve, West Bengal.  It appears to be a first record of the spider family Sparassidae serving as a host for a member of the family Mermithidae. 

  2. Brown Fat and Browning for the Treatment of Obesity and Related Metabolic Disorders

    Directory of Open Access Journals (Sweden)

    So Hun Kim

    2016-01-01

    Full Text Available Brown fat is a specialized fat depot that can increase energy expenditure and produce heat. After the recent discovery of the presence of active brown fat in human adults and novel transcription factors controlling brown adipocyte differentiation, the field of the study of brown fat has gained great interest and is rapidly growing. Brown fat expansion and/or activation results in increased energy expenditure and a negative energy balance in mice and limits weight gain. Brown fat is also able to utilize blood glucose and lipid and results in improved glucose metabolism and blood lipid independent of weight loss. Prolonged cold exposure and beta adrenergic agonists can induce browning of white adipose tissue. The inducible brown adipocyte, beige adipocyte evolving by thermogenic activation of white adipose tissue have different origin and molecular signature from classical brown adipocytes but share the characteristics of high mitochondria content, UCP1 expression and thermogenic capacity when activated. Increasing browning may also be an efficient way to increase whole brown fat activity. Recent human studies have shown possibilities that findings in mice can be reproduced in human, making brown fat a good candidate organ to treat obesity and its related disorders.

  3. The path to the nest of spiders The path to the nest of spiders

    Directory of Open Access Journals (Sweden)

    Eliane Luz Bayer

    2008-04-01

    Full Text Available Italo Calvino writes in his preface to The Path to the Nest of Spiders that the novel answers to the "ripeness of the time" since ht wrote it after wartime, a period when everyone had a tale to tell. He tells us that this is a story in which iobody is a hero and nobody has the class consciousness necessary to unify them in the struggle. Calvino acknowledges that it was difficult to conciliate his experiences with the postwar literary movement which he calls Neo-expresSionism, a term which, he thinks, describes better Italian Neo-realism. This is a book with a full realistic depictior of the incongruousness of the whole situation, showing rumen beings driven by loneliness, aggressiveness, unfulfilment and failure to meet, their nerves frayed by the War. It reveals human beings in their weaknesses, subjected to deterministic fates changing roles according to circumstance. Partisans shift to the Nazi side and inform on their f rmer allies and vice-versa, being later chased in revenge. The novel has as its setting Italy under Fascism and unde German occupation, the Italian people being divided betw en the fascists of the "Black Brigade" and the "Partisa4s" who belonged to the Resistance. Although this is a pOlitical book, it has universal appeal. At the same time that it livens up historical facts about the period, it moves our feelings. Calvino's book is about World War II as it is viewed and felt by a small outcast, Pin, who makes considerable efforts to be accepted and understood by adults. In his daily life Pinsuffers the consequences Of the war. His aggressive disposition reflects the environment which he has been brought up in: since he was born, his country has been at war. Besides that, his only sister is a whore, whom he hates and despises. Italo Calvino writes in his preface to The Path to the Nest of Spiders that the novel answers to the "ripeness of the time" since ht wrote it after wartime, a period when everyone had a tale to tell

  4. Factors that influence the beta-diversity of spider communities in northwestern Argentinean Grasslands

    Directory of Open Access Journals (Sweden)

    Sandra M. Rodriguez-Artigas

    2016-04-01

    Full Text Available Beta-diversity, defined as spatial replacement in species composition, is crucial to the understanding of how local communities assemble. These changes can be driven by environmental or geographic factors (such as geographic distance, or a combination of the two. Spiders have been shown to be good indicators of environmental quality. Accordingly, spiders are used in this work as model taxa to establish whether there is a decrease in community similarity that corresponds to geographic distance in the grasslands of the Campos & Malezales ecoregion (Corrientes. Furthermore, the influence of climactic factors and local vegetation heterogeneity (environmental factors on assemblage composition was evaluated. Finally, this study evaluated whether the differential dispersal capacity of spider families is a factor that influences their community structure at a regional scale. Spiders were collected with a G-Vac from vegetation in six grassland sites in the Campos & Malezales ecoregion that were separated by a minimum of 13 km. With this data, the impact of alpha-diversity and different environmental variables on the beta-diversity of spider communities was analysed. Likewise, the importance of species replacement and nesting on beta-diversity and their contribution to the regional diversity of spider families with different dispersion capacities was evaluated. The regional and site-specific inventories obtained were complete. The similarity between spider communities declined as the geographic distance between sites increased. Environmental variables also influenced community composition; stochastic events and abiotic forces were the principal intervening factors in assembly structure. The differential dispersal capacity of spider groups also influenced community structure at a regional scale. The regional beta-diversity, as well as species replacement, was greater in high and intermediate vagility spiders; while nesting was greater in spiders with low

  5. Association of spiders and lichen on Robben Island, South Africa: a case report

    Directory of Open Access Journals (Sweden)

    A. Mukherjee

    2010-04-01

    Full Text Available The present study is a firstrecord of spider occurrence on Robben Island, South Africa. Some habitats were rich in lichens. As we know, lichens enhance wildlife habitat in less direct ways. The objective of the study was to examine the potential importance of lichens in enriching spider diversity and abundance. A total of 260 spiders (170 from lichens and 90 from bush were collected following the visual search method over one year. Seasonal trends in overall species richness and abundance indicated that the relative density of spiders was greater in lichens than in bushes. The result suggests that habitat structure, such as branch size and epiphytic lichen abundance, can be an explanation for the greater number of spiders in lichen-rich patches of the island.

  6. Intercropping With Fruit Trees Increases Population Abundance and Alters Species Composition of Spider Mites on Cotton.

    Science.gov (United States)

    Li, Haiqiang; Pan, Hongsheng; Wang, Dongmei; Liu, Bing; Liu, Jian; Zhang, Jianping; Lu, Yanhui

    2018-05-05

    With the recent increase in planting of fruit trees in southern Xinjiang, the intercropping of fruit trees and cotton has been widely adopted. From 2014 to 2016, a large-scale study was conducted in Aksu, an important agricultural area in southern Xinjiang, to compare the abundance and species composition of spider mites in cotton fields under jujube-cotton, apple-cotton, and cotton monocrop systems. The abundance of spider mites in cotton fields under both intercropping systems was generally higher than in the cotton monocrop. The species composition of spider mites also differed greatly between cotton intercropped with apple or jujube compared to the cotton monocrop. The relative proportion of Tetranychus truncates Ehara (Acari: Tetranychidae) in the species complex generally increased while that of another spider mite, Tetranychus dunhuangensis Wang (Acari: Tetranychidae), decreased under fruit tree-cotton systems. More attention should be paid to the monitoring and management of spider mites, especially T. truncates in this important region of China.

  7. Distribution and importance of spiders inhabiting a Brazilian sugar cane plantation

    Directory of Open Access Journals (Sweden)

    Isabela Maria Piovesan Rinaldi

    2002-07-01

    Full Text Available The spider fauna (Araneae of a sugar eane plantation was surveyed monthly by hand colteetion and beating vegetation in sugar cane fields across Botucatu, State of São Paulo, Brazil. Composition and rchness (family and species where identifieation to species was possible microhabitat preferenees were reeorded, and diversity and evenness indices were calculated. A total of 1291 spiders belonging to 73 species and 20 families were collected. The most diverse families were Theridiidae, Salticidae, and Araneidae, and the most abundant ones were Theridiidae, Saltieidae, Anyphaenidae, and Araneidae, Seven species represented 58.6% of the total fauna, with Crysso pulcherrima (Mello-Leitão,1917 (Theridiidae composing 28.2%. About 65% of the spiders occupied the upper part of the plants (above 20 cm. Five spider species were present in the sugar cane throughout crop development. Evidence of spiders feeding on sugar cane pest species was observed.

  8. The time course of location-avoidance learning in fear of spiders.

    Science.gov (United States)

    Rinck, Mike; Koene, Marieke; Telli, Sibel; Moerman-van den Brink, Wiltine; Verhoeven, Barbara; Becker, Eni S

    2016-01-01

    Two experiments were designed to study the time course of avoidance learning in spider fearfuls (SFs) under controlled experimental conditions. To achieve this, we employed an immersive virtual environment (IVE): While walking freely through a virtual art museum to search for specific paintings, the participants were exposed to virtual spiders. Unbeknown to the participants, only two of four museum rooms contained spiders, allowing for avoidance learning. Indeed, the more SF the participants were, the faster they learned to avoid the rooms that contained spiders (Experiment. 1), and within the first six trials, high fearfuls already developed a preference for starting their search task in rooms without spiders (Experiment 2). These results illustrate the time course of avoidance learning in SFs, and they speak to the usefulness of IVEs in fundamental anxiety research.

  9. Spider genomes provide insight into composition and evolution of venom and silk

    Science.gov (United States)

    Sanggaard, Kristian W.; Bechsgaard, Jesper S.; Fang, Xiaodong; Duan, Jinjie; Dyrlund, Thomas F.; Gupta, Vikas; Jiang, Xuanting; Cheng, Ling; Fan, Dingding; Feng, Yue; Han, Lijuan; Huang, Zhiyong; Wu, Zongze; Liao, Li; Settepani, Virginia; Thøgersen, Ida B.; Vanthournout, Bram; Wang, Tobias; Zhu, Yabing; Funch, Peter; Enghild, Jan J.; Schauser, Leif; Andersen, Stig U.; Villesen, Palle; Schierup, Mikkel H; Bilde, Trine; Wang, Jun

    2014-01-01

    Spiders are ecologically important predators with complex venom and extraordinarily tough silk that enables capture of large prey. Here we present the assembled genome of the social velvet spider and a draft assembly of the tarantula genome that represent two major taxonomic groups of spiders. The spider genomes are large with short exons and long introns, reminiscent of mammalian genomes. Phylogenetic analyses place spiders and ticks as sister groups supporting polyphyly of the Acari. Complex sets of venom and silk genes/proteins are identified. We find that venom genes evolved by sequential duplication, and that the toxic effect of venom is most likely activated by proteases present in the venom. The set of silk genes reveals a highly dynamic gene evolution, new types of silk genes and proteins, and a novel use of aciniform silk. These insights create new opportunities for pharmacological applications of venom and biomaterial applications of silk. PMID:24801114

  10. Community structure of spiders in coastal habitats of a Mediterranean delta region (Nestos Delta, NE Greece

    Directory of Open Access Journals (Sweden)

    S. Buchholz

    2009-01-01

    Full Text Available (pp 101-115Habitat zonation and ecology of spider assemblages have been poorly studied in Mediterranean ecosystems. A first analysis of spider assemblages in coastal habitats in the east Mediterranean area is presented. The study area is the 250 km² Nestos Delta, located in East Macedonia in the North-East of Greece. Spiders were caught in pitfall traps at 17 sites from the beginning of April to the end of June 2004. Nonparametric estimators were used to determine species richness and alpha diversity. Ordination analysis (redundancy analysis indicated four clearly separable spider species groups (salt meadows, dunes, mea-dows and floodplain forests, along a soil salinity and moisture gradient. Based on these results we discuss the habitat preferences of these spiders and include the first ecological data on several species.

  11. Brown dwarf disks with ALMA

    Energy Technology Data Exchange (ETDEWEB)

    Ricci, L.; Isella, A. [Department of Astronomy, California Institute of Technology, MC 249-17, Pasadena, CA 91125 (United States); Testi, L.; De Gregorio-Monsalvo, I. [European Southern Observatory, Karl-Schwarzschild-Strasse 2, D-85748 Garching (Germany); Natta, A. [INAF-Osservatorio Astrofisico di Arcetri, Largo E. Fermi 5, I-50125 Firenze (Italy); Scholz, A., E-mail: lricci@astro.caltech.edu [School of Cosmic Physics, Dublin Institute for Advanced Studies, 31 Fitzwilliam Place, Dublin 2 (Ireland)

    2014-08-10

    We present Atacama Large Millimeter/submillimeter Array continuum and spectral line data at 0.89 mm and 3.2 mm for three disks surrounding young brown dwarfs and very low mass stars in the Taurus star forming region. Dust thermal emission is detected and spatially resolved for all the three disks, while CO(J = 3-2) emission is seen in two disks. We analyze the continuum visibilities and constrain the disks' physical structure in dust. The results of our analysis show that the disks are relatively large; the smallest one has an outer radius of about 70 AU. The inferred disk radii, radial profiles of the dust surface density, and disk to central object mass ratios lie within the ranges found for disks around more massive young stars. We derive from our observations the wavelength dependence of the millimeter dust opacity. In all the three disks, data are consistent with the presence of grains with at least millimeter sizes, as also found for disks around young stars, and confirm that the early stages of the solid growth toward planetesimals occur also around very low-mass objects. We discuss the implications of our findings on models of solids evolution in protoplanetary disks, the main mechanisms proposed for the formation of brown dwarfs and very low-mass stars, as well as the potential of finding rocky and giant planets around very low-mass objects.

  12. Cognitive reappraisal of snake and spider pictures: An event-related potentials study.

    Science.gov (United States)

    Langeslag, Sandra J E; van Strien, Jan W

    2018-05-30

    Fear of snakes and spiders are common animal phobias. Emotion regulation can change the response to emotional stimuli, including snakes and spiders. It is well known that emotion regulation modulates the late positive potential (LPP), which reflects sustained motivated attention. However, research concerning the effect of emotion regulation on the early posterior negativity (EPN), which reflects early selective attention, is scarce. The present research question was whether the EPN and LPP amplitudes are modulated by regulation of emotional responses to snake and spider stimuli. Emotion up- and down-regulation were expected to enhance and reduce the LPP amplitude, respectively, but emotion regulation was not expected to modulate the EPN amplitude. Female participants passively viewed snake, spider, and bird pictures, and up- and down-regulated their emotional responses to the snake and spider pictures using self-focused reappraisal, while their electroencephalogram was recorded. There were EPNs for snakes and spiders vs. birds, as well as for snakes vs. spiders. The LPP amplitude tended to be enhanced for snakes and spiders compared to birds. Most importantly, the LPP amplitude was larger in the up-regulate than in the down-regulate condition for both snakes and spiders, but there was no evidence that the EPN amplitude was modulated by emotion regulation. This suggests that emotion regulation modulated sustained motivated attention, but not early selective attention, to snakes and spiders. The findings are in line with the notion that the emotional modulation of the EPN is more automatic than the emotional modulation of the LPP. Copyright © 2018 Elsevier B.V. All rights reserved.

  13. Thermochemical modelling of brown dwarf discs

    NARCIS (Netherlands)

    Greenwood, A. J.; Kamp, I.; Waters, L. B. F. M.; Woitke, P.; Thi, W.-F.; Rab, Ch.; Aresu, G.; Spaans, M.

    The physical properties of brown dwarf discs, in terms of their shapes and sizes, are still largely unexplored by observations. ALMA has by far the best capabilities to observe these discs in sub-mm CO lines and dust continuum, while also spatially resolving some discs. To what extent brown dwarf

  14. Isolation of glycoproteins from brown algae

    DEFF Research Database (Denmark)

    2015-01-01

    The present invention relates to a novel process for the isolation of unique anti-oxidative glycoproteins from the pH precipitated fractions of enzymatic extracts of brown algae. Two brown seaweeds viz, Fucus serratus and Fucus vesiculosus were hydrolysed by using 3 enzymes viz, Alcalase, Viscozyme...

  15. Thyroid hormones induce browning of white fat

    Science.gov (United States)

    Martínez-Sánchez, Noelia; Moreno-Navarrete, José M; Contreras, Cristina; Rial-Pensado, Eva; Fernø, Johan; Nogueiras, Rubén; Diéguez, Carlos

    2016-01-01

    The canonical view about the effect of thyroid hormones (THs) on thermogenesis assumes that the hypothalamus acts merely as a modulator of the sympathetic outflow on brown adipose tissue (BAT). Recent data have challenged that vision by demonstrating that THs act on the ventromedial nucleus of the hypothalamus (VMH) to inhibit AMP-activated protein kinase (AMPK), which regulates the thermogenic program in BAT, leading to increased thermogenesis and weight loss. Current data have shown that in addition to activation of brown fat, the browning of white adipose tissue (WAT) might also be an important thermogenic mechanism. However, the possible central effects of THs on the browning of white fat remain unclear. Here, we show that 3,3′,5,5′ tetraiodothyroxyne (T4)-induced hyperthyroidism promotes a marked browning of WAT. Of note, central or VMH-specific administration of 3,3′,5-triiodothyronine (T3) recapitulates that effect. The specific genetic activation of hypothalamic AMPK in the VMH reversed the central effect of T3 on browning. Finally, we also showed that the expression of browning genes in human WAT correlates with serum T4. Overall, these data indicate that THs induce browning of WAT and that this mechanism is mediated via the central effects of THs on energy balance. PMID:27913573

  16. Beneficial Effects of Ants and Spiders on the Reproductive Value of Eriotheca gracilipes (Malvaceae) in a Tropical Savanna.

    Science.gov (United States)

    Stefani, Vanessa; Pires, Tayna Lopes; Torezan-Silingardi, Helena Maura; Del-Claro, Kleber

    2015-01-01

    Predators affect plant fitness when they forage on them and reduce the action of herbivores. Our study evaluates the complementary effects of spiders and ants that visit the extrafloral nectaries of Eriotheca gracilipes (Malvaceae) on the production of fruits and viable seeds of these savanna trees. Four experimental groups were established: control group - with free access of spiders and ants; exclusion group - spiders and ants excluded; ant group - absence of spiders; and spider group - absence of ants. The presence of ants reduced the spider richness; however, the presence of spiders did not affect the ant richness. A significantly higher number of fruits per buds were found in the presence of spiders alone or spiders and ants together (control group) compared with the absence of both predators (exclusion group). The number of seeds per fruits and seed viability were higher in the control group. This is the first study showing that spiders and ants may exert a positive and complementary effect on the reproductive value of an extrafloral nectaried plant. Mostly the impact of ants and/or spiders on herbivores is considered, whereas our study reinforces the importance of evaluating the effect of multiple predators simultaneously, exploring how the interactions among predators with distinct skills may affect the herbivores and the plants on which they forage.

  17. Can ant-eating Zodarion spiders (Araneae: Zodariidae) develop on a diet optimal for euryphagous arthropod predators?

    DEFF Research Database (Denmark)

    Pekar, Stano; Toft, Søren

    2009-01-01

    . Such adaptations may then entail trade-offs in handling and utilization of alternative prey. To investigate behavioural as well as nutritional adaptations and the occurrence of the corresponding trade-offs in two ant-eating spiders of the genus Zodarion [Zodarion atlanticum Pekár & Cardoso and Zodarion germanicum...... (C. L. Koch)], spiders are reared on two diets: ants (i.e. their preferred prey) and fruit flies (i.e. an alternative prey that is nutritionally optimal for euryphagous spiders). Food consumption is observed and several fitness-related life-history parameters are measured. Although spiders readily...... accept ants, more than one-third of 35 spiders refuse to consume fruit flies and starve. Furthermore, severe hunger does not induce these individuals to accept fruit flies. Starving spiders die before moulting to the second stadium. Spiders that eat fruit flies increase only little and slowly in weight...

  18. From Midges to Spiders: Mercury Biotransport in Riparian Zones Near the Buffalo River Area of Concern (AOC), USA.

    Science.gov (United States)

    Pennuto, C M; Smith, M

    2015-12-01

    Riparian communities can receive environmental contaminants from adjacent aquatic 'donor' habitats. We investigated mercury biotransport from aquatic to terrestrial habitats via aquatic insect emergence and uptake by riparian spiders at sites within and upstream of the Buffalo River Area of Concern (AOC), a site with known sediment Hg contamination. Mercury concentration in emerging midges was roughly 10× less than contaminated sediment levels with the AOC, but biomagnification factors from midges to spiders ranged from 2.0 to 2.65 between sites. There was a significantly negative body mass:total mercury relationship in spiders (p Spiders contained significantly more mercury than their midge prey and spiders upstream of the AOC had higher mercury concentrations than spiders from within the AOC. Collectively, these data indicate that riparian spiders can be good mercury sentinels in urban environments, and that riparian communities upstream from the AOC may be at greater risk to mercury than has been previously considered.

  19. Spider monkey, Muriqui and Woolly monkey relationships revisited.

    Science.gov (United States)

    de Lima, Margarida Maria Celeira; Sampaio, Iracilda; Vieira, Ricardo dos Santos; Schneider, Horacio

    2007-01-01

    The taxonomic relationships among the four genera of the Atelidae family, Alouatta (Howler), Ateles (Spider), Lagothrix (Woolly) and Brachyteles (Muriqui), have been the subject of great debate. In general, almost all authors agree with the assignment of Howler monkeys as the basal genus, either in its own tribe Alouattini or in the subfamily Alouattinae, but they disagree on the associations among the other members of the family. Muriquis have been grouped with Spider monkeys based on the fact that they share various behavioral and morphological characteristics. Cladistic analyses using morphological, biochemical, karyotype and behavioral characteristics depicted a phylogenetic tree that places Howler as the basal genus and the remaining genera in an unresolved politomy. More recent studies using molecular data have suggested that Muriqui and Woolly monkeys are sister groups. However, a recent study based on nuclear and mtDNA argued that politomy is what best represents the relationships among Spider, Woolly and Muriqui. To contribute to this debate we have added new data from two nuclear genes, Transferrin and von Willebrand Factor, and using an alignment of 17,997 bp we demonstrate that a total analysis strongly supports the Muriqui-Woolly clade. A gene-to-gene approach showed that four of the eight nuclear genes provide support for the Muriqui-Woolly clade, two strongly and two moderately, while none of the eight genes provide support for any alternative arrangement. The mitochondrial genes were not able to resolve the politomy. A possible reason for the difficulty in resolving atelid relationships may be the short period of time separating each cladogenetic event in the evolutionary process that shaped this family.

  20. SPIDERS (ARANEI IN HEPRETOBIONT MESOFAUNA OF THE NORTHWEST CAUCASUS

    Directory of Open Access Journals (Sweden)

    A. V. Ponomarev

    2014-01-01

    Full Text Available Abstract. Aim. We discussed in previous work a herpetobiont fauna of arachnids (Arachnida from the isolated yewboxwood wood, located in the Caucasian State Biosphere Reserve, 20 km near Sochi (Ponomarev, Chumachenko, 2007. The aim of the paper is to summarize available data about herpetobiont araneofauna of the Northwest Caucasus. Location. Republic of Adygea, Russia.Methods. Material was collected in 2009 on north macroslope of Main Caucasian Ridge within the territory of the Caucasian State Biosphere Reserve between 1000–1820 m. The following plant communities are studied: beech-silver fir (assotiation Abieti-Fagetion orientalis Korotkov et Belonovskaya 1987, maple forest (assotiation Petasito albae-Abietetum nordmannianae subassotiation Aceretosum trautvetteri Francuzov 2006, subalpine meadow (assotiation Poa longifolii – Calamagrostietum arundinaceae Semagina, 1992. Soil traps were used for collection of spiders.Results and main conclusions. During the period of study 100 species of spiders from 19 families are registered. Most diverse araneofauna of subalpine meadows includs 54 species belonging to 14 families. The least diverse araneofauna is in maple forest (24 species of 7 families. In beech-silver fir includes 45 species of 16 families of spiders. Only 3 species (Pireneitega ovtchinnikovi, Cybaeus abchasicus, Tenuiphantes mengei were found in all surveyed habitats. These 3 species clearly tend to forest habitats. Herpetobiont araneofauna of the Northwest Caucasus characterized by high taxonomic diversity with clear predominance of representatives of the family Linyphiidae. Specificity of araneofauna in different types of plant communities is high.

  1. Variation in Protein Intake Induces Variation in Spider Silk Expression

    Science.gov (United States)

    Blamires, Sean J.; Wu, Chun-Lin; Tso, I-Min

    2012-01-01

    Background It is energetically expensive to synthesize certain amino acids. The proteins (spidroins) of spider major ampullate (MA) silk, MaSp1 and MaSp2, differ in amino acid composition. Glutamine and proline are prevalent in MaSp2 and are expensive to synthesize. Since most orb web spiders express high proline silk they might preferentially attain the amino acids needed for silk from food and shift toward expressing more MaSp1 in their MA silk when starved. Methodology/Principal Findings We fed three spiders; Argiope aetherea, Cyrtophora moluccensis and Leucauge blanda, high protein, low protein or no protein solutions. A. aetherea and L. blanda MA silks are high in proline, while C. moluccesnsis MA silks are low in proline. After 10 days of feeding we determined the amino acid compositions and mechanical properties of each species' MA silk and compared them between species and treatments with pre-treatment samples, accounting for ancestry. We found that the proline and glutamine of A. aetherea and L. blanda silks were affected by protein intake; significantly decreasing under the low and no protein intake treatments. Glutmaine composition in C. moluccensis silk was likewise affected by protein intake. However, the composition of proline in their MA silk was not significantly affected by protein intake. Conclusions Our results suggest that protein limitation induces a shift toward different silk proteins with lower glutamine and/or proline content. Contradictions to the MaSp model lie in the findings that C. moluccensis MA silks did not experience a significant reduction in proline and A. aetherea did not experience a significant reduction in serine on low/no protein. The mechanical properties of the silks could not be explained by a MaSp1 expressional shift. Factors other than MaSp expression, such as the expression of spidroin-like orthologues, may impact on silk amino acid composition and spinning and glandular processes may impact mechanics. PMID:22363691

  2. The Linking Probability of Deep Spider-Web Networks

    OpenAIRE

    Pippenger, Nicholas

    2005-01-01

    We consider crossbar switching networks with base $b$ (that is, constructed from $b\\times b$ crossbar switches), scale $k$ (that is, with $b^k$ inputs, $b^k$ outputs and $b^k$ links between each consecutive pair of stages) and depth $l$ (that is, with $l$ stages). We assume that the crossbars are interconnected according to the spider-web pattern, whereby two diverging paths reconverge only after at least $k$ stages. We assume that each vertex is independently idle with probability $q$, the v...

  3. Aggression and conflict management at fusion in spider monkeys.

    Science.gov (United States)

    Aureli, Filippo; Schaffner, Colleen M

    2007-04-22

    In social systems characterized by a high degree of fission-fusion dynamics, members of a large community are rarely all together, spending most of their time in smaller subgroups with flexible membership. Although fissioning into smaller subgroups is believed to reduce conflict among community members, fusions may create conflict among individuals from joining subgroups. Here, we present evidence for aggressive escalation at fusion and its mitigation by the use of embraces in wild spider monkeys (Ateles geoffroyi). Our findings provide the first systematic evidence for conflict management at fusion and may have implications for the function of human greetings.

  4. Structure determination of spider silk from X-ray images

    Energy Technology Data Exchange (ETDEWEB)

    Ulrich, Stephan; Zippelius, Annette [Universitaet Goettingen, Institut fuer Theoretische Physik (Germany); Meling, Martin [Max-Planck-Institut fuer biophysikalische Chemie, Goettingen (Germany); Glisovic, Anja; Salditt, Tim [Universitaet Goettingen, Institut fuer Roentgenphysik (Germany)

    2008-07-01

    Spider silk consists of interconnected crystallites, which are typically aligned along the fiber axis. We present a method to systematically determine the structure of these crystallites. Hereby we introduce a model that calculates the scattering function G(q) which is fitted to the measured X-ray image (silk from nephila clavipes). With it, the crystallites' size, the constitution and dimensions of their unit cell, as well as their tilt with respect to the fiber axis is identified, and furthermore the effect of coherent scattering from different crystallites is investigated. The shown methods and the presented model can easily be generalized to a wide class of composite materials.

  5. Ineffective crypsis in a crab spider: a prey community perspective

    OpenAIRE

    Brechbühl, Rolf; Casas, Jérôme; Bacher, Sven

    2009-01-01

    Cryptic coloration is assumed to be beneficial to predators because of an increased encounter rate with unwary prey. This hypothesis is, however, very rarely, if ever, studied in the field. The aim of this study was to quantify the encounter rate and capture success of an ambush predator, in the field, as a function of its level of colour-matching with the background. We used the crab spider Misumena vatia, which varies its body colour and can thereby match the colour of the flower it hunts u...

  6. A Tank Bromeliad Favors Spider Presence in a Neotropical Inundated Forest.

    Directory of Open Access Journals (Sweden)

    Yann Hénaut

    Full Text Available Tank bromeliads are good models for understanding how climate change may affect biotic associations. We studied the relationships between spiders, the epiphytic tank bromeliad, Aechmea bracteata, and its associated ants in an inundated forest in Quintana Roo, Mexico, during a drought period while, exceptionally, this forest was dry and then during the flooding that followed. We compared spider abundance and diversity between 'Aechmea-areas' and 'control-areas' of the same surface area. We recorded six spider families: the Dipluridae, Ctenidae, Salticidae, Araneidae, Tetragnathidae and Linyphiidae among which the funnel-web tarantula, Ischnothele caudata, the only Dipluridae noted, was the most abundant. During the drought period, the spiders were more numerous in the Aechmea-areas than in the control-areas, but they were not obligatorily associated with the Aechmea. During the subsequent flooding, the spiders were concentrated in the A. bracteata patches, particularly those sheltering an ant colony. Also, a kind of specificity existed between certain spider taxa and ant species, but varied between the drought period and subsequent flooding. We conclude that climatic events modulate the relationship between A. bracteata patches and their associated fauna. Tank bromeliads, previously considered only for their ecological importance in supplying food and water during drought, may also be considered refuges for spiders during flooding. More generally, tank bromeliads have an important role in preserving non-specialized fauna in inundated forests.

  7. A Tank Bromeliad Favors Spider Presence in a Neotropical Inundated Forest.

    Science.gov (United States)

    Hénaut, Yann; Corbara, Bruno; Pélozuelo, Laurent; Azémar, Frédéric; Céréghino, Régis; Herault, Bruno; Dejean, Alain

    2014-01-01

    Tank bromeliads are good models for understanding how climate change may affect biotic associations. We studied the relationships between spiders, the epiphytic tank bromeliad, Aechmea bracteata, and its associated ants in an inundated forest in Quintana Roo, Mexico, during a drought period while, exceptionally, this forest was dry and then during the flooding that followed. We compared spider abundance and diversity between 'Aechmea-areas' and 'control-areas' of the same surface area. We recorded six spider families: the Dipluridae, Ctenidae, Salticidae, Araneidae, Tetragnathidae and Linyphiidae among which the funnel-web tarantula, Ischnothele caudata, the only Dipluridae noted, was the most abundant. During the drought period, the spiders were more numerous in the Aechmea-areas than in the control-areas, but they were not obligatorily associated with the Aechmea. During the subsequent flooding, the spiders were concentrated in the A. bracteata patches, particularly those sheltering an ant colony. Also, a kind of specificity existed between certain spider taxa and ant species, but varied between the drought period and subsequent flooding. We conclude that climatic events modulate the relationship between A. bracteata patches and their associated fauna. Tank bromeliads, previously considered only for their ecological importance in supplying food and water during drought, may also be considered refuges for spiders during flooding. More generally, tank bromeliads have an important role in preserving non-specialized fauna in inundated forests.

  8. Environmental and hormonal factors controlling reversible colour change in crab spiders.

    Science.gov (United States)

    Llandres, Ana L; Figon, Florent; Christidès, Jean-Philippe; Mandon, Nicole; Casas, Jérôme

    2013-10-15

    Habitat heterogeneity that occurs within an individual's lifetime may favour the evolution of reversible plasticity. Colour reversibility has many different functions in animals, such as thermoregulation, crypsis through background matching and social interactions. However, the mechanisms underlying reversible colour changes are yet to be thoroughly investigated. This study aims to determine the environmental and hormonal factors underlying morphological colour changes in Thomisus onustus crab spiders and the biochemical metabolites produced during these changes. We quantified the dynamics of colour changes over time: spiders were kept in yellow and white containers under natural light conditions and their colour was measured over 15 days using a spectrophotometer. We also characterised the chemical metabolites of spiders changing to a yellow colour using HPLC. Hormonal control of colour change was investigated by injecting 20-hydroxyecdysone (20E) into spiders. We found that background colouration was a major environmental factor responsible for colour change in crab spiders: individuals presented with white and yellow backgrounds changed to white and yellow colours, respectively. An ommochrome precursor, 3-OH-kynurenine, was the main pigment responsible for yellow colour. Spiders injected with 20E displayed a similar rate of change towards yellow colouration as spiders kept in yellow containers and exposed to natural sunlight. This study demonstrates novel hormonal manipulations that are capable of inducing reversible colour change.

  9. Comparative growth and development of spiders reared on live and dead prey.

    Science.gov (United States)

    Peng, Yu; Zhang, Fan; Gui, Shaolan; Qiao, Huping; Hose, Grant C

    2013-01-01

    Scavenging (feeding on dead prey) has been demonstrated across a number of spider families, yet the implications of feeding on dead prey for the growth and development of individuals and population is unknown. In this study we compare the growth, development, and predatory activity of two species of spiders that were fed on live and dead prey. Pardosa astrigera (Lycosidae) and Hylyphantes graminicola (Lyniphiidae) were fed live or dead fruit flies, Drosophila melanogaster. The survival of P. astrigera and H. graminicola was not affected by prey type. The duration of late instars of P. astrigera fed dead prey were longer and mature spiders had less protein content than those fed live prey, whereas there were no differences in the rate of H. graminicola development, but the mass of mature spiders fed dead prey was greater than those fed live prey. Predation rates by P. astrigera did not differ between the two prey types, but H. graminicola had a higher rate of predation on dead than alive prey, presumably because the dead flies were easier to catch and handle. Overall, the growth, development and reproduction of H. graminicola reared with dead flies was better than those reared on live flies, yet for the larger P. astrigera, dead prey may suit smaller instars but mature spiders may be best maintained with live prey. We have clearly demonstrated that dead prey may be suitable for rearing spiders, although the success of the spiders fed such prey appears size- and species specific.

  10. A Tank Bromeliad Favors Spider Presence in a Neotropical Inundated Forest

    Science.gov (United States)

    Hénaut, Yann; Corbara, Bruno; Pélozuelo, Laurent; Azémar, Frédéric; Céréghino, Régis; Herault, Bruno; Dejean, Alain

    2014-01-01

    Tank bromeliads are good models for understanding how climate change may affect biotic associations. We studied the relationships between spiders, the epiphytic tank bromeliad, Aechmea bracteata, and its associated ants in an inundated forest in Quintana Roo, Mexico, during a drought period while, exceptionally, this forest was dry and then during the flooding that followed. We compared spider abundance and diversity between ‘Aechmea-areas’ and ‘control-areas’ of the same surface area. We recorded six spider families: the Dipluridae, Ctenidae, Salticidae, Araneidae, Tetragnathidae and Linyphiidae among which the funnel-web tarantula, Ischnothele caudata, the only Dipluridae noted, was the most abundant. During the drought period, the spiders were more numerous in the Aechmea-areas than in the control-areas, but they were not obligatorily associated with the Aechmea. During the subsequent flooding, the spiders were concentrated in the A. bracteata patches, particularly those sheltering an ant colony. Also, a kind of specificity existed between certain spider taxa and ant species, but varied between the drought period and subsequent flooding. We conclude that climatic events modulate the relationship between A. bracteata patches and their associated fauna. Tank bromeliads, previously considered only for their ecological importance in supplying food and water during drought, may also be considered refuges for spiders during flooding. More generally, tank bromeliads have an important role in preserving non-specialized fauna in inundated forests. PMID:25494055

  11. Effects of kaolin particle films on the life span of an orb-weaver spider.

    Science.gov (United States)

    Benhadi-Marín, Jacinto; Pereira, José Alberto; Santos, Sónia A P

    2016-02-01

    Araniella cucurbitina (Araneae: Araneidae) is a widespread orb-weaver spider commonly found in agroecosystems. Mineral particle films such as kaolin, due to their protective or anti-feeding action, can represent an alternative to pesticides, especially in organic farming systems, but little is known about its effects on A. cucurbitina. Therefore, we tested the effect of kaolin sprays on the life span of A. cucurbitina under laboratory conditions. Four treatments were tested encompassing different exposure routes. Thus, kaolin sprays were applied on (i) the surface, (ii) the prey (fly), (iii) the spider and (iv) both spider & prey. A control group was tested with water in each treatment. Results showed that sprays of kaolin significantly affected the survival of A. curcubitina when applications were done on the surface and on both spider & prey registering a reduction of 48% and 56%, respectively. Spiders in control obtained higher probability of reaching alive at the end of the assay than those treated with kaolin. Differences observed can be explained by the feeding behavior of the species and may depend on the consumption of the web by the spider and the ratio spider/fly for body size. Copyright © 2015 Elsevier Ltd. All rights reserved.

  12. Interpretative bias in spider phobia: Perception and information processing of ambiguous schematic stimuli.

    Science.gov (United States)

    Haberkamp, Anke; Schmidt, Filipp

    2015-09-01

    This study investigates the interpretative bias in spider phobia with respect to rapid visuomotor processing. We compared perception, evaluation, and visuomotor processing of ambiguous schematic stimuli between spider-fearful and control participants. Stimuli were produced by gradually morphing schematic flowers into spiders. Participants rated these stimuli related to their perceptual appearance and to their feelings of valence, disgust, and arousal. Also, they responded to the same stimuli within a response priming paradigm that measures rapid motor activation. Spider-fearful individuals showed an interpretative bias (i.e., ambiguous stimuli were perceived as more similar to spiders) and rated spider-like stimuli as more unpleasant, disgusting, and arousing. However, we observed no differences between spider-fearful and control participants in priming effects for ambiguous stimuli. For non-ambiguous stimuli, we observed a similar enhancement for phobic pictures as has been reported previously for natural images. We discuss our findings with respect to the visual representation of morphed stimuli and to perceptual learning processes. Copyright © 2015 Elsevier B.V. All rights reserved.

  13. Deer herbivory reduces web-building spider abundance by simplifying forest vegetation structure

    Directory of Open Access Journals (Sweden)

    Elizabeth J. Roberson

    2016-09-01

    Full Text Available Indirect ecological effects are a common feature of ecological systems, arising when one species affects interactions among two or more other species. We examined how browsing by white-tailed deer (Odocoileus virginianus indirectly affected the abundance and composition of a web-building spider guild through their effects on the structure of the ground and shrub layers of northern hardwood forests. We examined paired plots consisting of deer-free and control plots in the Allegheny Plateau region Pennsylvania and Northern Highlands region of Wisconsin. We recorded the abundance of seven types of webs, each corresponding to a family of web-building spiders. We quantified vegetation structure and habitat suitability for the spiders by computing a web scaffold availability index (WSAI at 0.5 m and 1.0 m above the ground. At Northern Highlands sites, we recorded prey availability. Spider webs were twice as abundant in deer-free plots compared to control plots, while WSAI was 7–12 times greater in deerfree plots. Prey availability was lower in deer-free plots. With the exception of funnel web-builders, all spider web types were significantly more abundant in deer-free plots. Both deer exclusion and the geographic region of plots were significant predictors of spider community structure. In closed canopy forests with high browsing pressure, the low density of tree saplings and shrubs provides few locations for web-building spiders to anchor webs. Recruitment of these spiders may become coupled with forest disturbance events that increase tree and shrub recruitment. By modifying habitat structure, deer appear to indirectly modify arthropod food web interactions. As deer populations have increased in eastern North America over the past several decades, the effects of deer on web-building spiders may be widespread.

  14. Influence of Imidacloprid and Horticultural Oil on Spider Abundance on Eastern Hemlock in the Southern Appalachians.

    Science.gov (United States)

    Hakeem, A; Grant, J F; Lambdin, P L; Hale, F A; Rhea, J R; Wiggins, G J; Coots, C

    2018-05-08

    Hemlock woolly adelgid, Adelges tsugae Annand (Hemiptera: Adelgidae), is an exotic pest of eastern hemlock, Tsuga canadensis (L.) Carrière (Pinales: Pinaceae), in the eastern United States. Two commonly used insecticides to manage adelgid are imidacloprid, a systemic neonicotinoid insecticide, and horticultural oil, a refined petroleum oil foliar spray. We have investigated the influence of imidacloprid and horticultural oil on spider abundance at different canopy strata in eastern hemlock. In total, 2,084 spiders representing 11 families were collected from the canopies of eastern hemlock. In beat-sheet and direct observation samples, the families Theridiidae, Araneidae, Salticidae, and Anyphaenidae were the most abundant. Significantly higher numbers of spiders were recorded on untreated control trees compared with trees treated with imidacloprid using soil drench and soil injection applications. Spider abundance in trees injected with imidacloprid and horticultural oil applications did not significantly differ from control trees. Spider abundance was significantly greater in the top and middle strata of the canopy than in the bottom stratum, where imidacloprid concentrations were the highest. Regression analysis showed that spider abundance was inversely associated with imidacloprid concentration. This research demonstrates that imidacloprid, when applied with selected methods, has the potential to result in reductions of spider densities at different strata. However, slight reductions in spider abundance may be an acceptable short-term ecological impact compared with the loss of an untreated hemlock and all the associated ecological benefits that it provides. Future studies should include investigations of long-term impact of imidacloprid on spiders associated with eastern hemlock.

  15. Subsocial behaviour and brood adoption in mixed-species colonies of two theridiid spiders

    DEFF Research Database (Denmark)

    Grinsted, Lena; Agnarsson, Ingi; Bilde, Trine

    2012-01-01

    , aggression and cooperation through behavioural experiments and examine the potential for adoption of foreign brood. Morphological and genetic analyses confirmed that colonies consisted of two related species Chikunia nigra (O.P. Cambridge, 1880) new combination (previously Chrysso nigra) and a yet...... as in territorial, colonial spiders. Mixed species spider colonies, involving closely related species, have rarely been documented. We examined social interactions in newly discovered mixed-species colonies of theridiid spiders on Bali, Indonesia. Our aim was to test the degree of intra- and interspecific tolerance...

  16. Compositional changes in spider (Araneae) assemblages along an urbanisation gradient near a Danish town

    DEFF Research Database (Denmark)

    Horváth, R.; Elek, Zoltán; Lövei, Gabor L

    2014-01-01

    Spider (Araneae) assemblages were studied over two years by pitfall trapping along an urbanisation gradient of forested habitats (rural forest - suburban forest fragment - urban forest fragment) in a Danish town, using the Globenet protocol. During the two years, we collected 4340 individuals of 90...... species, with money spiders (Linyphiidae) and wolf spiders (Lycosidae) being most numerous. One species, Ero aphana, was new to the Danish fauna. In 2004, 45-47 species were captured in the habitats in various stages of urbanisation, while in 2005 (with a smaller collection effort), 28 (urban) - 37 (rural...

  17. Compliant threads maximize spider silk connection strength and toughness

    Science.gov (United States)

    Meyer, Avery; Pugno, Nicola M.; Cranford, Steven W.

    2014-01-01

    Millions of years of evolution have adapted spider webs to achieve a range of functionalities, including the well-known capture of prey, with efficient use of material. One feature that has escaped extensive investigation is the silk-on-silk connection joints within spider webs, particularly from a structural mechanics perspective. We report a joint theoretical and computational analysis of an idealized silk-on-silk fibre junction. By modifying the theory of multiple peeling, we quantitatively compare the performance of the system while systematically increasing the rigidity of the anchor thread, by both scaling the stress–strain response and the introduction of an applied pre-strain. The results of our study indicate that compliance is a virtue—the more extensible the anchorage, the tougher and stronger the connection becomes. In consideration of the theoretical model, in comparison with rigid substrates, a compliant anchorage enormously increases the effective adhesion strength (work required to detach), independent of the adhered thread itself, attributed to a nonlinear alignment between thread and anchor (contact peeling angle). The results can direct novel engineering design principles to achieve possible load transfer from compliant fibre-to-fibre anchorages, be they silk-on-silk or another, as-yet undeveloped, system. PMID:25008083

  18. Nectar Meals of a Mosquito-Specialist Spider

    Directory of Open Access Journals (Sweden)

    Josiah O. Kuja

    2012-01-01

    Full Text Available Evarcha culicivora, an East African jumping spider, is known for feeding indirectly on vertebrate blood by actively choosing blood-carrying mosquitoes as prey. Using cold-anthrone tests to detect fructose, we demonstrate that E. culicivora also feeds on nectar. Field-collected individuals, found on the plant Lantana camara, tested positive for plant sugar (fructose. In the laboratory, E. culicivora tested positive for fructose after being kept with L. camara or one of another ten plant species (Aloe vera, Clerodendron magnifica, Hamelia patens, Lantana montevideo, Leonotis nepetaefolia, Parthenium hysterophorus, Ricinus communis, Senna didymobotrya, Striga asiatica, and Verbena trivernia. Our findings demonstrate that E. culicivora acquires fructose from its natural diet and can ingest fructose directly from plant nectaries. However, experiments in the laboratory also show that E. culicivora can obtain fructose indirectly by feeding on prey that have fed on fructose, implying a need to consider this possibility when field-collected spiders test positive for fructose. In laboratory tests, 53.5% of 1,215 small juveniles, but only 3.4% of 622 adult E. culicivora, left with plants for 24 hours, were positive for fructose. These findings, along with the field data, suggest that fructose is especially important for early-instar juveniles of E. culicivora.

  19. Tetracycline Reduces Kidney Damage Induced by Loxosceles Spider Venom

    Directory of Open Access Journals (Sweden)

    Cinthya Kimori Okamoto

    2017-03-01

    Full Text Available Envenomation by Loxosceles spider can result in two clinical manifestations: cutaneous and systemic loxoscelism, the latter of which includes renal failure. Although incidence of renal failure is low, it is the main cause of death, occurring mainly in children. The sphingomyelinase D (SMase D is the main component in Loxosceles spider venom responsible for local and systemic manifestations. This study aimed to investigate the toxicity of L. intermedia venom and SMase D on kidney cells, using both In vitro and in vivo models, and the possible involvement of endogenous metalloproteinases (MMP. Results demonstrated that venom and SMase D are able to cause death of human kidney cells by apoptosis, concomitant with activation and secretion of extracellular matrix metalloproteases, MMP-2 and MMP-9. Furthermore, cell death and MMP synthesis and secretion can be prevented by tetracycline. In a mouse model of systemic loxoscelism, Loxosceles venom-induced kidney failure was observed, which was abrogated by administration of tetracycline. These results indicate that MMPs may play an important role in Loxosceles venom-induced kidney injury and that tetracycline administration may be useful in the treatment of human systemic loxoscelism.

  20. Attention bias modification in specific fears: Spiders versus snakes.

    Science.gov (United States)

    Luo, Xijia; Ikani, Nessa; Barth, Anja; Rengers, Lea; Becker, Eni; Rinck, Mike

    2015-12-01

    Attention Bias Modification (ABM) is used to manipulate attention biases in anxiety disorders. It has been successful in reducing attention biases and anxious symptoms in social anxiety and generalized anxiety, but not yet in specific fears and phobias. We designed a new version of the dot-probe training task, aiming to train fearful participants' attention away from or towards pictures of threatening stimuli. Moreover, we studied whether the training also affected participants' avoidance behavior and their physical arousal upon being confronted with a real threat object. In Experiment 1, students with fear of spiders were trained. We found that the attention manipulation was successful, but the training failed to affect behavior or arousal. In Experiment 2, the same procedure was used on snake-fearful students. Again, attention was trained in the expected directions. Moreover, participants whose attention had been trained away from snakes showed lower physiological arousal upon being confronted with a real snake. The study involved healthy students with normal distribution of the fear of spider/snake. Future research with clinical sample could help with determining the generalizability of the current findings. The effect of ABM on specific phobia is still in question. The finding in the present study suggested the possibility to alter attentional bias with a dot-probe task with general positive stimuli and this training could even affect the behavior while encountering a real threat. Copyright © 2015 Elsevier Ltd. All rights reserved.

  1. An insecticidal toxin from Nephila clavata spider venom.

    Science.gov (United States)

    Jin, Lin; Fang, Mingqian; Chen, Mengrou; Zhou, Chunling; Ombati, Rose; Hakim, Md Abdul; Mo, Guoxiang; Lai, Ren; Yan, Xiuwen; Wang, Yumin; Yang, Shilong

    2017-07-01

    Spiders are the most successful insect predators given that they use their venom containing insecticidal peptides as biochemical weapons for preying. Due to the high specificity and potency of peptidic toxins, discoveries of insecticidal toxins from spider venom have provided an opportunity to obtain natural compounds for agricultural applications without affecting human health. In this study, a novel insecticidal toxin (μ-NPTX-Nc1a) was identified and characterized from the venom of Nephila clavata. Its primary sequence is GCNPDCTGIQCGWPRCPGGQNPVMDKCVSCCPFCPPKSAQG which was determined by automated Edman degradation, cDNA cloning, and MS/MS analysis. BLAST search indicated that Nc1a shows no similarity with known peptides or proteins, indicating that Nc1a belongs to a novel family of insecticidal peptide. Nc1a displayed inhibitory effects on Na V and K V channels in cockroach dorsal unpaired median neurons. The median lethal dose (LD50) of Nc1a on cockroach was 573 ng/g. Herein, a study that identifies a novel insecticidal toxin, which can be a potential candidate and/or template for the development of bioinsecticides, is presented.

  2. Tests for attraction to prey and predator avoidance by chemical cues in spiders of the beech forest floor

    Directory of Open Access Journals (Sweden)

    Wetter, Melissa B.

    2012-07-01

    Full Text Available Spiders leave draglines, faeces and other secretions behind when traveling through their microhabitat. The presence of these secretions may unintentionally inform other animals, prey as well as predators, about a recent and possible current predation risk or food availability. For a wolf spider, other spiders including smaller conspecifics, form a substantial part of their prey, and larger wolf spiders, again including conspecifics, are potential predators. We tested two hypotheses: that large wolf spiders may locate patches of potential spider prey through the presence of silk threads and/or other secretions; and that prey spiders may use secretions from large wolf spiders to avoid patches with high predation risk. We used large (subadult or adult Pardosa saltans to provide predator cues and mixed dwarf spiders or small (juvenile P. saltans to provide prey cues. Subadult wolf spiders were significantly attracted to litter contaminated by dwarf spiders or small conspecifics after 6 hours but no longer after 24 hours. In contrast, neither dwarf spiders nor small P. saltans showed significant avoidance of substrate contaminated by adult P. saltans. However, small P. saltans showed different activity patterns on the two substrates. The results indicate that wolf spiders are able to increase the efficiency of foraging by searching preferentially in patches with the presence of intraguild prey. The lack of a clear patch selection response of the prey in spite of a modified activity pattern may possibly be associated with the vertical stratification of the beech litter habitat: the reduced volume of spaces in the deeper layers could make downward rather than horizontal movement a fast and safe tactic against a large predator that cannot enter these spaces.

  3. European brown hare syndrome virus in free-ranging European brown hares from Argentina

    DEFF Research Database (Denmark)

    Frolich, K.; Kujawski, G.E.J.G.; Rudolph, M.

    2003-01-01

    From 1998 to 2000, serum samples of 80 shot European brown hares (Lepus europaeus) from Argentina were examined for antibodies against European brown hare syndrome virus (EBHSV) and 80 spleen samples were tested for EBHSV-antigen by enzyme linked immunosorbent assay (ELISA). Nine hares were posit...... in these hares. This is the first report of antibodies to EBHSV, EBHSV-antigen, and electron microscopy findings in free-ranging European brown hares from South America....

  4. Storage stability of flour-blasted brown rice

    Science.gov (United States)

    Brown rice was blasted with rice flour rather than sand in a sand blaster to make microscopic nicks and cuts so that water can easily penetrate into the brown rice endosperm and cook the rice in a shorter time. The flour-blasted American Basmati brown rice, long grain brown rice, and parboiled long...

  5. Production of fine coke from brown coal

    Energy Technology Data Exchange (ETDEWEB)

    Koenigs, H B

    1977-08-01

    The coke supply of the iron and steel industry, the design, function, and special features of the open-hearth are described, including coking properties and applications of the culm coke produced from brown coal. (In German)

  6. Browning phenomenon of medieval stained glass windows.

    Science.gov (United States)

    Ferrand, Jessica; Rossano, Stéphanie; Loisel, Claudine; Trcera, Nicolas; van Hullebusch, Eric D; Bousta, Faisl; Pallot-Frossard, Isabelle

    2015-04-07

    In this work, three pieces of historical on-site glass windows dated from the 13th to 16th century and one archeological sample (8th century) showing Mn-rich brown spots at their surface or subsurface have been characterized by optical microscopy and Scanning Electron Microscopy coupled with Energy Dispersive X-ray spectroscopy. The oxidation state of Mn as well as the Mn environment in the alteration phase have been characterized by X-ray absorption spectroscopy at the Mn K-edge. Results show that the oxidation state of Mn and therefore the nature of the alteration phase varies according to the sample considered and is correlated with the extent of the brown alteration. The larger the brown areas the more oxidized the Mn. However, by contrast with literature, the samples presenting the more extended brown areas are not similar to pyrolusite and contain Mn mainly under a (+III) oxidation state.

  7. Stochastic prey arrivals and crab spider giving-up times: simulations of spider performance using two simple "rules of thumb".

    Science.gov (United States)

    Kareiva, Peter; Morse, Douglass H; Eccleston, Jill

    1989-03-01

    We compared the patch-choice performances of an ambush predator, the crab spider Misumena vatia (Thomisidae) hunting on common milkweed Asclepias syriaca (Asclepiadaceae) umbles, with two stochastic rule-of-thumb simulation models: one that employed a threshold giving-up time and one that assumed a fixed probability of moving. Adult female Misumena were placed on milkweed plants with three umbels, each with markedly different numbers of flower-seeking prey. Using a variety of visitation regimes derived from observed visitation patterns of insect prey, we found that decreases in among-umbel variance in visitation rates or increases in overall mean visitation rates reduced the "clarity of the optimum" (the difference in the yield obtained as foraging behavior changes), both locally and globally. Yield profiles from both models were extremely flat or jagged over a wide range of prey visitation regimes; thus, differences between optimal and "next-best" strategies differed only modestly over large parts of the "foraging landscape". Although optimal yields from fixed probability simulations were one-third to one-half those obtained from threshold simulations, spiders appear to depart umbels in accordance with the fixed probability rule.

  8. Microlensing Binaries with Candidate Brown Dwarf Companions

    DEFF Research Database (Denmark)

    Shin, I.-G; Han, C.; Gould, A.

    2012-01-01

    masses of the brown dwarf companions are 0.02 ± 0.01 M⊙ and 0.019 ± 0.002 M⊙ for MOA-2011-BLG-104/OGLE-2011-BLG-0172 and MOA-2011-BLG-149, respectively, and both companions are orbiting low-mass M dwarf host stars. More microlensing brown dwarfs are expected to be detected as the number of lensing events...

  9. Active optical sensor assessment of spider mite damage on greenhouse beans and cotton.

    Science.gov (United States)

    Martin, Daniel E; Latheef, Mohamed A

    2018-02-01

    The two-spotted spider mite, Tetranychus urticae Koch, is an important pest of cotton in mid-southern USA and causes yield reduction and deprivation in fiber fitness. Cotton and pinto beans grown in the greenhouse were infested with spider mites at the three-leaf and trifoliate stages, respectively. Spider mite damage on cotton and bean canopies expressed as normalized difference vegetation index indicative of changes in plant health was measured for 27 consecutive days. Plant health decreased incrementally for cotton until day 21 when complete destruction occurred. Thereafter, regrowth reversed decline in plant health. On spider mite treated beans, plant vigor plateaued until day 11 when plant health declined incrementally. Results indicate that pinto beans were better suited as a host plant than cotton for rearing T. urticae in the laboratory.

  10. Mediterranean Recluse Spider, Loxosceles rufescens (Araneae: Sicariidae from Charkhab Cave, Southern Iran

    Directory of Open Access Journals (Sweden)

    Saber Sadeghi

    2017-04-01

    Full Text Available Background: The best-known dangerous spiders belong to the six genera. The genus Loxosceles or violin spiders are well known for their ability to cause skin necrosis or loxoscelism. All Loxosceles species have medical im­portance due to their necrotizing venom. The present article reports the occurrence of L. rufescens in Charkhab Cave, south of Iran (Larestan.Methods: The specimens were collected from the Charkhab Cave using handling forceps, paintbrush and aspirator and preserved in 96% ethanol.Results: Loxosceles rufescens, a medically important spider, is recorded from Charkhab Cave in Fars Province (southwest of Iran. Identification of L. rufescens was performed based on external morphology and the features of male genitalia.Conclusion: Presence of L. rufescens in south of Iran especially in a cave confirmed that this species is a widely distributed species in Iran. Therefore, cavers or cave visitors should be aware of this poisonous spider in caves.

  11. Contamination and Harm Relevant UCS-Expectancy Bias in Spider Phobic Individuals : Influence of Treatment

    NARCIS (Netherlands)

    van Overveld, Mark; de Jong, Peter J.; Huijding, Jorg; Peters, Madelon L.

    2010-01-01

    Phobic individuals expect aversive UCS's following encounters with phobic stimuli. Previous research using a thought-experiment procedure showed that contamination rather than harm-related outcome expectancies differentiated best between high and low spider fearful undergraduates. This study

  12. The distribution of spiders and Harvestmen (Chelicerata) in the Dutch National Park "De Hoge Veluwe"

    NARCIS (Netherlands)

    Hammen, van der L.

    1983-01-01

    A preliminary study is made of the distribution of Araneida and Opilionida (Chelicerata) in a National Park in The Netherlands. Special attention is paid to the influence of vegetation structure on the distribution of the spiders.

  13. Envia garciai, a new genus and species of mygalomorph spiders (Araneae, Microstigmatidae from Brazilian Amazonia

    Directory of Open Access Journals (Sweden)

    Ott Ricardo

    2003-01-01

    Full Text Available The genus Envia, comprising only the new species Envia garciai, is proposed. These small mygalomorph spiders were abundantly collected in soil cores and litter samples in primary rain forests near Manaus, Amazonas, Brazil.

  14. Studies on the occurrence of true spiders as natural enemies in many Egyptian fields

    Directory of Open Access Journals (Sweden)

    Amira A. Ibrahim

    2012-01-01

    Full Text Available True spiders represent one of the most important natural predatory species in Egyptian fields. In this work, common true spiders were surveyed in wheat, cotton and maize fields, and were counted weekly by using the direct method. For evaluating the feeding consumption of true spiders, five feeding cases were tested (as preys. These cases were: eggs of Ephestia kuehniella, eggs of Phthorimaea operculella, one day eggs and larvae of E. kuehniella, larvae of E. kuehniella and P. operculella and larvae of E. kuehniella only. Results obtained revealed that, the highest average daily consumption for each spider was recorded in case of feeding on eggs of P. operculella. While, the longest survival period was recorded in case of feeding on larvae of E. kuehniella.

  15. Biomimetic Spider Leg Joints: A Review from Biomechanical Research to Compliant Robotic Actuators

    Directory of Open Access Journals (Sweden)

    Stefan Landkammer

    2016-07-01

    Full Text Available Due to their inherent compliance, soft actuated joints are becoming increasingly important for robotic applications, especially when human-robot-interactions are expected. Several of these flexible actuators are inspired by biological models. One perfect showpiece for biomimetic robots is the spider leg, because it combines lightweight design and graceful movements with powerful and dynamic actuation. Building on this motivation, the review article focuses on compliant robotic joints inspired by the function principle of the spider leg. The mechanism is introduced by an overview of existing biological and biomechanical research. Thereupon a classification of robots that are bio-inspired by spider joints is presented. Based on this, the biomimetic robot applications referring to the spider principle are identified and discussed.

  16. The use of tetragnathid spiders as bioindicators of metal exposure at a coal ash spill site.

    Science.gov (United States)

    Otter, Ryan R; Hayden, Mary; Mathews, Teresa; Fortner, Allison; Bailey, Frank C

    2013-09-01

    On 22 December 2008, a dike containing coal fly ash from the Tennessee Valley Authority Kingston Fossil Fuel Plant (TN, USA) failed, resulting in the largest coal ash spill in US history. The present study was designed to determine sediment metal concentrations at multiple site locations and to determine whether site-specific bioaccumulation of metals existed in tetragnathid spiders. Selenium and nickel were the only 2 metals to exceed the US Environmental Protection Agency sediment screening levels. Selenium concentrations in spiders were significantly higher at ash-affected sites than in those from reference sites. The ratio of methylmercury to total mercury in spiders was found to be similar to that in other organisms (65-75%), which highlights the potential use of tetragnathid spiders as an indicator species for tracing contaminant transfer between the aquatic and terrestrial ecosystems. Copyright © 2013 SETAC.

  17. Efficacy of DNA barcoding for the species identification of spiders from Western Ghats of India.

    Science.gov (United States)

    Gaikwad, Swapnil; Warudkar, Ashwin; Shouche, Yogesh

    2017-09-01

    DNA barcoding has emerged as an additional tool for taxonomy and as an aid to taxonomic impediments. Due to their extensive morphological variation, spiders are taxonomically challenging. Therefore, all over the world, attempts are being made to DNA barcode species of spiders. Till now no attempts were made to DNA barcode Indian spiders despite their rich diversity. We have generated DNA barcodes for 60 species (n = 112) of spiders for the first time from India. Although only 17 species were correctly identified at the species level, DNA barcoding correctly discriminated 99% of the species studied here. We have also found high intraspecies nucleotide divergence in Plexippus paykulli suggesting cryptic diversity that needs to be studied in detail. Our study also showed non-specific amplification of the Cytochrome Oxidase I (COI) gene of endosymbiont bacteria Wolbachia. However, these cases are very rare and could be resolved by the use of modified or group specific primers.

  18. Captive spider monkeys (Ateles geoffroyi) arm-raise to solicit allo-grooming.

    Science.gov (United States)

    Scheel, Matthew H; Edwards, Dori

    2012-03-01

    Old World monkeys solicit allo-grooming from conspecifics. However, there are relatively few studies of allo-grooming among spider monkeys, and descriptions of allo-grooming solicitation among spider monkeys are anecdotal. In this study, eighty-one hours of video, shot over eight weeks, captured 271 allo-grooming bouts among small groups of captive spider monkeys. Six of eight monkeys made heretofore unreported arm-raises that solicited higher than normal rates of allo-grooming. Allo-grooming bout durations following arm-raises also tended to be longer than bouts not preceded by arm-raises. The efficacy of the arm-raise at soliciting allo-grooming suggests spider monkeys are capable of intentional communication. Copyright © 2012 Elsevier B.V. All rights reserved.

  19. Investigating the influence of farm-scape geospatial characteristics on spider diversity

    Science.gov (United States)

    Biodiversity is an important aspect of sustainable crop management and agricultural production. Maintaining biodiversity within agricultural ecosystems, especially in regards to predator species, promotes natural pest control and many other ecosystem services. Spiders (Araneae) often prey upon commo...

  20. Prediction of abundance of forest spiders according to climate warming in South Korea

    Directory of Open Access Journals (Sweden)

    Tae-Sung Kwon

    2014-06-01

    Full Text Available Distribution of spiders will be changed as climate warms. Abundance of spider species was predicted nationwide in South Korea. Abundance of spiders was projected using temperature species distribution model based on a nationwide data (366 forest sites according to climate change scenario RCP 4.5 and 8.5. The model predicts that 9 out of 17 species will increase in abundance while 8 species will decrease. Based on this finding, a qualitative prediction (increase or decrease was conducted on the species with more than 1% occurrence: 68 species are expected to decrease, 9 to increase, and 8 to change a little. In pooled estimation, 76 species (75% are expected to decrease, 18 species (18% to increase, and by 8 species (8% to have little change. The projection indicates that majority of spider species will decrease, but minority of species will increase as climate warms, suggesting great increase of remained species in lowlands.

  1. Intersexual Trophic Niche Partitioning in an Ant-Eating spider (Araneae: Zodariidae)

    DEFF Research Database (Denmark)

    Pekár, Stanislav; Martisová, Martina; Bilde, T.

    2011-01-01

    lead to higher energy demands in females driven by fecundity selection, while males invest in mate searching. We tested predictions of the two hypotheses underlying intersexual trophic niche partitioning in a natural population of spiders. Zodarion jozefienae spiders specialize on Messor barbarus ants...... that are polymorphic in body size and hence comprise potential trophic niches for the spider, making this system well-suited to study intersexual trophic niche partitioning. Methodology/Principal Findings Comparative analysis of trophic morphology (the chelicerae) and body size of males, females and juveniles...... demonstrated highly female biased SSD (Sexual Size Dimorphism) in body size, body weight, and in the size of chelicerae, the latter arising from sex-specific growth patterns in trophic morphology. In the field, female spiders actively selected ant sub-castes that were larger than the average prey size...

  2. The efficacy of treatment reminders of life with emphasis on integrative reminiscence on self-esteem and anxiety in widowed old men.

    Science.gov (United States)

    Pishvaei, Malihe; Ataie Moghanloo, Roghayeh; Ataie Moghanloo, Vahid

    2015-01-01

    Loss of wife besides the phenomenon of aging could cause some psychological disorders and may shorten the duration of this stage of life. The aim of this study was to examine the efficacy of treatment reminders of life with emphasis on integrative reminiscence on self-esteem and anxiety in widowed old men. This was a clinical trial with pre-test and post-test design with a control group. The study population included All 60 to 80 year old men living in Meshginshahr; among whom, 34 participants were selected using convenience sampling method. They were randomly allocated into two equal groups (experimental and control). The experimental group participated in therapy sessions and the control group did not receive any intervention. The research instruments were Rosenberg Self-Esteem Scale and the General Anxiety Questionnaire. Data were analyzed using multivariable covariance analysis in SSPS-19. Statistical significance was set at Pself-esteem and anxiety in old widowed men (pself-esteem and reduce anxiety in widowed old men. This treatment gives better results compared to the traditional treatments and it is recommended to be implemented in nursing homes.

  3. The efficacy of treatment reminders of life with emphasis on integrative reminiscence on self-esteem and anxiety in widowed old men.

    Directory of Open Access Journals (Sweden)

    Malihe Pishvaei

    2015-03-01

    Full Text Available Loss of wife besides the phenomenon of aging could cause some psychological disorders and may shorten the duration of this stage of life. The aim of this study was to examine the efficacy of treatment reminders of life with emphasis on integrative reminiscence on self-esteem and anxiety in widowed old men.This was a clinical trial with pre-test and post-test design with a control group. The study population included All 60 to 80 year old men living in Meshginshahr; among whom, 34 participants were selected using convenience sampling method. They were randomly allocated into two equal groups (experimental and control. The experimental group participated in therapy sessions and the control group did not receive any intervention. The research instruments were Rosenberg Self-Esteem Scale and the General Anxiety Questionnaire. Data were analyzed using multivariable covariance analysis in SSPS-19. Statistical significance was set at P<0.05.MANCOVA results showed that the treatment positively affected the variables of self-esteem and anxiety in old widowed men (p<0.001.The reminders of life therapy with emphasis on integrative reminiscence may enhance self-esteem and reduce anxiety in widowed old men. This treatment gives better results compared to the traditional treatments and it is recommended to be implemented in nursing homes.

  4. Spider fauna of semi-dry grasslands on a military training base in Northwest Germany (Münster

    Directory of Open Access Journals (Sweden)

    Buchholz, Sascha

    2008-07-01

    Full Text Available The spider fauna of semi-dry grasslands on the military training area of Dorbaum near Münster (North Rhine-Westphalia was investigated. From 2002 to 2003 a total of 11,194 mature spiders from 141 species and 20 families was caught by pitfall trapping and hand sampling. Among them are 18 species listed in the Red Data Book of North Rhine-Westphalia, four species are rare or previously rarely recorded. Most of the spiders are habitat generalists that extend their occurrence into all types of habitats, while the number of species which are stenotopic to sand habitats is noticeably low (n = 13. The spider data were analysed with Principal Component Analysis (PCA. It is possible to distinguish spider communities of neighbouring forested habitats from species groups of open habitats, but there is no uniform spider community which is characteristic for semi-dry grassland.

  5. Riparian spiders as sentinels of polychlorinated biphenyl contamination across heterogeneous aquatic ecosystems

    Science.gov (United States)

    Kraus, Johanna M.; Gibson, Polly P.; Walters, David M.; Mills, Marc A.

    2017-01-01

    Riparian spiders are being used increasingly to track spatial patterns of contaminants in and fluxing from aquatic ecosystems.However, our understanding of the circumstances under which spiders are effective sentinels of aquatic pollution is limited. The present study tests the hypothesis that riparian spiders may be effectively used to track spatial patterns of sediment pollution by polychlorinated biphenyls (PCBs) in aquatic ecosystems with high habitat heterogeneity. The spatial pattern of ΣPCB concentrations in 2 common families of riparian spiders sampled in 2011 to 2013 generally tracked spatial variation in sediment ΣPCBs across all sites within the Manistique River Great Lakes Area of Concern (AOC), a rivermouth ecosystem located on the south shore of the Upper Peninsula, Manistique (MI,USA) that includes harbor, river, backwater, and lake habitats. Sediment ΣPCB concentrations normalized for total organic carbon explained 41% of the variation in lipid-normalized spider ΣPCB concentrations across 11 sites. Furthermore, 2 common riparian spider taxa (Araneidae and Tetragnathidae) were highly correlated (r2> 0.78) and had similar mean ΣPCB concentrations when averaged acrossall years. The results indicate that riparian spiders may be useful sentinels of relative PCB availability to aquatic and riparian food webs in heterogeneous aquatic ecosystems like rivermouths where habitat and contaminant variability may make the use of aquatic taxa lesseffective. Furthermore, the present approach appears robust to heterogeneity in shoreline development and riparian vegetation that support different families of large web-building spiders. Environ Toxicol Chem 2016;9999:1–9. Published 2016 Wiley Periodicals, Inc. on behalf of SETAC. This article is a US government work and, as such, is in the public domain in the United States of America.

  6. The functional morphology of color changing in a spider: development of ommochrome pigment granules.

    Science.gov (United States)

    Insausti, Teresita C; Casas, Jérôme

    2008-03-01

    Studies on the formation of ommochrome pigment granules are very few, despite their generalized occurrence as screening pigments in insect eyes. This is particularly true for ommochrome granules responsible for epidermal coloration. The aims of this study were to characterize the localization of major body pigments in a color changing mimetic spider, Misumena vatia (Thomisidae), and to describe the formation and location of ommochrome pigment granules responsible for the spider's color change from white to yellow. The unpigmented cuticula of this spider is transparent. Both the guanine localized in guanine cells in the opisthosoma and the uric acid localized in epidermis cells in the prosoma are responsible for the white coloration. The bright yellow color is due to the combination of ommochrome pigment granules and the white reflectance from coincident guanine and/or uric acid. The formation of ommochrome pigment granules in epidermis cells proceeds via three distinctive steps. Translucent, UV fluorescent, progranules (type I) are produced by a dense network of endoplasmic reticulum associated with numerous mitochondria and glycogen rosettes. These progranules are present in white spiders only, and regularly distributed in the cytoplasm. The merging of several progranules of type I into a transient state (progranule type II) leads to the formation of granules (type III) characterized by their lack of fluorescence, their spherical sections and their osmophilic-electron-dense contents. They are found in yellow spiders and in the red stripes on the body sides. Their color varies from yellow to red. Thus, white spiders contain only type I granules, yellow tinted spiders contain type II and III granules and bright yellow spiders contain only type III granules. We present a synthetic view of the ontogeny of ommochrome granules. We discuss the physiology of color changing and the nature of the chemical compounds in the different types of granules. Extended studies on the

  7. Design of the interlock and protection system for the SPIDER experiment

    International Nuclear Information System (INIS)

    Pomaro, N.; Grando, L.; Luchetta, A.; Paolucci, F.; Sartori, F.

    2013-01-01

    Highlights: •A custom designed interlock and protection system for SPIDER experiment is described. •It includes two subsystems implementing slow and fast protection functions. •High reliability PLCs are adopted for slow protection. •Fiber-optic based, custom designed fast logic circuitry is proposed for fast protection. •Accelerators breakdown events are also managed by the fast subsystem. -- Abstract: Unprecedented levels of beam energy and power are required for ITER Neutral Beam Heating systems. SPIDER experiment is an experimental device aimed to test and optimize a full size beam source satisfying ITER requirements. SPIDER experiment operation involves high power, voltage, temperature, and gas pressure. All these critical conditions are present simultaneously, so that any failure if not properly detected and managed is likely to cause severe damage. The Interlock and Protection System is a high-reliability system devoted to the investment protection of SPIDER. Its main purpose is to manage abnormal events occurring in one or more plants in order to minimize adverse consequences. The Interlock System also manages the SPIDER Operating Modes, defining the set and status of the Plants used in the various possible experimental configurations. In addition, the Interlock and Protection System takes care of particular events occurring during normal SPIDER operation, i.e. electrical arcs between accelerator grids, named breakdowns. Their treatment is committed to the Interlock and Protection System, as they need to be managed timely and with absolute reliability like actual faults. To perform the required functions, the Interlock and Protection System is interfaced with most SPIDER plants and with the SPIDER Control and Data Acquisition System. The paper describes the rationale of the protection functions, their implementation in the design and the technical specifications of the system

  8. Riparian spiders as sentinels of polychlorinated biphenyl contamination across heterogeneous aquatic ecosystems.

    Science.gov (United States)

    Kraus, Johanna M; Gibson, Polly P; Walters, David M; Mills, Marc A

    2017-05-01

    Riparian spiders are being used increasingly to track spatial patterns of contaminants in and fluxing from aquatic ecosystems. However, our understanding of the circumstances under which spiders are effective sentinels of aquatic pollution is limited. The present study tests the hypothesis that riparian spiders may be effectively used to track spatial patterns of sediment pollution by polychlorinated biphenyls (PCBs) in aquatic ecosystems with high habitat heterogeneity. The spatial pattern of ΣPCB concentrations in 2 common families of riparian spiders sampled in 2011 to 2013 generally tracked spatial variation in sediment ΣPCBs across all sites within the Manistique River Great Lakes Area of Concern (AOC), a rivermouth ecosystem located on the south shore of the Upper Peninsula, Manistique (MI, USA) that includes harbor, river, backwater, and lake habitats. Sediment ΣPCB concentrations normalized for total organic carbon explained 41% of the variation in lipid-normalized spider ΣPCB concentrations across 11 sites. Furthermore, 2 common riparian spider taxa (Araneidae and Tetragnathidae) were highly correlated (r 2  > 0.78) and had similar mean ΣPCB concentrations when averaged across all years. The results indicate that riparian spiders may be useful sentinels of relative PCB availability to aquatic and riparian food webs in heterogeneous aquatic ecosystems like rivermouths where habitat and contaminant variability may make the use of aquatic taxa less effective. Furthermore, the present approach appears robust to heterogeneity in shoreline development and riparian vegetation that support different families of large web-building spiders. Environ Toxicol Chem 2017;36:1278-1286. Published 2016 Wiley Periodicals, Inc. on behalf of SETAC. This article is a US government work and, as such, is in the public domain in the United States of America. Published 2016 Wiley Periodicals, Inc. on behalf of SETAC. This article is a US government work and, as such, is in

  9. Record breaking achievements by spiders and the scientists who study them.

    Science.gov (United States)

    Mammola, Stefano; Michalik, Peter; Hebets, Eileen A; Isaia, Marco

    2017-01-01

    Organismal biology has been steadily losing fashion in both formal education and scientific research. Simultaneous with this is an observable decrease in the connection between humans, their environment, and the organisms with which they share the planet. Nonetheless, we propose that organismal biology can facilitate scientific observation, discovery, research, and engagement, especially when the organisms of focus are ubiquitous and charismatic animals such as spiders. Despite being often feared, spiders are mysterious and intriguing, offering a useful foundation for the effective teaching and learning of scientific concepts and processes. In order to provide an entryway for teachers and students-as well as scientists themselves-into the biology of spiders, we compiled a list of 99 record breaking achievements by spiders (the "Spider World Records"). We chose a world-record style format, as this is known to be an effective way to intrigue readers of all ages. We highlighted, for example, the largest and smallest spiders, the largest prey eaten, the fastest runners, the highest fliers, the species with the longest sperm, the most venomous species, and many more. We hope that our compilation will inspire science educators to embrace the biology of spiders as a resource that engages students in science learning. By making these achievements accessible to non-arachnologists and arachnologists alike, we suggest that they could be used: (i) by educators to draw in students for science education, (ii) to highlight gaps in current organismal knowledge, and (iii) to suggest novel avenues for future research efforts. Our contribution is not meant to be comprehensive, but aims to raise public awareness on spiders, while also providing an initial database of their record breaking achievements.

  10. Web building and silk properties functionally covary among species of wolf spider.

    Science.gov (United States)

    Lacava, Mariángeles; Camargo, Arley; Garcia, Luis F; Benamú, Marco A; Santana, Martin; Fang, Jian; Wang, Xungai; Blamires, Sean J

    2018-04-15

    Although phylogenetic studies have shown covariation between the properties of spider major ampullate (MA) silk and web building, both spider webs and silks are highly plastic so we cannot be sure whether these traits functionally covary or just vary across environments that the spiders occupy. As MaSp2-like proteins provide MA silk with greater extensibility, their presence is considered necessary for spider webs to effectively capture prey. Wolf spiders (Lycosidae) are predominantly non-web building, but a select few species build webs. We accordingly collected MA silk from two web-building and six non-web-building species found in semirural ecosystems in Uruguay to test whether the presence of MaSp2-like proteins (indicated by amino acid composition, silk mechanical properties and silk nanostructures) was associated with web building across the group. The web-building and non-web-building species were from disparate subfamilies so we estimated a genetic phylogeny to perform appropriate comparisons. For all of the properties measured, we found differences between web-building and non-web-building species. A phylogenetic regression model confirmed that web building and not phylogenetic inertia influences silk properties. Our study definitively showed an ecological influence over spider silk properties. We expect that the presence of the MaSp2-like proteins and the subsequent nanostructures improves the mechanical performance of silks within the webs. Our study furthers our understanding of spider web and silk co-evolution and the ecological implications of spider silk properties. © 2018 European Society For Evolutionary Biology. Journal of Evolutionary Biology © 2018 European Society For Evolutionary Biology.

  11. Linking Native and Invader Traits Explains Native Spider Population Responses to Plant Invasion.

    Directory of Open Access Journals (Sweden)

    Jennifer N Smith

    Full Text Available Theoretically, the functional traits of native species should determine how natives respond to invader-driven changes. To explore this idea, we simulated a large-scale plant invasion using dead spotted knapweed (Centaurea stoebe stems to determine if native spiders' web-building behaviors could explain differences in spider population responses to structural changes arising from C. stoebe invasion. After two years, irregular web-spiders were >30 times more abundant and orb weavers were >23 times more abundant on simulated invasion plots compared to controls. Additionally, irregular web-spiders on simulated invasion plots built webs that were 4.4 times larger and 5.0 times more likely to capture prey, leading to >2-fold increases in recruitment. Orb-weavers showed no differences in web size or prey captures between treatments. Web-spider responses to simulated invasion mimicked patterns following natural invasions, confirming that C. stoebe's architecture is likely the primary attribute driving native spider responses to these invasions. Differences in spider responses were attributable to differences in web construction behaviors relative to historic web substrate constraints. Orb-weavers in this system constructed webs between multiple plants, so they were limited by the overall quantity of native substrates but not by the architecture of individual native plant species. Irregular web-spiders built their webs within individual plants and were greatly constrained by the diminutive architecture of native plant substrates, so they were limited both by quantity and quality of native substrates. Evaluating native species traits in the context of invader-driven change can explain invasion outcomes and help to identify factors limiting native populations.

  12. On Graceful Spider Graphs with at Most Four Legs of Lengths Greater than One

    Directory of Open Access Journals (Sweden)

    A. Panpa

    2016-01-01

    Full Text Available A graceful labeling of a tree T with n edges is a bijection f:V(T→{0,1,2,…,n} such that {|f(u-f(v|:uv∈E(T} equal to {1,2,…,n}. A spider graph is a tree with at most one vertex of degree greater than 2. We show that all spider graphs with at most four legs of lengths greater than one admit graceful labeling.

  13. Characterisation of protein families in spider digestive fluids and their role in extra-oral digestion.

    Science.gov (United States)

    Walter, André; Bechsgaard, Jesper; Scavenius, Carsten; Dyrlund, Thomas S; Sanggaard, Kristian W; Enghild, Jan J; Bilde, Trine

    2017-08-10

    Spiders are predaceous arthropods that are capable of subduing and consuming relatively large prey items compared to their own body size. For this purpose, spiders have evolved potent venoms to immobilise prey and digestive fluids that break down nutrients inside the prey's body by means of extra-oral digestion (EOD). Both secretions contain an array of active proteins, and an overlap of some components has been anecdotally reported, but not quantified. We systematically investigated the extent of such protein overlap. As venom injection and EOD succeed each other, we further infer functional explanations, and, by comparing two spider species belonging to different clades, assess its adaptive significance for spider EOD in general. We describe the protein composition of the digestive fluids of the mygalomorph Acanthoscurria geniculata and the araneomorph Stegodyphus mimosarum, in comparison with previously published data on a third spider species. We found a number of similar hydrolases being highly abundant in all three species. Among them, members of the family of astacin-like metalloproteases were particularly abundant. While the importance of these proteases in spider venom and digestive fluid was previously noted, we now highlight their widespread use across different spider taxa. Finally, we found species specific differences in the protein overlap between venom and digestive fluid, with the difference being significantly greater in S. mimosarum compared to A. geniculata. The injection of venom precedes the injection with digestive fluid, and the overlap of proteins between venom and digestive fluid suggests an early involvement in EOD. Species specific differences in the overlap may reflect differences in ecology between our two study species. The protein composition of the digestive fluid of all the three species we compared is highly similar, suggesting that the cocktail of enzymes is highly conserved and adapted to spider EOD.

  14. Physical characterization of functionalized spider silk: electronic and sensing properties

    Directory of Open Access Journals (Sweden)

    Eden Steven, Jin Gyu Park, Anant Paravastu, Elsa Branco Lopes, James S Brooks, Ongi Englander, Theo Siegrist, Papatya Kaner and Rufina G Alamo

    2011-01-01

    Full Text Available This work explores functional, fundamental and applied aspects of naturally harvested spider silk fibers. Natural silk is a protein polymer where different amino acids control the physical properties of fibroin bundles, producing, for example, combinations of β-sheet (crystalline and amorphous (helical structural regions. This complexity presents opportunities for functional modification to obtain new types of material properties. Electrical conductivity is the starting point of this investigation, where the insulating nature of neat silk under ambient conditions is described first. Modification of the conductivity by humidity, exposure to polar solvents, iodine doping, pyrolization and deposition of a thin metallic film are explored next. The conductivity increases exponentially with relative humidity and/or solvent, whereas only an incremental increase occurs after iodine doping. In contrast, iodine doping, optimal at 70 °C, has a strong effect on the morphology of silk bundles (increasing their size, on the process of pyrolization (suppressing mass loss rates and on the resulting carbonized fiber structure (that becomes more robust against bending and strain. The effects of iodine doping and other functional parameters (vacuum and thin film coating motivated an investigation with magic angle spinning nuclear magnetic resonance (MAS-NMR to monitor doping-induced changes in the amino acid-protein backbone signature. MAS-NMR revealed a moderate effect of iodine on the helical and β-sheet structures, and a lesser effect of gold sputtering. The effects of iodine doping were further probed by Fourier transform infrared (FTIR spectroscopy, revealing a partial transformation of β-sheet-to-amorphous constituency. A model is proposed, based on the findings from the MAS-NMR and FTIR, which involves iodine-induced changes in the silk fibroin bundle environment that can account for the altered physical properties. Finally, proof

  15. Peptidomic and transcriptomic profiling of four distinct spider venoms.

    Directory of Open Access Journals (Sweden)

    Vera Oldrati

    Full Text Available Venom based research is exploited to find novel candidates for the development of innovative pharmacological tools, drug candidates and new ingredients for cosmetic and agrochemical industries. Moreover, venomics, as a well-established approach in systems biology, helps to elucidate the genetic mechanisms of the production of such a great molecular biodiversity. Today the advances made in the proteomics, transcriptomics and bioinformatics fields, favor venomics, allowing the in depth study of complex matrices and the elucidation even of minor compounds present in minute biological samples. The present study illustrates a rapid and efficient method developed for the elucidation of venom composition based on NextGen mRNA sequencing of venom glands and LC-MS/MS venom proteome profiling. The analysis of the comprehensive data obtained was focused on cysteine rich peptide toxins from four spider species originating from phylogenetically distant families for comparison purposes. The studied species were Heteropoda davidbowie (Sparassidae, Poecilotheria formosa (Theraphosidae, Viridasius fasciatus (Viridasiidae and Latrodectus mactans (Theridiidae. This led to a high resolution profiling of 284 characterized cysteine rich peptides, 111 of which belong to the Inhibitor Cysteine Knot (ICK structural motif. The analysis of H. davidbowie venom revealed a high richness in term of venom diversity: 95 peptide sequences were identified; out of these, 32 peptides presented the ICK structural motif and could be classified in six distinct families. The profiling of P. formosa venom highlighted the presence of 126 peptide sequences, with 52 ICK toxins belonging to three structural distinct families. V. fasciatus venom was shown to contain 49 peptide sequences, out of which 22 presented the ICK structural motif and were attributed to five families. The venom of L. mactans, until now studied for its large neurotoxins (Latrotoxins, revealed the presence of 14

  16. Physical characterization of functionalized spider silk: electronic and sensing properties

    Energy Technology Data Exchange (ETDEWEB)

    Steven, Eden; Brooks, James S [Department of Physics and National High Magnetic Field Laboratory, Florida State University, 1800 East Paul Dirac, Tallahassee, FL 32310 (United States); Park, Jin Gyu [FAMU-FSU Department of Industrial and Manufacturing Engineering, High-Performance Materials Institute, Florida State University, 2005 Levy Ave., Tallahassee, FL 32310 (United States); Paravastu, Anant; Siegrist, Theo; Kaner, Papatya; Alamo, Rufina G [FAMU-FSU Department of Chemical and Biomedical Engineering and National High Magnetic Field Laboratory, Florida State University, 1800 East Paul Dirac, Tallahassee, FL 32310 (United States); Branco Lopes, Elsa [Departamento de Quimica, Instituto Tecnologico e Nuclear/CFMC-UL, P-2686-953 Sacavem (Portugal); Englander, Ongi, E-mail: esteven@magnet.fsu.edu [FAMU-FSU Department of Mechanical Engineering and National High Magnetic Field Laboratory, Florida State University, 1800 East Paul Dirac, Tallahassee, Florida 32310 (United States)

    2011-10-15

    This work explores functional, fundamental and applied aspects of naturally harvested spider silk fibers. Natural silk is a protein polymer where different amino acids control the physical properties of fibroin bundles, producing, for example, combinations of {beta}-sheet (crystalline) and amorphous (helical) structural regions. This complexity presents opportunities for functional modification to obtain new types of material properties. Electrical conductivity is the starting point of this investigation, where the insulating nature of neat silk under ambient conditions is described first. Modification of the conductivity by humidity, exposure to polar solvents, iodine doping, pyrolization and deposition of a thin metallic film are explored next. The conductivity increases exponentially with relative humidity and/or solvent, whereas only an incremental increase occurs after iodine doping. In contrast, iodine doping, optimal at 70 deg. C, has a strong effect on the morphology of silk bundles (increasing their size), on the process of pyrolization (suppressing mass loss rates) and on the resulting carbonized fiber structure (that becomes more robust against bending and strain). The effects of iodine doping and other functional parameters (vacuum and thin film coating) motivated an investigation with magic angle spinning nuclear magnetic resonance (MAS-NMR) to monitor doping-induced changes in the amino acid-protein backbone signature. MAS-NMR revealed a moderate effect of iodine on the helical and {beta}-sheet structures, and a lesser effect of gold sputtering. The effects of iodine doping were further probed by Fourier transform infrared (FTIR) spectroscopy, revealing a partial transformation of {beta}-sheet-to-amorphous constituency. A model is proposed, based on the findings from the MAS-NMR and FTIR, which involves iodine-induced changes in the silk fibroin bundle environment that can account for the altered physical properties. Finally, proof

  17. Physical characterization of functionalized spider silk: electronic and sensing properties

    International Nuclear Information System (INIS)

    Steven, Eden; Brooks, James S; Park, Jin Gyu; Paravastu, Anant; Siegrist, Theo; Kaner, Papatya; Alamo, Rufina G; Branco Lopes, Elsa; Englander, Ongi

    2011-01-01

    This work explores functional, fundamental and applied aspects of naturally harvested spider silk fibers. Natural silk is a protein polymer where different amino acids control the physical properties of fibroin bundles, producing, for example, combinations of β-sheet (crystalline) and amorphous (helical) structural regions. This complexity presents opportunities for functional modification to obtain new types of material properties. Electrical conductivity is the starting point of this investigation, where the insulating nature of neat silk under ambient conditions is described first. Modification of the conductivity by humidity, exposure to polar solvents, iodine doping, pyrolization and deposition of a thin metallic film are explored next. The conductivity increases exponentially with relative humidity and/or solvent, whereas only an incremental increase occurs after iodine doping. In contrast, iodine doping, optimal at 70 deg. C, has a strong effect on the morphology of silk bundles (increasing their size), on the process of pyrolization (suppressing mass loss rates) and on the resulting carbonized fiber structure (that becomes more robust against bending and strain). The effects of iodine doping and other functional parameters (vacuum and thin film coating) motivated an investigation with magic angle spinning nuclear magnetic resonance (MAS-NMR) to monitor doping-induced changes in the amino acid-protein backbone signature. MAS-NMR revealed a moderate effect of iodine on the helical and β-sheet structures, and a lesser effect of gold sputtering. The effects of iodine doping were further probed by Fourier transform infrared (FTIR) spectroscopy, revealing a partial transformation of β-sheet-to-amorphous constituency. A model is proposed, based on the findings from the MAS-NMR and FTIR, which involves iodine-induced changes in the silk fibroin bundle environment that can account for the altered physical properties. Finally, proof-of-concept applications of

  18. Local and Landscape Correlates of Spider Activity Density and Species Richness in Urban Gardens.

    Science.gov (United States)

    Otoshi, Michelle D; Bichier, Peter; Philpott, Stacy M

    2015-08-01

    Urbanization is a major threat to arthropod biodiversity and abundance due to reduction and loss of suitable natural habitat. Green spaces and small-scale agricultural areas may provide habitat and resources for arthropods within densely developed cities. We studied spider activity density (a measure of both abundance and degree of movement) and diversity in urban gardens in Santa Cruz, Santa Clara, and Monterey counties in central California, USA. We sampled for spiders with pitfall traps and sampled 38 local site characteristics for 5 mo in 19 garden sites to determine the relative importance of individual local factors. We also analyzed 16 landscape variables at 500-m and 1-km buffers surrounding each garden to determine the significance of landscape factors. We identified individuals from the most common families to species and identified individuals from other families to morphospecies. Species from the families Lycosidae and Gnaphosidae composed 81% of total adult spider individuals. Most of the significant factors that correlated with spider activity density and richness were local rather than landscape factors. Spider activity density and richness increased with mulch cover and flowering plant species, and decreased with bare soil. Thus, changes in local garden management have the potential to promote diversity of functionally important spiders in urban environments. © The Authors 2015. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  19. Whiteflies interfere with indirect plant defense against spider mites in Lima bean

    Science.gov (United States)

    Zhang, Peng-Jun; Zheng, Si-Jun; van Loon, Joop J. A.; Boland, Wilhelm; David, Anja; Mumm, Roland; Dicke, Marcel

    2009-01-01

    Plants under herbivore attack are able to initiate indirect defense by synthesizing and releasing complex blends of volatiles that attract natural enemies of the herbivore. However, little is known about how plants respond to infestation by multiple herbivores, particularly if these belong to different feeding guilds. Here, we report the interference by a phloem-feeding insect, the whitefly Bemisia tabaci, with indirect plant defenses induced by spider mites (Tetranychus urticae) in Lima bean (Phaseolus lunatus) plants. Additional whitefly infestation of spider-mite infested plants resulted in a reduced attraction of predatory mites (Phytoseiulus persimilis) compared to attraction to plants infested by spider mites only. This interference is shown to result from the reduction in (E)-β-ocimene emission from plants infested by both spider mites and whiteflies. When using exogenous salicylic acid (SA) application to mimic B. tabaci infestation, we observed similar results in behavioral and chemical analyses. Phytohormone and gene-expression analyses revealed that B. tabaci infestation, as well as SA application, inhibited spider mite-induced jasmonic acid (JA) production and reduced the expression of two JA-regulated genes, one of which encodes for the P. lunatus enzyme β-ocimene synthase that catalyzes the synthesis of (E)-β-ocimene. Remarkably, B. tabaci infestation concurrently inhibited SA production induced by spider mites. We therefore conclude that in dual-infested Lima bean plants the suppression of the JA signaling pathway by whitefly feeding is not due to enhanced SA levels. PMID:19965373

  20. Social makes smart: rearing conditions affect learning and social behaviour in jumping spiders.

    Science.gov (United States)

    Liedtke, J; Schneider, J M

    2017-11-01

    There is a long-standing debate as to whether social or physical environmental aspects drive the evolution and development of cognitive abilities. Surprisingly few studies make use of developmental plasticity to compare the effects of these two domains during development on behaviour later in life. Here, we present rearing effects on the development of learning abilities and social behaviour in the jumping spider Marpissa muscosa. These spiders are ideally suited for this purpose because they possess the ability to learn and can be reared in groups but also in isolation without added stress. This is a critical but rarely met requirement for experimentally varying the social environment to test its impact on cognition. We split broods of spiders and reared them either in a physically or in a socially enriched environment. A third group kept under completely deprived conditions served as a 'no-enrichment' control. We tested the spiders' learning abilities by using a modified T-maze. Social behaviour was investigated by confronting spiders with their own mirror image. Results show that spiders reared in groups outperform their conspecifics from the control, i.e. 'no-enrichment', group in both tasks. Physical enrichment did not lead to such an increased performance. We therefore tentatively suggest that growing up in contact with conspecifics induces the development of cognitive abilities in this species.