WorldWideScience

Sample records for brookhaven ags

  1. Increased intensity performance of the Brookhaven AGS

    Energy Technology Data Exchange (ETDEWEB)

    Raka, E.; Ahrens, L.; Frey, W.; Gill, E.; Glenn, J.W.; Sanders, R.; Weng, W.

    1985-05-01

    With the advent of H/sup -/ injection into the Brookhaven AGS, circulating beams of up to 3 x 10/sup 13/ protons at 200 MeV have been obtained. Rf capture of 2.2 x 10/sup 13/ and acceleration of 1.73 x 10/sup 13/ up to the transition energy (approx. = 8 GeV) and 1.64 x 10/sup 13/ to full energy (approx. = 29 GeV) has been achieved. This represents a 50% increase over the best performance obtained with H/sup +/ injection. The increase in circulation beam current is obtained without filling the horizontal aperture. This allows the rf capture process to utilize a larger longitudinal phase space area (approx. = 1 eV sec/bunch vs less than or equal to 0.6 eV sec with H/sup +/ operation). The resulting reduction in relative longitudinal density partially offsets the increase in space charge effects at higher currents. In order to make the capture process independent of injected beam current, a dynamic beam loading compensation loop was installed on the AGS rf system. This is the only addition to the synchrotron itself that was required to reach the new intensity records. A discussion of injection, the rf capture process, and space charge effects is presented. 9 refs., 5 figs.

  2. Initial experiments with the Nevis Cyclotron, the Brookhaven Cosmotron, the Brookhaven AGS and their effects on high energy physics

    Energy Technology Data Exchange (ETDEWEB)

    Lindenbaum, S.J.

    1988-01-01

    The first experiment at the Nevis Cyclotron by Bernardini, Booth and Lindenbaum demonstrated that nuclear stars are produced by a nucleon-nucleon cascade within the nucleon. This solved a long standing problem in Cosmic rays and made it clear that where they overlap cosmic ray investigation would not be competitive with accelerator investigations. The initial experiments at the Brookhaven Cosmotron by Lindenbaum and Yuan demonstrated that low energy pion nucleon scattering and pion production were unexpectedly mostly due to excitation of the isotopic spin = angular momentum = 3/2 isobaric state of the nucleon. This contradicted the Fermi statistical theory and led to the Isobar model proposed by the author and a collaborator. The initial experiments at the AGS by the author and collaborators demonstrated that the Pomeronchuck Theorem would not come true till at least several hundred GeV. These scattering experiments led to the development of the ''On-line Computer Technique'' by the author and collaborators which is now the almost universal technique in high energy physics. The first accomplishment which flowed from this technique led to contradiction of the Regge pole theory as a dynamical asymptotic theory, by the author and collaborators. The first critical experimental proof of the forward dispersion relation in strong interactions was accomplished by the author and collaborators. They were then used as a crystal ball to predict that ''Asymptopia''---the theoretically promised land where all asymptotic theorems come true---would not be reached till at least 25,000 BeV and probably not before 1,000,000 BeV. 26 refs., 11 figs., 2 tabs.

  3. Brookhaven highlights

    Energy Technology Data Exchange (ETDEWEB)

    Rowe, M.S.; Cohen, A.; Greenberg, D.; Seubert, L. (eds.)

    1992-01-01

    This publication provides a broad overview of the research programs and efforts being conducted, built, designed, and planned at Brookhaven National Laboratory. This work covers a broad range of scientific disciplines. Major facilities include the Alternating Gradient Synchrotron (AGS), with its newly completed booster, the National Synchrotron Light Source (NSLS), the High Flux Beam Reactor (HFBR), and the RHIC, which is under construction. Departments within the laboratory include the AGS department, accelerator development, physics, chemistry, biology, NSLS, medical, nuclear energy, and interdepartmental research efforts. Research ranges from the pure sciences, in nuclear physics and high energy physics as one example, to environmental work in applied science to study climatic effects, from efforts in biology which are a component of the human genome project to the study, production, and characterization of new materials. The paper provides an overview of the laboratory operations during 1992, including staffing, research, honors, funding, and general laboratory plans for the future.

  4. Brookhaven highlights - Brookhaven National Laboratory 1995

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-09-01

    This report highlights research conducted at Brookhaven National Laboratory in the following areas: alternating gradient synchrotron; physics; biology; national synchrotron light source; department of applied science; medical; chemistry; department of advanced technology; reactor; safety and environmental protection; instrumentation; and computing and communications.

  5. Brookhaven Linac Isotope Producer

    Data.gov (United States)

    Federal Laboratory Consortium — The Brookhaven Linac Isoptope Producer (BLIP)—positioned at the forefront of research into radioisotopes used in cancer treatment and diagnosis—produces commercially...

  6. Brookhaven National Laboratory

    Science.gov (United States)

    ... Medical Data Analysis for U.S. Veterans Making Glass Invisible: A Nanoscience-Based Disappearing Act Our Mission We ... our diverse portfolio of licensable technologies. | More Outlook Web Access Brookhaven National Lab PO Box 5000 Upton, ...

  7. AGS-2000: Experiments for the 21. Century. Proceedings of the workshop held at Brookhaven National Laboratory, May 13--17, 1996

    Energy Technology Data Exchange (ETDEWEB)

    Littenberg, L. [ed.] [Brookhaven National Lab., Upton, NY (United States); Sandweiss, J. [ed.] [Yale Univ., New Haven, CT (United States)

    1996-10-01

    The AGS has a vital and interesting potential for new research. The reasons for this are a fortunate concomitance of the energy chosen for the AGS and the steady stream of technological advances which have both increased the intensity and flexibility of the AGS beams, and the capability of detectors to use these new beam parameters. The physics potentials of the future AGS program can be roughly divided into three broad areas. (1) fundamental elementary particle studies (based on rare kaon decays, rare muon processes and searches for new particles); (2) non-perturbative QCD; and (3) heavy ion physics. The overriding considerations for the operation of the AGS in the next decade must, of course, be the interest and potential of the scientific program. However, once that has been established, there are other aspects of the AGS program which deserve mention. Although experiments at the AGS are of increasing sophistication, they are smaller, less expensive, and more quickly executed than experiments at newer, larger facilities. Finally, the authors note that since the AGS must be maintained as a viable accelerator to serve as an injector to RHIC, the cost of an AGS fixed target experiment need be only the incremental cost of the experiment itself along with some modest additional operating costs. This means that AGS fixed target experiments are substantially cheaper than they would have been before the RHIC era. The remainder of this document contains brief summaries of the experiments considered by the working groups in the AGS-2000 Workshop. These summaries expand on points discussed here.

  8. Brookhaven leak reactor to close

    CERN Multimedia

    MacIlwain, C

    1999-01-01

    The DOE has announced that the High Flux Beam Reactor at Brookhaven is to close for good. Though the news was not unexpected researchers were angry the decision had been taken before the review to assess the impact of reopening the reactor had been concluded (1 page).

  9. AGS experiments - 1994, 1995, 1996

    Energy Technology Data Exchange (ETDEWEB)

    Depken, J.C.

    1997-01-01

    This report contains the following information on the Brookhaven AGS Accelerator complex: FY 1996 AGS schedule as run; FY 1997 AGS schedule (working copy); AGS beams 1997; AGS experimental area FY 1994 physics program; AGS experimental area FY 1995 physics program; AGS experimental area FY 1996 physics program; AGS experimental area FY 1997 physics program (in progress); a listing of experiments by number; two-phage summaries of each experiment begin here, also ordered by number; listing of publications of AGS experiments begins here; and listing of AGS experimenters begins here.

  10. Brookhaven Highlights, January 1982-March 1983

    Energy Technology Data Exchange (ETDEWEB)

    Kuper, J.B.H.; Rustad, M.C. (eds.)

    1983-01-01

    Research at Brookhaven National Laboratory is summarized. Major headings are high energy physics, physics and chemistry, life sciences, applied energy science, support activities and administration. (GHT)

  11. BROOKHAVEN NATIONAL LABORATORY WILDLIFE MANAGEMENT PLAN.

    Energy Technology Data Exchange (ETDEWEB)

    NAIDU,J.R.

    2002-10-22

    The purpose of the Wildlife Management Plan (WMP) is to promote stewardship of the natural resources found at the Brookhaven National Laboratory (BNL), and to integrate their protection with pursuit of the Laboratory's mission.

  12. ATLAS Overview Week at Brookhaven

    CERN Multimedia

    Pilcher, J

    Over 200 ATLAS participants gathered at Brookhaven National Laboratory during the first week of June for our annual overview week. Some system communities arrived early and held meetings on Saturday and Sunday, and the detector interface group (DIG) and Technical Coordination also took advantage of the time to discuss issues of interest for all detector systems. Sunday was also marked by a workshop on the possibilities for heavy ion physics with ATLAS. Beginning on Monday, and for the rest of the week, sessions were held in common in the well equipped Berkner Hall auditorium complex. Laptop computers became the norm for presentations and a wireless network kept laptop owners well connected. Most lunches and dinners were held on the lawn outside Berkner Hall. The weather was very cooperative and it was an extremely pleasant setting. This picture shows most of the participants from a view on the roof of Berkner Hall. Technical Coordination and Integration issues started the reports on Monday and became a...

  13. Strong interactions of hyperons. [Summaries of research activities of Brookhaven National Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Nemethy, P.; Hungerbuehler, V.; Majka, R.

    1975-01-01

    A summary of the strong interaction results obtained with the Yale--FNAL--BNL hyperon beam at the Brookhaven AGS is presented. Differential cross sections are reported for hyperon-proton elastic scattering with samples of 6200 ..sigma../sup -/p events and 67 ..xi../sup -/p events. Also a report is made on a search for hyperon resonances in inelastic scattering. Finally, the prospects for new results on hyperon interactions are reviewed.

  14. Dr. Praveen Chaudhari named director of Brookhaven National Laboratory

    CERN Multimedia

    2003-01-01

    "Brookhaven Science Associates announced today the selection of Dr. Praveen Chaudhari as Director of the U.S. Department of Energy's Brookhaven National Laboratory. Dr. Chaudhari, who will begin his new duties on April 1, joins Brookhaven Lab after 36 years of distinguished service at IBM as a scientist and senior manager of research" (1 page).

  15. Brookhaven highlights, October 1979-September 1980

    Energy Technology Data Exchange (ETDEWEB)

    1980-01-01

    Highlights are given for the research areas of the Brookhaven National Laboratory. These areas include high energy physics, physics and chemistry, life sciences, applied energy science (energy and environment, and nuclear energy), and support activities (including mathematics, instrumentation, reactors, and safety). (GHT)

  16. AGS 20th anniversary celebration

    Energy Technology Data Exchange (ETDEWEB)

    Baggett, N.V. (ed.)

    1980-05-22

    On May 22, 1980, a symposium was held at Brookhaven to celebrate the 20th birthday of the AGS, to recall its beginnings, and to review major discoveries that have been made with its beams. The talks at the symposium are recorded in this volume.

  17. Measurement of the longitudinal coupling impedance in the Brookhaven AGS

    Energy Technology Data Exchange (ETDEWEB)

    Pedersen, F.; Raka, E.C.

    1979-01-01

    The imaginary part of the longitudinal coupling impedance has been measured as a function of energy from 5 to approx. 28 GeV. This impedance is proportional to ..delta..f = (f/sub q/--2f/sub d/) where f/sub d/ is the coherent dipole frequency and f/sub q/ the coherent quadrupole frequency. These frequencies are obtained by stimulating coupled bunch oscillations. If the dominant impedance is due to inductive wall plus space charge effects, then one has (Z/n) = j(..cap omega../sub 0/L--g/sub 0/Z/sub 0//2BETA..gamma.../sup 2/)/sup 1/ where L is the inductance per turn and ..cap omega../sub 0/ = 2..pi..f/sub 0/ the particle rotation frequency. The expression (Z/n) = 4j..delta..f..pi../sup 2/hV/sub 0/cos phi/sub s/B/sup 3//3I/sub 0/f/sub d/ can be used to find the impedance if the synchrotron phase space distribution is proportional to (1--r/sup 2/)/sub 1/2/. I/sub 0/ is the current per bunch, B = f/sub 0/ x tau/sub 0/ the bunch length and V/sub 0/ is the external voltage. For a distribution given by (1--r/sup 2/) the right hand side should be multiplied by 27/4..pi../sup 2/. If the latter is assumed, an inductive impedance of 20.4 ..cap omega.. is obtained with a null at approx. = 6 Gev (..gamma../sub tr/ = 8.5) for a transverse emittance of 22 ..pi mu.. rad-m. At 5 GeV the reactance is negative but larger than the simple relation assumed for (Z/n) would predict. If the bunches are parabolic, then the inductive impedance would be 29.7 ..cap omega.. with a null again at 6.6 GeV but only for an emittance of 2.5 ..mu..rad-m. Again the 5 GeV reactance is much too large. The significance of these results is discussed.

  18. Searching for the H dibaryon at Brookhaven

    Energy Technology Data Exchange (ETDEWEB)

    Schwartz, A.J. [Princeton Univ., NJ (United States)

    1994-12-01

    This paper reviews the status of current experiments at Brookhaven, searching for the six-quark H dibaryon postulated by R. Jaffe in 1977. Two experiments, E813 and E888, have recently completed running and two new experiments, E836 and E885, are approved to run. The data recorded so far is under analysis and should have good sensitivity to both short-lived and long-lived Hs.

  19. The Brookhaven electron analogue, 1953--1957

    Energy Technology Data Exchange (ETDEWEB)

    Plotkin, M.

    1991-12-18

    The following topics are discussed on the Brookhaven electron analogue: L.J. Haworth and E.L. VanHorn letters; Original G.K. Green outline for report; General description; Parameter list; Mechanical Assembly; Alignment; Degaussing; Vacuum System; Injection System; The pulsed inflector; RF System; Ferrite Cavity; Pick-up electrodes and preamplifiers; Radio Frequency power amplifier; Lens supply; Controls and Power; and RF acceleration summary.

  20. Brookhaven National Laboratory site environmental report for calendar year 1994

    Energy Technology Data Exchange (ETDEWEB)

    Naidu, J.R.; Royce, B.A. [eds.

    1995-05-01

    This report documents the results of the Environmental Monitoring Program at Brookhaven National Laboratory and presents summary information about environmental compliance for 1994. To evaluate the effect of Brookhaven National Laboratory`s operations on the local environment, measurements of direct radiation, and a variety of radionuclides and chemical compounds in ambient air, soil, sewage effluent, surface water, groundwater, fauna and vegetation were made at the Brookhaven National Laboratory site and at sites adjacent to the Laboratory.

  1. Brookhaven highlights, October 1, 1989--September 30, 1990

    Energy Technology Data Exchange (ETDEWEB)

    Rowe, M.S.; Cohen, A.; Greenberg, D.; Seubert, L.; Kuper, J.B.H. (eds.)

    1990-01-01

    This report discusses research being conducted at Brookhaven National Laboratory. Highlights from all the department are illustrated. The main topics are on accelerator development and applications. (LSP)

  2. Studies of relativistic heavy ion collisions at the AGS (Experiment 814)

    Energy Technology Data Exchange (ETDEWEB)

    Cleland, W.E.

    1990-01-01

    This report discusses the experimental setup of experiment 814 at Brookhaven AGS. This experiment involves the collision of silicon ions with target nuclei. The detector systems are discussed primarily. (LSP)

  3. Brookhaven highlights. [Fiscal year 1992, October 1, 1991--September 30, 1992

    Energy Technology Data Exchange (ETDEWEB)

    Rowe, M.S.; Cohen, A.; Greenberg, D.; Seubert, L. [eds.

    1992-12-31

    This publication provides a broad overview of the research programs and efforts being conducted, built, designed, and planned at Brookhaven National Laboratory. This work covers a broad range of scientific disciplines. Major facilities include the Alternating Gradient Synchrotron (AGS), with its newly completed booster, the National Synchrotron Light Source (NSLS), the High Flux Beam Reactor (HFBR), and the RHIC, which is under construction. Departments within the laboratory include the AGS department, accelerator development, physics, chemistry, biology, NSLS, medical, nuclear energy, and interdepartmental research efforts. Research ranges from the pure sciences, in nuclear physics and high energy physics as one example, to environmental work in applied science to study climatic effects, from efforts in biology which are a component of the human genome project to the study, production, and characterization of new materials. The paper provides an overview of the laboratory operations during 1992, including staffing, research, honors, funding, and general laboratory plans for the future.

  4. Brookhaven highlights, October 1978-September 1979. [October 1978 to September 1979

    Energy Technology Data Exchange (ETDEWEB)

    1979-01-01

    These highlights present an overview of the major research and development achievements at Brookhaven National Laboratory from October 1978 to September 1979. Specific areas covered include: accelerator and high energy physics programs; high energy physics research; the AGS and improvements to the AGS; neutral beam development; heavy ion fusion; superconducting power cables; ISABELLE storage rings; the BNL Tandem accelerator; heavy ion experiments at the Tandem; the High Flux Beam Reactor; medium energy physics; nuclear theory; atomic and applied physics; solid state physics; neutron scattering studies; x-ray scattering studies; solid state theory; defects and disorder in solids; surface physics; the National Synchrotron Light Source ; Chemistry Department; Biology Department; Medical Department; energy sciences; environmental sciences; energy technology programs; National Center for Analysis of Energy Systems; advanced reactor systems; nuclear safety; National Nuclear Data Center; nuclear materials safeguards; Applied Mathematics Department; and support activities. (GHT)

  5. Brookhaven National Laboratory site environmental report for calendar year 1996

    Energy Technology Data Exchange (ETDEWEB)

    Schroeder, G.L.; Paquette, D.E.; Naidu, J.R.; Lee, R.J.; Briggs, S.L.K.

    1998-01-01

    This report documents the results of the Environmental Monitoring Program at Brookhaven National Laboratory and summarizes information about environmental compliance for 1996. To evaluate the effect of Brookhaven National Laboratory`s operations on the local environment, measurements of direct radiation, and of a variety of radionuclides and chemical compounds in the ambient air, soil, sewage effluent, surface water, groundwater, fauna, and vegetation were made at the Brookhaven National Laboratory site and at adjacent sites. The report also evaluates the Laboratory`s compliance with all applicable guides, standards, and limits for radiological and non-radiological emissions and effluents to the environment.

  6. RHIC and quark matter: proposal for a relativistic heavy ion collider at Brookhaven National Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    1984-08-01

    This document describes the Brookhaven National Laboratory Proposal for the construction of a Relativistic Heavy Ion Collider (RHIC). The construction of this facility represents the natural continuation of the laboratory's role as a center for nuclear and high-energy physics research and extends and uses the existing AGS, Tandem Van de Graaff and CBA facilities at BNL in a very cost effective manner. The Administration and Congress have approved a project which will provide a link between the Tandem Van de Graaf and the AGS. Completion of this project in 1986 will provide fixed target capabilities at the AGS for heavy ions of about 14 GeV/amu with masses up to approx. 30 (sulfur). The addition of an AGS booster would extend the mass range to the heaviest ions (A approx. 200, e.g., gold); its construction could start in 1986 and be completed in three years. These two new AGS experimental facilities can be combined with the proposed Relativistic Heavy Ion Collider to extend the energy range to 100 x 100 GeV/amu for the heaviest ions. BNL proposes to start construction of RHIC in FY 86 with completion in FY 90 at a total cost of 134 M$.

  7. Geothermal materials development at Brookhaven National Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Kukacka, L.E. [Brookhaven National Lab., Upton, NY (United States)

    1997-12-31

    As part of the DOE/OGT response to recommendations and priorities established by industrial review of their overall R&D program, the Geothermal Materials Program at Brookhaven National Laboratory (BNL) is focusing on topics that can reduce O&M costs and increase competitiveness in foreign and domestic markets. Corrosion and scale control, well completion materials, and lost circulation control have high priorities. The first two topics are included in FY 1997 BNL activities, but work on lost circulation materials is constrained by budgetary limitations. The R&D, most of which is performed as cost-shared efforts with U.S. geothermal firms, is rapidly moving into field testing phases. FY 1996 and 1997 accomplishments in the development of lightweight CO{sub 2}-resistant cements for well completions; corrosion resistant, thermally conductive polymer matrix composites for heat exchange applications; and metallic, polymer and ceramic-based corrosion protective coatings are given in this paper. In addition, plans for work that commenced in March 1997 on thermally conductive cementitious grouting materials for use with geothermal heat pumps (GHP), are discussed.

  8. Linear accelerator development at Brookhaven National Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Batchelor, K

    1976-01-01

    A description is given of operating experience on the 200 MeV Proton Injector Linace of the A.G.S. emphasizing developments in field phase and amplitude control and beam diagnostics. Developments in auxilliary use of the machine are also described.

  9. Workshop on the AGS fixed-target research program

    Energy Technology Data Exchange (ETDEWEB)

    Ahrens, L; Schewe, P; Wanderer, P; Weisberg, H [eds.

    1978-01-01

    The summarized results of a two day workshop to determine experiment programs for the Brookhaven AGS during the construction period of the ISABELLE storage rings and after are presented. Topics covered include: experiments with low-energy beams; experiments with higher energy beams; neutrino physics; and polarized protons. (GHT)

  10. Brookhaven Lab and Argonne Lab scientists invent a plasma valve

    CERN Multimedia

    2003-01-01

    Scientists from Brookhaven National Laboratory and Argonne National Laboratory have received U.S. patent number 6,528,948 for a device that shuts off airflow into a vacuum about one million times faster than mechanical valves or shutters that are currently in use (1 page).

  11. COMPUTATIONAL SCIENCE AT BROOKHAVEN NATIONAL LABORATORY: THREE SELECTED TOPICS.

    Energy Technology Data Exchange (ETDEWEB)

    DAVENPORT,J.W.DENG,Y.GLIMM,J.SAMULYAK,R.

    2003-09-15

    We present an overview of computational science at Brookhaven National Laboratory (BNL), with selections from three areas: fluids, nanoscience, and biology. The work at BNL in each of these areas is itself very broad, and we select a few topics for presentation within each of them.

  12. Brookhaven National Laboratory site environmental report for calendar year 1995

    Energy Technology Data Exchange (ETDEWEB)

    Naidu, J.R.; Paquette, D.E.; Schroeder, G.L. [eds.] [and others

    1996-12-01

    This report documents the results of the Environmental Monitoring Program at Brookhaven National Laboratory and summarizes information about environmental compliance for 1995. To evaluate the effect of Brookhaven National Laboratory`s operations on the local environment, measurements of direct radiation, and of a variety of radionuclides and chemical compounds in the ambient air, soil, sewage effluent, surface water, groundwater, fauna, and vegetation were made at the Brookhaven National Laboratory site and at adjacent sites. The report also evaluates the Laboratory`s compliance with all applicable guides, standards, and limits for radiological and nonradiological emissions and effluents to the environment. Areas of known contamination are subject to Remedial Investigation/Feasibility Studies under the Inter Agency Agreement established by the Department of Energy, Environmental Protection Agency and the New York Department of Environmental Conservation. Except for identified areas of soil and groundwater contamination, the environmental monitoring data has continued to demonstrate that compliance was achieved with the applicable environmental laws and regulations governing emission and discharge of materials to the environment. Also, the data show that the environmental impacts at Brookhaven National Laboratory are minimal and pose no threat to the public nor to the environment. This report meets the requirements of Department of Energy Orders 5484.1, Environmental Protection, Safety, and Health Protection Information reporting requirements and 5400.1, General Environmental Protection Programs.

  13. Review of Brookhaven nuclear transparency measurements in (p ...

    Indian Academy of Sciences (India)

    Home; Journals; Pramana – Journal of Physics; Volume 61; Issue 5. Review of Brookhaven nuclear transparency ... First, we describe the measurements with the newer experiment, E850, which has more complete kinematic definition of quasi-elastic events. E850 covers a larger range of incident momenta, and thus ...

  14. Brookhaven National Laboratory moves to the fast lane

    CERN Multimedia

    2006-01-01

    "The U.S. Department of Energy's energy sciences network (ESnet) continues to roll out its next-generation architecture on schedule with the March 14 completion of the Long Island Metropolitan Area Network, connecting Brookhaven National Laboratory (BNL) to the ESnet point of presente (PO) 60 miles away in New York City." (1 page)

  15. Polarization preservation in the AGS

    Energy Technology Data Exchange (ETDEWEB)

    Ratner, L.G.

    1983-01-01

    The successful operation of a high energy polarized beam at the Argonne Zero Gradient Synchrotron (ZGS) with the concommitant development of depolarizing resonance correction techniques has led to the present project of commissioning such a beam at the Brookhaven Alternating Gradient Synchrotron (AGS). A description of the project was presented at the 1981 National Accelerator Conference. I would like to now present a more detailed description of how we plan to preserve the polarization during acceleration, and to present our game plan for tuning through some 50 resonances and reaching our goal of a 26 GeV polarized proton beam with greater than 60% polarization.

  16. BROOKHAVEN NATIONAL LABORATORY INSTITUTIONAL PLAN FY2003-2007.

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2003-06-10

    This document presents the vision for Brookhaven National Laboratory (BNL) for the next five years, and a roadmap for implementing that vision. Brookhaven is a multidisciplinary science-based laboratory operated for the U.S. Department of Energy (DOE), supported primarily by programs sponsored by the DOE's Office of Science. As the third-largest funding agency for science in the U.S., one of the DOE's goals is ''to advance basic research and the instruments of science that are the foundations for DOE's applied missions, a base for U.S. technology innovation, and a source of remarkable insights into our physical and biological world, and the nature of matter and energy'' (DOE Office of Science Strategic Plan, 2000 http://www.osti.gov/portfolio/science.htm). BNL shapes its vision according to this plan.

  17. BROOKHAVEN NATIONAL LABORATORY SITE ENVIRONMENTAL REPORT FOR CALENDAR YEAR 1994.

    Energy Technology Data Exchange (ETDEWEB)

    NAIDU,J.R.; ROYCE,B.A.

    1995-05-01

    This report documents the results of the Environmental Monitoring Program at Brookhaven National Laboratory and presents summary information about environmental compliance for 1994. To evaluate the effect of Brookhaven National Laboratory's operations on the local environment, measurements of direct radiation, and a variety of radionuclides and chemical compounds in ambient air, soil, sewage effluent, surface water, groundwater, fauna and vegetation were made at the Brookhaven National Laboratory site and at sites adjacent to the Laboratory. Brookhaven National Laboratory's compliance with all applicable guides, standards, and limits for radiological and nonradiological emissions and effluents to the environment were evaluated. Among the permitted facilities, two instances of pH exceedances were observed at recharge basins, possibly related to rain-water run-off to these recharge basins. Also, the discharge from the Sewage Treatment Plant to the Peconic River exceeded. on ten occasions, one each for fecal coliform and 5-day Biochemical Oxygen Demand (avg.) and eight for ammonia nitrogen. The ammonia and Biochemical Oxygen Demand exceedances were attributed to the cold winter and the routine cultivation of the sand filter beds which resulted in the hydraulic overloading of the filter beds and the possible destruction of nitrifying bacteria. The on-set of warm weather and increased aeration of the filter beds via cultivation helped to alleviate this condition. The discharge of fecal coliform may also be linked to this occurrence, in that the increase in fecal coliform coincided with the increased cultivation of the sand filter beds. The environmental monitoring data has identified site-specific contamination of groundwater and soil. These areas are subject to Remedial Investigation/Feasibility Studies under the Inter Agency Agreement. Except for the above, the environmental monitoring data has continued to demonstrate that compliance was achieved with

  18. Brookhaven highlights for fiscal year 1991, October 1, 1990--September 30, 1991

    Energy Technology Data Exchange (ETDEWEB)

    Rowe, M.S.; Cohen, A.; Greenberg, D.; Seubert, L.; Kuper, J.B.H.

    1991-12-31

    This report highlights Brookhaven National Laboratory`s activities for fiscal year 1991. Topics from the four research divisions: Computing and Communications, Instrumentation, Reactors, and Safety and Environmental Protection are presented. The research programs at Brookhaven are diverse, as is reflected by the nine different scientific departments: Accelerator Development, Alternating Gradient Synchrotron, Applied Science, Biology, Chemistry, Medical, National Synchrotron Light Source, Nuclear Energy, and Physics. Administrative and managerial information about Brookhaven are also disclosed. (GHH)

  19. Brookhaven highlights for fiscal year 1991, October 1, 1990--September 30, 1991

    Energy Technology Data Exchange (ETDEWEB)

    Rowe, M.S.; Cohen, A.; Greenberg, D.; Seubert, L.; Kuper, J.B.H.

    1991-01-01

    This report highlights Brookhaven National Laboratory's activities for fiscal year 1991. Topics from the four research divisions: Computing and Communications, Instrumentation, Reactors, and Safety and Environmental Protection are presented. The research programs at Brookhaven are diverse, as is reflected by the nine different scientific departments: Accelerator Development, Alternating Gradient Synchrotron, Applied Science, Biology, Chemistry, Medical, National Synchrotron Light Source, Nuclear Energy, and Physics. Administrative and managerial information about Brookhaven are also disclosed. (GHH)

  20. 1995 Annual epidemiologic surveillance report for Brookhaven National Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-12-31

    The US Department of Energy`s (DOE) conduct of epidemiologic surveillance provides an early warning system for health problems among workers. This program monitors illnesses and health conditions that result in an absence of five or more consecutive workdays, occupational injuries and illnesses, and disabilities and deaths among current workers. This report summarizes epidemiologic surveillance data collected from Brookhaven National Laboratory (BNL) from January 1, 1995 through December 31, 1995. The data were collected by a coordinator at BNL and submitted to the Epidemiologic Surveillance Data Center, located at Oak Ridge Institute for Science and Education, where quality control procedures and data analyses were carried out.

  1. Brookhaven National Laboratory site report for calendar year 1988

    Energy Technology Data Exchange (ETDEWEB)

    Miltenberger, R.P.; Royce, B.A.; Naidu, J.R.

    1989-06-01

    Brookhaven National Laboratory (BNL) is managed by Associated Universities Inc. (AUI). AUI was formed in 1946 by a group of nine universities whose purpose was to create and manage a laboratory in the Northeast in order to advance scientific research in areas of interest to universities, industry, and government. On January 31, 1947, the contract for BNL was approved by the Manhattan District of the Army Corps of Engineers and BNL was established on the former Camp Upton army camp. 54 refs., 21 figs., 78 tabs.

  2. Brookhaven National Laboratory site environmental report for calendar year 1991

    Energy Technology Data Exchange (ETDEWEB)

    Naidu, J.R.; Royce, B.A.; Miltenberger, R.P.

    1992-09-01

    This publication presents the results of BNL`s environmental monitoring and compliance effort and provides an assessment of the impact of Brookhaven National Laboratory (BNL) operations on the environment. This document is the responsibility of the Environmental Protection Section of the Safety and Envirorunental Protection Division. Within this Section, the Environmental Monitoring Group (EMG) sample the environment, interpreted the results, performed the impact analysis of the emissions from BNL, and compiled the information presented here. In this effort, other groups of the Section: Compliance; Analytical; Ground Water; and Quality played a key role in addressing the regulatory aspects and the analysis and documentation of the data, respectively.

  3. Brookhaven National Laboratory site environmental report for calendar year 1991

    Energy Technology Data Exchange (ETDEWEB)

    Naidu, J.R.; Royce, B.A.; Miltenberger, R.P.

    1992-09-01

    This publication presents the results of BNL's environmental monitoring and compliance effort and provides an assessment of the impact of Brookhaven National Laboratory (BNL) operations on the environment. This document is the responsibility of the Environmental Protection Section of the Safety and Envirorunental Protection Division. Within this Section, the Environmental Monitoring Group (EMG) sample the environment, interpreted the results, performed the impact analysis of the emissions from BNL, and compiled the information presented here. In this effort, other groups of the Section: Compliance; Analytical; Ground Water; and Quality played a key role in addressing the regulatory aspects and the analysis and documentation of the data, respectively.

  4. Brookhaven National Laboratory site environmental report for calendar year 1990

    Energy Technology Data Exchange (ETDEWEB)

    Miltenberger, R.P.; Royce, B.A.; Naidu, J.R.

    1992-01-01

    Brookhaven National Laboratory (BNL) carries out basic and applied research in the following fields: high-energy nuclear and solid state physics; fundamental material and structure properties and the interactions of matter; nuclear medicine, biomedical and environmental sciences; and selected energy technologies. In conducting these research activities, it is Laboratory policy to protect the health and safety of employees and the public, and to minimize the impact of BNL operations on the environment. This document is the BNL environmental report for the calendar year 1990 for the safety and Environmental Protection division and corners topics on effluents, surveillance, regulations, assessments, and compliance.

  5. 75 FR 43611 - U S Rail Corporation-Construction and Operation Exemption-Brookhaven Rail Terminal

    Science.gov (United States)

    2010-07-26

    ... TRANSPORTATION Surface Transportation Board U S Rail Corporation--Construction and Operation Exemption-- Brookhaven Rail Terminal On August 7, 2008, U S Rail Corporation (U S Rail), an existing class III short line...) of new rail line at a 28-acre site (the Brookhaven Rail Terminal or BRT) located in the Town of...

  6. Brookhaven National Laboratory Institutional Plan FY2001--FY2005

    Energy Technology Data Exchange (ETDEWEB)

    Davis, S.

    2000-10-01

    Brookhaven National Laboratory is a multidisciplinary laboratory in the Department of Energy National Laboratory system and plays a lead role in the DOE Science and Technology mission. The Laboratory also contributes to the DOE missions in Energy Resources, Environmental Quality, and National Security. Brookhaven strives for excellence in its science research and in facility operations and manages its activities with particular sensitivity to environmental and community issues. The Laboratory's programs are aligned continuously with the goals and objectives of the DOE through an Integrated Planning Process. This Institutional Plan summarizes the portfolio of research and capabilities that will assure success in the Laboratory's mission in the future. It also sets forth BNL strategies for our programs and for management of the Laboratory. The Department of Energy national laboratory system provides extensive capabilities in both world class research expertise and unique facilities that cannot exist without federal support. Through these national resources, which are available to researchers from industry, universities, other government agencies and other nations, the Department advances the energy, environmental, economic and national security well being of the US, provides for the international advancement of science, and educates future scientists and engineers.

  7. The High Flux Beam Reactor at Brookhaven National Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Shapiro, S.M.

    1994-12-31

    Brookhaven National Laboratory`s High Flux Beam Reactor (HFBR) was built because of the need of the scientist to always want `more`. In the mid-50`s the Brookhaven Graphite reactor was churning away producing a number of new results when the current generation of scientists, led by Donald Hughes, realized the need for a high flux reactor and started down the political, scientific and engineering path that led to the BFBR. The effort was joined by a number of engineers and scientists among them, Chemick, Hastings, Kouts, and Hendrie, who came up with the novel design of the HFBR. The two innovative features that have been incorporated in nearly all other research reactors built since are: (i) an under moderated core arrangement which enables the thermal flux to peak outside the core region where beam tubes can be placed, and (ii) beam tubes that are tangential to the core which decrease the fast neutron background without affecting the thermal beam intensity. Construction began in the fall of 1961 and four years later, at a cost of $12 Million, criticality was achieved on Halloween Night, 1965. Thus began 30 years of scientific accomplishments.

  8. High field magnet program at Brookhaven National Laboratory

    CERN Document Server

    Ghosh, A; Muratore, J; Parker, B; Sampson, W; Wanderer, P J; Willen, E

    2000-01-01

    The magnet program at Brookhaven National Laboratory (BNL) is focussed on superconducting magnets for particle accelerators. The effort includes magnet production at the laboratory and in industry, magnet R&D, and test facilities for magnets and superconductors. Nearly 2000 magnets-dipoles, quadrupoles, sextupoles and correctors for the arc and insertion regions-were produced for the Relativistic Heavy Ion Collider (RHIC), which is being commissioned. Currently, production of helical dipoles for the polarized proton program at RHIC, insertion region dipoles for the Large Hadron Collider (LHC) at CERN, and an insertion magnet system for the Hadron-Elektron-Ring- Analage (HERA) collider at Deutsches Elektronen-Synchrotron (DESY) is underway. The R&D effort is exploring dipoles with fields above 10 T for use in post-LHC colliders. Brittle superconductors-Nb/sub 3/Sn or HTS-are being used for these magnets. The superconductor test facility measures short-sample currents and other characteristics of sample...

  9. Deriving cleanup guidelines for radionuclides at Brookhaven National Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Meinhold, A.F.; Morris, S.C.; Dionne, B.; Moskowitz, P.D.

    1997-01-01

    Past activities at Brookhaven National Laboratory (BNL) resulted in soil and groundwater contamination. As a result, BNL was designated a Superfund site under the Comprehensive Environmental Response Compensation and Liability Act (CERCLA). BNL`s Office of Environmental Restoration (OER) is overseeing environmental restoration activities at the Laboratory. With the exception of radium, there are no regulations or guidelines to establish cleanup guidelines for radionuclides in soils at BNL. BNL must derive radionuclide soil cleanup guidelines for a number of Operable Units (OUs) and Areas of Concern (AOCs). These guidelines are required by DOE under a proposed regulation for radiation protection of public health and the environment as well as to satisfy the requirements of CERCLA. The objective of this report is to propose a standard approach to deriving risk-based cleanup guidelines for radionuclides in soil at BNL. Implementation of the approach is briefly discussed.

  10. Summary of failure analysis activities at Brookhaven National Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Cowgill, M.G.; Czajkowski, C.J.; Franz, E.M.

    1996-10-01

    Brookhaven National Laboratory has for many years conducted examinations related to the failures of nuclear materials and components. These examinations included the confirmation of root cause analyses, the determination of the causes of failure, identification of the species that accelerate corrosion, and comparison of the results of nondestructive examinations with those obtained by destructive examination. The results of those examinations, which had previously appeared in various formats (formal and informal reports, journal articles, etc.), have been collected together and summarized in the present report. The report is divided into sections according to the general subject matter (for example, corrosion, fatigue, etc.). Each section presents summaries of the information contained in specific reports and publications, all of which are fully identified as to title, authors, report number or journal reference, date of publication, and FIN number under which the work was performed.

  11. Scientists at Brookhaven contribute to the development of a better electron accelerator

    CERN Multimedia

    2004-01-01

    Scientists working at Brookhaven have developed a compact linear accelerator called STELLA (Staged Electron Laser Acceleration). Highly efficient, it may help electron accelerators become practical tools for applications in industry and medicine, such as radiation therapy (1 page)

  12. Proto-2, an ALICE detector prototype, part of the STAR experiment at the Brookhaven National Laboratory

    CERN Multimedia

    2002-01-01

    Proto-2, an LAICE detector prototype, overcame its prototype status to become a real part of the SDTAR, epxeriment at the US Brookhaven National Laboratory. After more than two years across the ocean, it has just arrived back at CERN.

  13. WILDLAND FIRE MANAGEMENT PLAN FOR BROOKHAVEN NATIONAL LABORATORY.

    Energy Technology Data Exchange (ETDEWEB)

    ENVIRONMENTAL AND WASTE MANAGEMENT SERVICES DIVISION

    2003-09-01

    This Wildland Fire Management Plan (FMP) for Brookhaven National Lab (BNL) and the Upton Ecological and Research Reserve (Upton Reserve) is based on the U.S. Fish & Wildlife Service (FWS) fire management planning procedures and was developed in cooperation with the Department of Energy (DOE) by Brookhaven Science Associates. As the Upton Reserve is contained within the BNL 5,265-acre site, it is logical that the plan applies to both the Upton Reserve and BNL. The Department of the Interior policy for managing wildland fires requires that all areas managed by FWS that can sustain fire must have an FMP that details fire management guidelines for operational procedures and specifies values to be protected or enhanced. Fire management plans provide guidance on fire preparedness, fire prevention, wildfire suppression, and the use of controlled, ''prescribed'' fires and mechanical means to control the amount of available combustible material. Values reflected in the BNL/Upton Reserve Wildland FMP include protecting life and public safety; Lab properties, structures and improvements; cultural and historical sites; neighboring private and public properties; and endangered and threatened species and species of concern. Other values supported by the plan include the enhancement of fire-dependent ecosystems at BNL and the Upton Reserve. This FMP will be reviewed periodically to ensure the fire program advances and evolves with the missions of FWS, BNL, and the Upton Reserve. This Fire Management Plan is a modified version of the Long Island National Wildlife Refuge Complex Fire plan (updated in 2000), which contains all FWS fire plan requirements and is presented in the format specified by the national template for fire management plans adopted under the National Fire Plan. The DOE is one of the signatory agencies on the National Fire Plan. FWS shall be, through an Interagency Agreement dated November 2000 (Appendix C), responsible for coordinating and

  14. Brookhaven National Laboratory 2008 Site Environment Report Volume 1

    Energy Technology Data Exchange (ETDEWEB)

    Brookhaven National Laboratory

    2009-10-01

    Brookhaven National Laboratory (BNL) prepares an annual Site Environmental Report (SER) in accordance with DOE Order 231.1A, Environment, Safety and Health Reporting of the U.S. Department of Energy. The report is written to inform the public, regulators, employees, and other stakeholders of the Laboratory's environmental performance during the calendar year in review. Volume I of the SER summarizes environmental data; environmental management performance; compliance with applicable DOE, federal, state, and local regulations; and performance in restoration and surveillance monitoring programs. BNL has prepared annual SERs since 1971 and has documented nearly all of its environmental history since the Laboratory's inception in 1947. Volume II of the SER, the Groundwater Status Report, also is prepared annually to report on the status of and evaluate the performance of groundwater treatment systems at the Laboratory. Volume II includes detailed technical summaries of groundwater data and its interpretation, and is intended for internal BNL users, regulators, and other technically oriented stakeholders. A brief summary of the information contained in Volume II is included in this volume in Chapter 7, Groundwater Protection. Both reports are available in print and as downloadable files on the BNL web page at http://www.bnl.gov/ewms/ser/. An electronic version on compact disc is distributed with each printed report. In addition, a summary of Volume I is prepared each year to provide a general overview of the report, and is distributed with a compact disc containing the full report.

  15. Environmental Survey preliminary report, Brookhaven National Laboratory, Upton, New York

    Energy Technology Data Exchange (ETDEWEB)

    1988-06-01

    This report presents the preliminary findings from the first phase of the Environmental Survey of the United States Department of Energy (DOE) Brookhaven National Laboratory (BNL) conducted April 6 through 17, 1987. The Survey is being conducted by an interdisciplinary team of environmental specialists, led and managed by the Office of Environment, Safety and Health's Office of Environmental Audit. Individual team components are being supplied by a private contractor. The objective of the Survey is to identify environmental problems and areas of environmental risk associated with BNL. The Survey covers all environmental media and all areas of environmental regulation. It is being performed in accordance with the DOE Environmental Survey Manual. This phase of the Survey involves the review of existing site environmental data, observations of the operations carried on at BNL, and interviews with site personnel. The Survey team developed a Sampling and Analysis Plan to assist in further assessing specific environmental problems identified during its on-site activities. The Sampling and Analysis Plan will be executed by Oak Ridge National Laboratory. When completed, the results will be incorporated into the BNL Environmental Survey Interim Report. The Interim Report will reflect the final determinations of the BNL Survey. 80 refs., 24 figs., 48 tabs.

  16. CULTURAL RESOURCE MANAGEMENT PLAN FOR BROOKHAVEN NATIONAL LABORATORY.

    Energy Technology Data Exchange (ETDEWEB)

    DAVIS, M.

    2005-04-01

    The Cultural Resource Management Plan (CRMP) for Brookhaven National Laboratory (BNL) provides an organized guide that describes or references all facets and interrelationships of cultural resources at BNL. This document specifically follows, where applicable, the format of the U.S. Department of Energy (DOE) Environmental Guidelines for Development of Cultural Resource Management Plans, DOE G 450.1-3 (9-22-04[m1]). Management strategies included within this CRMP are designed to adequately identify the cultural resources that BNL and DOE consider significant and to acknowledge associated management actions. A principal objective of the CRMP is to reduce the need for additional regulatory documents and to serve as the basis for a formal agreement between the DOE and the New York State Historic Preservation Officer (NYSHPO). The BNL CRMP is designed to be a ''living document.'' Each section includes identified gaps in the management plan, with proposed goals and actions for addressing each gap. The plan will be periodically revised to incorporate new documentation.

  17. In vivo neutron activation facility at Brookhaven National Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Ma, R.; Yasumura, Seiichi; Dilmanian, F.A.

    1997-11-01

    Seven important body elements, C, N, Ca, P, K, Na, and Cl, can be measured with great precision and accuracy in the in vivo neutron activation facilities at Brookhaven National Laboratory. The facilities include the delayed-gamma neutron activation, the prompt-gamma neutron activation, and the inelastic neutron scattering systems. In conjunction with measurements of total body water by the tritiated-water dilution method several body compartments can be defined from the contents of these elements, also with high precision. In particular, body fat mass is derived from total body carbon together with total body calcium and nitrogen; body protein mass is derived from total body nitrogen; extracellular fluid volume is derived from total body sodium and chlorine; lean body mass and body cell mass are derived from total body potassium; and, skeletal mass is derived from total body calcium. Thus, we suggest that neutron activation analysis may be valuable for calibrating some of the instruments routinely used in clinical studies of body composition. The instruments that would benefit from absolute calibration against neutron activation analysis are bioelectric impedance analysis, infrared interactance, transmission ultrasound, and dual energy x-ray/photon absorptiometry.

  18. Tiger Team assessment of the Brookhaven National Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    1990-06-01

    This report documents the results of the Department of Energy's (DOE's) Tiger Team Assessment conducted at Brookhaven National Laboratory (BNL) in Upton, New York, between March 26 and April 27, 1990. The BNL is a multiprogram laboratory operated by the Associated Universities, Inc., (AUI) for DOE. The purpose of the assessment was to provide the status of environment, safety, and health (ES H) programs at the Laboratory. The scope of the assessment included a review of management systems and operating procedures and records; observations of facility operations; and interviews at the facilities. Subteams in four areas performed the review: ES H, Occupational Safety and Health, and Management and Organization. The assessment was comprehensive, covering all areas of ES H activities and waste management operations. Compliance with applicable Federal, State, and local regulations; applicable DOE Orders; and internal BNL requirements was assessed. In addition, the assessment included an evaluation of the adequacy and effectiveness of the DOE and the site contractor, Associated Universities, Inc. (AUI), management, organization, and administration of the ES H programs at BNL.

  19. HOM identification by bead pulling in the Brookhaven ERL cavity

    CERN Document Server

    Hahn, H; Jain, Puneet; Johnson, Elliott C; Xu, Wencan

    2014-01-01

    Exploratory measurements of the Brookhaven Energy Recovery Linac (ERL) cavity at superconducting temperature produced a long list of high order modes (HOMs). The niobium 5-cell cavity is terminated at each end with HOM ferrite dampers that successfully reduce the Q-factors to levels required to avoid beam break up (BBU) instabilities. However, a number of un-damped resonances with Q≥106 were found at 4 K and their mode identification forms the focus of this paper. The approach taken here consists of bead pulling on a copper (Cu) replica of the ERL cavity with dampers involving various network analyzer measurements. Several different S21 transmission measurements are used, including those taken from the fundamental input coupler to the pick-up probe across the cavity, others between beam-position monitor probes in the beam tubes, and also between probes placed into the cells. The bead pull technique suitable for HOM identification with a metallic needle or dielectric bead is detailed. This paper presents the...

  20. Tiger Team assessment of the Brookhaven National Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    1990-06-01

    This report documents the results of the Department of Energy's (DOE's) Tiger Team Assessment conducted at Brookhaven National Laboratory (BNL) in Upton, New York, between March 26 and April 27, 1990. The BNL is a multiprogram laboratory operated by the Associated Universities, Inc., (AUI) for DOE. The purpose of the assessment was to provide the status of environment, safety, and health (ES H) programs at the laboratory. The scope of the assessment included a review of management systems and operating procedures and records; observations of facility operations; and interviews at the facilities. Subteams in four areas performed the review: ES H, Occupational Safety and Health, and Management and Organization. The assessment was comprehensive, covering all areas of ES H activities and waste management operations. Compliance with applicable Federal, State, and local regulations; applicable DOE Orders; and internal BNL requirements was assessed. In addition, the assessment included an evaluation of the adequacy and effectiveness of the DOE and the site contractor, Associated Universities, Inc. (AUI), management, organization, and administration of the ES H programs at BNL. This volume contains appendices.

  1. Barrier bucket experiment at the AGS

    Directory of Open Access Journals (Sweden)

    M. Fujieda

    1999-12-01

    Full Text Available A barrier bucket experiment with two dedicated barrier cavities was performed at the Brookhaven AGS. One of the barrier cavities was a magnetic alloy (MA–loaded cavity and the other was a ferrite-loaded cavity. They generated a single sine wave with a peak voltage of 40 kV at a repetition rate of 351 kHz. A barrier rf system was established with these cavities and five bunches from the AGS booster were accumulated. A total of 3×10^{13} protons were stored without beam loss, and were successfully rebunched and accelerated. The longitudinal emittance growth was observed during accumulation by the barrier bucket, the blowup factor of which was about 3. The longitudinal mismatch between the rf bucket and the beam bunch was the main reason for the emittance growth. The potential distortions by beam loading of the ferrite cavity and the overshooting voltage of the MA cavity disturbed the smooth debunching.

  2. The Founding of the Brookhaven National Laboratory - Associated Universities, Inc.

    Energy Technology Data Exchange (ETDEWEB)

    BROOKHAVEN NATIONAL LABORATORY

    1948-01-15

    At the end of the war it became apparent that the teamwork of government and scientific institutions, which had been so effective in wartime work, must somehow be perpetuated in order to insure the continued progress of nuclear science in peace time. The enormous expense of the tools needed to pursue the next steps in this research -- nuclear reactors and high energy accelerators -- and the shortage of scientifically trained personnel pointed towards the establishment of a cooperative laboratory. Such a laboratory, using government funds, could carry out a comprehensive research program that would benefit the many interested research groups throughout the country. As a result of the wartime programs under the Manhattan District, centers of research in nuclear science were already active at the Radiation Laboratory in Berkeley, California, at Los Alamos in New Mexico, at the Clinton Laboratories in Oak Ridge, Tennessee and at the Argonne Laboratory in Chicago. No analogous nuclear research laboratories, however, had developed in the Northeast, and since so much of the nation's scientific talent and industrial activities are concentrated in the northeastern states, it was proposed that a new laboratory be established near New York City. As a result of this plan, the Brookhaven National Laboratory is now in operation at Upton, Long Island. The work of this Laboratory is performed under a contract between the Atomic Energy Commission (AEC) and a corporation, Associated Universities, Inc. (AUI) , formed by representatives of nine of the larger private universities in the northeast: Columbia, Cornell, Harvard, Johns Hopkins, the Massachusetts Institute of Technology, the University of Pennsylvania, Princeton, the University of Rochester, and Yale. The purpose of this laboratory is the advancement of knowledge in the fundamentals of nuclear science, the extension of its application to other fields, and the training of young scientists in these new subjects. This

  3. NATURAL RESOURCE MANAGEMENT PLAN FOR BROOKHAVEN NATIONAL LABORATORY.

    Energy Technology Data Exchange (ETDEWEB)

    GREEN,T.ET AL.

    2003-12-31

    Brookhaven National Laboratory (BNL) is located near the geographic center of Long Island, New York. The Laboratory is situated on 5,265 acres of land composed of Pine Barrens habitat with a central area developed for Laboratory work. In the mid-1990s BNL began developing a wildlife management program. This program was guided by the Wildlife Management Plan (WMP), which was reviewed and approved by various state and federal agencies in September 1999. The WMP primarily addressed concerns with the protection of New York State threatened, endangered, or species of concern, as well as deer populations, invasive species management, and the revegetation of the area surrounding the Relativistic Heavy Ion Collider (RHIC). The WMP provided a strong and sound basis for wildlife management and established a basis for forward motion and the development of this document, the Natural Resource Management Plan (NRMP), which will guide the natural resource management program for BNL. The body of this plan establishes the management goals and actions necessary for managing the natural resources at BNL. The appendices provide specific management requirements for threatened and endangered amphibians and fish (Appendices A and B respectively), lists of actions in tabular format (Appendix C), and regulatory drivers for the Natural Resource Program (Appendix D). The purpose of the Natural Resource Management Plan is to provide management guidance, promote stewardship of the natural resources found at BNL, and to integrate their protection with pursuit of the Laboratory's mission. The philosophy or guiding principles of the NRMP are stewardship, adaptive ecosystem management, compliance, integration with other plans and requirements, and incorporation of community involvement, where applicable.

  4. Brookhaven National Laboratory site environmental report for calendar year 1993

    Energy Technology Data Exchange (ETDEWEB)

    Naidu, J.R.; Royce, B.A. [eds.

    1994-05-01

    This report documents the results of the Environmental Monitoring Program at BNL and presents summary information about environmental compliance for 1993. To evaluate the effect of BNL operations on the local environment, measurements of direct radiation, and a variety of radionuclides and chemical compounds in ambient air, soil, sewage effluent, surface water, ground water and vegetation were made at the BNL site and at sites adjacent to the Laboratory. Brookhaven National Laboratory`s compliance with all applicable guides, standards, and limits for radiological and nonradiological emissions to the environment were evaluated. Among the permitted facilities, two instances, of pH exceedances were observed at recharge basins, possible related to rain-water run-off to these recharge basins. Also, the discharge from the Sewage Treatment Plant (STP) to the Peconic River exceeded on five occasions, three for residual chlorine and one each for iron and ammonia nitrogen. The chlorine exceedances were related to a malfunctioning hypochlorite dosing pump and ceased when the pump was repaired. While the iron and ammonia-nitrogen could be the result of disturbances to the sand filter beds during maintenance. The environmental monitoring data has identified site-specific contamination of ground water and soil. These areas are subject to Remedial Investigation/Feasibility Studies (RI/FS) under the Inter Agency Agreement (IAG). Except for the above, the environmental monitoring data has continued to demonstrate that compliance was achieved with applicable environmental laws and regulations governing emission and discharge of materials to the environment, and that the environmental impacts at BNL are minimal and pose no threat to the public or to the environment. This report meets the requirements of DOE Orders 5484. 1, Environmental Protection, Safety, and Health Protection Information reporting requirements and 5400.1, General Environmental Protection Programs.

  5. The Brookhaven National Laboratory electron beam ion source for RHIC.

    Science.gov (United States)

    Alessi, J G; Barton, D; Beebe, E; Bellavia, S; Gould, O; Kponou, A; Lambiase, R; Lockey, R; McNerney, A; Mapes, M; Marneris, Y; Okamura, M; Phillips, D; Pikin, A I; Raparia, D; Ritter, J; Snydstrup, L; Theisen, C; Wilinski, M

    2010-02-01

    As part of a new heavy ion preinjector that will supply beams for the Relativistic Heavy Ion Collider and the National Aeronautics and Space Administration Space Radiation Laboratory, construction of a new electron beam ion source (EBIS) is now being completed. This source, based on the successful prototype Brookhaven National Laboratory Test EBIS, is designed to produce milliampere level currents of all ion species, with q/m=(1/6)-(1/2). Among the major components of this source are a 5 T, 2-m-long, 204 mm diameter warm bore superconducting solenoid, an electron gun designed to operate at a nominal current of 10 A, and an electron collector designed to dissipate approximately 300 kW of peak power. Careful attention has been paid to the design of the vacuum system, since a pressure of 10(-10) Torr is required in the trap region. The source includes several differential pumping stages, the trap can be baked to 400 C, and there are non-evaporable getter strips in the trap region. Power supplies include a 15 A, 15 kV electron collector power supply, and fast switchable power supplies for most of the 16 electrodes used for varying the trap potential distribution for ion injection, confinement, and extraction. The EBIS source and all EBIS power supplies sit on an isolated platform, which is pulsed up to a maximum of 100 kV during ion extraction. The EBIS is now fully assembled, and operation will be beginning following final vacuum and power supply tests. Details of the EBIS components are presented.

  6. A woman like you: Women scientists and engineers at Brookhaven National Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Benkovitz, Carmen; Bernholc, Nicole; Cohen, Anita; Eng, Susan; Enriquez-Leder, Rosario; Franz, Barbara; Gorden, Patricia; Hanson, Louise; Lamble, Geraldine; Martin, Harriet; Mastrangelo, Iris; McLane, Victoria; Villela, Maria-Alicia; Vivirito, Katherine; Woodhead, Avril

    1991-01-01

    This publication by the women in Science and Engineering introduces career possibilities in science and engineering. It introduces what work and home life are like for women who have already entered these fields. Women at Brookhaven National Laboratory work in a variety of challenging research roles -- from biologist and environmental scientist to safety engineer, from patent lawyer to technician. Brookhaven National Laboratory is a multi-program laboratory which carries out basic and applied research in the physical, biomedical and environmental sciences and in selected energy technologies. The Laboratory is managed by Associated University, Inc., under contract with the US Department of Energy. Brookhaven and the other national laboratories, because of their enormous research resources, can play a critical role in a education and training of the workforce.

  7. A woman like you: Women scientists and engineers at Brookhaven National Laboratory. Careers in action

    Energy Technology Data Exchange (ETDEWEB)

    1991-12-31

    This publication by the women in Science and Engineering introduces career possibilities in science and engineering. It introduces what work and home life are like for women who have already entered these fields. Women at Brookhaven National Laboratory work in a variety of challenging research roles -- from biologist and environmental scientist to safety engineer, from patent lawyer to technician. Brookhaven National Laboratory is a multi-program laboratory which carries out basic and applied research in the physical, biomedical and environmental sciences and in selected energy technologies. The Laboratory is managed by Associated University, Inc., under contract with the US Department of Energy. Brookhaven and the other national laboratories, because of their enormous research resources, can play a critical role in a education and training of the workforce.

  8. Natural Resource Management Plan for Brookhaven National Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    green, T.

    2011-08-15

    This comprehensive Natural Resource Management Plan (NRMP) for Brookhaven National Laboratory (BNL) was built on the successful foundation of the Wildlife Management Plan for BNL, which it replaces. This update to the 2003 plan continues to build on successes and efforts to better understand the ecosystems and natural resources found on the BNL site. The plan establishes the basis for managing the varied natural resources located on the 5,265 acre BNL site, setting goals and actions to achieve those goals. The planning of this document is based on the knowledge and expertise gained over the past 10 years by the Natural Resources management staff at BNL in concert with local natural resource agencies including the New York State Department of Environmental Conservation, Long Island Pine Barrens Joint Planning and Policy Commission, The Nature Conservancy, and others. The development of this plan is an attempt at sound ecological management that not only benefits BNL's ecosystems but also benefits the greater Pine Barrens habitats in which BNL is situated. This plan applies equally to the Upton Ecological and Research Reserve (Upton Reserve). Any difference in management between the larger BNL area and the Upton Reserve are noted in the text. The purpose of the Natural Resource Management Plan (NRMP) is to provide management guidance, promote stewardship of the natural resources found at BNL, and to sustainably integrate their protection with pursuit of the Laboratory's mission. The philosophy or guiding principles of the NRMP are stewardship, sustainability, adaptive ecosystem management, compliance, integration with other plans and requirements, and the incorporation of community involvement, where applicable. The NRMP is periodically reviewed and updated, typically every five years. This review and update was delayed to develop documents associated with a new third party facility, the Long Island Solar Farm. This two hundred acre facility will result in

  9. Wildland Fire Management Plan for Brookhaven National Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Green,T.

    2009-10-23

    This Wildland Fire Management Plan (FMP) for Brookhaven National Lab (BNL) updates the 2003 plan incorporating changes necessary to comply with DOE Order 450.1 and DOE P 450.4, Federal Wildland Fire Management Policy and Program Review; Wildland and Prescribed Fire Management Policy and implementation Procedures Reference Guide. This current plan incorporates changes since the original draft of the FMP that result from new policies on the national level. This update also removes references and dependence on the U.S. Fish & Wildlife Service and Department of the Interior, fully transitioning Wildland Fire Management responsibilities to BNL. The Department of Energy policy for managing wildland fires requires that all areas, managed by the DOE and/or its various contractors, that can sustain fire must have a FMP that details fire management guidelines for operational procedures associated with wild fire, operational, and prescribed fires. Fire management plans provide guidance on fire preparedness, fire prevention, wildfire suppression, and the use of controlled, 'prescribed' fires and mechanical means to control the amount of available combustible material. Values reflected in the BNL Wildland FMP include protecting life and public safety; Lab properties, structures and improvements; cultural and historical sites; neighboring private and public properties; and endangered, threatened, and species of concern. Other values supported by the plan include the enhancement of fire-dependent ecosystems at BNL. This FMP will be reviewed periodically to ensure the fire program advances and evolves with the missions of the DOE and BNL. This Fire Management Plan is presented in a format that coverers all aspects specified by DOE guidance documents which are based on the national template for fire management plans adopted under the National Fire Plan. The DOE is one of the signatory agencies on the National Fire Plan. This FMP is to be used and implemented for the

  10. Aberration-Coreected Electron Microscopy at Brookhaven National Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Zhu,Y.; Wall, J.

    2008-04-01

    The last decade witnessed the rapid development and implementation of aberration correction in electron optics, realizing a more-than-70-year-old dream of aberration-free electron microscopy with a spatial resolution below one angstrom [1-9]. With sophisticated aberration correctors, modern electron microscopes now can reveal local structural information unavailable with neutrons and x-rays, such as the local arrangement of atoms, order/disorder, electronic inhomogeneity, bonding states, spin configuration, quantum confinement, and symmetry breaking [10-17]. Aberration correction through multipole-based correctors, as well as the associated improved stability in accelerating voltage, lens supplies, and goniometers in electron microscopes now enables medium-voltage (200-300kV) microscopes to achieve image resolution at or below 0.1nm. Aberration correction not only improves the instrument's spatial resolution but, equally importantly, allows larger objective lens pole-piece gaps to be employed thus realizing the potential of the instrument as a nanoscale property-measurement tool. That is, while retaining high spatial resolution, we can use various sample stages to observe the materials response under various temperature, electric- and magnetic- fields, and atmospheric environments. Such capabilities afford tremendous opportunities to tackle challenging science and technology issues in physics, chemistry, materials science, and biology. The research goal of the electron microscopy group at the Dept. of Condensed Matter Physics and Materials Science and the Center for Functional Nanomaterials, as well as the Institute for Advanced Electron Microscopy, Brookhaven National Laboratory (BNL), is to elucidate the microscopic origin of the physical- and chemical-behavior of materials, and the role of individual, or groups of atoms, especially in their native functional environments. We plan to accomplish this by developing and implementing various quantitative

  11. 75 FR 55631 - U. S. Rail Corporation-Construction and Operation Exemption-Brookhaven Rail Terminal

    Science.gov (United States)

    2010-09-13

    ... Surface Transportation Board U. S. Rail Corporation--Construction and Operation Exemption-- Brookhaven Rail Terminal AGENCY: Surface Transportation Board. ACTION: Notice of Board Action. SUMMARY: Subject to... approval requirements of 49 U.S.C. 10901 for U. S. Rail Corporation (U. S. Rail) to construct and operate a...

  12. Brookhaven Lab physicist William Willis wins the 2003 W.K.H. Panofsky prize

    CERN Multimedia

    2003-01-01

    William Willis, a senior physicist Brookhaven National Laboratory, has won the American Physical Society's 2003 W.K.H. Panofsky Prize in Experimental Particle Physics. He received the prize, which consists of $5,000 and a certificate citing his contributions to physics, at the APS meeting in Philadelphia on April 6 (1 page).

  13. Brookhaven highlights, fiscal year 1985, October 1, 1984-September 30, 1985

    Energy Technology Data Exchange (ETDEWEB)

    1985-01-01

    Activities at Brookhaven National Laboratory are briefly discussed. These include work at the National Synchrotron Light Source, the High Flux Beam Reactor, and the Alternating Gradient Synchrotron. Areas of research include heavy ion reactions, neutrino oscillations, low-level waste, nuclear data, medicine, biology, chemistry, parallel computing, optics. Also provided are general and administrative news, a financial report. (LEW)

  14. T.D. LEE: RELATIVISTIC HEAVY ION COLLISIONS AND THE RIKEN BROOKHAVEN CENTER.

    Energy Technology Data Exchange (ETDEWEB)

    MCLERRAN,L.; SAMIOS, N.

    2006-11-24

    This paper presents the history of Professor T. D. Lee's seminal work on the theory of relativistic heavy ion collisions, and the founding and development of the Riken Brookhaven Center. A number of anecdotes are given about Prof. Lee, and his strong positive effect on his colleagues, particularly young physicists.

  15. Modeling and analysis of AGS thermal shock experiments

    Energy Technology Data Exchange (ETDEWEB)

    Taleyarkhan, R.P.; Kim, S.H.; Haines, J.R.

    1998-11-01

    An overview is provided on modeling and analysis of thermal shock experiments conducted with high-energy, short-pulse energy deposition in a mercury filled container in the Alternating Gradient Synchrotron (AGS) facility at Brookhaven National Laboratory (BNL). The simulation framework utilized along with results of simulations for pressure and strain profiles are presented. While the magnitude of peak strain predictions versus data are in reasonable agreement, the temporal variations were found to differ significantly in selected cases, indicating lack of modeling of certain physical phenomena or due to uncertainties in the experimental data gathering techniques. Key thermal-shock related issues and uncertainties are highlighted.

  16. AGS RESONANT EXTRACTION WITH HIGH INTENSITY BEAMS.

    Energy Technology Data Exchange (ETDEWEB)

    AHRENS,L.; BROWN,K.; GLENN,J.W.; ROSER,T.; TSOUPAS,N.; VANASSELT,W.

    1999-03-29

    The Brookhaven AGS third integer resonant extraction system allows the AGS to provide high quality, high intensity 25.5 GeV/c proton beams simultaneously to four target stations and as many as 8 experiments. With the increasing intensities (over 7 x 10{sup 13} protons/pulse) and associated longer spill periods (2.4 to 3 seconds long), we continue to run with low losses and high quality low modulation continuous current beams.[1] Learning to extract and transport these higher intensity beams has required a process of careful modeling and experimentation. We have had to learn how to correct for various instabilities and how to better match extraction and the transport lines to the higher emittance beams being accelerated in the AGS. Techniques employed include ''RF'' methods to smooth out momentum distributions and fine structure. We will present results of detailed multi-particle tracking modeling studies which enabled us to develop a clear understanding of beam loss mechanisms in the transport and extraction process. We will report on our status, experiences, and the present understanding of the intensity limitations imposed by resonant extraction and transport to fixed target stations.

  17. Radiological environmental monitoring report for Brookhaven National Laboratory 1967--1970

    Energy Technology Data Exchange (ETDEWEB)

    Meinhold, C.B.; Hull, A.P.

    1998-10-01

    Brookhaven National Laboratory (BNL) was established in 1947 on the former Army Camp Upton site located in central Long Island, New York. From the very beginning, BNL has monitored the environment on and around the Laboratory site to assess the effects of its operations on the environment. This document summarizes the environmental data collected for the years 1967, 1968, 1969, and 1970. Thus, it fills a gap in the series of BNL annual environmental reports beginning in 1962. The data in this document reflect measurements for those four years of concentrations and/or amounts of airborne radioactivity, radioactivity in streams and ground water, and external radiation levels in the vicinity of BNL. Also included are estimates, made at that time, of BNL`s contribution to radioactivity in the environment. Among the major scientific facilities operated at BNL are the High Flux Beam Reactor, Medical Research Reactor, Brookhaven Graphite Research Reactor, Alternating Gradient Synchrotron, and the 60-inch Cyclotron.

  18. First magnet constructed for the LHC by Brookhaven National Laboratory, USA

    CERN Document Server

    Maximilien Brice

    2003-01-01

    CERN has taken delivery of the first US-built contribution to the LHC. The 25-tonne interaction-region dipole magnet, which will guide the LHC´s two counter-rotating beams of protons into collision, was built at the US Brookhaven National Laboratory. It is the first of 20 that the laboratory will ultimately provide and took nine months for more than 100 scientists, engineers and technicians to construct. Brookhaven´s Superconducting Magnet Division is now building the remaining 19 magnets, which will be shipped to CERN later this year. They are provided for the LHC under the terms of a 1998 agreement between CERN and the US Department of Energy and National Science Foundation.

  19. Qualitative risk evaluation of environmental restoration programs at Brookhaven National Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Morris, S.C.

    1996-05-01

    This report documents the evaluation of risks associated with environmental restoration activities at Brookhaven National Laboratory using two tools supplied by DOE to provide a consistent set of risk estimates across the DOE complex: Risk Data Sheets (RDS) and Relative Risk Ranking. The tools are described, the process taken characterized, results provided and discussed. The two approaches are compared and recommendations provided for continuing improvement of the process.

  20. Brookhaven experience with handling and shipping of, and cask design for, reactor spent-fuel elements

    Energy Technology Data Exchange (ETDEWEB)

    Dugan, Francis A.

    1965-12-01

    The general problems in the area are presented. Solutions to the specific problems at Brookhaven are discussed in relation to the general problem. Presentation covers (a) fuel removal tools and equipment, and canal storage facilities; (b) methods of shipment; (c) brief review of the AEC and ICC regulatory requirements; and (d) optimized design of the shipping container. Specific solutions used by BNL over a six -year period are described. The need for complete and early analysis of the specific problem is indicated.

  1. The first picosecond terawatt CO{sub 2} laser at the Brookhaven Accelerator Test Facility

    Energy Technology Data Exchange (ETDEWEB)

    Pogorelsky, I.V.; Ben-Zvi, I.; Babzien, M. [and others

    1998-02-01

    The first terawatt picosecond CO{sub 2} laser will be brought to operation at the Brookhaven Accelerator Test Facility in 1998. System consists of a single-mode TEA oscillator, picosecond semiconductor optical switch, multi-atmosphere. The authors report on design, simulation, and performance tests of the 10 atm final amplifier that allows for direct multi-joule energy extraction in a picosecond laser pulse.

  2. Brookhaven highlights. Report on research, October 1, 1992--September 30, 1993

    Energy Technology Data Exchange (ETDEWEB)

    Rowe, M.S.; Belford, M.; Cohen, A.; Greenberg, D.; Seubert, L. [eds.

    1993-12-31

    This report highlights the research activities of Brookhaven National Laboratory during the period dating from October 1, 1992 through September 30, 1993. There are contributions to the report from different programs and departments within the laboratory. These include technology transfer, RHIC, Alternating Gradient Synchrotron, physics, biology, national synchrotron light source, applied science, medical science, advanced technology, chemistry, reactor physics, safety and environmental protection, instrumentation, and computing and communications.

  3. 2003 Brookhaven National Laboratory Annual Illness and Injury Surveillance Report, Revised September 2007

    Energy Technology Data Exchange (ETDEWEB)

    U.S. Department of Energy, Office of Health, Safety and Security, Office of Illness and Injury Prevention Programs

    2007-10-02

    Annual Illness and Injury Surveillance Program report for 2003 for Brookhaven National Lab. The U.S. Department of Energy’s (DOE) commitment to assuring the health and safety of its workers includes the conduct of epidemiologic surveillance activities that provide an early warning system for health problems among workers. The IISP monitors illnesses and health conditions that result in an absence of workdays, occupational injuries and illnesses, and disabilities and deaths among current workers.

  4. Design study of a normal conducting helical snake for AGS

    CERN Document Server

    Takano, Junpei; Okamura, Masahiro; Roser, Thomas; MacKay, William W; Luccio, Alfredo U; Takano, Koji

    2004-01-01

    A new normal conducting snake magnet is being fabricated for the Alternate Gradient Synchrotron (AGS) at Brookhaven National Laboratory (BNL). In the Relativistic Heavy Ion Collider (RHIC) project, a superconducting type helical dipole magnets had been developed and it performed successfully in high-energy polarized proton acceleration. The new AGS helical snake has the same basic magnetic structure but is more complicated. To achieve no beam shift and no beam deflection in one magnetic device, helical pitches and rotating angles were carefully calculated. Compared to a superconducting magnet, a normal warm magnet must have a large cross- sectional area of conductors which make it difficult to design a magnet with large helical pitch. We developed a modified window frame structure to accommodate the large number of conductors. Its three dimensional magnetic field was simulated by using OPERA3D/TOSCA. 3 Refs.

  5. Risk-based priority scoring for Brookhaven National Laboratory environmental restoration programs

    Energy Technology Data Exchange (ETDEWEB)

    Morris, S.C.; Meinhold, A.F.

    1995-05-01

    This report describes the process of estimating the risk associated with environmental restoration programs under the Brookhaven National Laboratory Office of Environmental Restoration. The process was part of an effort across all Department of Energy facilities to provide a consistent framework to communicate risk information about the facilities to senior managers in the DOE Office of Environmental Management to foster understanding of risk activities across programs. the risk evaluation was a qualitative exercise. Categories considered included: Public health and safety; site personnel safety and health; compliance; mission impact; cost-effective risk management; environmental protection; inherent worker risk; environmental effects of clean-up; and social, cultural, political, and economic impacts.

  6. Assessment of Energy Efficiency Project Financing Alternatives for Brookhaven National Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Hunt, W. D.; Hail, John C.; Sullivan, Gregory P.

    2000-02-14

    This document provides findings and recommendations that resulted from an assessment of the Brookhaven National Laboratory by a team from Pacific Northwest National Laboratory to assess the site's potential for various alternative financing options as a means to implement energy-efficiency improvements. The assessment looked for life-cycle cost-effective energy-efficiency improvement opportunities, and through a series of staff interviews, evaluated the various methods by which these opportunities may be financed, while considering availability of funds, staff, and available financing options. This report summarizes the findings of the visit and the resulting recommendations.

  7. X-ray holographic microscopy experiments at the Brookhaven synchrotron light source

    Energy Technology Data Exchange (ETDEWEB)

    Howells, M.R.; Iarocci, M.; Kenney, J.; Kirz, J.; Rarback, H.

    1983-01-01

    Soft x-ray holographic microscopy is discussed from an experimental point of view. Three series of measurements have been carried out using the Brookhaven 750 MeV storage ring as an x-ray source. Young slits fringes, Gabor (in line) holograms and various data pertaining to the soft x-ray performance of photographic plates are reported. The measurements are discussed in terms of the technique for recording them and the experimental limitations in effect. Some discussion is also given of the issues involved in reconstruction using visible light.

  8. Determination of floor response spectra for the Brookhaven HFBR reactor building structure

    Energy Technology Data Exchange (ETDEWEB)

    Subudhi, M.; Goradia, H.

    1978-11-01

    In order to perform the dynamic analysis of various structural components of the HFBR reactor building at Brookhaven National Laboratory (BNL) subjected to seismic disturbances, it is necessary to obtain the floor response spectra of the primary structure. The mathematical model includes the four floor levels of the internal structure, the dome, and soil spring effects. The standard time history analysis is adopted to obtain the response spectrum for each floor of the internal structure. This report summarizes the results both in tabular and graphical form for various damping values.

  9. Applications of nuclear techniques for in vivo body composition studies at Brookhaven National Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Cohn, S.H.; Ellis, K.J.; Vartsky, D.; Vaswani, A.N.; Wielopolski, L.

    1981-01-01

    A series of technical developments and their clinical applications in various nuclear technologies at Brookhaven National Laboratory is described. These include the development of a portable neutron activation facility for measuring cadmium in vivo in kidney and liver, a technique for the measurement of body iron utilizing nuclear resonant scattering of gamma rays, a non-invasive measure of the skeletal levels of lead by an x-ray fluorescence technique, and the development of a pulsed Van de Graaff generator as a source of pulsed neutrons for the measurement of lung silicon. (ACR)

  10. Summary of proposed approach for deriving cleanup guidelines for radionuclides in soil at Brookhaven National Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Meinhold, A.F.; Morris, S.C.; Dionne, B.; Moskowitz, P.D.

    1996-11-01

    Past activities at Brookhaven National Laboratory (BNL) resulted in soil and groundwater contamination. As a result, BNL was designated a Superfund site under the Comprehensive Environmental Response Compensation and Liability Act (CERCLA). BNL`s Office of Environmental Restoration (OER) is overseeing environmental restoration activities at the Laboratory, carried out under an Interagency Agreement (IAG) with the United States Department of Energy (DOE), the United States Environmental Protection Agency (EPA) and the New York State Department of Environmental Conservation (NYSDEC). The objective of this paper is to propose a standard approach to deriving risk-based cleanup guidelines for radionuclides in soil at BNL.

  11. Proceedings of Brookhaven National Laboratory's fusion/synfuel workshop

    Energy Technology Data Exchange (ETDEWEB)

    Fillo, J.A.; Powell, J.R. (eds.)

    1979-01-01

    The fusion synfuels workshop held at Brookhaven National Laboratory (BNL) on August 27-29, 1979 examined the current status of candidate synfuel processes and the R and D required to develop the capability for fusion synfuel production. Participants divided into five working groups, covering the following areas: (1) economics and applications; (2) high-temperature electrolysis; (3) thermochemical processes (including hybrid thermo-electrochemical); (4) blanket and materials; and (5) high-efficiency power cycles. Each working group presented a summary of their conclusions and recommendations to all participants during the third day of the Workshop. These summaries are given.

  12. Doing More with Less: Cost-effective, Compact Particle Accelerators (489th Brookhaven Lecture)

    Energy Technology Data Exchange (ETDEWEB)

    Trbojevic, Dejan [BNL Collider-Accelerator Department

    2013-10-22

    Replace a 135-ton magnet used for cancer-fighting particle therapies with a magnet that weighs only two tons? Such a swap is becoming possible thanks to new particle accelerator advances being developed by researchers at Brookhaven Lab. With an approach that combines techniques used by synchrotron accelerators with the ability to accept more energy, these new technologies could be used for more than fighting cancer. They could also decrease the lifecycle of byproducts from nuclear power plants and reduce costs for eRHIC—a proposed electron-ion collider for Brookhaven Lab that researchers from around the world would use to explore the glue that holds together the universe’s most basic building blocks and explore the proton-spin puzzle. During this lecture, Dr. Trbojevic provides an overview of accelerator technologies and techniques—particularly a non-scaling, fixed-focused alternating gradient—to focus particle beams using fewer, smaller magnets. He discusses how these technologies will benefit eRHIC and other applications, including particle therapies being developed to combat cancer.

  13. Magic Lenses for RHIC: Compensating Beam-beam Interaction (488th Brookhaven Lecture)

    Energy Technology Data Exchange (ETDEWEB)

    Luo, Yun [BNL Collider-Accelerator Department

    2013-07-17

    Scientists at Brookhaven Lab’s Relativistic Heavy Ion Collider (RHIC) smash atomic particles together to understand more about why the physical world works the way it does. Increasing rates of particle collisions, or luminosity, at RHIC is no small challenge, but the results—more data for better clues—are crucial for scientists trying answer big questions about the origins of matter and mass. When scientists at RHIC collide protons, they don’t hope for a head-on crash by focusing only two particles roaring toward each other from opposite directions. For all intents and purposes, that would be impossible. The scientists can smash protons because they significantly increase the likelihood of collisions by steering hundreds of billions clumped into bunches, which at RHIC are about 3.5 meters long and less than 1 millimeter tall. The particles of these bunches are all positively charged, so when they interact, they repel outwardly—think how magnets repel when their same poles are pushed together. Although this decreases the density of each bunch, reducing luminosity, scientists in Brookhaven Lab’s Collider-Accelerator Department (C-AD) have a solution. After more than seven years of development, the scientists have designed an electron-lens system that uses electrons’ negative charges to attract positively charged proton bunches and minimize their repelling tendencies. Combined with other upgrades to the RHIC accelerator complex, these lenses are important components in efforts towards the major task of doubling the luminosity for proton-proton collisions.

  14. Manipulating Light to Understand and Improve Solar Cells (494th Brookhaven Lecture)

    Energy Technology Data Exchange (ETDEWEB)

    Eisaman, Matthew [BNL, Sustainable Energy Technologies Department

    2014-04-16

    Energy consumption around the world is projected to approximately triple by the end of the century, according to the 2005 Report from the U.S. Department of Energy's Basic Energy Sciences Workshop on Solar Energy Utilization. Much will change in those next 86 years, but for all the power the world needs—for everything from manufacturing and transportation to air conditioning and charging cell phone batteries—improved solar cells will be crucial to meet this future energy demand with renewable energy sources. At Brookhaven Lab, scientists are probing solar cells and exploring variations within the cells—variations that are so small they are measured in billionths of a meter—in order to make increasingly efficient solar cells and ultimately help reduce the overall costs of deploying solar power plants. Dr. Eisaman will discuss DOE's Sunshot Initiative, which aims to reduce the cost of solar cell-generated electricity by 2020. He will also discuss how he and collaborators at Brookhaven Lab are probing different material compositions within solar cells, measuring how efficiently they collect electrical charge, helping to develop a new class of solar cells, and improving solar-cell manufacturing processes.

  15. Is Overeating Behavior Similar to Drug Addiction? (427th Brookhaven Lecture)

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Gene-Jack

    2007-09-27

    The increasing number of obese individuals in the U.S. and other countries world-wide adds urgency to the need to understand the mechanisms underlying pathological overeating. Research by the speaker and others at Brookhaven National Laboratory and elsewhere is compiling evidence that the brain circuits disrupted in obesity are similar to those involved in drug addiction. Using positron emission tomography (PET), the speaker and his colleagues have implicated brain dopamine in the normal and the pathological intake of food by humans. During the 427th Brookhaven Lecture, speaker will review the findings and implications of PET studies of obese subjects and then compare them to PET research involving drug-addicted individuals. For example, in pathologically obese subjects, it was found that reductions in striatal dopamine D2 receptors are similar to those observed in drug-addicted subjects. The speaker and his colleagues have postulated that decreased levels of dopamine receptors predisposed subjects to search for strongly rewarding reinforcers, be it drugs for the drug-addicted or food for the obese, as a means to compensate for decreased sensitivity of their dopamine-regulated reward circuits. As the speaker will summarize, multiple but similar brain circuits involved in reward, motivation, learning and inhibitory control are disrupted both in drug addiction and obesity, resulting in the need for a multimodal approach to the treatment of obesity.

  16. Optimization of AGS Polarized Proton Operation with the Warm Helical Snake

    CERN Document Server

    Takano, Junpei; Bai, Mei; Brown, Kevin A; Gardner, Chris J; Glenn, Joseph; Hattori, Toshiyuki; Huang, Haixin; Luccio, Alfredo U; MacKay, William W; Okamura, Masahiro; Roser, Thomas; Tepikian, Steven; Tsoupas, Nicholaos

    2005-01-01

    A normal conducting helical dipole partial Siberian snake (Warm Snake) has been installed in the Alternating Gradient Synchrotron (AGS) at Brookhaven National Laboratory (BNL) for overcoming all of imperfection depolarizing resonances and reducing the transverse coupling resonances caused by the solenoidal Siberian snake which had been operated in AGS before the last polarized run. The polarized proton beam has been accelerated successfully with the warm snake and the polarization at extraction of the AGS was increased to 50% as opposed to 40% with the solenoidal snake. The magnetic field and beam trajectory in the warm snake was calculated by using the OPERA-3D/TOSCA software. We present optimization of the warm snake with beam during RUN5.

  17. Brookhaven Lab physicists Edward Beebe and Alexander Pikin win 'Brightness Award' for achievement in ion source physics and technology

    CERN Multimedia

    2003-01-01

    "Edward Beebe and Alexander Pikin, physicists at the U.S. Department of Energy's Brookhaven National Laboratory, have been awarded the Ion Source Prize, known as the "Brightness Award," which recognizes and encourages innovative and significant recent achievements in the fields of ion source physics and technology" (1 page).

  18. Structural biology facilities at Brookhaven National Laboratory`s high flux beam reactor

    Energy Technology Data Exchange (ETDEWEB)

    Korszun, Z.R.; Saxena, A.M.; Schneider, D.K. [Brookhaven National Laboratory, Upton, NY (United States)

    1994-12-31

    The techniques for determining the structure of biological molecules and larger biological assemblies depend on the extent of order in the particular system. At the High Flux Beam Reactor at the Brookhaven National Laboratory, the Biology Department operates three beam lines dedicated to biological structure studies. These beam lines span the resolution range from approximately 700{Angstrom} to approximately 1.5{Angstrom} and are designed to perform structural studies on a wide range of biological systems. Beam line H3A is dedicated to single crystal diffraction studies of macromolecules, while beam line H3B is designed to study diffraction from partially ordered systems such as biological membranes. Beam line H9B is located on the cold source and is designed for small angle scattering experiments on oligomeric biological systems.

  19. Superconducting Helical Snake Magnet for the AGS

    CERN Document Server

    Willen, Erich; Escallier, John; Ganetis, George; Ghosh, Arup; Gupta, Ramesh C; Harrison, Michael; Jain, Animesh K; Luccio, Alfredo U; MacKay, William W; Marone, Andrew; Muratore, Joseph F; Okamura, Masahiro; Plate, Stephen R; Roser, Thomas; Tsoupas, Nicholaos; Wanderer, Peter

    2005-01-01

    A superconducting helical magnet has been built for polarized proton acceleration in the Brookhaven AGS. This "partial Snake" magnet will help to reduce the loss of polarization of the beam due to machine resonances. It is a 3 T magnet some 1940 mm in magnetic length in which the dipole field rotates with a pitch of 0.2053 degrees/mm for 1154 mm in the center and a pitch of 0.3920 degrees/mm for 393 mm in each end. The coil cross-section is made of two slotted cylinders containing superconductor. In order to minimize residual offsets and deflections of the beam on its orbit through the Snake, a careful balancing of the coil parameters was necessary. In addition to the main helical coils, a solenoid winding was built on the cold bore tube inside the main coils to compensate for the axial component of the field that is experienced by the beam when it is off-axis in this helical magnet. Also, two dipole corrector magnets were placed on the same tube with the solenoid. A low heat leak cryostat was built so that t...

  20. FFAG ACCELERATOR AS A NEW INJECTOR FOR THE BNL-AGS.

    Energy Technology Data Exchange (ETDEWEB)

    RUGGIERO, A.G.

    2004-10-13

    It has been proposed recently to upgrade the Alternating-Gradient Synchrotron (AGS) of Brookhaven National Laboratory (BNL) to an average proton beam power of one MWatt at the top energy of 28 GeV. This is to be accomplished primarily by raising the AGS repetition rate from the present {approx} 1/3 to 2.5 pulses per second, and by a relatively modest increase of beam intensity from the present 0.7 to about 1.0 x 10{sup 14} protons per cycle. The present injector, the 1.5 GeV Booster, has a circumference a quarter of that of the AGS, and four successive beam pulses are required for a complete fill of the AGS. The filling time at injection is thus at least 0.5 seconds, and it ought to be eliminated if one desires to shorten the AGS cycle period. Moreover, holding the beam for such a long period of time during injection causes its quality to deteriorate and beam losses. This report is the summary of the results of a feasibility study of a 1.5 GeV Fixed-Field Alternating-Gradient (FFAG) Accelerator as a new possible injection to the AGS.

  1. Interactive radiopharmaceutical facility between Yale Medical Center and Brookhaven National Laboratory. Progress report, October 1976-June 1979

    Energy Technology Data Exchange (ETDEWEB)

    Gottschalk, A.

    1979-01-01

    DOE Contract No. EY-76-S-02-4078 was started in October 1976 to set up an investigative radiochemical facility at the Yale Medical Center which would bridge the gap between current investigation with radionuclides at the Yale School of Medicine and the facilities in the Chemistry Department at the Brookhaven National Laboratory. To facilitate these goals, Dr. Mathew L. Thakur was recruited who joined the Yale University faculty in March of 1977. This report briefly summarizes our research accomplishments through the end of June 1979. These can be broadly classified into three categories: (1) research using indium-111 labelled cellular blood components; (2) development of new radiopharmaceuticals; and (3) interaction with Dr. Alfred Wolf and colleagues in the Chemistry Department of Brookhaven National Laboratory.

  2. Department of Energy’s ARM Climate Research Facility External Data Center Operations Plan Located At Brookhaven National Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Cialella, A. [Brookhaven National Lab. (BNL), Upton, NY (United States); Gregory, L. [Brookhaven National Lab. (BNL), Upton, NY (United States); Lazar, K. [Brookhaven National Lab. (BNL), Upton, NY (United States); Liang, M. [Brookhaven National Lab. (BNL), Upton, NY (United States); Ma, L. [Brookhaven National Lab. (BNL), Upton, NY (United States); Tilp, A. [Brookhaven National Lab. (BNL), Upton, NY (United States); Wagener, R. [Brookhaven National Lab. (BNL), Upton, NY (United States)

    2015-05-01

    The External Data Center (XDC) Operations Plan describes the activities performed to manage the XDC, located at Brookhaven National Laboratory (BNL), for the Department of Energy’s Atmospheric Radiation Measurement (ARM) Climate Research Facility. It includes all ARM infrastructure activities performed by the Data Management and Software Engineering Group (DMSE) at BNL. This plan establishes a baseline of expectation within the ARM Operations Management for the group managing the XDC.

  3. The Shape and Flow of Heavy Ion Collisions (490th Brookhaven Lecture)

    Energy Technology Data Exchange (ETDEWEB)

    Schenke, Bjoern [BNL Physics Department

    2014-12-18

    The sun can’t do it, but colossal machines like the Relativistic Heavy Ion Collider (RHIC) at Brookhaven Lab and Large Hadron Collider (LHC) in Europe sure can. Quarks and gluons make up protons and neutrons found in the nucleus of every atom in the universe. At heavy ion colliders like RHIC and the LHC, scientists can create matter more than 100,000 times hotter than the center of the sun—so hot that protons and neutrons melt into a plasma of quarks and gluons. The particle collisions and emerging quark-gluon plasma hold keys to understanding how these fundamental particles interact with each other, which helps explain how everything is held together—from atomic nuclei to human beings to the biggest stars—how all matter has mass, and what the universe looked like microseconds after the Big Bang. Dr. Schenke discusses theory that details the shape and structure of heavy ion collisions. He will also explain how this theory and data from experiments at RHIC and the LHC are being used to determine properties of the quark-gluon plasma.

  4. What Goes Up Must Come Down: The Lifecycle of Convective Clouds (492nd Brookhaven Lecture)

    Energy Technology Data Exchange (ETDEWEB)

    Jensen, Michael [BNL Environmental Sciences

    2014-02-19

    Some clouds look like cotton balls and others like anvils. Some bring rain, some snow and sleet, and others, just shade. But, whether big and billowy or dark and stormy, clouds affect far more than the weather each day. Armed with measurements of clouds’ updrafts and downdrafts—which resemble airflow in a convection oven—and many other atmospheric interactions, scientists from Brookhaven Lab and other institutions around the world are developing models that are crucial for understanding Earth’s climate and forecasting future climate change. During his lecture, Dr. Jensen provides an overview of the importance of clouds in the Earth’s climate system before explaining how convective clouds form, grow, and dissipate. His discussion includes findings from the Midlatitude Continental Convective Clouds Experiment (MC3E), a major collaborative experiment between U.S. Department of Energy (DOE) and NASA scientists to document precipitation, clouds, winds, and moisture in 3-D for a holistic view of convective clouds and their environment.

  5. A Really Good Hammer: Quantification of Mass Transfer Using Perfluorocarbon Tracers (475th Brookhaven Lecture)

    Energy Technology Data Exchange (ETDEWEB)

    Watson, Tom [BNL Environmental Sciences, Tracer Technology Group

    2012-02-15

    Brookhaven Lab’s perfluorocarbon tracer (PFT) technology can be viewed as a hammer looking for nails. But, according to Tom Watson, leader of the Lab’s Tracer Technology Group in the Environmental Research and Technology Division (ERTD), “It’s a really good hammer!” The colorless, odorless and safe gases have a number of research uses, from modeling how airborne contaminants might move through urban canyons to help first responders plan their response to potential terrorist attacks and accidents to locating leaks in underground gas pipes. Their extremely low background level — detectable at one part per quadrillion — allows their transport to be easily tracked. Lab researchers used PFTs during the 2005 Urban Dispersion Program field studies in New York City, gathering data to help improve models of how a gas or chemical release might move around Manhattan’s tall buildings and canyons. Closer to home, scientists also used PFTs to make ventilation measurements in Bldg. 400 on the Lab site to provide data to test air flow models used in determining the effects of passive and active air exchange on the levels of indoor and outdoor air pollution, and to determine the effects of an accidental or intentional release of hazardous substances in or around buildings.

  6. Reliable operation of the Brookhaven EBIS for highly charged ion production for RHIC and NSRL

    Energy Technology Data Exchange (ETDEWEB)

    Beebe, E., E-mail: beebe@bnl.gov; Alessi, J., E-mail: beebe@bnl.gov; Binello, S., E-mail: beebe@bnl.gov; Kanesue, T., E-mail: beebe@bnl.gov; McCafferty, D., E-mail: beebe@bnl.gov; Morris, J., E-mail: beebe@bnl.gov; Okamura, M., E-mail: beebe@bnl.gov; Pikin, A., E-mail: beebe@bnl.gov; Ritter, J., E-mail: beebe@bnl.gov; Schoepfer, R., E-mail: beebe@bnl.gov [Brookhaven National Laboratory, Upton, NY 11973 (United States)

    2015-01-09

    An Electron Beam Ion Source for the Relativistic Heavy Ion Collider (RHIC EBIS) was commissioned at Brookhaven in September 2010 and since then it routinely supplies ions for RHIC and NASA Space Radiation Laboratory (NSRL) as the main source of highly charged ions from Helium to Uranium. Using three external primary ion sources for 1+ injection into the EBIS and an electrostatic injection beam line, ion species at the EBIS exit can be switched in 0.2 s. A total of 16 different ion species have been produced to date. The length and the capacity of the ion trap have been increased by 20% by extending the trap by two more drift tubes, compared with the original design. The fraction of Au{sup 32+} in the EBIS Au spectrum is approximately 12% for 70-80% electron beam neutralization and 8 pulses operation in a 5 Hertz train and 4-5 s super cycle. For single pulse per super cycle operation and 25% electron beam neutralization, the EBIS achieves the theoretical Au{sup 32+} fractional output of 18%. Long term stability has been very good with availability of the beam from RHIC EBIS during 2012 and 2014 RHIC runs approximately 99.8%.

  7. In-situ containment of buried waste at Brookhaven National Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Dwyer, B.P. [Sandia National Labs., Albuquerque, NM (United States); Heiser, J. [Brookhaven National Lab., Upton, NY (United States); Stewart, W.; Phillips, S. [Applied Geotechnical Engineering and Construction, Inc., Richland, WA (United States)

    1997-12-31

    The primary objective of this project was to further develop close-coupled barrier technology for the containment of subsurface waste or contaminant migration. A close-coupled barrier is produced by first installing a conventional cement grout curtain followed by a thin inner lining of a polymer grout. The resultant barrier is a cement polymer composite that has economic benefits derived from the cement and performance benefits from the durable and chemically resistant polymer layer. The technology has matured from a regulatory investigation of issues concerning barriers and barrier materials to a pilot-scale, multiple individual column injections at Sandia National Labs (SNL) to full scale demonstration. The feasibility of this barrier concept was successfully proven in a full scale {open_quotes}cold test{close_quotes} demonstration at Hanford, WA. Consequently, a full scale deployment of the technology was conducted at an actual environmental restoration site at Brookhaven National Lab (BNL), Long Island, NY. This paper discusses the installation and performance of a technology deployment implemented at OU-1 an Environmental Restoration Site located at BNL.

  8. BESTIA (Brookhaven Experimental Supra-Terawatt Infrared at ATF) laser: A status report

    Science.gov (United States)

    Polyanskiy, Mikhail N.; Babzien, Marcus; Pogorelsky, Igor V.

    2017-03-01

    Development of a next-generation CO2 laser aiming at 100 TW peak power at a wavelength of 10 µm ts underway at the Brookhaven Accelerator Test Facility (ATF). A new laser facility is being deployed as part of the ATF-II upgrade. New high-pressure power amplifiers are being fabricated and assembled, while R&D continues with ATF's present 2 TW CO2 laser system. Our plan for increasing the peak laser power envisions several discrete steps in the upgrade. First will be demonstration of a 10 TW capability utilizing chirped pulse amplification, with an extended power amplifier chain filled with high-pressure isotopic gas. Further development aimed at a demonstration of 25 TW operation will require the addition of a nonlinear compressor system to shrink the pulse width below the nominal gain-bandwidth limit. These upgrades will then enable a longer-term R&D effort to achieve the 100 TW goal. Over the last two years, significant R&D effort has been focused on the development of chirped-pulse amplification, the study of the behavior of optical materials under the action of high-peak-power mid-IR pulses, and the optimization of the beam quality, which is required for nonlinear pulse compression. The results of this R&D have been implemented into the ongoing operation of the ATF's CO2 laser and have already benefited our users in their experimental programs.

  9. Higher-order-mode absorbers for energy recovery linac cryomodules at Brookhaven National Laboratory

    Directory of Open Access Journals (Sweden)

    H. Hahn

    2010-12-01

    Full Text Available Several future accelerator projects at Brookhaven for the Relativistic Heavy Ion Collider (RHIC are based on energy recovery linacs (ERLs with high-charge high-current electron beams. Their stable operation mandates effective higher-order-mode (HOM damping. The development of HOM dampers for these projects is pursued actively at this laboratory. Strong HOM damping was experimentally demonstrated both at room and at superconducting (SC temperatures in a prototype research and development (R&D five-cell niobium superconducting rf (SRF cavity with ferrite dampers. Two room-temperature mock-up five-cell copper cavities were used to study various damper configurations with emphasis on capacitive antenna dampers. An innovative type of ferrite damper over a ceramic break for an R&D SRF electron gun also was developed. For future SRF linacs longer cryomodules comprised of multiple superconducting cavities with reasonably short intercavity transitions are planned. In such a configuration, the dampers, located closer to the cavities, will be at cryogenic temperatures; this will impose additional constraints and complications. This paper presents the results of simulations and measurements of several damper configurations.

  10. Modeling and Analysis of AGS (1998) Thermal Shock Experiments

    Energy Technology Data Exchange (ETDEWEB)

    Haines, J.R.; Kim, S.H.; Taleyarkhan, R.P.

    1999-11-14

    An overview is provided on modeling and analysis of thermal shock experiments conducted during 1998 with high-energy, short-pulse energy deposition in a mercury filled container in the Alternating Gradient Synchrotron (AGS) facility at Brookhaven National Laboratory (BNL). The simulation framework utilized along with the results of simulations for pressure and strain profiles are presented. While the magnitude of penk strain predictions versus data are in reasonable agreement, the temporal variations were found to differ significantly in selected cases, indicating lack of modeling of certain physical phenomena or due to uncertainties in the experimental data gathering techniques. Key thermal-shock related issues and uncertainties are highlighted. Specific experiments conducted at BNL's AGS facility during 1998 (the subject of this paper) involved high-energy (24 GeV) proton energy deposition in the mercury target over a time frame of - 0.1s. The target consisted of an - 1 m. long cylindrical stainless steel shell with a hemispherical dome at the leading edge. It was filled with mercury at room temperature and pressure. Several optical strain gages were attached to the surface of the steel target. Figure 1 shows a schematic representation of the test vessel along with the main dimensions and positions of three optical strain gages at which meaningful data were obtained. As

  11. 915-MHz Wind Profiler for Cloud Forecasting at Brookhaven National Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Jensen, M. [Brookhaven National Lab. (BNL), Upton, NY (United States); Bartholomew, M. J. [Brookhaven National Lab. (BNL), Upton, NY (United States); Giangrande, S. [Brookhaven National Lab. (BNL), Upton, NY (United States)

    2016-03-01

    When considering the amount of shortwave radiation incident on a photovoltaic solar array and, therefore, the amount and stability of the energy output from the system, clouds represent the greatest source of short-term (i.e., scale of minutes to hours) variability through scattering and reflection of incoming solar radiation. Providing estimates of this short-term variability is important for determining and regulating the output from large solar arrays as they connect with the larger power infrastructure. In support of the installation of a 37-MW solar array on the grounds of Brookhaven National Laboratory (BNL), a study of the impacts of clouds on the output of the solar array has been undertaken. The study emphasis is on predicting the change in surface solar radiation resulting from the observed/forecast cloud field on a 5-minute time scale. At these time scales, advection of cloud elements over the solar array is of particular importance. As part of the BNL Aerosol Life Cycle Intensive Operational Period (IOP), a 915-MHz Radar Wind Profiler (RWP) was deployed to determine the profile of low-level horizontal winds and the depth of the planetary boundary layer. The initial deployment mission of the 915-MHz RWP for cloud forecasting has been expanded the deployment to provide horizontal wind measurements for estimating and constraining cloud advection speeds. A secondary focus is on the observation of dynamics and microphysics of precipitation during cold season/winter storms on Long Island. In total, the profiler was deployed at BNL for 1 year from May 2011 through May 2012.

  12. 915-Mhz Wind Profiler for Cloud Forecasting at Brookhaven National Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Jensen, M. [Brookhaven National Laboratory (BNL), Upton, NY (United States); Bartholomew, M. J. [Brookhaven National Laboratory (BNL), Upton, NY (United States); Giangrande, S. [Brookhaven National Laboratory (BNL), Upton, NY (United States)

    2016-03-01

    When considering the amount of shortwave radiation incident on a photovoltaic solar array and, therefore, the amount and stability of the energy output from the system, clouds represent the greatest source of short-term (i.e., scale of minutes to hours) variability through scattering and reflection of incoming solar radiation. Providing estimates of this short-term variability is important for determining and regulating the output from large solar arrays as they connect with the larger power infrastructure. In support of the installation of a 37-MW solar array on the grounds of Brookhaven National Laboratory (BNL), a study of the impacts of clouds on the output of the solar array has been undertaken. The study emphasis is on predicting the change in surface solar radiation resulting from the observed/forecast cloud field on a 5-minute time scale. At these time scales, advection of cloud elements over the solar array is of particular importance. As part of the BNL Aerosol Life Cycle Intensive Operational Period (IOP), a 915-MHz Radar Wind Profiler (RWP) was deployed to determine the profile of low-level horizontal winds and the depth of the planetary boundary layer. The initial deployment mission of the 915-MHz RWP for cloud forecasting has been expanded the deployment to provide horizontal wind measurements for estimating and constraining cloud advection speeds. A secondary focus is on the observation of dynamics and microphysics of precipitation during cold season/winter storms on Long Island. In total, the profiler was deployed at BNL for 1 year from May 2011 through May 2012.

  13. Radar Wind Profiler for Cloud Forecasting at Brookhaven National Laboratory (BNL) Field Campaign Report

    Energy Technology Data Exchange (ETDEWEB)

    Jensen, M. P. [Brookhaven National Laboratory (BNL), Upton, NY (United States); Giangrande, S. E. [Brookhaven National Laboratory (BNL), Upton, NY (United States); Bartholomew, M. J. [Brookhaven National Laboratory (BNL), Upton, NY (United States)

    2016-04-01

    The Radar Wind Profiler for Cloud Forecasting at Brookhaven National Laboratory (BNL) [http://www.arm.gov/campaigns/osc2013rwpcf] campaign was scheduled to take place from 15 July 2013 through 15 July 2015 (or until shipped for the next U.S. Department of Energy Atmospheric Radiation Measurement [ARM] Climate Research Facility first Mobile Facility [AMF1] deployment). The campaign involved the deployment of the AMF1 Scintec 915 MHz Radar Wind Profiler (RWP) at BNL, in conjunction with several other ARM, BNL and National Weather Service (NWS) instruments. The two main scientific foci of the campaign were: 1) To provide profiles of the horizontal wind to be used to test and validate short-term cloud advection forecasts for solar-energy applications and 2) to provide vertical profiling capabilities for the study of dynamics (i.e., vertical velocity) and hydrometeors in winter storms. This campaign was a serendipitous opportunity that arose following the deployment of the RWP at the Two-Column Aerosol Project (TCAP) campaign in Cape Cod, Massachusetts and restriction from participation in the Green Ocean Amazon 2014/15 (GoAmazon 2014/15) campaign due to radio-frequency allocation restriction for international deployments. The RWP arrived at BNL in the fall of 2013, but deployment was delayed until fall of 2014 as work/safety planning and site preparation were completed. The RWP further encountered multiple electrical failures, which eventually required several shipments of instrument power supplies and the final amplifier to the vendor to complete repairs. Data collection began in late January 2015. The operational modes of the RWP were changed such that in addition to collecting traditional profiles of the horizontal wind, a vertically pointing mode was also included for the purpose of precipitation sensing and estimation of vertical velocities. The RWP operated well until the end of the campaign in July 2015 and collected observations for more than 20 precipitation

  14. TWENTY-YEAR PLANNING STUDY FOR THE RELATIVISTIC HEAVY ION COLLIDER FACILITY AT BROOKHAVEN NATIONAL LABORATORY.

    Energy Technology Data Exchange (ETDEWEB)

    LUDLAM,T.ET AL.

    2003-12-31

    At the request of DOE's Office of Nuclear Physics (ONP), Brookhaven National Laboratory (BNL) has created this planning document to assemble and summarize a planning exercise that addresses the core scientific thrust of the Relativistic Heavy Ion Collider (RHIC) for the next twenty years and the facilities operation plan that will support this program. The planning work was carried out by BNL in close collaboration with the RHIC user community and within budgetary guidelines for the next five years supplied by the ONP. The resulting plans were reviewed by the BNL High Energy and Nuclear Physics Program Advisory Committee (PAC) at a special RHIC planning meeting held in December 2003. Planning input from each of the four RHIC experimental collaborations was absolutely central to the preparation of this overall Laboratory plan. Each collaboration supplied two key documents, a five-year ''Beam Use Proposal'' and a ten-year ''Decadal Plan''. These plans are posted on the BNL website http://www.bnl.gov/henp/, along with other planning documents germane to this paper, such as the complete written reports from the August and December 2003 PAC meetings that considered the five-year and decadal planning documents of the four RHIC collaborations and offered advice and commentary on these plans. Only in these collaboration documents can the full physics impact of the RHIC program be seen and the full scope of the efforts put into this planning process be appreciated. For this reason, the maximum value of the present planning paper can only be realized by making frequent reference to the collaboration documents.

  15. AGS experiments: 1993 - 1994 - 1995

    Energy Technology Data Exchange (ETDEWEB)

    Depken, J.C.

    1996-04-01

    This report contains: FY 1995 AGS Schedule as Run; FY 1996-97 AGE Schedule (working copy); AGS Beams 1995; AGS Experimental Area FY 1993 Physics Program; AGS Experimental Area FY 1994 Physics Program; AGS Experimental Area FY 1995 Physics Program; AGS Experimental Area FY 1996 Physics Program (In progress); A listing of experiments by number; Two-page summaries of each experiment begin here, also ordered by number; Listing of publications of AGS experiments begins here; and Listing of AGS experimenters begins here. This is the twelfth edition.

  16. AgSTAR Partners

    Science.gov (United States)

    AgSTAR’s Partner Program builds stronger relationships with state and non-governmental stakeholders to support all phases of anaerobic digester projects: planning, deployment, and long-term success.

  17. AG Dra monitoring requested

    Science.gov (United States)

    Waagen, Elizabeth O.

    2017-04-01

    Dr. Rudolf Gális (Pavel Jozef Šafárik University) and colleagues have requested AAVSO assistance in observing the symbiotic variable AG Dra. Observations are requested as a follow-up to spectroscopic observations and in order to monitor the system for an anticipated outburst. Gális writes: "AG Dra is one of the best studied symbiotic systems, which undergoes characteristic symbiotic activity with alternating quiescent and active stages. The latter ones consist of several outbursts in intervals of about 1 yr. After seven years of flat quiescence following the 2006-08 major outbursts, in the spring of 2015, AG Dra...[entered the active stage]...with...two minor outbursts (in 2015 and 2016) up to now. Such behaviour is quite unusual in the photometric history of AG Dra, so the further systematic photometric monitoring of this symbiotic binary is highly desirable. We expect the next outburst of AG Dra in the late spring of 2017..." Daily monitoring of AG Dra in UBV(RI) filters is requested beginning at once and continuing until further notice. Visual observations are welcome and are encouraged. When the outburst occurs, revised observing instructions will likely be issued via an AAVSO Special Notice. Finder charts with sequence may be created using the AAVSO Variable Star Plotter (https://www.aavso.org/vsp). Observations should be submitted to the AAVSO International Database. See full Alert Notice for more details.

  18. BROOKHAVEN NATIONAL LABORATORY SOURCE WATER ASSESSMENT FOR DRINKING WATER SUPPLY WELLS

    Energy Technology Data Exchange (ETDEWEB)

    BENNETT,D.B.; PAQUETTE,D.E.; KLAUS,K.; DORSCH,W.R.

    2000-12-18

    The BNL water supply system meets all water quality standards and has sufficient pumping and storage capacity to meet current and anticipated future operational demands. Because BNL's water supply is drawn from the shallow Upper Glacial aquifer, BNL's source water is susceptible to contamination. The quality of the water supply is being protected through (1) a comprehensive program of engineered and operational controls of existing aquifer contamination and potential sources of new contamination, (2) groundwater monitoring, and (3) potable water treatment. The BNL Source Water Assessment found that the source water for BNL's Western Well Field (comprised of Supply Wells 4, 6, and 7) has relatively few threats of contamination and identified potential sources are already being carefully managed. The source water for BNL's Eastern Well Field (comprised of Supply Wells 10, 11, and 12) has a moderate number of threats to water quality, primarily from several existing volatile organic compound and tritium plumes. The g-2 Tritium Plume and portions of the Operable Unit III VOC plume fall within the delineated source water area for the Eastern Well Field. In addition, portions of the much slower migrating strontium-90 plumes associated with the Brookhaven Graphite Research Reactor, Waste Concentration Facility and Building 650 lie within the Eastern source water area. However, the rate of travel in the aquifer for strontium-90 is about one-twentieth of that for tritium and volatile organic compounds. The Laboratory has been carefully monitoring plume migration, and has made adjustments to water supply operations. Although a number of BNL's water supply wells were impacted by VOC contamination in the late 1980s, recent routine analysis of water samples from BNL's supply wells indicate that no drinking water standards have been reached or exceeded. The high quality of the water supply strongly indicates that the operational and engineered

  19. Proceedings of RIKEN BNL Research Center Workshop: Brookhaven Summer Program on Nucleon Spin Physics

    Energy Technology Data Exchange (ETDEWEB)

    Aschenauer, A.; Qiu, Jianwei; Vogelsang, W.; Yuan, F.

    2011-08-02

    Understanding the structure of the nucleon is of fundamental importance in sub-atomic physics. Already the experimental studies on the electro-magnetic form factors in the 1950s showed that the nucleon has a nontrivial internal structure, and the deep inelastic scattering experiments in the 1970s revealed the partonic substructure of the nucleon. Modern research focuses in particular on the spin and the gluonic structure of the nucleon. Experiments using deep inelastic scattering or polarized p-p collisions are carried out in the US at the CEBAF and RHIC facilities, respectively, and there are other experimental facilities around the world. More than twenty years ago, the European Muon Collaboration published their first experimental results on the proton spin structure as revealed in polarized deep inelastic lepton-nucleon scattering, and concluded that quarks contribute very little to the proton's spin. With additional experimental and theoretical investigations and progress in the following years, it is now established that, contrary to naive quark model expectations, quarks and anti-quarks carry only about 30% of the total spin of the proton. Twenty years later, the discovery from the polarized hadron collider at RHIC was equally surprising. For the phase space probed by existing RHIC experiments, gluons do not seem to contribute any to the proton's spin. To find out what carries the remaining part of proton's spin is a key focus in current hadronic physics and also a major driving force for the new generation of spin experiments at RHIC and Jefferson Lab and at a future Electron Ion Collider. It is therefore very important and timely to organize a series of annual spin physics meetings to summarize the status of proton spin physics, to focus the effort, and to layout the future perspectives. This summer program on 'Nucleon Spin Physics' held at Brookhaven National Laboratory (BNL) on July 14-27, 2010 [http://www.bnl.gov/spnsp/] is the

  20. The First Moment of Azimuthal Anisotropy in Nuclear Collisions from AGS to LHC Energies

    Directory of Open Access Journals (Sweden)

    Subhash Singha

    2016-01-01

    Full Text Available We review topics related to the first moment of azimuthal anisotropy (v1, commonly known as directed flow, focusing on both charged particles and identified particles from heavy-ion collisions. Beam energies from the highest available, at the CERN LHC, down to projectile kinetic energies per nucleon of a few GeV per nucleon, as studied in experiments at the Brookhaven AGS, fall within our scope. We focus on experimental measurements and on theoretical work where direct comparisons with experiment have been emphasized. The physics addressed or potentially addressed by this review topic includes the study of Quark Gluon Plasma and, more generally, investigation of the Quantum Chromodynamics phase diagram and the equation of state describing the accessible phases.

  1. Risk assessment and optimization (ALARA) analysis for the environmental remediation of Brookhaven National Laboratory`s hazardous waste management facility

    Energy Technology Data Exchange (ETDEWEB)

    Dionne, B.J.; Morris, S.C. III; Baum, J.W. [and others

    1998-01-01

    The Department of Energy`s (DOE) Office of Environment, Safety, and Health (EH) sought examples of risk-based approaches to environmental restoration to include in their guidance for DOE nuclear facilities. Extensive measurements of radiological contamination in soil and ground water have been made at Brookhaven National Laboratory`s Hazardous Waste Management Facility (HWMF) as part of a Comprehensive Environmental Response, Compensation and Liability Act (CERCLA) remediation process. This provided an ideal opportunity for a case study. This report provides a risk assessment and an {open_quotes}As Low as Reasonably Achievable{close_quotes} (ALARA) analysis for use at other DOE nuclear facilities as an example of a risk-based decision technique. This document contains the Appendices for the report.

  2. Risk assessment and optimization (ALARA) analysis for the environmental remediation of Brookhaven National Laboratory`s hazardous waste management facility

    Energy Technology Data Exchange (ETDEWEB)

    Dionne, B.J.; Morris, S. III; Baum, J.W. [and others

    1998-03-01

    The Department of Energy`s (DOE) Office of Environment, Safety, and Health (EH) sought examples of risk-based approaches to environmental restoration to include in their guidance for DOE nuclear facilities. Extensive measurements of radiological contamination in soil and ground water have been made at Brookhaven National Laboratory`s Hazardous Waste Management Facility (HWMF) as part of a Comprehensive Environmental Response, Compensation and Liability Act (CERCLA) remediation process. This provided an ideal opportunity for a case study. This report provides a risk assessment and an {open_quotes}As Low as Reasonably Achievable{close_quotes} (ALARA) analysis for use at other DOE nuclear facilities as an example of a risk-based decision technique.

  3. A PERSPECTIVE FROM THE AGS.

    Energy Technology Data Exchange (ETDEWEB)

    PILE,P.H.

    1998-03-04

    A working model for the proposed JHF project is the AGS facility at BNL. Research that is being planned at the JHF represent extensions of present AGS experiments. The AGS presently holds the record for beam intensity from a synchrotron. Experience gained and lessons learned over the years from operation of the AGS is invaluable to a new facility like JHF. Presented here is a brief description of the AGS facility with emphasis on the separated particle beam lines that are presently being used for studying strangeness -1 and -2 systems.

  4. A perspective from the AGS

    Energy Technology Data Exchange (ETDEWEB)

    Pile, P.H.

    1998-03-04

    A working model for the proposed SHF project is the AGS facility at BNL. Research that is being planned at the JHF represent extensions of present AGS experiments. The AGS presently holds the record for beam intensity from a synchrotron. Experience gained and lessons learned over the years from operation of the AGS is invaluable to a new facility like JHF. Presented here is a brief description of the AGS facility with emphasis on the separated particle beam lines that are presently being used for studying strangeness {minus}1 and {minus}2 systems.

  5. A perspective from the AGS

    Energy Technology Data Exchange (ETDEWEB)

    Pile, P.H.

    1998-04-01

    A working model for the proposed JHF project is the AGS facility at BNL. Research that is being planned at the JHF represent extensions of present AGS experiments. The AGS presently holds the record for beam intensity from a synchrotron. Experience gained and lessons learned over the years from operation of the AGS is invaluable to a new facility like JHF. Presented here is a brief description of the AGS facility with emphasis on the separated particle beam lines that are presently being used for studying strangeness-1 and -2 systems.

  6. AGS experiments -- 1991, 1992, 1993. Tenth edition

    Energy Technology Data Exchange (ETDEWEB)

    Depken, J.C.

    1994-04-01

    This report contains: (1) FY 1993 AGS schedule as run; (2) FY 1994--95 AGS schedule; (3) AGS experiments {ge} FY 1993 (as of 30 March 1994); (4) AGS beams 1993; (5) AGS experimental area FY 1991 physics program; (6) AGS experimental area FY 1992 physics program; (7) AGS experimental area FY 1993 physics program; (8) AGS experimental area FY 1994 physics program (planned); (9) a listing of experiments by number; (10) two-page summaries of each experiment; (11) listing of publications of AGS experiments; and (12) listing of AGS experiments.

  7. AGS experiments -- 1995, 1996 and 1997

    Energy Technology Data Exchange (ETDEWEB)

    Depken, J.C.; Presti, P.L.

    1997-12-01

    This report contains (1) FY 1995 AGS schedule as run; (2) FY 1996 AGS schedule as run; (3) FY 1997 AGS schedule as run; (4) FY 1998--1999 AGS schedule (proposed); (5) AGS beams 1997; (6) AGS experimental area FY 1995 physics program; (7) AGS experimental area FY 1996 physics program; (8) AGS experimental area FY 1997 physics program; (9) AGS experimental area FY 1998--1999 physics program (proposed); (10) a listing of experiments by number; (11) two-page summaries of each experiment, in order by number; and (12) listing of publications of AGS experiments.

  8. Ag transport in CrN-Ag nanocomposite coatings

    Energy Technology Data Exchange (ETDEWEB)

    Mulligan, C.P. [Department of Materials Science and Engineering, Rensselaer Polytechnic Institute, Troy, NY 12180 (United States); U.S. Army Armament Research Development and Engineering Center, Benet Laboratories, Watervliet, NY 12189 (United States); Papi, P.A. [Department of Materials Science and Engineering, Rensselaer Polytechnic Institute, Troy, NY 12180 (United States); Gall, D., E-mail: galld@rpi.edu [Department of Materials Science and Engineering, Rensselaer Polytechnic Institute, Troy, NY 12180 (United States)

    2012-09-01

    2-{mu}m-thick CrN-Ag composite coatings containing 22 at.% Ag were deposited on Si(001) by reactive co-sputtering at T{sub s} = 300, 400, and 500 Degree-Sign C. Subsequent vacuum annealing at T{sub a} = 425, 525, and 625 Degree-Sign C causes Ag transport to the surface. Auger electron spectroscopy and plan-view microscopy are used to quantify the Ag transport to the surface, which increases strongly with increasing {Delta}T = T{sub a} - T{sub s}. Compositional depth profiles and cross-sectional microscopy show that annealing causes a negligible Ag gradient through the composite layer, suggesting that the Ag transport is detachment-limited as opposed to diffusion-limited. Statistical analyses of Ag aggregate size-distributions within the matrix show that large aggregates ({>=} 50 nm) are unaffected by annealing, while the Ag in a large fraction of small aggregates (< 50 nm) moves to the surface, leaving behind 10-50 nm wide voids in the annealed composite. This indicates that the Ag from the smaller grains, with a higher chemical potential and thus a higher detachment rate, is transferred to the large grains on the surface which are 200-1000 nm wide. - Highlights: Black-Right-Pointing-Pointer CrN-Ag coatings were deposited at T{sub s} = 300-500 Degree-Sign C and annealed at T{sub a} = 425-625 Degree-Sign C. Black-Right-Pointing-Pointer Ag diffuses from aggregates in the coating to the surface, if T{sub a} > T{sub s}. Black-Right-Pointing-Pointer During annealing, aggregates < 50 nm become voids, those > 50 nm are unaffected. Black-Right-Pointing-Pointer The Ag transport is detachment rather than diffusion limited.

  9. AGS experiments: 1984, 1985, 1986. Third edition

    Energy Technology Data Exchange (ETDEWEB)

    Depken, J.C.

    1986-02-01

    Brief summaries are given of 44 different experiments either running or scheduled to run at the Brookhaven National Laboratory Alternating Gradient Synchrotron, as well as the experiment schedules. The beam parameters and fluxes are tabulated. Illustrations are given of both the experimental area layouts and the apparatus for each experiment. (LEW)

  10. THE AGS-BASED SUPER NEUTRINO BEAM FACILITY CONCEPTUAL DESIGN REPORT

    Energy Technology Data Exchange (ETDEWEB)

    WENG,W.T.; DIWAN,M.; RAPARIA,D.

    2004-10-08

    After more than 40 years of operation, the AGS is still at the heart of the Brookhaven hadron accelerator complex. This system of accelerators presently comprises a 200 MeV linac for the pre-acceleration of high intensity and polarized protons, two Tandem Van der Graaffs for the pre-acceleration of heavy ion beams, a versatile Booster that allows for efficient injection of all three types of beams into the AGS and, most recently, the two RHIC collider rings that produce high luminosity heavy ion and polarized proton collisions. For several years now, the AGS has held the world intensity record with more than 7 x 10{sup 13} protons accelerated in a single pulse. The requirements for the proton beam for the super neutrino beam are summarized and a schematic of the upgraded AGS is shown. Since the present number of protons per fill is already close to the required number, the upgrade is based on increasing the repetition rate and reducing beam losses (to avoid excessive shielding requirements and to maintain activation of the machine components at workable level). It is also important to preserve all the present capabilities of the AGS, in particular its role as injector to RHIC. The AGS Booster was built not only to allow the injection of any species of heavy ion into the AGS but to allow a fourfold increase of the AGS intensity. It is one-quarter the circumference of the AGS with the same aperture. However, the accumulation of four Booster loads in the AGS takes about 0.6 s, and is therefore not well suited for high average beam power operation. To minimize the injection time to about 1 ms, a 1.2 GeV linac will be used instead. This linac consists of the existing warm linac of 200 MeV and a new superconducting linac of 1.0 GeV. The multi-turn H{sup -} injection from a source of 30 mA and 720 {micro}s pulse width is sufficient to accumulate 9 x 10{sup 13} particle per pulse in the AGS[10]. The minimum ramp time of the AGS to full energy is presently 0.5 s; this must

  11. Preparation and antibacterial activities of Ag/Ag+/Ag3+ nanoparticle composites made by pomegranate (Punica granatum) rind extract

    Science.gov (United States)

    Yang, Hui; Ren, Yan-yu; Wang, Tao; Wang, Chuang

    Nano-silver and its composite materials are widely used in medicine, food and other industries due to their strong conductivity, size effect and other special performances. So far, more microbial researches have been applied, but a plant method is rarely reported. In order to open up a new way to prepare AgNP composites, pomegranate peel extract was used in this work to reduce Ag+ to prepare Ag/Ag+/Ag3+ nanoparticle composites. UV-Vis was employed to detect and track the reduction of Ag+ and the forming process of AgNPs. The composition, structure and size of the crystal were analyzed by XRD and TEM. Results showed that, under mild conditions, pomegranate peel extract reacted with dilute AgNO3 solution to produce Ag/Ag+/Ag3+ nanoparticle composites. At pH = 8 and 10 mmol/L of AgNO3 concentration, the size of the achieved composites ranged between 15 and 35 nm with spherical shapes and good crystallinity. The bactericidal experiment indicated that the prepared Ag/Ag+/Ag3+ nanoparticles had strong antibacterial activity against gram positive bacteria and gram negative bacteria. FTIR analysis revealed that biological macromolecules with groups of sbnd NH2, sbnd OH, and others were distributed on the surface of the newly synthesized Ag/Ag+/Ag3+ nanoparticles. This provided a useful clue to further study the AgNP biosynthesis mechanism.

  12. Evaluation of alternative designs for an injectable subsurface barrier at the Brookhaven National Laboratory Site, Long Island, New York

    Science.gov (United States)

    Moridis, George J.; Finsterle, Stefan; Heiser, John

    1999-10-01

    Two alternative designs for the demonstration emplacement of a viscous liquid barrier (VLB) at the Brookhaven National Laboratory (BNL), Long Island, New York, are investigated by means of numerical simulation. The application of the VLB technology at the BNL site involved a surface-modified colloidal silica (CS), which gels upon addition of an appropriate electrolyte. Lance injection was used for the CS barrier emplacement. The lance injections occur in three stages: primary, secondary, and tertiary. The geometry of the barrier is based on the wedge model. The first design is based on optimization principles and determines the parameters that maximize uniformity and minimize permeability by minimizing an appropriate objective function while meeting the design criteria. These include a maximum hydraulic conductivity of 10-7 cm/s and a minimum thickness of 1 m. The second design aims to meet the same criteria and reflects standard chemical grouting practices. The combined effects of the key design parameters (i.e., lance spacing, injection location and spacing, gel time, injection rate, and volume) on the barrier permeability are studied. The optimization-based design is shown to have a significantly better performance than the standard engineering design. The interpenetration of adjacent CS bulbs appears to be of critical importance in meeting the barrier specifications. The three-dimensional simulations show that the barrier performance depends heavily on the path by which the final state is achieved. The in situ field measurements of the barrier permeability are consistent with, and appear to validate, the model predictions.

  13. The RaDIATE High-Energy Proton Materials Irradiation Experiment at the Brookhaven Linac Isotope Producer Facility

    Energy Technology Data Exchange (ETDEWEB)

    Ammigan, Kavin; et al.

    2017-05-01

    The RaDIATE collaboration (Radiation Damage In Accelerator Target Environments) was founded in 2012 to bring together the high-energy accelerator target and nuclear materials communities to address the challenging issue of radiation damage effects in beam-intercepting materials. Success of current and future high intensity accelerator target facilities requires a fundamental understanding of these effects including measurement of materials property data. Toward this goal, the RaDIATE collaboration organized and carried out a materials irradiation run at the Brookhaven Linac Isotope Producer facility (BLIP). The experiment utilized a 181 MeV proton beam to irradiate several capsules, each containing many candidate material samples for various accelerator components. Materials included various grades/alloys of beryllium, graphite, silicon, iridium, titanium, TZM, CuCrZr, and aluminum. Attainable peak damage from an 8-week irradiation run ranges from 0.03 DPA (Be) to 7 DPA (Ir). Helium production is expected to range from 5 appm/DPA (Ir) to 3,000 appm/DPA (Be). The motivation, experimental parameters, as well as the post-irradiation examination plans of this experiment are described.

  14. Magnet design for the splitter/combiner regions of CBETA, the Cornell-Brookhaven Energy-Recovery-Linac Test Accelerator

    Energy Technology Data Exchange (ETDEWEB)

    Crittendon, J. A. [Cornell Lab. for Accelerator-Based Sciences and Education, Ithaca, NY (United States); Burke, D. C. [Cornell Lab. for Accelerator-Based Sciences and Education, Ithaca, NY (United States); Fuentes, Y. L.P. [Cornell Lab. for Accelerator-Based Sciences and Education, Ithaca, NY (United States); Mayes, C. E. [Cornell Lab. for Accelerator-Based Sciences and Education, Ithaca, NY (United States); Smolenski, K. W. [Cornell Lab. for Accelerator-Based Sciences and Education, Ithaca, NY (United States)

    2017-01-06

    The Cornell-Brookhaven Energy-Recovery-Linac Test Accelerator (CBETA) will provide a 150-MeV electron beam using four acceleration and four deceleration passes through the Cornell Main Linac Cryomodule housing six 1.3-GHz superconducting RF cavities. The return path of this 76-m-circumference accelerator will be provided by 106 fixed-field alternating-gradient (FFAG) cells which carry the four beams of 42, 78, 114 and 150 MeV. Here we describe magnet designs for the splitter and combiner regions which serve to match the on-axis linac beam to the off-axis beams in the FFAG cells, providing the path-length adjustment necessary to energy recovery for each of the four beams. The path lengths of the four beamlines in each of the splitter and combiner regions are designed to be adapted to 1-, 2-, 3-, and 4-pass staged operations. Design specifi- cations and modeling for the 24 dipole and 32 quadrupole electromagnets in each region are presented. The CBETA project will serve as the first demonstration of multi-pass energy recovery using superconducting RF cavities with FFAG cell optics for the return loop.

  15. RADIATION MEASUREMENTS BY BROOKHAVEN NATIONAL LABORATORY DURING THE WOODS HOLE OCEANOGRAPHIC INSTITUTION INTERCOMPARISON STUDY, MAY-JUNE 2000.

    Energy Technology Data Exchange (ETDEWEB)

    REYNOLDS, R.M.; BARTHOLOMEW, M.J.; MILLER, M.A.; SMITH, S.; EDWARDS, R.

    2000-12-01

    The WHOI buoy radiometer intercomparison took place during May and June, 2000 at the WHOI facility. The WHOI IMET, JAMSTEC Triton, and NOAA TAO buoy systems were operated from a beach site and the Brookhaven National Laboratory set up two Portable Radiation Package systems (P01 and P02) alongside the WHOI instrumentation on the roof of the Clark Building, about 300 m away. The BNL instruments were named ''P01'' and ''P02'' and were identical. Buoy instruments were all leveled to {+-}1{degree} to horizontal. The purpose of the project was to compare the buoy systems with precision measurements so that any differences in data collection or processing would be evaluated. BNL was pleased to participate so the PRP system could be evaluated as a calibration tool. The Portable Radiation Package is an integral component of the BNL Shipboard Oceanographic and Atmospheric Radiation (SOAR) system. It is designed to make accurate downwelling radiation measurements, including the three solar irradiance components (direct normal, diffuse and global) at six narrowband channels, aerosol optical depth measurements, and broadband longwave and shortwave irradiance measurements.

  16. THE BOOSTER APPLICATION FACILITY (BAF) BEAM TRANSPORT LINE OF BNL-AGS BOOSTER.

    Energy Technology Data Exchange (ETDEWEB)

    TSOUPAS,N.; BROWN,K.A.; CULLEN,J.R.; LEE,Y.Y.; MCNERNEY,A.J.; PILE,P.H.; ROSER,T.; SOUKAS,A.; TUOZZOLO,J.E.

    1999-03-29

    An experimental facility, to irradiate materials with energetic ion beams, has been proposed to be built at the Brookhaven National Laboratory. The BAF facility will mainly consist of the AGS-Booster slow extraction, of a beam transport line, and a target room. The beam transport line will transport the slow extracted beam of the AGS-Booster to the target location for the irradiation of various materials and specimens. A variety of ion beams like (p, {sup 28}Si, {sup 56}Fe, {sup 63}Cu, {sup 197}Au) in the energy range of 0.04 to 3.07 GeV/nucleon will be transported by the BAF line which is designed to provide variable beam spot sizes on the BAF target with sizes varying from 2.0 cm to 20.0 cm in diameter. The beam spot sizes will include 95% of the beam intensity with the beam distributed normally (Gaussian) on the target area. It is also possible by introducing magnetic octupoles at specified locations along the beam transport line, to modify the distribution on the BAF target and provide well confined beams with rectangular cross section and with uniform distribution on the target.

  17. Construction of Ag/AgCl nanostructures from Ag nanoparticles as high-performance visible-light photocatalysts

    Energy Technology Data Exchange (ETDEWEB)

    Yang, Fan; Liu, Dongzhi; Wang, Tianyang; Li, Wei [Tianjin University, School of Chemical Engineering and Technology (China); Hu, Wenping [Tianjin University, Collaborative Innovation Center of Chemical Science and Engineering (China); Zhou, Xueqin, E-mail: zhouxueqin@tju.edu.cn [Tianjin University, School of Chemical Engineering and Technology (China)

    2016-11-15

    A combined strategy of in situ oxidation and assembly is developed to prepare Ag/AgCl nanospheres and nanocubes from Ag nanoparticles under room temperature. It is a new facile way to fabricate Ag/AgCl with small sizes and defined morphologies. Ag/AgCl nanospheres with an average size of 80 nm were achieved without any surfactants, while Ag/AgCl nanocubes with a mean edge length of 150 nm were obtained by introduction of N-dodecyl-N,N-dimethyl-2-ammonio-acetate. The possible formation mechanism involves the self-assembly of AgCl nanoparticles, Ostwald ripening and photoreduction of Ag{sup +} into Ag{sup 0} by the room light. The as-prepared Ag/AgCl nanospheres and nanocubes exhibit excellent photocatalytic activity and stability toward degradation of organic pollutants under visible-light irradiation. It is demonstrated that Ag/AgCl nanocubes display enhanced photocatalytic activity in comparison with Ag/AgCl nanospheres due to the more efficient charge transfer. This work may pave an avenue to construct various functional materials via the assembly strategy using nanoparticles as versatile building blocks.

  18. Construction of Ag/AgCl nanostructures from Ag nanoparticles as high-performance visible-light photocatalysts

    Science.gov (United States)

    Yang, Fan; Liu, Dongzhi; Wang, Tianyang; Li, Wei; Hu, Wenping; Zhou, Xueqin

    2016-11-01

    A combined strategy of in situ oxidation and assembly is developed to prepare Ag/AgCl nanospheres and nanocubes from Ag nanoparticles under room temperature. It is a new facile way to fabricate Ag/AgCl with small sizes and defined morphologies. Ag/AgCl nanospheres with an average size of 80 nm were achieved without any surfactants, while Ag/AgCl nanocubes with a mean edge length of 150 nm were obtained by introduction of N-dodecyl- N, N-dimethyl-2-ammonio-acetate. The possible formation mechanism involves the self-assembly of AgCl nanoparticles, Ostwald ripening and photoreduction of Ag+ into Ag0 by the room light. The as-prepared Ag/AgCl nanospheres and nanocubes exhibit excellent photocatalytic activity and stability toward degradation of organic pollutants under visible-light irradiation. It is demonstrated that Ag/AgCl nanocubes display enhanced photocatalytic activity in comparison with Ag/AgCl nanospheres due to the more efficient charge transfer. This work may pave an avenue to construct various functional materials via the assembly strategy using nanoparticles as versatile building blocks.

  19. CSEWG SYMPOSIUM, A CSWEG RETROSPECTIVE. 35TH ANNIVERSARY CROSS SECTION EVALUATION WORKING GROUP, NOV. 5, 2001, BROOKHAVEN NATIONAL LABORATORY.

    Energy Technology Data Exchange (ETDEWEB)

    DUNFORD, C.; HOLDEN, N.; PEARLSTEIN, S.

    2001-11-05

    This publication has been prepared to record some of the history of the Cross Section Evaluation Working Group (CSEWG). CSEWG is responsible for creating the evaluated nuclear data file (ENDF/B) which is widely used by scientists and engineers who are involved in the development and maintenance of applied nuclear technologies. This organization has become the model for the development of nuclear data libraries throughout the world. The data format (ENDF) has been adopted as the international standard. On November 5, 2001, a symposium was held at Brookhaven National Laboratory to celebrate the 50 th meeting of the CSEWG organization and the 35 th anniversary of its first meeting in November 1966. The papers presented in this volume were prepared by present and former CSEWG members for presentation at the November 2001 symposium. All but two of the presentations are included. I have included an appendix to list all of the CSEWG members and their affiliations, which has been compiled from the minutes of each of the CSEWG meetings. Minutes exist for all meetings except the 4 th meeting held in January 1968. The list includes 348 individuals from 71 organizations. The dates for each of the 50 CSEWG meetings are listed. The committee structure and chairmen of all committees and subcommittees are also included in the appendix. This volume is dedicated to three individuals whose foresight and talents made CSEWG possible and successful. They are Henry Honeck who lead the effort to develop the ENDF format and the CSEWG system, Ira Zartman, the Atomic Energy Commission program manager who provided the programmatic direction and support, and Sol Pearlstein who led the development of the CESWG organization and the ENDF/B evaluated nuclear data library.

  20. Striving Toward Energy Sustainability: How Plants Will Play a Role in Our Future (453rd Brookhaven Lecture)

    Energy Technology Data Exchange (ETDEWEB)

    Ferrieri, Richard A. (Ph.D., Medical Department)

    2009-10-28

    Edible biomass includes sugars from sugar cane or sugar beets, starches from corn kernels or other grains, and vegetable oils. The fibrous, woody and generally inedible portions of plants contain cellulose, hemicellulose and lignin, three key cell-wall components that make up roughly 70 percent of total plant biomass. At present, starch can readily be degraded from corn grain into glucose sugar, which is then fermented into ethanol, and an acre of corn can yield roughly 400 gallons of ethanol. In tapping into the food supply to solve the energy crisis, however, corn and other crops have become more expensive as food. One solution lies in breaking down other structural tissues of plants, including the stalks and leaves of corn, grasses and trees. However, the complex carbohydrates in cellulose-containing biomass are more difficult to break down and convert to ethanol. So researchers are trying to engineer plants having optimal sugars for maximizing fuel yield. This is a challenge because only a handful of enzymes associated with the more than 1,000 genes responsible for cell-wall synthesis have had their roles in controlling plant metabolism defined. As Richard Ferrieri, Ph.D., a leader of a biofuel research initiative within the Medical Department, will discuss during the 453rd Brookhaven Lecture, he and his colleagues use short-lived radioisotopes, positron emission tomography and biomarkers that they have developed to perform non-invasive, real time imaging of whole plants. He will explain how the resulting metabolic flux analysis gives insight into engineering plant metabolism further.

  1. Spectroscopy of {sup 96}Ag.

    Energy Technology Data Exchange (ETDEWEB)

    Boutachkov, P.; Gorska, M.; Grawe, H.; Pietri, S.; Pardo, C.D.; Farinon, F.; Kojouharov, I.; Kurz, N.; Nociforo, C.; Prochazka, A.; Prokopowicz, W.; Caceres, L.; Engert, T.; Gerl, J.; Goel, N.; Schaffner, H.; Weick, H.; Wollersheim, H.J.; Merchant, E. [GSI (Germany); Braun, N.; Blazhev, A.; Bettermann, L.; Finke, F.; Geibel, K.; Ilie, G.; Iwasaki, H.; Reiter, P.; Scholl, C.; Warr, N. [Univ. Koeln (Germany); Brock, T.; Nara Singh, B.S.; Wadsworth, R. [Univ. York (United Kingdom); Liu, Z.; Gottardo, A.; Woods, P. [Univ. Edinburgh (United Kingdom); Faestermann, T.; Eppinger, K.; Hinke, C.; Kruecken, R. [TU Munich (Germany); Grebosz, J. [Inst. Fizyki, Krakow (Poland); Podolyak, Zs.; Steer, S.; Regan, P. [Univ. Surrey (United Kingdom); Hoischen, R. [GSI (Germany); Lund Univ. (Sweden); Nyberg, J.; Soederstroem, P.A. [Uppsala Univ. (Sweden); Pfuetzner, M. [Warsaw Univ. (Poland); Rinta-Antila, S. [Univ. Liverpool (United Kingdom); Rudolph, D. [Lund Univ. (Sweden); Atac, A. [Ankara Univ. (Turkey)

    2010-07-01

    A measurement with the RISING setup at the GSI-FRS facility has been performed to study isomer and {beta} decays in N{proportional_to}Z Cd, Ag and Pd isotopes. This study provides information on the shell evolution around the N=Z=50 shell closure. In particular, three new isomeric states were observed in {sup 96}Ag, extending the level scheme to high-spin spherical structures, including core-excited states. A comparison to shell-model calculations ascertains the {sup 100}Sn shell gap from this data. The new {sup 96}Ag results are presented.

  2. Bioceres: AG Biotechnology from Argentina

    Directory of Open Access Journals (Sweden)

    Roberto Feeney

    2016-04-01

    Full Text Available In this case we present a business decision-making situation in which the CEO of an Argentine Ag Biotech company, Bioceres, has to decide the best way to commercialize a new drought-tolerant transgenic technology. The company was founded by twenty three farmers, who shared a common dream that Argentina could become a benchmark in the development of Ag biotechnology. The case has strategic and financial implications, as well as decision-making situation involving a joint venture with an American biotechnology company. It also introduces to discussion the business models of Ag biotechnology companies in developing countries.

  3. Energy-related perturbations of the northeast coastal zone: five years (1974-1979) of oceanographic research at Brookhaven National Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Walsh, J.J.

    1980-03-01

    Since inception of oceanographic research at Brookhaven National Laboratory in 1974, over 75 cruises and 150 papers and reports have been completed. In comparison of shelf ecosystems at high, mid, and low latitudes, an understanding of the natural variability of US coastal waters has been derived. Annual carbon and nitrogen budgets suggest that the energy flow is diverted to a pelagic food web in summer-fall and a demersal food web in winter-spring within the Mid-Atlantic Bight. The impact of energy-related perturbations can now be assessed within the context of natural oscillation of the coastal food web.

  4. File list: Oth.Dig.10.AllAg.AGS [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.Dig.10.AllAg.AGS hg19 TFs and others Digestive tract AGS SRX367641,SRX367642,SR...X371981,SRX367640 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/Oth.Dig.10.AllAg.AGS.bed ...

  5. Self-Assembly by Instruction: Designing Nanoscale Systems Using DNA-Based Approaches (474th Brookhaven Lecture)

    Energy Technology Data Exchange (ETDEWEB)

    Gang, Oleg [Center for Functional Nanomaterials

    2012-01-18

    In the field of nanoscience, if you can control how nanoparticles self-assemble in particular structures — joining each other, for example, as molecules can form, atom-by-atom — you can design new materials that have unique properties that industry needs. Nature already uses the DNA genetic code to instruct the building of specific proteins and whole organisms in both plants and people. Taking a cue from nature, scientists at BNL devised a way of using strands of synthetic DNA attached to the surface of nanoparticles to instruct them to self-assemble into specific nanoscale structures, clusters, and three-dimensional organizations. Novel materials designed and fabricated this way promise use in photovoltaics, energy storage, catalysis, cell-targeted systems for more effective medical treatments, and biomolecular sensing for environmental monitoring and medical applications. To find out more about the rapid evolution of this nanoassembly method and its applications, join Physicist Oleg Gang of the Center for Functional Nanomaterials (CFN) as he gives the 474th Brookhaven Lecture, titled “Self-Assembly by Instruction: Designing Nanoscale Systems Using DNA-Based Approaches." Gang, who has led this work at the CFN, will explain the rapid evolution of this nanoassembly method, and discuss its present and future applications in highly specific biosensors, optically active nano-materials, and new ways to fabricate complex architectures in a rational manner via self-assembly. Gang and his colleagues used the CFN and the National Synchrotron Light Source (NSLS) facilities to perform their groundbreaking research. At the CFN, the scientists used electron microscopes and optical methods to visualize the clusters that they fabricated. At the NSLS, they applied x-rays to study a particles-assembly process in solution, DNA’s natural environment. Gang earned a Ph.D. in soft matter physics from Bar-Ilan University in 2000, and he was a Rothschild Fellow at Harvard

  6. Application of the SmartSampling Methodology to the Evaluation of Contaminated Landscape Soils at Brookhaven National Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    RAUTMAN,CHRISTOPHER A.

    2000-08-01

    Portions of the SmartSampling{trademark} analysis methodology have been applied to the evaluation of radioactive contaminated landscape soils at Brookhaven National Laboratory. Specifically, the spatial, volumetric distribution of cesium-137 ({sup 137}Cs) contamination within Area of Concern 16E-1 has been modeled probabilistically using a geostatistical methodology, with the purpose of identifying the likelihood of successfully reducing, with respect to a pre-existing, baseline remediation plan, the volume of soil that must be disposed of offsite during clean-up. The principal objective of the analysis was to evaluate the likelihood of successful deployment of the Segmented Gate System (SGS), a novel remediation approach that emphasizes real-time separation of clean from contaminated materials during remediation operations. One primary requirement for successful application of the segmented gate technology investigated is that a variety of contaminant levels exist at the deployment site, which would enable to the SGS to discriminate material above and below a specified remediation threshold value. The results of this analysis indicate that there is potential for significant volume reduction with respect to the baseline remediation plan at a threshold excavation level of 23 pCi/g {sup 137}Cs. A reduction of approximately 50%, from a baseline volume of approximately 1,064.7 yd{sup 3} to less than 550 yd{sup 3}, is possible with acceptance of only a very small level of engineering risk. The vast majority of this volume reduction is obtained by not excavating almost all of levels 3 and 4 (from 12 to 24 inches in depth), which appear to be virtually uncontaminated, based on the available data. Additional volume reductions related to soil materials on levels 1 (depths of 0--6 inches) and 2 (6--12 inches) may be possible, specifically through use of the SGS technology. Level-by-level evaluation of simulation results suggests that as much as 26 percent of level 1 and as

  7. Proceedings of RIKEN BNL Research Center Workshop: Brookhaven Summer Program on Quarkonium Production in Elementary and Heavy Ion Collisions

    Energy Technology Data Exchange (ETDEWEB)

    Dumitru, A.; Lourenco, C.; Petreczky, P.; Qiu, J., Ruan, L.

    2011-08-03

    Understanding the structure of the hadron is of fundamental importance in subatomic physics. Production of heavy quarkonia is arguably one of the most fascinating subjects in strong interaction physics. It offers unique perspectives into the formation of QCD bound states. Heavy quarkonia are among the most studied particles both theoretically and experimentally. They have been, and continue to be, the focus of measurements in all high energy colliders around the world. Because of their distinct multiple mass scales, heavy quarkonia were suggested as a probe of the hot quark-gluon matter produced in heavy-ion collisions; and their production has been one of the main subjects of the experimental heavy-ion programs at the SPS and RHIC. However, since the discovery of J/psi at Brookhaven National Laboratory and SLAC National Accelerator Laboratory over 36 years ago, theorists still have not been able to fully understand the production mechanism of heavy quarkonia, although major progresses have been made in recent years. With this in mind, a two-week program on quarkonium production was organized at BNL on June 6-17, 2011. Many new experimental data from LHC and from RHIC were presented during the program, including results from the LHC heavy ion run. To analyze and correctly interpret these measurements, and in order to quantify properties of the hot matter produced in heavy-ion collisions, it is necessary to improve our theoretical understanding of quarkonium production. Therefore, a wide range of theoretical aspects on the production mechanism in the vacuum as well as in cold nuclear and hot quark-gluon medium were discussed during the program from the controlled calculations in QCD and its effective theories such as NRQCD to various models, and to the first principle lattice calculation. The scientific program was divided into three major scientific parts: basic production mechanism for heavy quarkonium in vacuum or in high energy elementary collisions; the

  8. Photoreduction of Ag{sup +} in Ag/Ag{sub 2}S/Au memristor

    Energy Technology Data Exchange (ETDEWEB)

    Mou, N.I.; Tabib-Azar, M., E-mail: azar.m@utah.edu

    2015-06-15

    Highlights: • The effect of illumination on the operating voltages and switching speed of Ag/Ag{sub 2}S/Au memristors is studied • Illumination decreased the average switching time from high to low resistance states by ∼19% and decreased the turn-off voltages dramatically from −0.8 V to −0.25 V. • Photo-induced reduction of silver in Ag{sub 2}S may be used in three dimensional optical memories that can be electronically read and reset. • Illumination changed sulfur's valency and modified its oxidation/reduction potential. - Abstract: Silver halides and chalcogenides are excellent memristor materials that have been extensively used in the past as photosensitive layers in photography. Here we examine the effect of illumination on the operating voltages and switching speed of Ag/Ag{sub 2}S/Au memristors using a green laser (473–523 nm). Our results indicate that illumination decreases the average switching time from high to low resistance states by ∼19% and decreases the turn-off voltages dramatically from −0.8 V to −0.25 V that we attribute to the change in sulfur valency and a photo-induced change in its oxidation/reduction potential. Photo-induced reduction of silver in Ag{sub 2}S may be used in three dimensional optical memories that can be electronically read and reset.

  9. Ruhrgas AG. Business report 2000; Ruhrgas AG. Geschaeftsbericht 2000

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2001-07-01

    A detailed account of the situation of the international gas market provides the basis of the status report of Ruhrgas AG and the group of affiliated companies. Emphasis is placed on gas procurement aspects, sales volumes, the construction and operation of natural gas distribution systems, and on development, utilization and application aspects. The activities and situation of major Ruhrgas AG holding companies are described, and the annual financial statements are documented. (orig.) [German] Ausgehend von einer eingehenden Beschreibung des internationalen Gasmarktes wird ein Lagebericht des Konzerns sowie der Ruhrgas AG gegeben. Dabei wird insbesondere auf Fragen der Gasbeschaffung, des Gasabsatzes, des Baus und Betriebs von Erdgasverteilungsnetzen, sowie der Entwicklung und der Anwendungstechnik eingegangen. Ferner wird ueber den Geschaeftsverlauf wesentlicher Ruhrgas-Beteiligungsgesellschaften berichtet. Abschliessend wird der Jahresabschluss dokumentiert. (orig.)

  10. How Ag Nanospheres Are Transformed into AgAu Nanocages

    Energy Technology Data Exchange (ETDEWEB)

    Moreau, Liane M.; Schurman, Charles A.; Kewalramani, Sumit; Shahjamali, Mohammad M.; Mirkin, Chad A.; Bedzyk, Michael J. (NWU)

    2017-08-23

    Bimetallic hollow, porous noble metal nanoparticles are of broad interest for biomedical, optical and catalytic applications. The most straightforward method for preparing such structures involves the reaction between HAuCl4 and well-formed Ag particles, typically spheres, cubes, or triangular prisms, yet the mechanism underlying their formation is poorly understood at the atomic scale. By combining in situ nanoscopic and atomic-scale characterization techniques (XAFS, SAXS, XRF, and electron microscopy) to follow the process, we elucidate a plausible reaction pathway for the conversion of citrate-capped Ag nanospheres to AgAu nanocages; importantly, the hollowing event cannot be explained by the nanoscale Kirkendall effect, nor by Galvanic exchange alone, two processes that have been previously proposed. We propose a modification of the bulk Galvanic exchange process that takes into account considerations that can only occur with nanoscale particles. This nanoscale Galvanic exchange process explains the novel morphological and chemical changes associated with the typically observed hollowing process.

  11. Brookhaven highlights 1994

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1994-12-31

    Established in 1947 on Long Island, New York, on the site of the former army Camp Upton, BNL is a multidisciplinary laboratory that carries out basic and applied research in the physical, biomedical and environmental sciences and in selected energy technologies. The Laboratory is managed by Associated Universities, Inc., under contract to the US Department of Energy. BNL`s annual budget is about $400 million, and the Laboratory`s facilities are valued at replacements cost in excess of over $2.8 billion. Employees number around 3,300,and over 4,000 guests, collaborators and students come each year to use the Laboratory`s facilities and work with the staff. Scientific and technical achievements at BNL have made their way into daily life in areas as varied as health care, construction materials and video games. The backbone of these developments is fundamental research, which is and always will be an investment in the future.

  12. Compare the photocatalytic properties of nanocomposites with tandem n (AgBr)-n (Ag2CO3) and p (AgCl)-n (Ag2CO3) heterojunctions

    Science.gov (United States)

    Asadollahi, A.; Sohrabnezhad, Sh.; Ansari, R.

    2017-07-01

    In this work, Ag2CO3 nanoparticles (NPs) (as a n-type semiconductor) incorporated in mordenite zeolite (MOR) by a facile precipitation method. Silver halides, AgCl (as a p-type semiconductor) and AgBr (as a n-type semiconductor), with different weight percentage (20%, 40% and 50%) were coupled into Ag2CO3-MOR nanocomposite (NC) and producing a series of novel AgCl/Ag2CO3 (p-n heterojunction)-MOR and AgBr/Ag2CO3 (n-n heterojunction)-MOR NCs. The effects of silver halides on the Ag2CO3-MOR catalyst for the photocatalytic degradation of methyl blue (MB) under visible light irradiation have been investigated. The structure, composition and optical properties of NCs were investigated by UV-Visible diffuse reflectance spectroscopy (UV-Vis DRS), X-ray diffraction (XRD), transmission electron microscopy (TEM), scanning electron microscopy (SEM). The prepared AgX/Ag2CO3-MOR NCs with the optimal content of AgX (50 wt%) indicated higher photocatalytic activity than that of the Ag2CO3-MOR and Ag2CO3. The cycle experiments on the heterojuctions NCs indicated that photocatalytic stability of AgBr/Ag2CO3-MOR NC was more than AgCl/Ag2CO3-MOR NC in all cycles. On the basis of the experimental results, a possible mechanism for the enhanced photocatalytic activity and photoinduced stability of silver compounds was proposed.

  13. ALTERNATING CURRENT LOSSES IN AG-SHEATHED BSCCO (2212 AND 2223) TAPES AND WIRES AND YBCO (123) COATED CONDUCTORS

    Energy Technology Data Exchange (ETDEWEB)

    Dr. John S. Hurley

    2000-01-01

    In this study, we focus on the examination of ac losses in conductors utilizing Bi{sub 2}Sr{sub 2}Ca{sub 2}Cu{sub 3}O [BSCCO (2223)] high TC superconductors (HTS). In addition, we seek to assist other facilities such as the University of Wisconsin-Madison Applied Superconductivity Center (UW-ASC), Brookhaven National Laboratory, and other DoE facilities investigating the use of HTS in electric power applications (e.g., generators, motors, and transformers). To accomplish this we will develop an ac losses capability at Clark Atlanta University to complement the established ac losses efforts at Brookhaven National Laboratory (BSCCO) on BSCCO/Ag and various material characterization efforts taking place at the UW-ASC. Our goal is through this effort to gain a greater understanding of the effects on ac losses due to parameters such as ac/dc current, J{sub c}, tape geometry, voltage tap placement, field orientation, material anisotropy, surface irregularities, percolations and filament coupling effects. As a result, we expect to better understand how to minimize ac losses in applications requiring real or practical conductors. HTS conductors based on BSCCO-2223 are now being routinely produced in industrial lengths of high quality. Vendors such as Southwire and ASC are producing multi-filamentary tapes in lengths of 6 km or more carrying critical current densities of up to 3 kA/cm**2 at 77 K. While this is approaching the level of performance where some large-scale applications are considered to be economically viable, a number of problems remain to be solved. The remaining issues include: rapid reduction in JC in magnetic fields; and power dissipation due to varying magnetic fields or currents (ac losses).

  14. Measurements of activation reaction rate distributions on a mercury target bombarded with high-energy protons at AGS

    Energy Technology Data Exchange (ETDEWEB)

    Takada, Hiroshi; Kasugai, Yoshimi; Nakashima, Hiroshi; Ikeda, Yujiro [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment; Ino, Takashi; Kawai, Masayoshi [High Energy Accelerator Research Organization, Tsukuba, Ibaraki (Japan); Jerde, Eric; Glasgow, David [Oak Ridge National Laboratory, Oak Ridge, TN (United States)

    2000-02-01

    A neutronics experiment was carried out using a thick mercury target at the Alternating Gradient Synchrotron (AGS) facility of Brookhaven National Laboratory in a framework of the ASTE (AGS Spallation Target Experiment) collaboration. Reaction rate distributions around the target were measured by the activation technique at incident proton energies of 1.6, 12 and 24 GeV. Various activation detectors such as the {sup 115}In(n,n'){sup 115m}In, {sup 93}Nb(n,2n){sup 92m}Nb, and {sup 209}Bi(n,xn) reactions with threshold energies ranging from 0.3 to 70.5 MeV were employed to obtain the reaction rate data for estimating spallation source neutron characteristics of the mercury target. It was found from the measured {sup 115}In(n,n'){sup 115m}In reaction rate distribution that the number of leakage neutrons becomes maximum at about 11 cm from the top of hemisphere of the mercury target for the 1.6-GeV proton incidence and the peak position moves towards forward direction with increase of the incident proton energy. The similar result was observed in the reaction rate distributions of other activation detectors. The experimental procedures and a full set of experimental data in numerical form are summarized in this report. (author)

  15. Synthesis, morphological control, and antibacterial properties of hollow/solid Ag2S/Ag heterodimers

    KAUST Repository

    Pang, Maolin

    2010-08-11

    Ag2S and Ag are important functional materials that have received considerable research interest in recent years. In this work, we develop a solution-based synthetic method to combine these two materials into hollow/solid Ag2S/Ag heterodimers at room temperature. Starting from monodisperse Cu2O solid spheres, CuS hollow spheres can be converted from Cu2O through a modified Kirkendall process, and the obtained CuS can then be used as a solid precursor for preparation of the Ag2S/Ag heterodimers through ion exchange and photo-assisted reduction. We have found that formation of the Ag2S/Ag heterodimers is instantaneous, and the size of Ag nanocrystals on the hollow spheres of Ag2S can be controlled by changing the concentration and power of reducing agents in the synthesis. The growth of Ag nanoparticles on hollow spheres of Ag2S in the dimers is along the [111] direction of the silver crystal; the light absorption properties have also been investigated. Furthermore, coupling or tripling of Ag2S/Ag heterodimers into dumbbell-like trimers ((Ag 2S)2/Ag, linear) and triangular tetramers ((Ag 2S)3/Ag, coplanar) can also be attained at 60°C by adding the bidentate ligand ethylenediamine as a cross-linking agent. To test the applicability of this highly asymmetric dipolar composite, photocatalytic inactivation of Escherichia coli K-12 in the presence of the as-prepared Ag 2S/Ag heterodimers has been carried out under UV irradiation. The added Ag2S/Ag heterodimers show good chemical stability under prolonged UV irradiation, and no appreciable solid dissolution is found. Possible mechanisms regarding the enhanced antibacterial activity have also been addressed. © 2010 American Chemical Society.

  16. AGS experiments, 1988, 1989, 1990

    Energy Technology Data Exchange (ETDEWEB)

    Depken, J.C.

    1991-04-01

    This report contains: experimental areas layout; table of beam parameters and fluxes; experiment schedule as run''; experiment long range schedule; a listing of experiments by number; two-page summaries of each experiment begin here, also ordered by number; publications of AGS experiments; and list of experimenters.

  17. AGS experiments: 1985, 1986, 1987

    Energy Technology Data Exchange (ETDEWEB)

    Depken, J.C.

    1987-01-01

    This report contains: Experimental areas layout, table of beam parameters and fluxes, experiment schedule ''as run,'' experiment long range schedule, a listing of experiments by number, two-page summaries of each experiment, also ordered by number, and publications of AGS experiments, 1982-1987.

  18. AGS experiments: 1990, 1991, 1992. Ninth edition

    Energy Technology Data Exchange (ETDEWEB)

    Depken, J.C.

    1993-04-01

    This report contains a description of the following: AGS Experimental Area - High Energy Physics FY 1993 and Heavy Ion Physics FY 1993; Table of Beam Parameters and Fluxes; Experiment Schedule ``as run``; Proposed 1993 Schedule; A listing of experiments by number; Two-page summaries of each experiment begin here, also ordered by number; Publications of AGS Experiments; and List of AGS Experimenters.

  19. Periodic Structures Formed by Ag Nanoparticles in AgCl-Ag Film Waveguides Exposed to Violet Laser Light

    Science.gov (United States)

    Ageev, L. A.; Miloslavsky, V. K.; Makovetsky, E. D.; Volosenko, V. M.

    2013-07-01

    Periodic structures with a period d ≈ 266 nm owing to excitation of waveguide modes are produced in a thin film AgCl-Ag composition by normally incident linearly polarized light from a semiconductor laser (λ ≈ 407 nm). The grooves in the periodic structure are formed by Ag nanoparticles oriented along the polarization direction E 0. Dichroism with a gap at the laser wavelength is observed in absorption spectra of these films measured in polarized light. The dichroism is retained after chemical removal of the AgCl from the AgCl-Ag film. It is found that the absorption gap is related to conversion of the plasmon energy into the energy of a waveguide mode, while the dichroism is attributable to anisotropic absorption of the light by Ag nanoparticles distributed in the grooves of the periodic structures.

  20. Novel AgCl/Ag/AgFeO2 Z-scheme heterostructure photocatalyst with enhanced photocatalytic and stability under visible light

    Science.gov (United States)

    Song, Zhe; He, Yiqiang

    2017-10-01

    A new AgCl/Ag/AgFeO2 composite was synthesized for the first time via a simple precipitation method. The very detailed characterizations were enforced in photocatalytic activity and stability. The photocatalytic performance was studied by the degradation of the rhodamine B (RhB, a cationic dye) under visible irradiation. The as-prepared AgCl/Ag/AgFeO2 photocatalyst exhibited excellent photocatalytic activity and stability under the visible light region compared to pure AgCl and AgFeO2. About 97.47% of RhB can be removed in 60 min by the optimized AgCl/Ag/AgFeO2 composite, which was ∼2.26 and ∼10.83 times as fast as that pure AgCl and pure AgFeO2. After three cycles visible light irradiation experiments found that degradation rate of RhB reached 76.35%, which was still higher than pure AgCl and AgFeO2. The obviously enhanced photocatalytic activity of AgCl/Ag/AgFeO2 composites can be attributed to the efficient separation of electron-hole pairs of the Z-scheme heterostructure between AgCl, Ag and AgFeO2. In this study, we also found the superoxide radicals (rad O2-) was considered to be the dominant active radical in the degradation of dye.

  1. Hierarchically plasmonic photocatalysts of Ag/AgCl nanocrystals coupled with single-crystalline WO₃ nanoplates.

    Science.gov (United States)

    Chen, Deliang; Li, Tao; Chen, Qianqian; Gao, Jiabing; Fan, Bingbing; Li, Jian; Li, Xinjian; Zhang, Rui; Sun, Jing; Gao, Lian

    2012-09-07

    The hierarchical photocatalysts of Ag/AgCl@plate-WO₃ have been synthesized by anchoring Ag/AgCl nanocrystals on the surfaces of single-crystalline WO₃ nanoplates that were obtained via an intercalation and topochemical approach. The heterogeneous precipitation process of the PVP-Ag⁺-WO₃ suspensions with a Cl⁻ solution added drop-wise was developed to synthesize AgCl@WO₃ composites, which were then photoreduced to form Ag/AgCl@WO₃ nanostructures in situ. WO₃ nanocrystals with various shapes (i.e., nanoplates, nanorods, and nanoparticles) were used as the substrates to synthesize Ag/AgCl@WO₃ photocatalysts, and the effects of the WO₃ contents and photoreduction times on their visible-light-driven photocatalytic performance were investigated. The techniques of TEM, SEM, XPS, EDS, XRD, N₂ adsorption-desorption and UV-vis DR spectra were used to characterize the compositions, phases and microstructures of the samples. The RhB aqueous solutions were used as the model system to estimate the photocatalytic performance of the as-obtained Ag/AgCl@WO₃ nanostructures under visible light (λ ≥ 420 nm) and sunlight. The results indicated that the hierarchical Ag/AgCl@plate-WO₃ photocatalyst has a higher photodegradation rate than Ag/AgCl, AgCl, AgCl@WO₃ and TiO₂ (P25). The contents and morphologies of the WO₃ substrates in the Ag/AgCl@plate-WO₃ photocatalysts have important effects on their photocatalytic performance. The related mechanisms for the enhancement in visible-light-driven photodegradation of RhB molecules were analyzed.

  2. Thermochemical properties of silver tellurides including empressite (AgTe) and phase diagrams for Ag-Te and Ag-Te-O

    Science.gov (United States)

    Voronin, Mikhail V.; Osadchii, Evgeniy G.; Brichkina, Ekaterina A.

    2017-10-01

    This study compiles original experimental and literature data on the thermodynamic properties (ΔfG°, S°, ΔfH°) of silver tellurides (α-Ag2Te, β-Ag2Te, Ag1.9Te, Ag5Te3, AgTe) obtained by the method of solid-state galvanic cell with the RbAg4I5 and AgI solid electrolytes. The thermodynamic data for empressite (AgTe, pure fraction from Empress Josephine Mine, Colorado USA) have been obtained for the first time by the electrochemical experiment with the virtual reaction Ag + Te = AgTe. The Ag-Te phase diagrams in the T - x and log fTe2 (gas) - 1/ T coordinates have been refined, and the ternary Ag-Te-O diagrams with Ag-Te-TeO2 (paratellurite) composition range have been calculated.

  3. Effects of Ag nanoshape and AgGa phase in Ag-Si nanostructure using 2-step etching process

    Energy Technology Data Exchange (ETDEWEB)

    Hu, Zhan-Shuo [Institute of Electro-Optical Science and Engineering, Center for Micro/Nano Science and Technology, National Cheng Kung University, Tainan 701, Taiwan (China); Hung, Fei-Yi, E-mail: fyhung@mail.mse.ncku.edu.tw [Institute of Nanotechnology and Microsystems Engineering, Center for Micro/Nano Science and Technology, National Cheng Kung University, Tainan 701, Taiwan (China); Chang, Shoou-Jinn, E-mail: changsj@mail.ncku.edu.tw [Institute of Electro-Optical Science and Engineering, Center for Micro/Nano Science and Technology, National Cheng Kung University, Tainan 701, Taiwan (China); Institute of Microelectronics and Department of Electrical Engineering, Center for Micr/Nano Science and Technology, National Cheng Kung University, Tainan 701, Taiwan (China); Chen, Kuan-Jen [Institute of Microelectronics, National Cheng Kung University, Tainan 701, Taiwan (China); Wang, Wen-Long [Institute of Nanotechnology and Microsystems Engineering, Center for Micro/Nano Science and Technology, National Cheng Kung University, Tainan 701, Taiwan (China); Young, Sheng-Joue; Chen, Tse-Pu [Institute of Microelectronics, National Cheng Kung University, Tainan 701, Taiwan (China)

    2011-01-21

    Research highlights: > In order to connect biotechnology and semiconductor fabrication, the two step DWE (dry-wet etching, DWE) of Si nanohollow structure needs a development. Because the DWE is a new material process, its mechanism has still not been examined, and in particular the redox reaction and the effect of sidewalls. The present nanostructures and results have been obtained by an advanced method, and 15-30 nm Ag nano-particles were able to enhance the DWE mechanism in the Ag/Si nanostructures. - Abstract: The etching scale was controled by the layball process and a focus ion beam (FIB) was used to investige the dry-wet etching (DWE) mechanism. Increasing the beam current of dry-etching raised the height of nano prominent structures, but deteriorated the interface of Ag/Si film, and even damaged the Ag film because of Ga{sup +} bombardment. Regardless of the Ag nanoshape deposition, the residual Ag films were doped with Ga{sup +} and were sensitive to DWE. After wet-etching, the nano hollow formed and the Ag films sunk. However, AgGa sidewall films formed by the concentration gradient and the oxidative potential and this increased the volume of microporous phases, resulting in a reduction in the depth. Also, 15-30 nm Ag nano-particles were able to enhance the DWE mechanism in the Ag/Si nanostructures.

  4. Plasmonic Ag{sub 2}MoO{sub 4}/AgBr/Ag composite: Excellent photocatalytic performance and possible photocatalytic mechanism

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Zhongliao [College of Physics and Electronic Information, Anhui Key Laboratory of Energetic Materials, Huaibei Normal University, Huaibei, 235000 (China); Zhang, Jinfeng, E-mail: zjf_y2004@126.com [College of Physics and Electronic Information, Anhui Key Laboratory of Energetic Materials, Huaibei Normal University, Huaibei, 235000 (China); Lv, Jiali [College of Physics and Electronic Information, Anhui Key Laboratory of Energetic Materials, Huaibei Normal University, Huaibei, 235000 (China); Dai, Kai, E-mail: daikai940@chnu.edu.cn [College of Physics and Electronic Information, Anhui Key Laboratory of Energetic Materials, Huaibei Normal University, Huaibei, 235000 (China); Liang, Changhao [College of Physics and Electronic Information, Anhui Key Laboratory of Energetic Materials, Huaibei Normal University, Huaibei, 235000 (China); Key Laboratory of Materials Physics and Anhui Key Laboratory of Nanomaterials and Nanotechnology, Institute of Solid State Physics, Chinese Academy of Sciences, Hefei, 230031 (China)

    2017-02-28

    Highlights: • Novel Ag{sub 2}MoO{sub 4}/AgBr/Ag photocatalyst was prepared. • Ag{sub 2}MoO{sub 4}/AgBr/Ag showed high photocatalytic activity. • Ag{sub 2}MoO{sub 4}/AgBr/Ag showed long reusable life. - Abstract: Plasmonic Ag{sub 2}MoO{sub 4}/AgBr/Ag composite is fabricated by in-situ ion exchange and reduction methods at room temperature. The samples are characterized by X-ray diffraction (XRD), UV–vis diffuse reflectance (DRS), energy-dispersive X-ray spectroscopy (EDS), scanning electron microscope (SEM) and photoluminescence (PL) measurements. The results show that butterfly-like Ag{sub 2}MoO{sub 4} nanosheets served as the precursor, and Ag{sub 2}MoO{sub 4}/AgBr/Ag is formed in phase transformation with MoO{sub 4}{sup 2−} displaced by Br{sup −}. The ternary Ag{sub 2}MoO{sub 4}/AgBr/Ag composite photocatalysts show greatly enhanced photocatalytic activity in photodegrading methylene blue (MB) under visible light irradiation compared with AgBr and Ag{sub 2}MoO{sub 4}. The pseudo-first-order rate constant k{sub app} of Ag{sub 2}MoO{sub 4}/AgBr/Ag is 0.602 min{sup −1}, which is 11.6 and 18.3 times as high as that of AgBr and Ag{sub 2}MoO{sub 4}, respectively. Meanwhile, the efficiency of degradation still kept 90% after ten times cyclic experiments. Eventually, possible photocatalytic mechanism was proposed.

  5. Enhancing the ag precipitation by surface mechanical attrition treatment on Cu-Ag alloys

    Science.gov (United States)

    Liu, Jiabin; Zhang, Lehao; Liu, Jingjing; Huang, Liuyi; Gu, Hao; Fang, Youtong; Meng, Liang; Zhang, Jian

    2016-09-01

    The influence of surface mechanical attrition treatment (SMAT) on Ag precipitation in Cu-Ag alloys was investigated. Cu-6 wt% Ag was melt, cold rolled and solution treated to be Cu-Ag solid solution, which was either aged at 250 and 350 °C for 24 h directly or SMAT-ed before aging. Ag precipitates were hard be found in the directly aged Cu-Ag sample while they were observed clearly in the SMAT-ed counterpart at 250 °C. The Ag precipitates formed in the surface layer by SMAT are much coarser than those in the un-SMAT-ed sample. It is obvious that the precipitating behavior of Ag was promoted significantly by SMAT approach. A large number of defects were generated by SMAT and they were acting as fast atomic diffusion channels that facilitated the atomic diffusion of Ag.

  6. Deteksi HBsAg dan HBeAg dalam Saliva Pengidap Virus Hepatitis B

    Directory of Open Access Journals (Sweden)

    Riemawati A. Lesmana

    2015-10-01

    Full Text Available Transmission of hepatitis B virus (HBV via blood or its product has been well established. However, body fluids like urine and saliva may also contain HBV. A complete HBV consists of HBsAg, HBeAg, HBcAg dan partikel DNA. Hepatitis B carrier is detected by the presence of serologic marker HBsAg while the ongoing viral replication or infectivity is diagnosed by the presence of HBeAg or DNA particle. Meanwhile dentists will often contact with the saliva of their patients in daily practice. This cross-sectional study was carried out to assess the infectivity of the saliva of HBV carriers. During a 10 month period (August 1994 - May 1995 detection of HBsAg and HBeAg in blood and saliva were done in 97 HBV carriers using the ELISA method (Enzyme Linked Immunosorbent Assay. Of 97 HBV carriers both positive gor HBsAG in blood were found 56 (Group I and positive HBsAg and negativa HBeAg in the other 41 (Group II. Examination of the saliva of HBV carriers in Group I showed positive HBsAg as well as HBeAg in 48 (85,7%, only positive for HBsAg in 5 (10,7% and both negative for HBsAg and HBeAg in the other 2 (3,6% where as in Group II positive for both HBsAg and HBeAG in the remaining 10 (24,4%. In conclusion, the majority of highly infectious hepatitis B carriers do also have infectious saliva which could be an important source of infection and transmission of the virus in the field of dentistry.

  7. As-synthesis of nanostructure AgCl/Ag/MCM-41 composite.

    Science.gov (United States)

    Sohrabnezhad, Sh; Pourahmad, A

    2012-02-01

    In this work, we present the simple synthetic route for silver chloride/silver nanoparticles (AgCl/Ag-NPs) using as-synthesis method. The structure, composition and optical properties of such material were investigated by transmission electron microscopy (TEM), UV-visible diffuse reflectance spectroscopy (UV-vis DRS), X-ray diffraction (XRD) and FTIR. Powder X-ray diffraction showed that when AgNO(3) content is below 0.1 wt.% in synthetic gel, the guest AgCl/Ag-NPs is formed on the silica channel wall, and lower exists in the crystalline state. When AgNO(3) content exceeds this value, AgCl/Ag nanoparticles can be observed in high crystalline state. The absorption at 327 nm ascribed to the characteristic absorption of the AgCl semiconductor. Ag nanoparticles have been shown to exist in the nanocomposite at 375 nm. When AgNO(3) content is above 0.1 wt.% in synthetic gel, spectra exhibited stronger absorption at 450-700 nm that was attributed to the surface plasmonic resonance of silver nanoparticles. The obtained AgCl/Ag/MCM-41 sample exhibit enhanced photocatalytic activity for the degradation of methylene blue under visible-light irradiation. Copyright © 2011 Elsevier B.V. All rights reserved.

  8. Demixing processes in AgPd superlattices

    Energy Technology Data Exchange (ETDEWEB)

    Dumont, J; Sporken, R [Laboratoire de Physique des Materiaux Electroniques (LPME), Facultes Universitaires Notre-Dame de la Paix, Namur, B-5000 (Belgium); Verstraete, M J; Gonze, X [ETSF and Unite de Physico-Chimie et de Physique des Materiaux (PCPM), Universite Catholique de Louvain, 1 Croix du Sud, B-1348 Louvain-la-Neuve (Belgium); Ghijsen, J [Laboratoire Interdisciplinaire de Spectroscopie Electronique (LISE), Facultes Universitaires Notre-Dame de la Paix, Namur, B-5000 (Belgium)

    2009-08-05

    The present scanning tunneling microscopy (STM) study describes the growth of silver-palladium heterostructures at room temperature, with ab initio simulations of ordered AgPd phases supporting the interpretation of STM images. First, the growth of Pd on an Ag(111) surface proceeds in a multilayer mode, leading to the formation of a columnar structure. Then, upon Ag deposition on this structure, Ag and Pd partially mix and form a two-dimensional AgPd alloy on top of the columns. Finally, an atomically flat Ag(111) surface is restored, and two-dimensional growth continues. An interpretation of this peculiar growth mode including interfacial alloying is proposed based on thermodynamic and kinetic arguments.

  9. Ag nanoprisms with Ag₂S attachment.

    KAUST Repository

    Xiong, Shenglin

    2013-01-01

    Triangular Ag nanoprisms are a type of most-studied noble-metal nanostructures over the past decade owing to their special structural architecture and outstanding optical and catalytic properties for a wide range of applications. Nevertheless, in contrast to active research for the synthesis of phase-pure Ag nanoprisms, no asymmetric heterodimers containing Ag prisms have been developed so far, probably due to lack of suitable synthetic methods. Herein, we devise a simple ion-exchange method to synthesize Ag2S/Ag heterodimers at room temperature, through which Ag nanoprisms with controllable size and thickness can be fabricated. Formation chemistry and optical properties of the heterodimers have been investigated. These semiconductor/metal heterodimers have exhibited remarkable bactericidal activity to E. coli cells under visible light illumination.

  10. Half-life determination for 108Ag and 110Ag

    Science.gov (United States)

    Zahn, Guilherme S.; Genezini, Frederico A.

    2014-11-01

    In this work, the half-life of the short-lived silver radionuclides 108Ag and 110Ag were measured by following the activity of samples after they were irradiated in the IEA-R1 reactor. The results were then fitted using a non-paralizable dead time correction to the regular exponential decay and the individual half-life values obtained were then analyzed using both the Normalized Residuals and the Rajeval techniques, in order to reach the most exact and precise final values. To check the validity of dead-time correction, a second correction method was also employed by means of counting a long-lived 60Co radioactive source together with the samples as a livetime chronometer. The final half-live values obtained using both dead-time correction methods were in good agreement, showing that the correction was properly assessed. The results obtained are partially compatible with the literature values, but with a lower uncertainty, and allow a discussion on the last ENSDF compilations' values.

  11. Transformation from Ag@Ag3PO4 to Ag@Ag2SO4 hybrid at room temperature: preparation and its visible light photocatalytic activity

    Science.gov (United States)

    Wei, Ting; Gao, Shanmin; Wang, Qingyao; Xu, Hui; Wang, Zeyan; Huang, Baibiao; Dai, Ying

    2017-02-01

    In the present study, Ag/Ag2SO4 hybrid photocatalysts were obtained via a facile redox-precipitation reaction approach by using Ag@Ag3PO4 nanocomposite as the precursor and KMnO4 as the oxidant. Multiple techniques, such as X-ray diffraction pattern (XRD), transmission electron microscope (TEM), high-resolution transmission electron microscopy (HRTEM), X-ray photoelectron spectroscopy (XPS), UV-vis diffuse reflectance spectroscopy (DRS) and Brunauer-Emmett-Teller (BET), photocurrent and electrochemical impedance spectroscopy (EIS), were applied to investigate the structures, morphologies, optical, and electronic properties of as-prepared samples. The photocatalytic activities were evaluated by photodegradation of organic rhodamine B (RhB) and methyl orange (MO) under visible light irradiation. It was found that pure Ag2SO4 can partially transform into metallic Ag during the photocatalytic degradation of organic pollutants, but the Ag/Ag2SO4 hybrids can maintain its structure stability and show enhanced visible light photocatalytic activity because of the surface plasma resonance effect of the metallic Ag.

  12. AgRP Neurons Regulate Bone Mass

    Directory of Open Access Journals (Sweden)

    Jae Geun Kim

    2015-10-01

    Full Text Available The hypothalamus has been implicated in skeletal metabolism. Whether hunger-promoting neurons of the arcuate nucleus impact the bone is not known. We generated multiple lines of mice to affect AgRP neuronal circuit integrity. We found that mice with Ucp2 gene deletion, in which AgRP neuronal function was impaired, were osteopenic. This phenotype was rescued by cell-selective reactivation of Ucp2 in AgRP neurons. When the AgRP circuitry was impaired by early postnatal deletion of AgRP neurons or by cell autonomous deletion of Sirt1 (AgRP-Sirt1−/−, mice also developed reduced bone mass. No impact of leptin receptor deletion in AgRP neurons was found on bone homeostasis. Suppression of sympathetic tone in AgRP-Sirt1−/− mice reversed osteopenia in transgenic animals. Taken together, these observations establish a significant regulatory role for AgRP neurons in skeletal bone metabolism independent of leptin action.

  13. Synthesis of Cu-Ag@Ag particles using hyperbranched polyester as template

    Science.gov (United States)

    Han, Wen-Song

    2015-07-01

    In this manuscript, the third-generation hyperbranched polyester was synthesized with 2, 2-dimethylol propionic acid as AB2 monomer and pentaerythrite as core molecule by using step by step polymerization process at first. Then, the Cu-Ag particles were prepared by co-reduction of silver nitrate and copper nitrate with ascorbic acid in the aqueous solution using hyperbranched polyester as template. Finally, the Cu-Ag@Ag particles were prepared by coating silver on the surface of Cu-Ag particles by reduction of silver nitrate. The synthesized hyperbranched polyester and Cu-Ag@Ag particles were characterized by Fourier transform infrared (FT-IR) spectroscopy, UV-vis spectra, x-ray diffraction, Laser light scattering, thermogravimetric analysis (TGA) and SEM. UV-vis spectra results showed that the Cu-Ag@Ag particles had a strong absorption band at around 420 nm. Laser light scattering and SEM studies confirmed that the most frequent particle sizes of Cu-Ag@Ag particles were 1.2 um. TGA results indicated that the Cu-Ag@Ag particles had good thermal stability. [Figure not available: see fulltext.

  14. Evolution of AgX nanowires into Ag derivative nano/microtubes for highly efficient visible-light photocatalysts.

    Science.gov (United States)

    Choi, Won San; Byun, Gyo Yeon; Bae, Tae Sung; Lee, Ha-Jin

    2013-11-13

    Our study proposes a novel strategy for the synthesis of Ag derivatives (AgX@Ag (X = Cl and Br) or Ag nano/microtubes) using the controlled chemical reduction or electron-beam irradiation of AgX nanowires (NWs), which are formed from the controlled dewetting of a AgX thin film on colloidal particles. The size of the AgX@Ag and Ag nano/microtubes can be controlled using the AgCl NWs as templates and varying the concentration of NaX. By controlling the concentration of NaBr, heterojunction-structured AgCl/AgBr NWs (H-AgCl/AgBr NWs) can be produced from the AgCl NWs due to a partial ion-exchange reaction (low concentration), and the AgBr NWs produced after a complete ion-exchange reaction between Cl- and Br- are further grown into micrometer-sized AgBr wires (high concentration). The resulting AgX NWs can be transformed into corresponding AgX@Ag or Ag nano/microtubes via a controlled chemical or physical method. The AgX derivatives (AgX@Ag nanotubes (NTs) and AgX NWs) are tested as visible-light-induced photocatalysts for decomposition of methyl orange. The AgX@Ag NTs exhibit the best photocatalytic activities due to the advantages of the core@shell structure, allowing multiple reflections of visible light within the interior cavity, providing a well-defined and clean Ag/AgX interface, and preventing direct adsorption of pollutants on AgX because of the shell structure. These advantages allow AgX@Ag NTs to maintain high catalytic performance even after multiple uses. The approach can also be used as a direct method for preparing Ag nano/microtubes with a tailored size and as a new method for incorporating a AgX NW core into a Ag nano/microtube shell. Our approach is useful for synthesizing various types of one-dimensional heterostructured NWs or metal NTs with controlled structures and properties.

  15. Kinetics of Ag-rich precipitates formation in Cu-Al-Ag alloys

    Energy Technology Data Exchange (ETDEWEB)

    Adorno, A.T.; Guerreiro, M.R.; Silva, R.A.G

    2004-06-15

    The kinetics of Ag-rich precipitates formation in the Cu-2 wt.% Al alloy with additions of 2, 4, 6, 8, 10 and 12 wt.% Ag was studied using microhardness changes with temperature and time, differential scanning calorimetry (DSC), differential thermal analysis (DTA), scanning electron microscopy (SEM), optical microscopy (OM), energy dispersive X-ray analysis (EDX) and X-ray diffractometry (XRD). The results indicated that an increase in the Ag content decreases the activation energy for Ag-rich precipitates formation, and that it is possible to estimate the values of the diffusion and nucleation activation energies for the Ag precipitates.

  16. Report on summary results of the inspection of issues regarding the scope of the accident investigation of the TRISTAN Fire at the Brookhaven National Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-03-01

    The subject final report is provided to inform you of our findings and recommendations concerning our review of issues regarding the scope of the accident investigation of a March 31, 1994, fire at the Terrific Reactor Isotope Separator To Analyze Nuclides (TRISTAN) experiment at the Department of Energy (DOE) Brookhaven National Laboratory (BNL), Upton, New York. The Chicago Operations Office (CH) Manager appointed a Type B Accident Investigation Board (Board) to investigate the fire. In a June 16, 1994, letter to the Inspector General, DOE, the CH Manager requested the Inspector General to look into an allegation by a former Board member that senior Chicago management consciously violated the requirements of DOE Order 5484.1, {open_quotes}Environmental Protection, Safety, And Health Protection Information Reporting Requirements,{close_quotes} in attempting to control the investigation. The former Board member alleged that there was not a clear verbal agreement among the Board members regarding the focus of the scope of the investigation. He said that the Board Chairman wanted to focus on the physical causes of the fire, while he (the former Board member) believed that the Board should focus on the apparent management deficiencies that allowed TRISTAN to operate without a proper safety analysis and in violation of DOE orders for so many years.

  17. A Fast, Versatile Nanoprobe for Complex Materials: The Sub-micron Resolution X-ray Spectroscopy Beamline at NSLS-II (491st Brookhaven Lecture)

    Energy Technology Data Exchange (ETDEWEB)

    Thieme, Juergen [BNL Photon Sciences Directorate

    2014-02-06

    Time is money and for scientists who need to collect data at research facilities like Brookhaven Lab’s National Synchrotron Light Source (NSLS), “beamtime” can be a precious commodity. While scanning a complex material with a specific technique and standard equipment today would take days to complete, researchers preparing to use brighter x-rays and the new sub-micron-resolution x-ray spectroscopy (SRX) beamline at the National Synchrotron Light Source II (NSLS-II) could scan the same sample in greater detail with just a few hours of beamtime. Talk about savings and new opportunities for researchers! Users will rely on these tools for locating trace elements in contaminated soils, developing processes for nanoparticles to deliver medical treatments, and much more. Dr. Thieme explains benefits for next-generation research with spectroscopy and more intense x-rays at NSLS-II. He discusses the instrumentation, features, and uses for the new SRX beamline, highlighting its speed, adjustability, and versatility for probing samples ranging in size from millimeters down to the nanoscale. He will talk about complementary beamlines being developed for additional capabilities at NSLS-II as well.

  18. Direct electrospinning of Ag/polyvinylpyrrolidone nanocables

    DEFF Research Database (Denmark)

    Song, Jie; Chen, Menglin; Havelund, Rasmus

    2011-01-01

    Core-sheath silver nanowire/polyvinylpyrrolidone (AgNW/PVP) nanocables have been fabricated via an efficient single-spinneret electrospinning method. The core-sheath structure is revealed by combining several characterization methods. A possible formation mechanism of the AgNW/PVP nanocable...

  19. AgCl/Ag3PO4: A stable Ag-Based nanocomposite photocatalyst with enhanced photocatalytic activity for the degradation of parabens.

    Science.gov (United States)

    Guo, Jianhao; Shi, Huixian; Huang, Xiaobo; Shi, Huifang; An, Zhongfu

    2018-04-01

    An AgCl/Ag 3 PO 4 composite has been successfully fabricated by a simple desorption-precipitation method. Scanning electron microscopy (SEM), transmission electron microscopy (TEM), X-ray diffraction (XRD), X-ray photoelectron spectroscopy (XPS), ultraviolet-visible spectroscopy (UV/Vis), and photoluminescence (PL) have been used to study the structural and physicochemical characteristics of the AgCl/Ag 3 PO 4 composite. The photocatalytic activity of the AgCl/Ag 3 PO 4 composite has been tested by the degradation of parabens under visible-light irradiation. 100% of MPB was degraded within 40 min in the AgCl/Ag 3 PO 4 -visible light system. Moreover, the photocatalytic activity of AgCl/Ag 3 PO 4 remained at 94% of the original level after five runs, which was much higher than that of pure Ag 3 PO 4 (25%). The obtained results confirmed that the AgCl/Ag 3 PO 4 composite exhibited significantly higher photocatalytic performance and improved stability compared with bare Ag 3 PO 4 . The enhanced photocatalytic performance of the AgCl/Ag 3 PO 4 composite could be mainly attributed to highly efficient charge separation through a synergistic effect of AgCl, Ag 3 PO 4 , and in situ photo-reduced Ag nanoparticles. Trapping experiments confirmed h + and ·O 2 - to be the two main active species in the photocatalytic process. Finally, a possible photocatalytic mechanism for the charge-transfer process is proposed to account for the enhanced photocatalytic performance of the AgCl/Ag 3 PO 4 composite. Copyright © 2018 Elsevier Inc. All rights reserved.

  20. Visible light driven photocatalysis and antibacterial activity of AgVO{sub 3} and Ag/AgVO{sub 3} nanowires

    Energy Technology Data Exchange (ETDEWEB)

    Singh, Anamika [Department of Life Sciences, University of Mumbai, Santacruz (E), Mumbai 400 098 (India); Dutta, Dimple P., E-mail: dimpled@barc.gov.in [Chemistry Division, Bhabha Atomic Research Centre, Mumbai 400 085 (India); Ballal, A. [Molecular Biology Division, Bhabha Atomic Research Centre, Mumbai 400 085 (India); Tyagi, A.K. [Chemistry Division, Bhabha Atomic Research Centre, Mumbai 400 085 (India); Fulekar, M.H. [School of Environment and Sustainable Development, Central University of Gujarat, Gandhinagar 382 030, Gujarat (India)

    2014-03-01

    Graphical abstract: - Highlights: • Ag/AgVO{sub 3} and pure AgVO{sub 3} nanowires synthesized by sonochemical process. • Characterization done using XRD, SEM, TEM, EDX and BET analysis. • Visible light degradation of RhB by Ag/AgVO{sub 3} within 45 min. • Antibacterial activity of Ag/AgVO{sub 3} demonstrated. - Abstract: Ag/AgVO{sub 3} nanowires and AgVO{sub 3} nanorods were synthesized in aqueous media via a facile sonochemical route. The as-synthesized products were characterized by X-ray diffraction, Brunauer–Emmett–Teller surface area analysis, scanning electron microscopy together with an energy dispersion X-ray spectrum analysis, transmission electron microscopy and UV–vis diffuse reflectance spectroscopy. The results revealed that inert atmosphere promotes the formation of Ag/AgVO{sub 3} nanowires. The photocatalytic studies revealed that the Ag/AgVO{sub 3} nanowires exhibited complete photocatalytic degradation of Rhodamine B within 45 min under visible light irradiation. The antibacterial activity of Ag/AgVO{sub 3} nanowires was tested against Escherechia coli and Bacillus subtilis. The minimum growth inhibitory concentration value was found to be 50 and 10 folds lower than for the antibiotic ciprofloxacin for E. coli and B. subtilis, respectively. The antibacterial properties of the β-AgVO{sub 3} nanorods prove that in case of the Ag dispersed Ag/AgVO{sub 3} nanowires, the enhanced antibacterial action is also due to contribution from the AgVO{sub 3} support.

  1. Preparation and Characterization of γ-AgI in Superionic Composite Glasses (AgIx(AgPO31-x

    Directory of Open Access Journals (Sweden)

    S. Suminta

    2007-07-01

    Full Text Available The γ-AgI phase was stabilized at room temperature in the composites glasses (AgIx(AgPO31-x with x = 0.6 and 0.7 via rapid quenching of their molten mixture. The measurement of the crystal structure has been carried out using an X-ray Difractometer at the Physics Departement of Ibaraki University, Japan. The micro strain and crystal size are derived from Hall’s equation. The X-ray diffraction pattern shows some Bragg peaks that correspond to the crystalline γ-AgI. By increasing the concentration of AgI, the peak width becomes more narrow and the position shifts to the higher angle. This indicates that the crystalline size and microstrain are increasing. The increase of micro strain (η, and particle size (D will increase the ionic mobility, thus increasing the ionic conductivity. It is concluded that solidification process on melt AgI into glass matrix AgPO3 not only decreases the micro strain and the particle size, but it also increases the ionic conductivity.

  2. Ab initio band structure calculations of the low-temperature phases of Ag2Se, Ag2Te and Ag3AuSe2

    NARCIS (Netherlands)

    Fang, C.M.; Groot, R.A. de; Wiegers, G.A.

    Ab initio band structure calculations were performed for the low-temperature modifications of the silver chalcogenides β-Ag2Se, β-Ag2Te and the ternary compound β-Ag3AuSe2 by the local spherical wave (LSW) method. Coordinates of the atoms of β-Ag2Se and β-Ag3AuSe2 were obtained from refinements

  3. Spectroscopic Study on Eu3+ Doped Borate Glasses Containing Ag Nanoparticles and Ag Aggregates.

    Science.gov (United States)

    Fu, Shaobo; Zheng, Hui; Zhang, Jinsu; Li, Xiangping; Sun, Jiashi; Hua, Ruinian; Dong, Bin; Xia, Haiping; Chen, Baojiu

    2015-01-01

    Transparent Eu(3+)-doped borate glasses containing Ag nanoparticles and Ag aggregates with composition (40 - x) CaO-59.5B2O3-0.5Eu2O3-xAgNO3 were prepared by a simple one-step melt-quenching technique. The X-ray diffraction (XRD) patterns of the glasses reveal amorphous structural properties and no diffraction peaks belonging to metal Ag particles. Ag particles and Ag aggregates were observed from the absorption spectra. Effective energy transfers from the Ag aggregates to the Eu3+ ions were observed in the excitation spectra from monitoring the intrinsic emission of Eu3+x .5D0 --> 7F2. The glasses with higher Ag content can be effectively excited by light in a wide wavelength region, indicating that these glasses have potential application in the solid state lighting driven by semiconductor light emitting diodes (LEDs). The emission spectra of the samples with higher Ag contents exhibit plenteous spectral components covering the full visible region from violet to red, thus indicating that these glass materials possess an excellent and tunable color rendering index. The color coordinates for all the glass samples were calculated by using the intensity-corrected emission spectra and the standard data issued by the CIE (Commission International de l' Eclairage) in 1931. It was found that the color coordinates for most samples with higher Ag contents fall into the white region in the color space.

  4. On the measurement of /sup 107/Ag//sup 109/Ag ratios in meteorites

    Energy Technology Data Exchange (ETDEWEB)

    Kutschera, W.; Faestermann, T.; Gillitzer, A.; Fortuna, G.

    1986-01-01

    The detection of stable Ag isotopes in meteorites at the ppB level was attempted in an AMS experiment using the Munich MP tandem accelerator in conjunction with a time-of-flight detection system. The sensitivity of detecting Ag at this level was established by observing a counting rate of 17 ions of /sup 107/Ag per sec from a Au sample, which had been spiked with the radioisotope /sup 105/Ag (T/sub 1/2/ = 41 d) at a concentration of 1.0 ppB. A blank Ta sample gave no /sup 105/Ag counts in 13 min, which corresponds to a detection limit of 7.5 x 10/sup -5/ ppB. Although this sensitivity was clearly sufficient to perform /sup 107/Ag and /sup 109/Ag measurements in the desired concentration range, experiments with these isotopes were hampered by a currently irreducable background of stable Ag in the ppM range, possibly originating from the ion source itself. Indications of extraordinarily high Ag concentrations, far above this background, were observed in some of the investigated meteorites, but conclusions on their actual existence must await a better understanding of the origin of the general Ag background. 10 refs., 4 figs., 3 tabs.

  5. Quantum interference effects in nanostructured Ag

    Science.gov (United States)

    Pratumpong, P.; Cochrane, R.; Howson, M. A.; Busmann, H.-G.

    2000-02-01

    We present results for the measured low temperature magnetoresistance of nanostructured Ag produced by inert gas phase condensation. The Ag particles are typically between 2 and 100 nm in diameter and the material is in the form a network of chains of particles. The magnetoresistance is negative and consistent with the presence of quantum interference effects similar to that seen in disordered metals. From the field dependence of the resistance we can infer characteristic length scales associated with the network of connected Ag particles.

  6. Hierarchically plasmonic photocatalysts of Ag/AgCl nanocrystals coupled with single-crystalline WO3 nanoplates

    Science.gov (United States)

    Chen, Deliang; Li, Tao; Chen, Qianqian; Gao, Jiabing; Fan, Bingbing; Li, Jian; Li, Xinjian; Zhang, Rui; Sun, Jing; Gao, Lian

    2012-08-01

    The hierarchical photocatalysts of Ag/AgCl@plate-WO3 have been synthesized by anchoring Ag/AgCl nanocrystals on the surfaces of single-crystalline WO3 nanoplates that were obtained via an intercalation and topochemical approach. The heterogeneous precipitation process of the PVP-Ag+-WO3 suspensions with a Cl- solution added drop-wise was developed to synthesize AgCl@WO3 composites, which were then photoreduced to form Ag/AgCl@WO3 nanostructures in situ. WO3 nanocrystals with various shapes (i.e., nanoplates, nanorods, and nanoparticles) were used as the substrates to synthesize Ag/AgCl@WO3 photocatalysts, and the effects of the WO3 contents and photoreduction times on their visible-light-driven photocatalytic performance were investigated. The techniques of TEM, SEM, XPS, EDS, XRD, N2 adsorption-desorption and UV-vis DR spectra were used to characterize the compositions, phases and microstructures of the samples. The RhB aqueous solutions were used as the model system to estimate the photocatalytic performance of the as-obtained Ag/AgCl@WO3 nanostructures under visible light (λ >= 420 nm) and sunlight. The results indicated that the hierarchical Ag/AgCl@plate-WO3 photocatalyst has a higher photodegradation rate than Ag/AgCl, AgCl, AgCl@WO3 and TiO2 (P25). The contents and morphologies of the WO3 substrates in the Ag/AgCl@plate-WO3 photocatalysts have important effects on their photocatalytic performance. The related mechanisms for the enhancement in visible-light-driven photodegradation of RhB molecules were analyzed.The hierarchical photocatalysts of Ag/AgCl@plate-WO3 have been synthesized by anchoring Ag/AgCl nanocrystals on the surfaces of single-crystalline WO3 nanoplates that were obtained via an intercalation and topochemical approach. The heterogeneous precipitation process of the PVP-Ag+-WO3 suspensions with a Cl- solution added drop-wise was developed to synthesize AgCl@WO3 composites, which were then photoreduced to form Ag/AgCl@WO3 nanostructures in

  7. Hierarchical visible-light-response Ag/AgCl@TiO2 plasmonic photocatalysts for organic dye degradation

    Science.gov (United States)

    Liu, Wentao; Chen, Deliang; Yoo, Seung Hwa; Cho, Sung Oh

    2013-10-01

    A plasmonic photocatalyst of Ag/AgCl@TiO2 nanoparticles (NPs) was directly prepared by a one-step sonochemical method. Both Ag NPs and AgCl were co-deposited on TiO2 NPs to form Ag@TiO2 and Ag/AgCl@TiO2 using the method. Due to the localized surface plasmonic effects of Ag NPs, the visible-light absorbance of the Ag/AgCl@TiO2 photocatalyst was dramatically increased and the photocatalytic activity to decompose Rhodamine B was much improved under visible light. In addition, due to the advantages of the sonochemical approach, only a very small amount of Ag is required to obtain a high photocatalytic activity in the plasmonic catalyst. The mechanism for the enhancement of the visible-light-driven photocatalytic activities was also analyzed.

  8. Ag-rich precipitates formation in the Cu–11%Al–10%Mn–3%Ag alloy

    Energy Technology Data Exchange (ETDEWEB)

    Silva, R.A.G., E-mail: galdino.ricardo@gmail.com [Departamento de Ciências Exatas e da Terra, UNIFESP, 09972-270 Diadema, SP (Brazil); Paganotti, A.; Jabase, L. [Departamento de Ciências Exatas e da Terra, UNIFESP, 09972-270 Diadema, SP (Brazil); Adorno, A.T.; Carvalho, T.M.; Santos, C.M.A. [Departamento de Físico-Química, Instituto de Química, UNESP, 14801-970 Araraquara, SP (Brazil)

    2014-12-05

    Highlights: • Cu-rich nanoprecipitates are formed in the presence of Ag. • Bainite precipitation is shifted to higher temperatures in the Cu–11%Al–10%Mn–3%Ag alloy. • The eutectoid α phase and bainite α{sub 1} phase compete by the Cu atoms during precipitation process. - Abstract: The formation of Ag-rich precipitates in the Cu–11%Al–10%Mn–3%Ag alloy initially quenched from 1123 K was analyzed. The results showed that nanoprecipitates of a Cu-rich phase are produced at about 523 K. In higher temperatures these nanoparticles grow and the relative fraction of Ag dissolved in it is increased, thus forming the Ag-rich phase.

  9. AgSat Areas of Interest

    Data.gov (United States)

    Farm Service Agency, Department of Agriculture — The AgSat Areas of Interest map contains area polygons where satellite imagery will be collected for the Farm Service Agency (FSA) to provide imagery coverage for...

  10. Lesson 3: Attorney General (AG) Certification

    Science.gov (United States)

    The AG Certification is a letter confirming legal authority to implement the electronic reporting covered by the application and enforce the affected programs using the electronic documents received under those programs.

  11. AgSat Imagery Collection Footprints

    Data.gov (United States)

    Farm Service Agency, Department of Agriculture — The AgSat Imagery Collection Footprints map shows the imagery footprints which have been collected under the USDA satellite blanket purchase agreement. Click on a...

  12. Degradation of blue and red inks by Ag/AgCl photocatalyst under UV light irradiation

    Science.gov (United States)

    Daupor, Hasan; Chenea, Asmat

    2017-08-01

    Objective of this research, cubic Ag/AgCl photocatalysts with an average particle size of 500 nm has been successfully synthesized via a modified precipitation reaction between ZrCl4 and AgNO3. Method for analysis, the crystal structure of the product was characterized by X-ray powder diffraction (XRD). The morphology and composition were studied by scanning electron microscopy (SEM), Fourier transform infrared spectroscopy (FTIR), UV-vis diffuse-reflection spectra (DRS) and so on. The result showed that the optical absorption spectrum exhibited strong absorption in the visible region around 500-600 nm due to surface plasmon resonance (SPR) of metallic silver nanoparticles. SEM micrographs showed that the obtained Ag/AgCl had cubic morphology and appeared on the porous surface as the cubic cage morphology. As a result, this porous surface also positively affected the photocatalytic reaction. The photocatalytic activity of the obtained product was evaluated by the photodegradation of blue and red ink solutions under UV light irradiation, and it was interestingly, discovered that AgCl could degrade 0.25% and 0.10% in 7 hours for blue and red inks solution respectively, Which were higher than of commercial AgCl. The result suggested that the morphology of Ag/AgCl strongly affected their photocatalytic activities. O2-, OH- reaction. radicals and Cl° atom are main species during photocatalytic reaction.

  13. Nanoporous Ag prepared from the melt-spun Cu-Ag alloys

    Science.gov (United States)

    Li, Guijing; Song, Xiaoping; Sun, Zhanbo; Yang, Shengchun; Ding, Bingjun; Yang, Sen; Yang, Zhimao; Wang, Fei

    2011-07-01

    Nanoporous Ag ribbons with different morphology and porosity were achieved by the electrochemical corrosion of the melt-spun Cu-Ag alloys. The Cu-rich phase in the alloys was removed, resulting in the formation of the nanopores distributed across the whole ribbon. It is found that the structures, morphology and porosity of the nanoporous Ag ribbons were dependent on the microstructures of the parent alloys. The most of ligaments presented a rod-like shape due to the formation of pseudoeutectic microstructure in the melt-spun Cu 55Ag 45 and Cu 70Ag 30 alloys. For nanoporous Ag prepared from Cu 85Ag 15 alloys, the ligaments were camber-like because of the appearance of the divorced microstructures. Especially, a novel bamboo-grove-like structure could be observed at the cross-section of the nanoporous Ag ribbons. The experiment reveals that nanoporous Ag ribbons exhibited excellent enhancement of surface-enhanced Raman scattering (SERS) effect, but a slight difference existed due to the discrepancy of their morphology.

  14. Synthesis and characterization of Ag/AgBrO{sub 3} photocatalyst with high photocatalytic activity

    Energy Technology Data Exchange (ETDEWEB)

    Song, Limin, E-mail: songlmnk@sohu.com [College of Environment and Chemical Engineering & State Key Laboratory of Hollow-Fiber Membrane Materials and Membrane Processes, Tianjin Polytechnic University, Tianjin, 300387 (China); Li, Tongtong [College of Environment and Chemical Engineering & State Key Laboratory of Hollow-Fiber Membrane Materials and Membrane Processes, Tianjin Polytechnic University, Tianjin, 300387 (China); Zhang, Shujuan [College of Science, Tianjin University of Science & Technology, Tianjin, 300457 (China)

    2016-10-01

    A new Ag/AgBrO{sub 3} photocatalyst was prepared by mixing aqueous solutions of AgNO{sub 3} and NaBrO{sub 3}. The catalyst’s structure and performance were investigated with X-ray powder diffraction, transmission electron microscopy, and X-ray photoelectron spectroscopy. The UV–vis absorption spectrum of Ag/AgBrO{sub 3} exhibits a band gap of 3.97 eV. The results show that the Ag/AgBrO{sub 3} semiconductor can be excited by ultraviolet–visible light. The photodegradation of Rhodamine B displayed much higher photocatalytic activity than that of N-doped TiO{sub 2} under the same experimental conditions. Moreover, ·OH and ·O{sub 2}{sup −} generated in the photocatalysis played a key role of the photodegradation of Rhodamine B. - Highlights: • Ag/AgBrO{sub 3} with higher photodegradation ability was synthesized. • ·OH and ·O{sub 2}{sup −} radicals were the main active species in the oxidation of RhB. • The possible reaction mechanism was discussed in details.

  15. Carbon-Ag/AgCl probes for detection of cell activity in droplets.

    Science.gov (United States)

    Ino, Kosuke; Ono, Kaoru; Arai, Toshiharu; Takahashi, Yasufumi; Shiku, Hitoshi; Matsue, Tomokazu

    2013-04-16

    In this study, we fabricated a probe consisting of a carbon nanoelectrode and an Ag/AgCl reference electrode for detecting the activity of cells in single droplets. HeLa cells were confined into a single droplet, and the alkaline phosphatase (ALP) activity of the cells was electrochemically measured using the probe inserted into the droplet. The ALP of the confined cells catalyzed the hydrolysis of p-aminophenyl phosphate (PAPP) to yield p-aminophenol (PAP) that gave electrochemical responses. Since the tip of the carbon-Ag/AgCl probe is very small, it is useful for electrochemical analysis of cells using droplets.

  16. Monolayer solid of N-2/Ag(111)

    DEFF Research Database (Denmark)

    Bruch, L.W.; Hansen, Flemming Yssing

    1998-01-01

    An incommensurate monolayer solid of N-2/Ag(111) is modeled using extensive molecular-dynamics simulations. The conditions treated range from the low-temperature orientationally ordered solid to the melting of the solid. The properties are evaluated as a function of spreading pressure. Comparison...... is made to recent experimental data for N-2/Ag(111) and to results for N-2 adsorbed on graphite. Cu(110), and MgO(001). [S0163-1829(98)02715-5]....

  17. Fabrication and size control of Ag nanoparticles

    Directory of Open Access Journals (Sweden)

    M Farbod

    2012-06-01

    Full Text Available  The objective of this research was to fabricate Ag nanoparticles and control their sizes. Colloidal Ag nanoparticles with particle size of 30 nm were prepared by dissolving AgNO3 in ethanol and through the chemical reduction of Ag+ in alcohol solution. To control the nanoparticle size, different samples were fabricated by changing the AgNO3 and stabilizer concentrations and the effects of different factors on the shape and size of nanoparticles were investigated. The samples were characterized using SEM and EDX analysis. The results showed that by increasing the AgNO3 concentration, the average size of nanoparticles increases and nanoparticles lose their spherical shape. Also, we found that by using the stabilizer, it is possible to produce stable nanoparticles but increasing the stabilizer concentration caused an increase in size of nanoparticles. Fabrication of nanoparticles without using stabilizer was achieved but the results showed the nanoparticles size had a growth of 125 nm/h in the alcoholic media.

  18. An Ab Initio Study of the Low-Lying Doublet States of AgO and AgS

    Science.gov (United States)

    Bauschlicher, Charles W., Jr.; Partridge, Harry; Langhoff, Stephen R.

    1990-01-01

    Spectroscopic constants (D(sub o), r(sub e), mu(sub e), T(sub e)) are determined for the doublet states of AgO and AgS below approx. = 30000/cm. Large valence basis sets are employed in conjunction with relativistic effective core potentials (RECPs). Electron correlation is included using the modified coupled-pair functional (MCPF) and multireference configuration interaction (MRCI) methods. The A(sup 2)Sigma(sup +) - X(sup 2)Pi band system is found to occur in the near infrared (approx. = 9000/cm) and to be relatively weak with a radiative lifetime of 900 microns for A(sup 2)Sigma(sup +) (upsilon = 0). The weakly bound C(sup 2)Pi state (our notation), the upper state of the blue system, is found to require high levels of theoretical treatment to determine a quantitatively accurate potential. The red system is assigned as a transition from the C(sup 2)Pi state to the previously unobserved A(sup 2)Sigma(sup +) state. Several additional transitions are identified that should be detectable experimentally. A more limited study is performed for the vertical excitation spectrum of AgS. In addition, a detailed all-electron study of the X(sup 2)Pi and A(sup 2)Sigma(sup +) states of AgO is carried out using large atomic natural orbital (ANO) basis sets. Our best calculated D(sub o) value for AgO is significantly less than the experimental value, which suggests that there may be some systematic error in the experimental determination.

  19. Antibacterial Ag/a-C nanocomposite coatings: The influence of nano-galvanic a-C and Ag couples on Ag ionization rates

    Energy Technology Data Exchange (ETDEWEB)

    Manninen, N.K., E-mail: nora.sousa@dem.uc.pt [SEG-CEMUC, Mechanical Engineering Department, University of Coimbra, 3030-788 Coimbra (Portugal); GRF-CFUM, Physics Department, University of Minho, Campus of Azurém, 4800-058 Guimarães (Portugal); Calderon, S. [SEG-CEMUC, Mechanical Engineering Department, University of Coimbra, 3030-788 Coimbra (Portugal); GRF-CFUM, Physics Department, University of Minho, Campus of Azurém, 4800-058 Guimarães (Portugal); Carvalho, I. [GRF-CFUM, Physics Department, University of Minho, Campus of Azurém, 4800-058 Guimarães (Portugal); CEB—Centre of Biological Engineering, LIBRO-Laboratório de Investigação em Biofilmes Rosário Oliveira, University of Minho, 4710-057 Braga (Portugal); Henriques, M. [CEB—Centre of Biological Engineering, LIBRO-Laboratório de Investigação em Biofilmes Rosário Oliveira, University of Minho, 4710-057 Braga (Portugal); Cavaleiro, A. [SEG-CEMUC, Mechanical Engineering Department, University of Coimbra, 3030-788 Coimbra (Portugal); Carvalho, S. [SEG-CEMUC, Mechanical Engineering Department, University of Coimbra, 3030-788 Coimbra (Portugal); GRF-CFUM, Physics Department, University of Minho, Campus of Azurém, 4800-058 Guimarães (Portugal)

    2016-07-30

    Highlights: • Amorphous carbon (a-C), Ag/a-C and Ag coatings were deposited by magnetron sputtering. • a-C/Ag coating shows antibacterial activity against S. epidermidis. • The formation of nano-galvanic couples in a-C/Ag enhances the Ag{sup +} ionization rate. • The Ag{sup +} ionization occurs along with Ag nanoparticles agglomeration in 0.9% NaCl. - Abstract: Biofilm formation has been pointed as a major concern in different industrial applications, namely on biomedical implants and surgical instruments, which has prompted the development of new strategies for production of efficient antimicrobial surfaces. In this work, nano-galvanic couples were created to enhance the antibacterial properties of silver, by embedding it into amorphous carbon (a-C) matrix. The developed Ag/a-C nanocomposite coatings, deposited by magnetron sputtering, revealed an outstanding antibacterial activity against Staphylococcus epidermidis, promoting a total reduction in biofilm formation with no bacteria counts in all dilution. The open circuit potential (OCP) tests in 0.9% NaCl confirmed that a-C shows a positive OCP value, in contrast to Ag coating, thus enhancing the ionization of biocidal Ag{sup +} due to the nano-galvanic couple activation. This result was confirmed by the inductively coupled plasma-optical emission spectroscopy (ICP-OES), which revealed a higher Ag ionization rate in the nanocomposite coating in comparison with the Ag coating. The surface of Ag/a-C and Ag coatings immersed in 0.9% NaCl were monitored by scanning electron microscopy (SEM) over a period of 24 h, being found that the Ag ionization determined by ICP-OES was accompanied by an Ag nanoparticles coalescence and agglomeration in Ag/a-C coating.

  20. Facile synthesis of ternary Ag/AgBr-Ag{sub 2}CO{sub 3} hybrids with enhanced photocatalytic removal of elemental mercury driven by visible light

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Anchao, E-mail: anchaozhang@126.com [School of Mechanical and Power Engineering, Henan Polytechnic University, Jiaozuo, 454000 (China); Zhang, Lixiang; Lu, Hao; Chen, Guoyan; Liu, Zhichao [School of Mechanical and Power Engineering, Henan Polytechnic University, Jiaozuo, 454000 (China); Xiang, Jun; Sun, Lushi [State Key Laboratory of Coal Combustion, Huazhong University of Science and Technology, Wuhan, 430074 (China)

    2016-08-15

    Graphical abstract: Schematic illustration for the charge transfer in the Ag/AgBr(0.7)-Ag{sub 2}CO{sub 3} system. - Highlights: • A novel technique on Hg{sup 0} removal using visible-light-driven Ag/AgBr-Ag{sub 2}CO{sub 3} hybrids was proposed. • Ag/AgBr-Ag{sub 2}CO{sub 3} hybrids were synthesized by a simple modified co-precipitation method. • Hg{sup 0} was mainly removed by the photogenerated holes (h{sup +}). • The possible reaction mechanism for superior Hg{sup 0} removal was proposed. - Abstract: A novel technique for photocatalytic removal of elemental mercury (Hg{sup 0}) using visible-light-driven Ag/AgBr-Ag{sub 2}CO{sub 3} hybrids was proposed. The ternary Ag/AgBr-Ag{sub 2}CO{sub 3} hybrids were synthesized by a simple modified co-precipitation method and characterized by N{sub 2} adsorption-desorption, scanning electron microscope (SEM), X-ray diffraction (XRD), UV–vis diffused reflectance spectroscopy (DRS), X-ray photoelectron spectroscopy (XPS) and electron spin resonance (ESR) techniques. The effects of AgBr content, fluorescent lamp (FSL) irradiation, solution temperature, SO{sub 2} and NO on Hg{sup 0} removal were investigated in detail. Furthermore, a possible reaction mechanism for higher Hg{sup 0} removal was proposed, and the simultaneous removal of Hg{sup 0}, SO{sub 2} and NO was studied. The results showed that a high efficiency of Hg{sup 0} removal was obtained by using Ag/AgBr-Ag{sub 2}CO{sub 3} hybrids under fluorescent lamp irradiation. The AgBr content, FSL irradiation, solution temperature, and SO{sub 2} all exhibited significant effects on Hg{sup 0} removal, while NO had slight effect on Hg{sup 0} removal. The addition of Ca(OH){sub 2} demonstrated a little impact on Hg{sup 0} removal and could significantly improve the SO{sub 2}-resistance performance of Ag/AgBr(0.7)-Ag{sub 2}CO{sub 3} hybrid. The characterization results exhibited that hydroxyl radical (·OH), superoxide radical (·O{sub 2}{sup −}), hole (h{sup +}), and Br

  1. Ag-Ag2S/reduced graphene oxide hybrids used as long-wave UV radiation emitting nanocomposites

    Science.gov (United States)

    Li, Wenyao; Xu, Ruoyu; Ling, Min; He, Guanjie

    2017-10-01

    We report a facile thermal decomposition approach to synthesize Ag-Ag2S/reduced graphene oxide (Ag-Ag2S/rGO), the Ag-Ag2S nanoparticles uniformly dispersed on reduced graphene oxide with diameters of 10-20 nm. The photoluminescence spectra of Ag-Ag2S/rGO showed two obvious emission peaks at 327 and 339 nm with the excitation wavelength at 287 nm. Compared with Ag-Ag2S heterostructured clusters with two peaks at 407 and 430 nm, it showed a big blue shift and higher intensity, which makes it a novel candidate for long-wave UV radiation emitting nanocomposite.

  2. A biodynamic understanding of dietborne and waterborne Ag uptake from Ag NPs in the sediment-dwelling oligochaete, Tubifex tubifex

    DEFF Research Database (Denmark)

    Tangaa, Stine Rosendal; Selck, Henriette; Winther-Nielsen, Margrethe

    2018-01-01

    Metal nanoparticles (Me-NPs) are increasingly used in various products, such as inks and cosmetics, enhancing the likelihood of their release into aquatic environments. An understanding of the mechanisms controlling their bioaccumulation and ecotoxicity in aquatic biota will help support...... environmental risk assessment. Here we characterized unidirectional parameters for uptake and elimination of silver (Ag) in the sediment-dwelling oligochaete Tubifex tubifex after waterborne (0.01–47 nmol Ag/L) and dietborne (0.4–482 nmol Ag/g dw sed.) exposures to Ag NPs and AgNO3, respectively. Worms...... environments. However, inference of bioavailability from our estimations of Ag assimilation efficiencies (AE) suggests that Ag (AE: 3–12% for AgNO3 and 0.1–0.8% for Ag NPs) is weakly bioavailable from sediment for this species. Thus, Ag amended to sediment as NPs might not pose greater problems than...

  3. Dealloying-driven synthesis and characterization of AgCl/Ag/TiO2 nanocomposites with enhanced photocatalytic properties

    Science.gov (United States)

    Wang, Tongyang; Wang, Yan; Zhao, Zhengfeng; Zhang, Lanxiang; Huang, Shifeng

    2017-03-01

    The combination of dealloying with acid treatment was used to fabricate mesoporous anatase TiO2 with high specific surface area of 233 m2/g. Using anatase TiO2 as a matrix, a photoreduction strategy was developed to synthesize AgCl/Ag/TiO2 nanocomposites with different Ti/Ag molar ratios. The morphology and properties of AgCl/Ag/TiO2 nanocomposites were investigated by X-ray diffraction, field emission scanning electron microscopy and transmission electron microscopy. The AgCl/Ag/TiO2 nanocomposites showed an enhanced photocatalytic activity for the degradation of methyl orange solution under visible light irradiation. The optimum Ti/Ag molar ratio in the AgCl/Ag/TiO2 nanocomposites was shown to be 6:1, which was attributed to its high specific surface area of 207 m2/g and the surface plasmon resonance effect.

  4. Ternary Ag/epoxy adhesive with excellent overall performance.

    Science.gov (United States)

    Ji, Yan-Hong; Liu, Yu; Huang, Gui-Wen; Shen, Xiao-Jun; Xiao, Hong-Mei; Fu, Shao-Yun

    2015-04-22

    Excellent electrical conductivity (EC) generally conflicts with high lap shear strength (LSS) for electrically conductive adhesives (ECAs) since EC increases while LSS decreases with increasing conductive filler content. In this work, the ECAs with the excellent overall performance are developed based on the ternary hybrid of Ag microflakes (Ag-MFs), Ag nanospheres (Ag-NSs), and Ag nanowires (Ag-NWs). First, a low silver content adhesive system is determined. Then, the effects of the relative contents of Ag fillers on the EC and the LSS are studied. It is shown that a small amount of Ag-NSs or Ag-NWs can dramatically improve the EC for the Ag-MF/epoxy adhesives. The Ag-NSs and Ag-NWs with appropriate contents have a synergistic effect in improving the EC. Meanwhile, the LSS of the as-prepared adhesive with the appropriate Ag contents reaches an optimal value. Both the EC and the LSS of the as-prepared ternary hybrid ECA with a low content of 40 wt % Ag are higher than those of the commercial ECAs filled with the Ag-MF content over 60 wt %. Finally, the ternary hybrid ECA with the optimal formulation is shown to be promising for printing the radio frequency identification tag antennas as an immediate application example.

  5. HBcrAg Identifies Patients Failing to Achieve HBeAg Seroconversion Treated with Pegylated Interferon Alfa-2b

    Directory of Open Access Journals (Sweden)

    Hui Ma

    2016-01-01

    Conclusions: Effective antiviral treatment can decrease HBcrAg levels in the serum. The NPVs of HBcrAg for predicting HBeAg seroconversion at 24-week follow-up was 100%, but the PPVs were not satisfactory (all <31%. The serum HBcrAg levels of the patients with HBeAg seroconversion at the end of the 24-week follow-up steadily declined or even became undetectable during the LTFU.

  6. Electrochemical artifacts originating from nanoparticle contamination by Ag/AgCl quasi-reference electrodes.

    Science.gov (United States)

    Yakushenko, Alexey; Mayer, Dirk; Buitenhuis, Johan; Offenhäusser, Andreas; Wolfrum, Bernhard

    2014-02-07

    Electrochemical techniques rely on the stability of a defined reference potential. Due to the need for miniaturization, electrochemical lab-on-a-chip platforms often employ Ag/AgCl quasi-reference electrodes for this purpose. Here, we report on electrochemical artifacts resulting from nanoparticle-electrode collisions originating from standard chlorinated silver wires.

  7. Beet Juice-Induced Green Fabrication of Plasmonic AgCl/Ag Nanoparticles

    Science.gov (United States)

    A simple, green, and fast approach (complete within 5 min) was explored for the fabrication of hybrid AgCl/Ag plasmonic nanoparticles under microwave (MW) irradiation. In this method, beet juice served as a reducing reagent, which is an abundant sugar-rich agricultural produce. I...

  8. Properties of Ag/AgCl electrodes fabricated with IC-compatible technologies

    NARCIS (Netherlands)

    Bousse, L.J.; Bergveld, Piet; Geeraedts, H.J.M.

    1986-01-01

    The purpose of this work is to fabricate and characterize Ag/AgCl electrodes made on a silicon chip at the wafer level with integrated circuit-compatible fabrication techniques. Such electrodes are useful as reference electrodes in several kinds of chemical sensors. Two types of electrode were

  9. Radiation hardness of LuAG:Ce and LuAG:Pr scintillator crystals

    CERN Document Server

    Derdzyan, M V; Belsky, A; Dujardin, C; Lecoq, P; Lucchini, M; Ovanesyan, K L; Pauwels, K; Pedrini, C; Petrosyan, A G

    2012-01-01

    Single crystals of LuAG:Ce, LuAG:Pr and un-doped LuAG were grown by the vertical Bridgman method and studied for radiation hardness under gamma-rays with doses in the range 10-10(5) Gy (Co-60). A wide absorption band peaking at around 600 nm springs up in all three types of crystals after the irradiations. The second band peaking at around 375 nm appears in both LuAG:Pr and un-doped LuAG. Compositional variations have been done to reveal the spectral behavior of induced color centers in more detail and to understand their origin. Similarities in behavior of Yb2+ centers in as-grown garnets are found, indicating that radiation induced color centers can be associated with residual trace amounts of Yb present in the raw materials. Un-doped LuAG and LuAG:Ce demonstrate moderate radiation hardness (the induced absorption coefficients being equal to 0.05-0.08 cm(-1) for accumulated doses of 10(3)-10(4) Gy), while LuAG:Pr is less radiation hard. The ways to improve the radiation hardness are discussed.

  10. Oxygen electrosorption on Ag(111) and Ag(110) electrodes in in NaOH solution

    NARCIS (Netherlands)

    Droog, J.M.M.

    1980-01-01

    The first stages of the anodic oxidation of Ag(111) and Ag(110) electrodes in NaOH solution were studied by potential sweep voltammetry and ellipsometry. It was found that in the potential region studied, dissolution of silver species and electrosorption of oxygen occur. The (110) face is much more

  11. Characterization of Ag/Ag 2 SO 4 system as reference electrode for ...

    Indian Academy of Sciences (India)

    Characterization of Ag/Ag2SO4 system as reference electrode for in-situ electrochemical studies of advanced aqueous supercapacitors' ... Using the data obtained from threeelectrodeelectrochemical measurements with the electrode in question, a graphene–carbon nanotube/ MnO2 supercapacitor cell accumulating 9.8 ...

  12. First-principles study of surface plasmons on Ag(111) and H/Ag(111)

    DEFF Research Database (Denmark)

    Yan, Jun; Jacobsen, Karsten Wedel; Thygesen, Kristian Sommer

    2011-01-01

    Linear-response time-dependent density functional theory is used to investigate the relation between molecular bonding and surface plasmons for the model system H/Ag(111). We employ an orbital-dependent exchange-correlation functional to obtain a correct description of the Ag 3d band, which...

  13. Synthesis of Pt, Pd, Pt/Ag and Pd/Ag nanoparticles by microwave ...

    Indian Academy of Sciences (India)

    Unknown

    Abstract. Pt, Pd, Pt-Ag and Pd-Ag bimetallic nanoparticles were synthesized in ethylene glycol and glycerol using the microwave technique in the presence of a stabilizer poly(N-vinylpyrrolidone) (PVP). It has been observed that PVP is capable of complexing and stabilizing nanoparticles. Mixed clusters were formed by ...

  14. Magnetically separable Ag/AgBr/NiFe2O4 composite as a highly efficient visible light plasmonic photocatalyst

    Science.gov (United States)

    Ge, Ming; Liu, Wei; Hu, Xin-Rong; Li, Zhen-Lu

    2017-10-01

    A magnetic Ag/AgBr/NiFe2O4 plasmonic photocatalyst was firstly prepared by coupling a hydrothermal route with a solvothermal method. The as-synthesized Ag/AgBr/NiFe2O4 was characterized by XRD, XPS, FE-SEM, UV-vis DRS, PL and BET surface area. Under visible light irradiation, the resulting Ag/AgBr/NiFe2O4 exhibited a higher photocatalytic activity for rhodamine B (RhB) degradation compared with Ag/AgBr, which was ascribed to the heterostructured Ag/AgBr/NiFe2O4 and the surface plasmon resonance (SPR) effect of Ag nanoparticles. Moreover, the Ag/AgBr/NiFe2O4 plasmonic photocatalyst can be recovered and recycled by a magnetic field along with good stability. A plausible mechanism is also proposed via active species trapping experiments, which indicating that the superoxide radicals (O2-•) are the main reactive oxygen species for RhB degradation in Ag/AgBr/NiFe2O4 suspension under visible light.

  15. Facile synthesis of AgCl/polydopamine/Ag nanoparticles with in-situ laser improving Raman scattering effect

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Yan; Zhang, Wenqi; Wang, Lin; Wang, Feng, E-mail: wangfeng@shnu.edu.cn; Yang, Haifeng

    2017-01-15

    Highlights: • AgCl/PDA/AgNPs (polydopamine (PDA) adlayer covered cubic AgCl core inlaid with Ag nanoparticles (AgNPs)) was fabricated for in-situ SERS detection. • Such SERS substrate shows in-situ laser improving Raman scattering effect due to the generation of more AgNPs. • Enhancement factor could reach 10{sup 7}. • Such SERS substrate shows good reproducibility and long term stability. - Abstract: We reported a simple and fast method to prepare a composite material of polydopamine (PDA) adlayer covered cubic AgCl core, which was inlaid with Ag nanoparticles (NPs), shortly named as AgCl/PDA/AgNPs. The resultant AgCl/PDA/AgNPs could be employed as surface-enhanced Raman scattering (SERS) substrate for in-situ detection and the SERS activity could be further greatly improved due to the production of more AgNPs upon laser irradiation. With 4-mercaptopyridine (4-Mpy) as the probe molecule, the enhancement factor could reach 10{sup 7}. Additionally, such SERS substrate shows good reproducibility with relative standard deviation of 7.32% and long term stability (after storage for 100 days under ambient condition, SERS intensity decay is less than 25%). In-situ elevating SERS activity of AgCl/PDA/AgNPs induced by laser may be beneficial to sensitive analysis in practical fields.

  16. Ag on Si(111) from basic science to application

    Energy Technology Data Exchange (ETDEWEB)

    Belianinov, Aleksey [Iowa State Univ., Ames, IA (United States)

    2012-01-01

    In our work we revisit Ag and Au adsorbates on Si(111)-7x7, as well as experiment with a ternary system of Pentacene, Ag and Si(111). Of particular interest to us is the Si(111)-(√3x√3)R30°}–Ag (Ag-Si-√3 hereafter). In this thesis I systematically explore effects of Ag deposition on the Ag-Si-√3 at different temperatures, film thicknesses and deposition fluxes. The generated insight of the Ag system on the Si(111) is then applied to generate novel methods of nanostructuring and nanowire growth. I then extend our expertise to the Au system on the Ag-Si(111) to gain insight into Au-Si eutectic silicide formation. Finally we explore behavior and growth modes of an organic molecule on the Ag-Si interface.

  17. On possible existence of pseudobinary mixed valence fluorides of Ag(I)/Ag(II): a DFT study.

    Science.gov (United States)

    Grochala, Wojciech

    2011-09-01

    The DFT calculations performed within local density approximation disclose conceivable existence of two novel mixed-valence Ag(I)/Ag(II) fluorides, Ag(2)F(3), i.e., Ag(I)Ag(II)F(3) and Ag(3)F(4), i.e., Ag(I)(2)Ag(II)F(4). Ag(2)F(3) is predicted to crystallize in three equally stable NaCuF(3)-, KAgF(3)-, or CuTeO(3)-type structures, while Ag(3)F(4) should be isostructural to Na(2)CuF(4). The calculated vibration-corrected energies of formation at 0 K of Ag(2)F(3) and Ag(3)F(4) (in their most stable polytypes) from binary fluorides are negative but small (respectively, -0.09 eV and -0.21 eV per formula unit). Formation of Ag(3)F(5) (which, in fact, is a mixed valence Ag(I)/Ag(III) salt) from binary fluorides is much less likely, since the energy of formation is quite positive of about a quarter eV. The predicted volumes per formula unit for all forms of Ag(2)F(3) are larger and that for K(2)CuF(4)-type Ag(3)F(4) is smaller than the sum of volumes of the corresponding binary fluorides; Ag(2)F(3) should not form at high pressure conditions due to a decomposition to the binary constituents. Ag(2)F(3) and Ag(3)F(4) should exhibit genuine mixed- and not intermediate-valence with quite different coordination spheres of Ag(I) and Ag(II). Nevertheless, they should not be electric insulators. Ag(2)F(3) is predicted to be a metallic ferrimagnet with a magnetic superexchange coupling constant, J, of -2 meV while Ag(3)F(4) should be a metallic ferromagnet with J of +52 meV. Since Ag(2)F(3) and Ag(3)F(4) are at the verge of thermodynamic stability, a handful of exothermic reactions have been proposed which could yield these as yet unknown compounds.

  18. Strongly visible-light responsive plasmonic shaped AgX:Ag (X = Cl, Br) nanoparticles for reduction of CO2 to methanol

    Science.gov (United States)

    An, Changhua; Wang, Jizhuang; Jiang, Wen; Zhang, Meiyu; Ming, Xijuan; Wang, Shutao; Zhang, Qinhui

    2012-08-01

    Plasmonic shaped AgX:Ag (X = Cl, Br) nanoparticles have been synthesized by a facile and versatile glycerol-mediated solution route. The as-prepared AgX:Ag nanoparticles exhibit regular shapes, i.e., cube-tetrapod-like AgCl:Ag nanoparticles and AgBr:Ag nanoplates. Compared with the pristine AgX, AgX:Ag nanocomposites display stronger absorption in the visible region due to the surface plasmon resonance of silver nanoparticles. The calculation of bandgaps and band positions indicates the as-achieved AgX:Ag nanoparticles can be used as a class of potential photocatalyst for the reduction of CO2. For example, reduction of CO2 under visible light irradiation with the assistance of the anisotropic AgX:Ag nanoparticles yields as much as 100 μmol methanol in the products. Furthermore, the AgX:Ag nanoparticles can maintain its structure and activity after 3 runs of reactions. Therefore, the present route opens an avenue to acquire plasmonic photocatalysts for conversion of CO2 into useful organic compounds.Plasmonic shaped AgX:Ag (X = Cl, Br) nanoparticles have been synthesized by a facile and versatile glycerol-mediated solution route. The as-prepared AgX:Ag nanoparticles exhibit regular shapes, i.e., cube-tetrapod-like AgCl:Ag nanoparticles and AgBr:Ag nanoplates. Compared with the pristine AgX, AgX:Ag nanocomposites display stronger absorption in the visible region due to the surface plasmon resonance of silver nanoparticles. The calculation of bandgaps and band positions indicates the as-achieved AgX:Ag nanoparticles can be used as a class of potential photocatalyst for the reduction of CO2. For example, reduction of CO2 under visible light irradiation with the assistance of the anisotropic AgX:Ag nanoparticles yields as much as 100 μmol methanol in the products. Furthermore, the AgX:Ag nanoparticles can maintain its structure and activity after 3 runs of reactions. Therefore, the present route opens an avenue to acquire plasmonic photocatalysts for conversion of CO2

  19. Spectrophotometry of the shell around AG Carinae

    Science.gov (United States)

    Mitra, P. Mila; Dufour, Reginald J.

    1990-01-01

    Spatially-resolved long-slit spectrophotometry are presented for two regions of the shell nebula around the P-Cygni variable star AG Carinae. The spectra cover the 3700-6800 A wavelength range. Emission-line diagnostics are used to derive extinction, electron temperatures, and densities for various positions in the nebula. The chemical abundances and ionization structure are calculated and compared with other types of planetary nebulae and shells around other luminous stars. It is found that the N/O and N/S ratios of Ag Car are high compared to solar neighborhood ISM values. The O/H depletion found for the AG Car shell approaches that found in the condensations of the Eta Car system.

  20. Optical absorption spectra of Ag-11 isomers

    DEFF Research Database (Denmark)

    Martinez, Jose Ignacio; Fernandez, E. M.

    2009-01-01

    The optical absorption spectra of the three most; stable structural isomers of the Ag-11 cluster were calculated using the time-dependent, density functional theory within the Casida formalism. The slightly different, spectra, of the isomers may permit the identification of the ground-stale confi......The optical absorption spectra of the three most; stable structural isomers of the Ag-11 cluster were calculated using the time-dependent, density functional theory within the Casida formalism. The slightly different, spectra, of the isomers may permit the identification of the ground......-stale configuration predominantly present in the laboratory beams based on a direct comparison between the calculated photoabsorptiou response for the Ag-11 isomers and the measured spectra of medium-size silver clusters trapped in noble gas Ar and Ne matrices at different, temperatures. This assignment is confirmed...

  1. Teaming with Brookhaven National Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Yang, G. [Brookhaven National Lab. (BNL), Upton, NY (United States)

    2017-06-06

    BNL has started growing CdZnTeSe crystals for room-temperature radiation detector applications. The addition of Se to CdTe reduces the concentration of secondary phases and sub-grain boundary networks. The addition of Zn increases the energy band gap. Material characterization to understand the limiting factors of radiation detection material and to improve the properties continues to be a core element of an extensive R&D program at the LBNL’s ALS and BNL’s NSLS-II synchrotron facilities. ALS’s Beamline 3.3.2 is available for 60% of its beamtime and allows us to perform both White Beam X-ray Diffraction Topography and Micron Scale X-ray Detector Mapping. The latter technique is extremely useful when measuring scintillators because it allows us to subtract contributions from the variability in the counting statistics, and also the fluctuations due to delta electrons, and non-proportionality. BNL has recently developed a new type of thermal neutron detector using pad technology in combination with 3He gas operated in ionization mode. The new detector is used for coded aperture thermal neutron imaging.

  2. Facile synthesis of AgCl/polydopamine/Ag nanoparticles with in-situ laser improving Raman scattering effect

    Science.gov (United States)

    Zhang, Yan; Zhang, Wenqi; Wang, Lin; Wang, Feng; Yang, Haifeng

    2017-01-01

    We reported a simple and fast method to prepare a composite material of polydopamine (PDA) adlayer covered cubic AgCl core, which was inlaid with Ag nanoparticles (NPs), shortly named as AgCl/PDA/AgNPs. The resultant AgCl/PDA/AgNPs could be employed as surface-enhanced Raman scattering (SERS) substrate for in-situ detection and the SERS activity could be further greatly improved due to the production of more AgNPs upon laser irradiation. With 4-mercaptopyridine (4-Mpy) as the probe molecule, the enhancement factor could reach 107. Additionally, such SERS substrate shows good reproducibility with relative standard deviation of 7.32% and long term stability (after storage for 100 days under ambient condition, SERS intensity decay is less than 25%). In-situ elevating SERS activity of AgCl/PDA/AgNPs induced by laser may be beneficial to sensitive analysis in practical fields.

  3. Template synthesis of Ag/AgCl microrods and their efficient visible light-driven photocatalytic performance

    Energy Technology Data Exchange (ETDEWEB)

    Chen, Hua; Xiao, Liang; Huang, Jianhua, E-mail: jhhuang@zstu.edu.cn

    2014-09-15

    Highlights: • Preparation ofAg/AgCl microrods by reaction of Ag{sub 2}WO{sub 4} microrods with NaCl solution. • Generation of metallic Ag is induced by the ambient light in the synthesis process. • Ag/AgCl shows excellent visible light-driven photodegradation of organic dyes. - Abstract: Ag/AgCl microrods, aggregated by nanoparticles with a diameter ranging from 100 nm to 2 μm, were prepared by an ion-exchange reaction at 80 °C between Ag{sub 2}WO{sub 4} template and NaCl solution. The existence of metallic Ag species was confirmed by XRD, DRS and XPS measurements. Ag/AgCl microrods showed excellent photocatalytic activity for the degradation of rhodamine B and methylene blue under visible light irradiation. The degradation rate constants of rhodamine B and methylene blue are 0.176 and 0.114 min{sup −1}, respectively. The cycling photodegradation experiments suggest that Ag/AgCl microds could be employed as stable plasmonic photocatalysts for the degradation of organic dyes under visible light irradiation.

  4. Structure and stability of defective silicene on Ag(001) and Ag(111) substrates: A computer experiment

    Science.gov (United States)

    Galashev, A. E.; Ivanichkina, K. A.; Vorob'ev, A. S.; Rakhmanova, O. R.

    2017-06-01

    The structure and stability of a two-layer defective silicene on Ag(001) and Ag(111) substrates have been investigated using the molecular dynamics method. The transformation of the radial distribution function of silicene due to the formation of monovacancies, divacancies, trivacancies, and hexavacancies is reduced primarily to a decrease in the intensity of the peaks and the disappearance of the "shoulder" in the second peak. With the passage of time, multivacancies can undergo coalescence with each other and the fragmentation into smaller vacancies, as well as form vacancy clusters. According to the geometric criterion, the Ag(001) substrate provides a higher stability of a perfect two-layer silicene. It has been found, however, that the defective silicene on this substrate has a lower energy only when it contains monovacancies and divacancies. A change in the size of defects leads to a change in the energy priority when choosing between the Ag(001) and Ag(111) substrates. The motion of a lithium ion inside an extended channel between two silicene sheets results in a further disordering of the defective structure of the silicene, during which the strongest stresses in the silicene are generated by forces directed perpendicular to the external electric field. These forces dominate in the silicene channel, the wall of which is supported by the Ag(001) or Ag(111) substrate.

  5. Mussel-inspired green synthesis of polydopamine-Ag-AgCl composites with efficient visible-light-driven photocatalytic activity.

    Science.gov (United States)

    Cai, Aijun; Wang, Xiuping; Guo, Aiying; Chang, Yongfang

    2016-09-01

    Polydopamine-Ag-AgCl composites (PDA-Ag-AgCl) were synthesized using a mussel-inspired method at room temperature, where PDA acts as a reducing agent to obtain the noble Ag nanoparticles from a precursor. The morphologies and structures of the as-prepared PDA-Ag-AgCl were characterized by several techniques including field emission scanning electron microscopy (FESEM), transmission electron microscopy (SEM), Raman spectra, and X-Ray photoelectron spectrum (XPS). The morphological observation depicts formation of nanoparticles with various micrometer size diameters and surface XPS analysis shows presence of various elements including Ag, N, Cl, and O. The enhanced absorbance of the PDA-Ag-AgCl particles in the visible light region is confirmed through UV-Vis diffuse reflectance spectra (DRS), and the charge transfer is demonstrated by photoluminescence (PL) and photocurrent response. The synthesized PDA-Ag-AgCl composites could be used as visible-light-driven photocatalysts for the degradation of Rhodamine B. The elevated photocatalytic activity is ascribed to the effective charge transfer from plasmon-excited Ag to AgCl that can improve the efficiency of the charge separation during the photocatalytic reaction. Furthermore, differences in the photocatalytic performance among the different PDA-Ag-AgCl composites are noticed that could be attributed to the Brunauer-Emmett-Teller (BET) specific surface area, which benefits to capture the visible light efficiently. The PDA-Ag-AgCl exhibits excellent stability without a significant loss in activity after 5cycles. The proposed method is low-cost and environmentally friendly, hence a promising new way to fabricate plasmon photocatalysts. Copyright © 2016. Published by Elsevier B.V.

  6. Effect of cysteine and humic acids on bioavailability of Ag from Ag nanoparticles to a freshwater snail

    Science.gov (United States)

    Luoma, Samuel N.; Tasha Stoiber,; Croteau, Marie-Noele; Isabelle Romer,; Ruth Merrifeild,; Lead, Jamie

    2016-01-01

    Metal-based engineered nanoparticles (NPs) will undergo transformations that will affect their bioavailability, toxicity and ecological risk when released to the environment, including interactions with dissolved organic material. The purpose of this paper is to determine how interactions with two different types of organic material affect the bioavailability of silver nanoparticles (AgNPs). Silver uptake rates by the pond snail Lymnaea stagnalis were determined after exposure to 25 nmol l-1 of Ag as PVP AgNPs, PEG AgNPs or AgNO3, in the presence of either Suwannee River humic acid or cysteine, a high-affinity thiol-rich organic ligand. Total uptake rate of Ag from the two NPs was either increased or not strongly affected in the presence of 1 – 10 mg 1-1 humic acid. Humic substances contain relatively few strong ligands for Ag explaining their limited effects on Ag uptake rate. In contrast, Ag uptake rate was substantially reduced by cysteine. Three components of uptake from the AgNPs were quantified in the presence of cysteine using a biodynamic modeling approach: uptake of dissolved Ag released by the AgNPs, uptake of a polymer or large (>3kD) Ag-cysteine complex and uptake of the nanoparticle itself. Addition of 1:1 Ag:cysteine reduced concentrations of dissolved Ag, which contributed to, but did not fully explain the reductions in uptake. A bioavailable Ag-cysteine complex (> 3kD) appeared to be the dominant avenue of uptake from both PVP AgNPs and PEG AgNPs in the presence of cysteine. Quantifying the different avenues of uptake sets the stage for studies to assess toxicity unique to NPs.

  7. Sonosynthesis of an Ag/AgBr/Graphene-oxide nanocomposite as a solar photocatalyst for efficient degradation of methyl orange.

    Science.gov (United States)

    Esmaeili, A; Entezari, M H

    2016-03-15

    In this study, a new method has developed for the synthesis of Ag/AgBr/Graphene-oxide (Ag/AgBr/GO) nanocomposite with high adsorption capacity and high photocatalytic activity in degradation of methyl orange (MO). In this method, ultrasound was applied in the synthesis and it was facilitated the process. The samples prepared under ultrasound were shown as Ag/AgBr/GO-U, and the samples under conventional method as Ag/AgBr/GO-C. The results of FT-IR, XRD, Raman, DRS and SEM confirmed the structure of the nanocomposites very well. Ultrasound played a key role in the formation of nanocomposite with smaller size of GO sheets and particles. Different amount of GO was used in the nanocomposite composition and their photocatalytic activities were compared. The MO in solution was completely degraded in 15 min, 30 min, and 45 min with Ag/AgBr/GO-U-1 that contained 1 mg mL(-1) GO, Ag/AgBr/GO-U-0.5 that contained 0.5 mg mL(-1) GO and Ag/AgBr/GO-C-0.5 that contained 0.5 mg mL(-1) GO, respectively. The chemical oxygen demand (COD) measurements displayed a complete mineralization in 30 min for Ag/AgBr/GO-U-0.5. The data obtained from the degradation experiments were fitted to the first-order kinetics and the adsorption obeyed the Langmuir model. The nanocatalyst did not exhibit significant loss of activity even after four cycles of successive uses. To determine the mechanism of photocatalytic degradation of MO, different scavengers were used. Based on the results, the superoxide radical, hydroxyl radical and hole had a key role in the degradation process. The Ag/AgBr/GO-U-1 nanocomposite exhibited the highest photocatalytic activity due to its high adsorption capacity and enhanced charge transfer. Copyright © 2015 Elsevier Inc. All rights reserved.

  8. Ag/CdS heterostructural composites: Fabrication, characterizations and photocatalysis

    Energy Technology Data Exchange (ETDEWEB)

    Liu, Yang [Key Laboratory of Interface Science and Engineering in Advanced Materials, Taiyuan University of Technology, Ministry of Education, Taiyuan, Shanxi 030024 (China); College of Materials Science and Engineering, Taiyuan University of Technology, Taiyuan, Shanxi 030024 (China); Chi, Mei [Institute of Metal Research, Chinese Academy of Sciences, Shenyang, Liaoning 110016 (China); Dong, Hailiang; Jia, Husheng; Xu, Bingshe [Key Laboratory of Interface Science and Engineering in Advanced Materials, Taiyuan University of Technology, Ministry of Education, Taiyuan, Shanxi 030024 (China); College of Materials Science and Engineering, Taiyuan University of Technology, Taiyuan, Shanxi 030024 (China); Zhang, Zhuxia, E-mail: zhangzhuxia@tyut.edu.cn [Key Laboratory of Interface Science and Engineering in Advanced Materials, Taiyuan University of Technology, Ministry of Education, Taiyuan, Shanxi 030024 (China); College of Materials Science and Engineering, Taiyuan University of Technology, Taiyuan, Shanxi 030024 (China)

    2014-09-15

    Highlights: • Novel Ag/CdS core–shell heterostructural composites were fabricated using a two-step chemical method. • A formation mechanism of Ag/CdS heterostructural composites. • The photocatalytic activity of Ag/CdS heterostructural composites was found to be improved. • PL emissions are markedly quenched in the Ag/CdS composites than in CdS nanoparticles. - Abstract: Ag/CdS heterostructural materials were successfully synthesized by ultrasound-assisted polyols and hydrothermal method. Under hydrothermal condition, thiourea adsorbed on Ag nanowires releases S{sup 2−} ions, which react with vicinal Cd{sup 2+} ions to form CdS clusters on Ag nanowires. Thereafter, the Ag/CdS composites grow into core–shell structure through CdS aggregation, Ostwald ripening, and preferential growth. The obtained core–shell structures and morphologies were investigated by XRD, SEM, and TEM; the experimental results indicate that the composites are composed of Ag nanowires serving as the core and CdS particles as the shell. The photocatalytic property of Ag/CdS core–shell materials was then investigated in detail. Comparing studies on the degradation of methylene blue were employed by using pure CdS, pure Ag, and Ag/CdS composites, respectively. The results show that the Ag/CdS composites possess higher photocatalytic degradation efficiency. Moreover, the Ag/CdS composites show improved stability, and the photocatalytic activity remains almost unchanged after four recycles. The enhanced photocatalytic effect for Ag/CdS composites is mainly attributed to the photogenerated electron transfer from CdS to Ag nanowire, while photogenerated holes still remain in CdS's valence band. Consequently, the effective separation of photogenerated electrons and holes and the resulting OH radicals improve the photocatalytic efficiency of Ag/CdS composites greatly.

  9. Effect of Ag in structural, electrical and magnetic properties of Ag-sheated Bi-2223 wires

    Directory of Open Access Journals (Sweden)

    D Sohrabi

    2009-08-01

    Full Text Available  In this study, the superconducting properties of Bi-2223/Ag wires, made by the PIT method have been studied. Powder samples were prepared using conventional solid state reaction method. After calcination, samples with different Ag percent (0, 5, 10, 15, 20, and 25 prepared and sintered at 830 °C. It was shown that Ag addition has not only affected the formation of the desired Bi-2223 phase and the microstructure of these wires, but also influenced on the critical current density (JC and critical temperature.

  10. Removal of I by adsorption with AgX (Ag-impregnated X Zeolite) from high-radioactive seawater waste

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Eil Hee; Lee, Keun Young; Kim, Kwang Wook; Kim, Hyung Ju; Kim, Ik Soo; Chung, Dong Yong; Moon, Jei Kwon; Choi, Jong Won [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)

    2016-09-15

    This study aimed to the adsorption-removal of high- radioactive iodide (I) contained in the initially generated high-radioactive seawater waste (HSW), with the use of AgX (Ag-impregnated X zeolite). Adsorption of I by AgX (hereafter denoted as AgX-I adsorption) was increased by increasing the Ag-impregnated concentration in AgX, and its concentration was suitable at about 30 wt%. Because of AgCl precipitation by chloride ions contained in seawater waste, the leaching yields of Ag from AgX (Ag-impregnated concentration : about 30-35 wt%) was less than those in distilled water (< 1 mg/L). AgX-I adsorption was above 99% in the initial iodide concentration (Ci) of 0.01-10 mg/L at m/V (ratio of weight of adsorbent to solution volume)=2.5 g/L. This shows that efficient removal of I is possible. AgX-I adsorption was found to be more effective in distilled water than in seawater waste, and the influence of solution temperature was insignificant. Ag-I adsorption was better described by a Freundlich isotherm rather than a Langmuir isotherm. AgX-I adsorption kinetics can be expressed by a pseudo-second order rate equation. The adsorption rate constants (k2) decreased by increasing Ci, and conversely increased by increasing the ratio of m/V and the solution temperature. This time, the activation energy of AgX-I adsorption was about 6.3 kJ/mol. This suggests that AgX-I adsorption is dominated by physical adsorption with weaker bonds. The evaluation of thermodynamic parameters (a negative Gibbs free energy and a positive Enthalpy) indicates that AgX-I adsorption is a spontaneous reaction (forward reaction), and an endothermic reaction indicating that higher temperatures are favored.

  11. Bifunctional AgCl/Ag composites for SERS monitoring and low temperature visible light photocatalysis degradation of pollutant

    Science.gov (United States)

    Dong, Lihong; Zhu, Junyi; Xia, Guangqing

    2014-12-01

    With the assistance of Polyvinylpyrrolidone (PVP), AgCl/Ag composites were fabricated in N, N-Dimethylformamide (DMF) solvent via a photoactivated route. The size of AgCl particles was in the range of 500 nm to 1 μm and the Ag particle's diameter was about 10-20 nm. Different from those core-shell structures reported before, the Ag nanoparticles were dispersed uniformly both on the surface and in the body of AgCl particles. The generation of such kind of composites was resulted from the reducing ability of DMF and light irradiation during the formation of AgCl particles. The as-obtained AgCl/Ag composites presented great activity for both surface-enhanced Raman scattering (SERS) detection and visible light photocatalytic degradation of organic dyes. Additionally, the AgCl/Ag composites could maintain high photocatalytic activity even though the ambient temperature was as low as 15 °C and recycle photocatalysis experiments indicated that the photocatalyst exhibited higher stability. Such kind of AgCl/Ag composites holds great potential for environmental monitoring devices and pollutant treatments.

  12. Preparation and Characterization of Highly Efficient and Stable Visible-Light-Responsive Photocatalyst AgBr/Ag3PO4

    Directory of Open Access Journals (Sweden)

    Zhang Jinfeng

    2013-01-01

    Full Text Available AgBr/Ag3PO4 photocatalyst was synthesized using a facile coprecipitation method. The photocatalyst was characterized by X-ray powder diffraction (XRD, UV-Vis diffuse reflectance spectroscopy (DRS, scanning electron microscopy (SEM, Brunauer-Emmett-Teller (BET surface areas, and photoluminescence (PL technique. The activity of the photocatalyst was evaluated by the degradation of methyl orange (MO and rhodamine B (RhB. The results showed that the prepared AgBr/Ag3PO4 exhibited excellent performance and much higher photocatalytic activity than the single one under visible-light irradiation. The optimum mole ratio of Br/P in AgBr/Ag3PO4 samples is 0.3. The prepared AgBr/Ag3PO4 photocatalyst was transformed to Ag/AgBr/Ag3PO4 system with excellent property and good stability in the photocatalytic process. The possible mechanisms of the enhanced photocatalytic activity for the AgBr/Ag3PO4 were also discussed in detail.

  13. Development of a Rhizoctonia solani AG1-IB Specific Gene Model Enables Comparative Genome Analyses between Phytopathogenic R. solani AG1-IA, AG1-IB, AG3 and AG8 Isolates.

    Directory of Open Access Journals (Sweden)

    Daniel Wibberg

    Full Text Available Rhizoctonia solani, a soil-born plant pathogenic basidiomycetous fungus, affects various economically important agricultural and horticultural crops. The draft genome sequence for the R. solani AG1-IB isolate 7/3/14 as well as a corresponding transcriptome dataset (Expressed Sequence Tags--ESTs were established previously. Development of a specific R. solani AG1-IB gene model based on GMAP transcript mapping within the eukaryotic gene prediction platform AUGUSTUS allowed detection of new genes and provided insights into the gene structure of this fungus. In total, 12,616 genes were recognized in the genome of the AG1-IB isolate. Analysis of predicted genes by means of different bioinformatics tools revealed new genes whose products potentially are involved in degradation of plant cell wall components, melanin formation and synthesis of secondary metabolites. Comparative genome analyses between members of different R. solani anastomosis groups, namely AG1-IA, AG3 and AG8 and the newly annotated R. solani AG1-IB genome were performed within the comparative genomics platform EDGAR. It appeared that only 21 to 28% of all genes encoded in the draft genomes of the different strains were identified as core genes. Based on Average Nucleotide Identity (ANI and Average Amino-acid Identity (AAI analyses, considerable sequence differences between isolates representing different anastomosis groups were identified. However, R. solani isolates form a distinct cluster in relation to other fungi of the phylum Basidiomycota. The isolate representing AG1-IB encodes significant more genes featuring predictable functions in secondary metabolite production compared to other completely sequenced R. solani strains. The newly established R. solani AG1-IB 7/3/14 gene layout now provides a reliable basis for post-genomics studies.

  14. Measurement of Fragmentation Products including Angular Distributions for 3, 5, and 10 GeV/A C and Si on several nuclear targets at the AGS

    CERN Document Server

    Pinsky, L; Broggi, F; Brugger, M; Campanella, M; Carboni, M; Cerutti, F; Colleoni, P; Crystl, M; D'Ambrosio, C; Elkhayari, N; Empl, A; Fassó, A; Ferrari, A; Ferrari, A; Gadioli, E; Garzelli, M V; Geutersloh, S; Heilbronn, L; Lantz, M; Lebourgeois, M; Lee, K T; Lukasik, G; Mairani, A; Margiotta, A; Mayes, B; Miller, J; Morone, M C; Mostacci, A; Muraro, S; Parodi, K; Patera, V; Pelliccioni, M; Ranft, J; Reddell, B; Roesler, S; Rollet, S; Sala, P R; Sarchiapone, L; Sioli, M; Smirnov, G; Sommerer, F; Theis, C; Trovati, S; Villari, R; Vinke, H; Vlachoudis, V; Vollaire, J; Wilson, T; Zapp, N; Zeitlin, C

    2010-01-01

    Motivated by differences in the predicted fragmentation of heavy ions at energies around 5 GeV/A as employed in the event generators used by the FLUKA Monte Carlo Code [1], a set of measurements were carried out at the AGS facility at the Brookhaven National Laboratory to determine as much information as possible about the cross sections to allow harmonization of those event generators for these incident lab energies. The FLUKA Code employs the RQMD event generator of Sorge [2] for heavy ion interactions starting at 100 MeV/A and extending into the region around 5 GeV/A. Above those energies the DPMJET code of Ranft and Roesler [3] is typically employed to simulate such interactions. The detailed predictions of these event generators had some disagreement in the vicinity of this crossover energy and in order to tune these codes to be in closer harmony at the transition, and of course to be simulating nature as closely as possible, data were taken at 3, 5 and 10 GeV/A with beams of Fe, Si and C on a variety of...

  15. Size-Controlled Water-Soluble Ag Nanoparticles

    OpenAIRE

    Dominguez-Vera, J. M.; Galvez, N.; Sanchez, P; A. J. Mota; Trasobares Llorente, Susana; Hernandez, J.C.; Calvino Gámez, José Juan

    2007-01-01

    Ag nanoparticles of two different sizes (1 and 4 nm) were prepared within an apoferritin cavity by using an Ag+-loaded apoferritin as a nanoconfined environment for their construction. The initial amount of Ag' ions injected in the apoferritin cavity dictates the size of the final Ag particles. The protein shell prevents bulk aggregation of the metal particles, which renders them water soluble and extremely stable.

  16. Study of structural modification of PVA by incorporating Ag nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Saini, Isha; Sharma, Annu, E-mail: asharma@kuk.ac.in; Rozra, Jyoti; Aggarwal, Sanjeev [Department of Physics, Kurukshetra University, Kurukshetra 136119 (India); Dhiman, Rajnish [Department of Physics and Chemistry, University of Southern Denmark, Campusvej 55, DK-5230 Odense M (Denmark); Sharma, Pawan K. [Department of Chemistry, Kurukshetra University, Kurukshetra 136119 (India)

    2016-05-23

    Nanocomposites of PVA with Ag nanoparticles dispersed in it were synthesized using solution casting method. The morphology and size distribution of Ag nanoparticles embedded in PVA matrix were obtained by transmission electron microscopy (TEM) and Field emission scanning electron microscopy (FE-SEM). Raman spectroscopy was used to examine structural changes taking place inside polyvinyl alcohol (PVA) matrix due to incorporation of Ag nanoparticle. Raman analysis indicates that Ag nanoparticles interact with PVA through H-bonding.

  17. Antifungal Applications of Ag-Decorated Hydroxyapatite Nanoparticles

    OpenAIRE

    Zamperini, C. A.; André, R. S.; Longo, V. M.; Mima, E. G.; Vergani, C. E.; Machado, A. L.; Varela, J. A.; Longo, E.

    2013-01-01

    Pure hydroxyapatite (HA) and hydroxyapatite decorated with silver (HA@Ag) nanoparticles were synthesized and characterized. The antifungal effect of HA@Ag nanoparticles in a distilled water solution was evaluated against Candida albicans. The origin of the antifungal activity of the HA@Ag is also discussed. The results obtained showed that the HA nanorod morphology remained the same with Ag ions decorations on the HA structure which were deposited in the form of nanospheres. Interaction where...

  18. Study of structural modification of PVA by incorporating Ag nanoparticles

    DEFF Research Database (Denmark)

    Saini, I.; Sharma, A.; Rozra, J.

    2016-01-01

    Nanocomposites of PVA with Ag nanoparticles dispersed in it were synthesized using solution casting method. The morphology and size distribution of Ag nanoparticles embedded in PVA matrix were obtained by transmission electron microscopy (TEM) and Field emission scanning electron microscopy (FE......-SEM). Raman spectroscopy was used to examine structural changes taking place inside polyvinyl alcohol (PVA) matrix due to incorporation of Ag nanoparticle. Raman analysis indicates that Ag nanoparticles interact with PVA through H-bonding. © 2016 Author(s)....

  19. Communication: Kinetics of chemical ordering in Ag-Au and Ag-Ni nanoalloys

    Science.gov (United States)

    Calvo, F.; Fortunelli, A.; Negreiros, F.; Wales, D. J.

    2013-09-01

    The energy landscape and kinetics of medium-sized Ag-Au and Ag-Ni nanoalloy particles are explored via a discrete path sampling approach, focusing on rearrangements connecting regions differing in chemical order. The highly miscible Ag27Au28 supports a large number of nearly degenerate icosahedral homotops. The transformation from reverse core-shell to core-shell involves large displacements away from the icosahedron through elementary steps corresponding to surface diffusion and vacancy formation. The immiscible Ag42Ni13 naturally forms an asymmetric core-shell structure, and about 10 eV is required to extrude the nickel core to the surface. The corresponding transformation occurs via a long and smooth sequence of surface displacements. For both systems the rearrangement kinetics exhibit Arrhenius behavior. These results are discussed in the light of experimental observations.

  20. High-Reliability Low-Ag-Content Sn-Ag-Cu Solder Joints for Electronics Applications

    Science.gov (United States)

    Shnawah, Dhafer Abdulameer; Said, Suhana Binti Mohd; Sabri, Mohd Faizul Mohd; Badruddin, Irfan Anjum; Che, Fa Xing

    2012-09-01

    Sn-Ag-Cu (SAC) alloy is currently recognized as the standard lead-free solder alloy for packaging of interconnects in the electronics industry, and high- Ag-content SAC alloys are the most popular choice. However, this choice has been encumbered by the fragility of the solder joints that has been observed in drop testing as well as the high cost of the Ag itself. Therefore, low-Ag-content SAC alloy was considered as a solution for both issues. However, this approach may compromise the thermal-cycling performance of the solders. Therefore, to enhance the thermal-cycling reliability of low-Ag-content SAC alloys without sacrificing their drop-impact performance, alloying elements such as Mn, Ce, Ti, Bi, In, Sb, Ni, Zn, Al, Fe, and Co were selected as additions to these alloys. However, research reports related to these modified SAC alloys are limited. To address this paucity, the present study reviews the effect of these minor alloying elements on the solder joint reliability of low-Ag-content SAC alloys in terms of thermal cycling and drop impact. Addition of Mn, Ce, Bi, and Ni to low-Ag-content SAC solder effectively improves the thermal-cycling reliability of joints without sacrificing the drop-impact performance. Taking into consideration the improvement in the bulk alloy microstructure and mechanical properties, wetting properties, and growth suppression of the interface intermetallic compound (IMC) layers, addition of Ti, In, Sb, Zn, Al, Fe, and Co to low-Ag-content SAC solder has the potential to improve the thermal-cycling reliability of joints without sacrificing the drop-impact performance. Consequently, further investigations of both thermal-cycling and drop reliability of these modified solder joints must be carried out in future work.

  1. Surface-enhanced Raman scattering from AgNP-graphene-AgNP sandwiched nanostructures

    Science.gov (United States)

    Wu, Jian; Xu, Yijun; Xu, Pengyu; Pan, Zhenghui; Chen, Sheng; Shen, Qishen; Zhan, Li; Zhang, Yuegang; Ni, Weihai

    2015-10-01

    We developed a facile approach toward hybrid AgNP-graphene-AgNP sandwiched structures using self-organized monolayered AgNPs from wet chemical synthesis for the optimized enhancement of the Raman response of monolayer graphene. We demonstrate that the Raman scattering of graphene can be enhanced 530 fold in the hybrid structure. The Raman enhancement is sensitively dependent on the hybrid structure, incident angle, and excitation wavelength. A systematic simulation is performed, which well explains the enhancement mechanism. Our study indicates that the enhancement resulted from the plasmonic coupling between the AgNPs on the opposite sides of graphene. Our approach towards ideal substrates offers great potential to produce a ``hot surface'' for enhancing the Raman response of two-dimensional materials.We developed a facile approach toward hybrid AgNP-graphene-AgNP sandwiched structures using self-organized monolayered AgNPs from wet chemical synthesis for the optimized enhancement of the Raman response of monolayer graphene. We demonstrate that the Raman scattering of graphene can be enhanced 530 fold in the hybrid structure. The Raman enhancement is sensitively dependent on the hybrid structure, incident angle, and excitation wavelength. A systematic simulation is performed, which well explains the enhancement mechanism. Our study indicates that the enhancement resulted from the plasmonic coupling between the AgNPs on the opposite sides of graphene. Our approach towards ideal substrates offers great potential to produce a ``hot surface'' for enhancing the Raman response of two-dimensional materials. Electronic supplementary information (ESI) available: Additional SEM images, electric field enhancement profiles, Raman scattering spectra, and structure-dependent peak ratios. See DOI: 10.1039/c5nr04500b

  2. Prevalence of HBsAg Among Prospective Blood Donors and ...

    African Journals Online (AJOL)

    This study was aimed at determining the prevalence of Hepatitis B surface antigen ( HBsAg) among prospective blood donors and pregnant women in Kebbi State, Nigeria. Three hundred and sixty one (361) apparently healthy prospective blood donors were recruited and screened for HBsAg using HBsAg rapid test kit.

  3. AGS experiments -- 1996, 1997, 1998, 1999. Fifteenth edition

    Energy Technology Data Exchange (ETDEWEB)

    Lo Presti, P.

    1999-03-01

    This report is a compilation of two-page summaries for AGS experiments for FY 1996, FY 1997, FY 1998, FY 1999. The bulk of the experiments are for high energy physics and nuclear physics programs. Also included are the run schedules for the AGS for each of those years and a listing of publications of AGS experiments for 1982--1999.

  4. Effect of an Ag buffer layer on a Cu/Ag/Si system

    Energy Technology Data Exchange (ETDEWEB)

    Yukawa, M.; Kitagawa, H.; Iida, S

    2004-10-15

    It is well known that Cu reacts with Si to form copper silicide, even at room temperature. To prevent copper silicide from forming on an Si substrate when Cu is used for wiring or as electrodes, it is necessary to place a buffer layer between Cu and the Si substrate. Silver works as a buffer layer between Cu and the Si substrate to form a layered Cu/Ag/Si structure. In the present paper, we determine the minimum effective Ag buffer layer thickness to prevent Cu diffusing into the Si substrate. The results show that Cu can reach the Si substrate through a 5 nm thick Ag film, but that a 50 nm film prevents Cu from diffusing through to the Si substrate. Using scanning electron microscopy (SEM) to observe the interface layer, it was found that round Ag islands form on the Si substrate, whereas Cu appears as a few large square islands and a lot of small clusters. The small Cu clusters tended to wedge into the gaps between the Ag islands. Furthermore, the results indicate that Cu and Ag repel each other.

  5. Effect of nano/micro-Ag compound particles on the bio-corrosion, antibacterial properties and cell biocompatibility of Ti-Ag alloys.

    Science.gov (United States)

    Chen, Mian; Yang, Lei; Zhang, Lan; Han, Yong; Lu, Zheng; Qin, Gaowu; Zhang, Erlin

    2017-06-01

    In this research, Ti-Ag alloys were prepared by powder metallurgy, casting and heat treatment method in order to investigate the effect of Ag compound particles on the bio-corrosion, the antibacterial property and the cell biocompatibility. Ti-Ag alloys with different sizes of Ag or Ag-compounds particles were successfully prepared: small amount of submicro-scale (100nm) Ti 2 Ag precipitates with solid solution state of Ag, large amount of nano-scale (20-30nm) Ti 2 Ag precipitates with small amount of solid solution state of Ag and micro-scale lamellar Ti 2 Ag phases, and complete solid solution state of Ag. The mechanical tests indicated that both nano/micro-scale Ti 2 Ag phases had a strong dispersion strengthening ability and Ag had a high solid solution strengthening ability. Electrochemical results shown the Ag content and the size of Ag particles had a limited influence on the bio-corrosion resistance although nano-scale Ti 2 Ag precipitates slightly improved corrosion resistance. It was demonstrated that the nano Ag compounds precipitates have a significant influence on the antibacterial properties of Ti-Ag alloys but no effect on the cell biocompatibility. It was thought that both Ag ions release and Ti 2 Ag precipitates contributed to the antibacterial ability, in which nano-scale and homogeneously distributed Ti 2 Ag phases would play a key role in antibacterial process. Copyright © 2017 Elsevier B.V. All rights reserved.

  6. Preparation of Ag@AgCl-doped TiO2/sepiolite and its photocatalytic mechanism under visible light.

    Science.gov (United States)

    Liu, Shaomin; Zhu, Dinglong; Zhu, Jinglin; Yang, Qing; Wu, Huijun

    2017-10-01

    A cube-like Ag@AgCl-doped TiO2/sepiolite (denoted Ag@AgCl-TiO2/sepiolite) was successfully synthesized via a novel method. X-ray diffraction, scanning electron microscopy, energy dispersion X-ray fluorescence, X-ray photoelectron spectroscopy, Fourier transform infrared spectroscopy, and diffuse reflectance ultraviolet-visible spectroscopy were performed to determine the structure and physicochemical properties of Ag@AgCl-TiO2/sepiolite. SEM micrographs revealed that Ag@AgCl nanoparticles and TiO2 film are well deposited on the surface of tube-like sepiolite. As a result, Ag@AgCl-TiO2/sepiolite exhibits a red shift relative to TiO2/sepiolite. Photocatalytic experiments demonstrated that the dosage of catalysts plays an important role during photocatalysis. The photoelectrochemical activities of Ag@AgCl-TiO2/sepiolite and TiO2/sepiolite were also investigated. Photocurrent responses confirmed that the ability of Ag@AgCl-TiO2/sepiolite to separate photo-generated electron-hole pairs is stronger than that of TiO2/sepiolite. Methylene Blue degradation is also improved under alkaline conditions and visible light irradiation because more OH is produced by visible light excitation. This excellent catalytic ability is mainly attributed to the formed Ag nanoparticles and the Schottky barrier at the Ag/TiO2 interface. Active species analysis indicated that O2- and h+ are implicated as active species in photocatalysis. Therefore, catalysts are excited to produce abundant electron-hole pairs after they absorb photons in photocatalysis. Copyright © 2017. Published by Elsevier B.V.

  7. Biochemical Synthesis of Ag/AgCl Nanoparticles for Visible-Light-Driven Photocatalytic Removal of Colored Dyes

    OpenAIRE

    Xiyun Zhao; Jie Zhang; Binsong Wang; Amir Zada; Muhammad Humayun

    2015-01-01

    Photocatalytic removal of organic pollution such as waste colored dyes was a promising technique for environment technique. However, effective photocatalysts were needed to enhance the photocatalytic efficiency. Ag/AgCl was regarded as high performance catalyst for photocatalytic degradation. Ag/AgCl nanoparticles were biochemically prepared with metabolin of living fungi which was used as reductant and characterized by X-Ray diffraction (XRD), UV-visible spectroscopy and transmission electro...

  8. Biochemical Synthesis of Ag/AgCl Nanoparticles for Visible-Light-Driven Photocatalytic Removal of Colored Dyes

    Directory of Open Access Journals (Sweden)

    Xiyun Zhao

    2015-04-01

    Full Text Available Photocatalytic removal of organic pollution such as waste colored dyes was a promising technique for environment technique. However, effective photocatalysts were needed to enhance the photocatalytic efficiency. Ag/AgCl was regarded as high performance catalyst for photocatalytic degradation. Ag/AgCl nanoparticles were biochemically prepared with metabolin of living fungi which was used as reductant and characterized by X-Ray diffraction (XRD, UV-visible spectroscopy and transmission electron microscopy (TEM. The Ag/AgCl nanoparticle composites showed spherical aggregation shape with an average size of about 3–5 nm which is well inside the quantum regime. The UV-visible study showed that Ag/AgCl nanoparticles had strong visible light absorption and exhibited excellent visible-light-driven photocatalytic performance. Photocatalytic results indicated that the obtained Ag/AgCl nanoparticles were suitable for photocatalytic removal of RhB dye under visible light irradiation. The excellent photocatalytic activities could be attributed to the quantum size nanoparticles and the Plasmon resonance of Ag/AgCl composites.

  9. New insight into daylight photocatalysis of AgBr@Ag: synergistic effect between semiconductor photocatalysis and plasmonic photocatalysis.

    Science.gov (United States)

    Jiang, Jing; Li, Hao; Zhang, Lizhi

    2012-05-14

    Noble metal nanoparticles (NPs) are often used as electron scavengers in conventional semiconductor photocatalysis to suppress electron-hole (e(-)-h(+) ) recombination and promote interfacial charge transfer, and thus enhance photocatalytic activity of semiconductors. In this contribution, it is demonstrated that noble metal NPs such as Ag NPs function as visible-light harvesting and electron-generating centers during the daylight photocatalysis of AgBr@Ag. Novel Ag plasmonic photocatalysis could cooperate with the conventional AgBr semiconductor photocatalysis to enhance the overall daylight activity of AgBr@Ag greatly because of an interesting synergistic effect. After a systematic investigation of the daylight photocatalysis mechanism of AgBr@Ag, the synergistic effect was attributed to surface plasmon resonance induced local electric field enhancement on Ag, which can accelerate the generation of e(-)-h(+) pairs in AgBr, so that more electrons are produced in the conduction band of AgBr under daylight irradiation. This study provides new insight into the photocatalytic mechanism of noble metal/semiconductor systems as well as the design and fabrication of novel plasmonic photocatalysts. Copyright © 2012 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  10. In situ oxidation synthesis of Ag/AgCl core-shell nanowires and their photocatalytic properties.

    Science.gov (United States)

    Bi, Yingpu; Ye, Jinhua

    2009-11-21

    Ag/AgCl core-shell nanowires with uniform structure have been synthesized in large quantities via an in situ oxidation reaction between pentagonal Ag nanowires and FeCl(3) solution at room temperature, which exhibit excellent photocatalytic performance for decomposition of methylene orange under visible-light irradiation.

  11. Ag/AgCl Loaded Bi2WO6 Composite: A Plasmonic Z-Scheme Visible Light-Responsive Photocatalyst

    Directory of Open Access Journals (Sweden)

    Xiangchao Meng

    2016-01-01

    Full Text Available Hierarchical flower-like Bi2WO6 was successfully synthesized by facile hydrothermal method at low pH. And Ag/AgCl was loaded by photoreduction on its surface. As-prepared photocatalysts were characterized by various techniques. Bi2WO6 was successfully synthesized at a size of 2-3 μm. Depositing Ag/AgCl did not destroy the crystal structure, and both Ag+ and metallic Ag0 were found. The band gap of the composite was 2.57 eV, which indicates that visible light could be the activating irradiation. In the photocatalytic activity test, the composite with 10 wt% Ag/AgCl boasted the highest removal efficiency (almost 100% in 45 min. The significant enhancement can be attributed to the surface plasmon resonance (SPR effect and the establishment of heterostructures between Ag/AgCl and Bi2WO6. A possible mechanism of photocatalytic oxidation in the presence of Ag/AgCl-Bi2WO6 was proposed. This work sheds light on the potential applications of plasmonic metals in photocatalysis to enhance their activities.

  12. Enhanced thermal stability of Ag nanorods through capping

    Energy Technology Data Exchange (ETDEWEB)

    Bachenheimer, Lou; Elliott, Paul [Department of Mechanical Engineering, University of Connecticut, Storrs, Connecticut 06269 (United States); Stagon, Stephen [Department of Mechanical Engineering, University of North Florida, Jacksonville, Florida 32224 (United States); Huang, Hanchen, E-mail: h.huang@neu.edu [Department of Mechanical and Industrial Engineering, Northeastern University, Boston, Massachusetts 02115 (United States)

    2014-11-24

    Ag nanorods may serve as sensors in the detection of trace amounts of chemical agents, even single molecules, through surface enhanced Raman spectroscopy (SERS). However, thermal coarsening of Ag nanorods near room temperature limits their applications. This letter proposes the use of a thin oxide capping layer to enhance the thermal stability of Ag nanorods beyond 100 °C. Using electron microscopy characterization and SERS tests, the authors show that the proposed method is effective in stabilizing both morphology and sensitivity of Ag nanorods. The results of this work extend the applicability of Ag nanorods as chemical sensors to higher temperatures.

  13. The strange diffusivity of Ag atoms in CdTe

    CERN Document Server

    Wolf, H; Ostheimer, V; Schachtrup, A R; Stolwijk, N A; Wichert, T

    2001-01-01

    The diffusion of Ag atoms in CdTe was investigated using the radiotracer $^{111}\\!$Ag, which was introduced by implantation with an energy of 60 or 80 keV. The measured diffusion profiles are explained by assuming the existence of a repulsive interaction between Ag and residual Cu atoms causing a drift of the Ag atoms towards the centre of the crystal, which supposes the diffusion in a concentration gradient. This effect vanishes if the Ag concentration is increased and becomes more pronounced if the crystals are simultaneously co- doped with Cu. (11 refs).

  14. Hierarchical Ag mesostructures for single particle SERS substrate

    Energy Technology Data Exchange (ETDEWEB)

    Xu, Minwei, E-mail: xuminwei@xjtu.edu.cn; Zhang, Yin

    2017-01-30

    Highlights: • Hierarchical Ag mesostructures with the size of 250, 360 and 500 nm are synthesized via a seed-mediated approach. • The Ag mesostructures present the tailorable size and highly roughened surfaces. • The average enhancement factors for individual Ag mesostructures were estimated to be as high as 10{sup 6}. - Abstract: Hierarchical Ag mesostructures with highly rough surface morphology have been synthesized at room temperature through a simple seed-mediated approach. Electron microscopy characterizations indicate that the obtained Ag mesostructures exhibit a textured surface morphology with the flower-like architecture. Moreover, the particle size can be tailored easily in the range of 250–500 nm. For the growth process of the hierarchical Ag mesostructures, it is believed that the self-assembly mechanism is more reasonable rather than the epitaxial overgrowth of Ag seed. The oriented attachment of nanoparticles is revealed during the formation of Ag mesostructures. Single particle surface enhanced Raman spectra (sp-SERS) of crystal violet adsorbed on the hierarchical Ag mesostructures were measured. Results reveal that the hierarchical Ag mesostructures can be highly sensitive sp-SERS substrates with good reproducibility. The average enhancement factors for individual Ag mesostructures are estimated to be about 10{sup 6}.

  15. Nanojoining of crossed Ag nanowires: a molecular dynamics study

    Energy Technology Data Exchange (ETDEWEB)

    Cui, Jianlei, E-mail: cjlxjtu@mail.xjtu.edu.cn; Wang, Xuewen; Barayavuga, Theogene; Mei, Xuesong; Wang, Wenjun [Xi’an Jiaotong University, State Key Laboratory for Manufacturing Systems Engineering (China); He, Xiaoqiao, E-mail: bcxqhe@cityu.edu.hk [City University of Hong Kong, Department of Architecture and Civil Engineering (Hong Kong)

    2016-07-15

    Ag nanowires are considered to be the promising candidates for future electronic circuit owing to the excellent electrical and thermal properties, with the miniaturization of electronics devices into nanometer scale. Though interconnect technology between Ag nanowires (Ag NWs) is essential for nanofunctional devices, it lacks sufficient experimental data. Besides, the determination of Ag NW interconnection configuration is experimentally difficult to do for lacking the sufficient investigation of atomic configuration evolution during nanojoining process. So the nanojoining between the crossed Ag NWs with the same diameter of 2 nm and different lengths was performed by molecular dynamics simulation to explain the unclear nanojoining mechanism based on thermal effect. As the simulation results present, when the nanojoining temperature is relatively high, though the Ag NWs are connected with the interpenetration effect of Ag atoms at the crossed nanojunction area, the nanostructures of Ag NWs have been seriously deformed with shorter length and larger diameter, showing relatively more obvious melting characteristics based on the chaotic atomic structures. If the temperature is reduced to 300 K as cold welding, the crossed Ag NWs can be partially contacted with the partial mixture of Ag atoms, and the interstices always exist between the Si surface and the upper Ag nanowire. In addition, the obvious dislocation phenomenon will appear and evolve as time goes on. Consequently, the dominant mechanism was revealed for providing a fundamental understanding of how ‘hot’ and ‘cold’ welding technology affects the atomic contact configuration, respectively.

  16. Microstructure evolution during 300 °C storage of sintered Ag nanoparticles on Ag and Au substrates

    Energy Technology Data Exchange (ETDEWEB)

    Paknejad, S.A. [King’s College London, Physics Department, Strand, London WC2R 2LS (United Kingdom); Dumas, G. [Eltek Semiconductors Ltd, Nelson Road Industrial Estate, Dartmouth, Devon TQ6 9LA (United Kingdom); West, G. [Loughborough University, Materials Department, Loughborough LE11 3TU (United Kingdom); Lewis, G. [Eltek Semiconductors Ltd, Nelson Road Industrial Estate, Dartmouth, Devon TQ6 9LA (United Kingdom); Mannan, S.H., E-mail: samjid.mannan@kcl.ac.uk [King’s College London, Physics Department, Strand, London WC2R 2LS (United Kingdom)

    2014-12-25

    Highlights: • Shear strength of pressure-free sintered Ag found to increase during ageing at 300 °C on Ag substrate. • Rapid collapse of void number density after 24 h ageing in the sintered Ag layer. • Higher porosity at edge of joint compared to the middle. • Shear strength of pressure-free sintered Ag decreases during ageing at 300 °C due to high porosity layer growth. • Void free layer and high porosity layer growth explained in terms of atomic diffusion and grain boundary migration. - Abstract: A silver nanoparticle based die attach material was used in a pressure free process to bond 2.5 mm square Ag plated Si die to Ag and Au plated substrates. The assemblies were stored at 300 °C for up to 500 h and the morphology of the sintered Ag and the shear strength were monitored as a function of time. On Ag substrate it was found that die shear strength increased and that the Ag grains grew in size and porosity decreased over time. There was also a clear difference in morphology between sintered Ag at the die edge and centre. On Au substrate, it was observed that the initially high die shear strength decreased with storage time and that voids migrated away from the Ag/Au interface and into the Ag joint. This has led to the formation of a void free layer at the interface followed by a high porosity region, which weakened the joint. The microstructure reveals a high density of grain and twin boundaries which facilitate the Ag and Au atomic diffusion responsible. The grain structure of the plated Au led to diffusion of Au into the Ag via high-angle tilt grain boundaries, and grain boundary migration further dispersed the Au into the Ag layer.

  17. Preparation of Ag nanoparticle dispersed silk fibroin compact

    Science.gov (United States)

    Yu, Weidong; Kuzuya, Toshihiro; Hirai, Shinji; Tamada, Yasushi; Sawada, Ken; Iwasa, Tatsuo

    2012-12-01

    We prepared a silk fibroin compact in which Ag nanoparticles (Ag NPs) were dispersed, by adding only silver nitrate (AgNO3) to a silk fibroin solution without using any reducing agent. FT-IR and DSC revealed that the formation of Ag NPs distorted the conformation of the silk fibroin. However, the Ag NPs did not affect the thermal stability of the silk fibroin compact. An antimicrobial test against Escherichia coli (E. coli) was performed using the silk fibroin compact in which Ag NPs were dispersed. The compact showed sufficient antimicrobial activity because the average survival of E. coli was 1.6% after 8 h incubation even when the silver content was 0.01 wt%. The addition of Ag NPs into silk fibroin compact can provide color and an antimicrobial function without spoiling the function of the silk fibroin compact.

  18. The effect of AgNO3 concentration on formation of Ag nanoparticles in Sol-Gel derived Ag-SiO2 thin films

    Directory of Open Access Journals (Sweden)

    A Babapour

    2007-12-01

    Full Text Available   In this investigation, Ag-SiO2 thin films with different concentrations of Ag (0.2, 0.4, 1.6 and 8% has been fabricated on soda-lime glass substrate using sol-gel method. After an annealing process, physical and chemical properties of the deposited silica films containing Ag nanoparticles have been studied including optical, topographical structural, morphological and size of the nanoparticle as well as their distribution using UV-visble spectrophotometery, atomic force microscopy (AFM, scanning electron microscopy (SEM, and transmission electron microscopy (TEM techniques, respectively. Based on our data analysis, the Ag nanoparticles did not form in the samples with low (0.2% and high Ag concentrations (8%, without any suitable annealing process. Instead, the nanoparticles were formed easily for the intermediate Ag concentrations. In fact, for the the low and high Ag concentration, the Ag nanoparticles formed at the annealing temperature of 200 º C. In addition, according to TEM observations, the minimum average size of the synthesized particles were determined about 4 hm for the thin films containing 0.2% Ag concentration.

  19. Spots on AG Virginis - Paradigm or panacea?

    Science.gov (United States)

    Bell, S. A.; Rainger, P. P.; Hilditch, R. W.

    1990-12-01

    New photometric and spectroscopic observations of the eclipsing binary AG Vir are presented. Medium-resolution spectroscopy has allowed the measurement of velocities for the secondary component for the first time. The V light curve shows many of the features seen in previous studies of this system. A full analysis of the spectroscopic and photometric data has been made which suggests that the system is either in a marginal state of conatact or a deep-contact configuration depending on the type of spot model invoked. AG Vir constitutes an excellent example of the expected manifestations of spot activity on a light curve. It also demonstrates the ease with which the spot phenomenon can be invoked to explain the appearance of a light curve and to provide conflicting results. This study shows the necessity of a more thorough investigation of this system using Doppler-imaging techniques and simultaneous infrared and optical photometry.

  20. Spots on AG Virginis - paradigm or panacea

    Energy Technology Data Exchange (ETDEWEB)

    Bell, S.A.; Rainger, P.P.; Hilditch, R.W. (Saint Andrews Univ. (UK). Observatory)

    1990-12-15

    New photometric and spectroscopic observations of the eclipsing binary AG Vir are presented. Medium-resolution spectroscopy has allowed the measurement of velocities for the secondary component for the first time. The V light curve shows many of the features seen in previous studies of this system. A full analysis of the spectroscopic and photometric data has been made which suggests that the system is either in a marginal state of contact or a deep-contact configuration depending on the type of spot model invoked. AG Vir constitutes an excellent example of the expected manifestations of spot activity on a light curve. It also demonstrates the ease with which the spot phenomenon can be invoked to explain the appearance of a light curve and to provide conflicting results. (author).

  1. Ab initio Study of Ag-Based Fluoroperovskite AgMF3 (M = Co and Ni) Compounds

    Science.gov (United States)

    Mubarak, A. A.

    2017-10-01

    Ab initio calculations of Ag-based fluoroperovskite AgMF3 (M = Co and Ni) compounds are investigated using the full-potential linearized augmented plane wave method. Wien2k and BoltzTrap codes are used to calculate the different physical properties. The structural parameters of the present compounds are within reasonable agreement with previous calculations. This study shows that AgCoF3 and AgNiF3 are anisotropic, ductile, mechanically and thermodynamically stable␣compounds, where AgCoF3 is found to be stiffer and less compressible than AgNiF3. The spin-polarized electronic band structure illustrates that AgCoF3 is metallic, while AgNiF3 is a semiconductor with indirect (M-D) band gap energy of 0.43 eV. The bonding force between atoms is found to be mainly ionic with some covalent nature. The total magnetic moment of AgCoF3 (3.04 μ B) is found to be higher than that calculated for AgNiF3 (2.00 μ B). Using the magnetic susceptibility calculations, AgCoF3 is classified as antiferromagnetic, whereas AgNiF3 is a ferromagnetic compound. The calculated static refractive index of AgCoF3 (3.85) and AgNiF3 (3.60) is inversely proportional with the energy band gap. Suitable␣applications are predicted for AgCoF3 and AgNiF3 based on their absorption and reflection properties. Furthermore, beneficial thermoelectric applications are expected for the present compounds due to their large Seebeck coefficient ( S_{{{{AgCoF}}_{ 3} }} = 2.92 × 103 μ {V/K} {and} S_{{{{AgNiF}}3 }} = 2.84 × 103 μ {V/K} ) and their thermoelectric power factor with respect to relaxation time ( S2 σ /t_{{AgNiF3 }} = 1.11 × 109 {W/K}^{ 2} {and} S2 σ /t_{{AgNiF3 }} = 1.28 × 10^{11} {W/K}^{ 2} ).

  2. KAJIAN ADSORPSI Ag(S2O323- DALAM LIMBAH FOTOGRAFI PADA ADSORBEN KITIN DAN ASAM HUMAT TERIMOBILISASI PADA KITIN

    Directory of Open Access Journals (Sweden)

    Fitri Khoerunnisa

    2007-12-01

    Full Text Available This work was started with isolation of humic acid from peat soil and chitin from crab shell, immobilization of humic acid on chitin, and characterization of adsorbents of C and HAC. Optimum condition was studied by interacting the adsorbents with Ag(S2O323- in a synthetic solution on various  of pH from 2 to 10. Adsorption rate was studied by interacting the adsorbent with Ag(S2O323- in the synthetic solution on various time from 2 to 120 minutes. The determination of the energy and the capacity of adsorption were studied by interacting the adsorbent with Ag(S2O323- on various initial concentration from 2 to 75 ppm. Moreover, the mechanism of adsorption was studied by applying a sequential desorption using H2O, Na2EDTA 0.1 M, KSCN 0.5 M, and KOH 1 M. The adsorption of Ag(S2O323- in photography wastewater on C and on HAC were studied at the same condition as obtained for the synthetic solution. The result showed that pH 2 was the optimum adsorption condition for Ag(S2O323- in the synthetic solution on both C and HAC adsorbents. Ag(S2O323- in the synthetic solution was chemically adsorbed on C and on HAC, involving energy adsorption of 22.74–23.30 kJ/mole, respectively. Adsorption of Ag(S2O323- on C was faster than that on HAC with the rate constants for adsorbent C and HAC were 73 x 10-4 and 46 x 10-4 minute-1, respectively. Adsorption capacity of Ag(S2O323- on C and on HAC were 2.107 x 10-4 and 1.818 x 10-4 mole/g, respectively. The amount of Ag(S2O323- in photography wastewater that was adsorbed on C and on HAC were 13.52 and 12.47 mg/L, respectively. The hydrogen bonding and ion exchange were the dominant mechanism of adsorption. Key words: Ag(S2O323-, adsorption, chitin, immobilization, humic acid.

  3. Ab initio Study of Ag-Based Fluoroperovskite AgMF3 (M = Co and Ni) Compounds

    Science.gov (United States)

    Mubarak, A. A.

    2018-01-01

    Ab initio calculations of Ag-based fluoroperovskite AgMF3 (M = Co and Ni) compounds are investigated using the full-potential linearized augmented plane wave method. Wien2k and BoltzTrap codes are used to calculate the different physical properties. The structural parameters of the present compounds are within reasonable agreement with previous calculations. This study shows that AgCoF3 and AgNiF3 are anisotropic, ductile, mechanically and thermodynamically stable compounds, where AgCoF3 is found to be stiffer and less compressible than AgNiF3. The spin-polarized electronic band structure illustrates that AgCoF3 is metallic, while AgNiF3 is a semiconductor with indirect (M-D) band gap energy of 0.43 eV. The bonding force between atoms is found to be mainly ionic with some covalent nature. The total magnetic moment of AgCoF3 (3.04 μ B) is found to be higher than that calculated for AgNiF3 (2.00 μ B). Using the magnetic susceptibility calculations, AgCoF3 is classified as antiferromagnetic, whereas AgNiF3 is a ferromagnetic compound. The calculated static refractive index of AgCoF3 (3.85) and AgNiF3 (3.60) is inversely proportional with the energy band gap. Suitable applications are predicted for AgCoF3 and AgNiF3 based on their absorption and reflection properties. Furthermore, beneficial thermoelectric applications are expected for the present compounds due to their large Seebeck coefficient ( S_{{{{AgCoF}}_{ 3} }} = 2.92 × 103 μ {V/K} {and} S_{{{{AgNiF}}3 }} = 2.84 × 103 μ {V/K} ) and their thermoelectric power factor with respect to relaxation time ( S2 σ /t_{{AgNiF3 }} = 1.11 × 109 {W/K}^{ 2} {and} S2 σ /t_{{AgNiF3 }} = 1.28 × 10^{11} {W/K}^{ 2} ).

  4. Quantitative serum HBsAg and HBeAg are strong predictors of sustained HBeAg seroconversion to pegylated interferon alfa-2b in HBeAg-positive patients.

    Science.gov (United States)

    Ma, Hui; Yang, Rui-Feng; Wei, Lai

    2010-09-01

    To evaluate the usefulness of quantitative hepatitis B surface antigen (HBsAg) and hepatitis B e antigen (HBeAg) for predicting HBeAg seroconversion in chronic hepatitis B patients treated with conventional interferon (IFN) alfa-2b or PegIFN alfa-2b. Fifty-eight patients were enrolled; 29 for the training group and 29 for the validating group. Quantification of HBsAg and HBeAg was carried out at baseline, week 12, week 24, and then again at 12 and 24 weeks follow up, respectively, for two groups. Sixteen patients in the training group were followed up for 5 years. The cutoff of 1500 IU/mL in serum HBsAg at week 12 had a positive predictive value (PPV) of 33% and a negative predictive value (NPV) of 91%, and 2890 IU/mL at week 24 had a PPV of 43% and an NPV of 95% for HBeAg seroconversion at week 48. The cutoff of 17.55 Paul Ehrlich Institute units/mL (PEI-U/mL) in serum HBeAg at week 12 had a PPV of 38% and an NPV of 95%, and 8.52 PEI-U/mL at week 24 had a PPV of 44% and a NPV of 100% for HBeAg seroconversion at week 48. Moreover the HBsAg and HBeAg levels of PegIFN alfa-2b group were lower than those of the conventional IFN alfa-2b group. During follow up, patients with HBeAg seroconversion remained HBeAg negative and none of them progressed to cirrhosis, but among the patients with non-HBeAg seroconversion, two progressed to cirrhosis. Two additional patients with negative HBeAg were observed. On-treatment serum HBsAg and HBeAg had high predictive values to predict sustained HBeAg seroconversion by PegIFN alfa-2b. Patients who cleared HBeAg had better survival free of hepatic complications during long-term follow-up study.

  5. Rotational structures in {sup 107}Ag

    Energy Technology Data Exchange (ETDEWEB)

    Espinoza-Quinones, F.R.; Cybulska, E.W.; Oliveira, J.R.; Ribas, R.V.; Medina, N.H.; Rao, M.N.; Rizzutto, M.A.; Emediato, L.G.; Seale, W.A.; Botelho, S. [Laboratorio Pelletron, Instituto de Fisica, Universidade de Sao Paulo, Sao Paulo (Brazil)

    1997-03-01

    The {sup 107}Ag nucleus has been investigated with the {sup 100}Mo({sup 11}B,4n{gamma}) reaction at 39 MeV beam energy. Gamma-gamma coincidences and angular correlations were measured. The ground state band has been extended to higher spins and a three-quasiparticle rotational band has been established. The results were interpreted within the cranked shell model and total Routhian surface predictions. {copyright} {ital 1997} {ital The American Physical Society}

  6. Multifunction of Ni/Ag Nanocompound Fluid

    Directory of Open Access Journals (Sweden)

    Mu-Jung Kao

    2013-01-01

    Full Text Available An arc-submerged nanoparticle synthesis system (ASNSS is proposed and developed for fabricating Ni/Ag nanocompound fluid. In the development process, the positive and negative electrodes in the system are Ni and Ag, respectively. Applied electrical energy then produces heating source by generating an adequate arc with a high temperature that can melt and vaporize the two electrodes. The nanocompound fluid that is generated by the synthesis system is analyzed by morphological analysis, Zeta potential analysis, heat conductivity analysis, magnetic characteristic analysis, and UV-Vis absorption spectra analysis. Experimental results show that increasing the concentration of added particles and the higher temperature can be helpful to the enhancement of thermal conductivity. The Ni/Ag nanofluid not only preserves the magnetic character of the nickel and the ability of silver to absorb visible light but also enhances the thermal conductivity. The absorption occurs at 406 nm wavelength (redshift from 396 nm to 406 nm, which means that, under the excitement of visible light range (400~700 nm, it can let more easy electrons jump to the conductivity zone from the valence electron zone.

  7. Sequestration of Ag(I) from aqueous solution as Ag(0) nanostructures by nanoscale zero valent iron (nZVI)

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Yalei, E-mail: zhangyalei2003@163.com [Tongji University, State Key Laboratory of Pollution Control and Resources Reuse (China); Yan, Jing [Tongji University, Modern Agricultural Science and Engineering Institute (China); Dai, Chaomeng, E-mail: daichaomeng@163.com, E-mail: daichaomeng@tongji.edu.cn [Tongji University, College of Civil Engineering (China); Li, Yuting; Zhu, Yan [Tongji University, Modern Agricultural Science and Engineering Institute (China); Zhou, Xuefei [Tongji University, State Key Laboratory of Pollution Control and Resources Reuse (China)

    2015-11-15

    This study investigates the application of nanoparticle zero valent iron (nZVI) to sequester Ag(I) as Ag(0) nanostructures from aqueous solution. Batch experiments were performed with nZVI exposed to aqueous Ag(I) to investigate the effects of environmental parameters, including nZVI dose, temperature and pH. High temperature facilitates Ag(I) sequestration, and the rate constants are determined to be 0.02, 0.12, and 0.31 mg L/m{sup 2} at 30, 50, and 60 °C, respectively. Ag(I) sequestration was adversely affected by adding nitric acid to the solution due to significant acid washing, decreasing the available nZVI active sites. Characterization techniques including TEM, XRD, and HR-XPS revealed that nZVI is oxidized to lepidocrocite and magnetite/maghemite and confirmed the formation of nanocrystalline silver. HR-XPS analysis indicated that Ag{sub 2}O forms rapidly as an intermediate due to Ag(I) adsorption onto the FeOOH layer. The Ag(0) nanostructures that are formed are fractal, spherical, and dendritic or rod-like, respectively, in morphology by FE-TEM images at different Ag/Fe mass ratios. A general reaction model for the interaction Ag(I) with nZVI is proposed. Our results suggest that nZVI is effective for Ag(I) removal.

  8. Highly efficient degradation of thidiazuron with Ag/AgCl- activated carbon composites under LED light irradiation.

    Science.gov (United States)

    Yang, Yisi; Zhang, Yan; Dong, Mingguang; Yan, Ting; Zhang, Maosheng; Zeng, Qingru

    2017-08-05

    Thidiazuron (TDZ; 1-phenyl-3-(1,2,3-thiadiazol-5-yl)urea) is one of the most widely used defoliant and easy to dissolve in surface water. Risk associated with the pesticide is not clearly defined, so it is important to remove/degrade TDZ with an efficient and environment friendly technology. Here, we investigated the use of Ag/AgCl-activated carbon (Ag/AgCl-AC) composites in photocatalytic degradation of TDZ under LED light. By the synergic effect of Ag/AgCl and AC, the optimum Ag/carbon weight ratio of 2:1 exhibited superior visible-light photocatalytic activity, the highest removal efficiency was close to 91% in pH 7 matrix. Different types of Ag/AgCl-AC composites were tested, all showed much faster photodegradation kinetics than bare Ag/AgCl in 210min. The degradation products as identified by HPLC-MS revealed that the hydroxylation by hydroxyl radicals and that of oxidation by superoxide radicals as well as holes were the two main pathways for TDZ degradation. Results revealed that the adsorption concentrated TDZ molecules and the photocatalytically generated radicals rapidly degradated TDZ, the two contributions functioned together for removal of the pollutant from water. Copyright © 2017 Elsevier B.V. All rights reserved.

  9. Directional solidification of YBaCuO thick films deposited by screen printing on Ag and Ag-Pd tapes

    Science.gov (United States)

    Piñol, S.; Najib, M.; Puig, T.; Obradors, X.; Xuriguera, H.; Segarra, M.

    2002-08-01

    Textured tapes of Ag{1 1 0} and polycrystalline tapes of Ag-Pd(0.5-12.5%) alloys have been prepared by cold rolling as possible substrates for deposition of high critical current density YBCO films. The Ag{1 1 0} texture with some twins was promoted by recrystallization after cold rolling from ingots prepared by melting and solidification of Ag powders. Nevertheless, no textured tapes were obtained by cold rolling from Ag-Pd alloys with Pd>0.5%. YBCO thick films (10-30 μm) were deposited on the metallic tapes by screen printing using organic inks. Biaxially textured superconducting thick films were observed on the Ag{1 1 0} substrates at low solidification rates. Nevertheless, uniaxial texture with some biaxial colonies of YBCO grains were found on Ag-Pd alloys when the superconducting phase was solidified at high rate.

  10. Visible light photocatalytic activity enhancement and mechanism of AgBr/Ag3PO4 hybrids for degradation of methyl orange.

    Science.gov (United States)

    Cao, Jing; Luo, Bangde; Lin, Haili; Xu, Benyan; Chen, Shifu

    2012-05-30

    Novel AgBr/Ag(3)PO(4) hybrids were synthesized via an in situ anion-exchange method and characterized by X-ray diffraction (XRD), field emission scanning electron microscopy (FE-SEM), energy-dispersive spectroscopy (EDS) and UV-vis diffuse reflectance spectroscopy (DRS). Under visible light (λ>420 nm), AgBr/Ag(3)PO(4) degraded methyl orange (MO) efficiently and displayed much higher photocatalytic activity than that of pure AgBr or Ag(3)PO(4). X-ray photoelectron spectroscopy (XPS) suggests that AgBr/Ag(3)PO(4) transformed to be Ag@AgBr/Ag(3)PO(4)@Ag system while remained good photocatalytic activity after 5 times of cycle experiments. In addition, the quenching effects of different scavengers proved that reactive OH and h(+) played the major role for the MO degradation. The photocatalytic activity enhancement of AgBr/Ag(3)PO(4) is closely related to the efficient separation of electron-hole pairs derived from the matching band potentials between AgBr and Ag(3)PO(4), as well as the good electron trapping role of Ag nanoparticles in situ formed on the surfaces of AgBr and Ag(3)PO(4) particles during the photocatalytic reaction. Copyright © 2012 Elsevier B.V. All rights reserved.

  11. Effect of Ag nanostructures and annealing process on the localized surface plasmon resonance properties of Ag-based AZO films

    Science.gov (United States)

    Jin, Jing; Hui, Chaoxian; Liu, Can; Shi, Weimin

    2017-08-01

    Ag nanoparticles were obtained in Ag/AZO and AZO/Ag/AZO films by magnetron sputtering method at room temperature with different deposition time. The morphology of Ag nanoparticles is strongly affected by the particle size, shape and distribution as well as annealing temperatures, which determine the optical response of films. The high quality of AZO film with better crystallinity can enhance the optical transmittance and a good coverage by AZO as top layer on Ag nanoparticles can also enhance the surface plasmon resonance (SPR) absorption of Ag in long wavelengths. The mechanisms involved in shifts and broadening of SPR peaks have been explained detailedly. The effect of annealing process on SPR of Ag and photoelectric properties of AZO/Ag/AZO films can be also discussed. It is shown that the SPR peak of 664 nm only appears in AZO/Ag (5 s)/AZO film and no SPR peaks are found in annealed AZO/Ag/AZO films. The AZO/Ag (20 s)/AZO film annealed at 300 °C shows a great figure of merit (F_{{TC}}) of 4.8 × 10-2 Ω-1 because of high visible optical average transmittance of 85% and low sheet resistance (R_{{S}}) of 4.1 Ω/sq. The overall results reveal that annealing process can improve the electrical property of film and may not be able to promote the SPR of Ag nanoparticles, especially when AZO top layer is added. The introduction of Ag nanoparticles in AZO/Ag/AZO films should be very effective for improving the SPR or photoelectric properties of films depending on deposition conditions and annealing process.

  12. Mechanisms of Toxicity of Ag Nanoparticles in Comparison to Bulk and Ionic Ag on Mussel Hemocytes and Gill Cells.

    Science.gov (United States)

    Katsumiti, Alberto; Gilliland, Douglas; Arostegui, Inmaculada; Cajaraville, Miren P

    2015-01-01

    Silver nanoparticles (Ag NPs) are increasingly used in many products and are expected to end up in the aquatic environment. Mussels have been proposed as marine model species to evaluate NP toxicity in vitro. The objective of this work was to assess the mechanisms of toxicity of Ag NPs on mussel hemocytes and gill cells, in comparison to ionic and bulk Ag. Firstly, cytotoxicity of commercial and maltose stabilized Ag NPs was screened in parallel with the ionic and bulk forms at a wide range of concentrations in isolated mussel cells using cell viability assays. Toxicity of maltose alone was also tested. LC50 values were calculated and the most toxic Ag NPs tested were selected for a second step where sublethal concentrations of each Ag form were tested using a wide array of mechanistic tests in both cell types. Maltose-stabilized Ag NPs showed size-dependent cytotoxicity, smaller (20 nm) NPs being more toxic than larger (40 and 100 nm) NPs. Maltose alone provoked minor effects on cell viability. Ionic Ag was the most cytotoxic Ag form tested whereas bulk Ag showed similar cytotoxicity to the commercial Ag NPs. Main mechanisms of action of Ag NPs involved oxidative stress and genotoxicity in the two cell types, activation of lysosomal AcP activity, disruption of actin cytoskeleton and stimulation of phagocytosis in hemocytes and increase of MXR transport activity and inhibition of Na-K-ATPase in gill cells. Similar effects were observed after exposure to ionic and bulk Ag in the two cell types, although generally effects were more marked for the ionic form. In conclusion, results suggest that most observed responses were due at least in part to dissolved Ag.

  13. Novel chloride-centered Ag18 clusters featuring a cuboctahedral Ag12 skeleton.

    Science.gov (United States)

    Shen, Hui; Kubo, Kazuyuki; Kume, Shoko; Zhang, Limin; Mizuta, Tsutomu

    2017-11-28

    Two novel chloride-centered Ag18 clusters with the same framework but different supporting phosphines are synthesized by the reaction of PhC[triple bond, length as m-dash]CAg, AgSbF6, PPh3 (or P(p-Tol)3), and NaBH4 in CH2Cl2, followed by the addition of PhC[triple bond, length as m-dash]CH and NEt3. The inner twelve Ag atoms of these two clusters are arranged in a rare cuboctahedral structure, which can be rationalized by considering a ligand effect. Through careful analysis, we find that the central chloride arises from a generally ignored but nonetheless existing reaction between CH2Cl2 and NEt3, which is well recognized as the Menshutkin reaction. This research provides insights into the dependence of the cluster structure on the nature of the ligand and into the cluster formation mechanism of the Menshutkin reaction.

  14. A nanosized {Ag@Ag12} "molecular windmill" templated by polyoxometalates anions.

    Science.gov (United States)

    Wang, Lei; Yang, Weiting; Zhu, Wei; Guan, Xingang; Xie, Zhigang; Sun, Zhong-Ming

    2014-11-03

    Reaction of multidentate 5-(4-imidazol-1-yl-phenyl)-2H-tetrazole (L) ligand with Ag(I) ions in the existence of H3PW12O40 as anionic template under hydrothermal conditions results in tridecanuclear silver cluster-polyoxometalates hybrid: {Ag13L12}{PW12O40}4·30H2O (1). X-ray single crystal diffraction analysis indicates that the main structural feature of 1 is a nanosized molecular windmill-shaped polynuclear Ag cluster with intriguing {M@M12}-type cuboctahedral topology. The as-synthesized compound exhibits effective photocatalytic activity in the photodegradation of Rhodamine-B (RhB) and antibacterial activity against Escherichia coli, respectively.

  15. High critical current Ag and Ag alloy sheathed multifilament Bi-2223 tapes

    DEFF Research Database (Denmark)

    Wang, W.G.; Han, Z.; Skov-Hansen, P.

    1999-01-01

    Ag sheathed Bi-2223 multifilament tapes with filament numbers of 19, 37, 55, and 85 were produced by the powder-in-tube method. Enhanced tape performance has been achieved by optimisation of the processing conditions. Key factors are addressed that include elimination of the 2212 phase, improving...... grain connectivity through reducing the 2201 phase and alkaline earth cuprate phases, increasing superconductor core density as well as enhancing current contribution from edge filaments. A high J(c) of 50 kA/cm(2) with an I-c of 42 A has been achieved reproducibly in 19 filament tapes with dimensions......-c of 32 A was achieved in 250 metres long standard tapes. A 1250 m long pure Ag sheathed tape and an 1100 m long Ag alloyed tape have been produced with a J(c) of higher than 25 kA/cm(2) by using optimised process parameters....

  16. Ag-AgBr/TiO2/RGO nanocomposite: Synthesis, characterization, photocatalytic activity and aggregation evaluation.

    Science.gov (United States)

    Wang, Penghua

    2017-06-01

    Ag-AgBr/TiO2 supported on reduced graphene oxide (Ag-AgBr/TiO2/RGO) with different mass ratios of grapheme oxide (GO) to TiO2 were synthesized via a facile solvothermal-photo reduction method. Compared to the single-, two- and three-component nanocomposites, the four-component nanocomposite, Ag-AgBr/TiO2/RGO-1 with mass ratio of GO to TiO2 at 1%, exhibited a much higher photocatalytic activity for the degradation of penicillin G (PG) under white light-emitting diode (LED-W) irradiation. The PG degradation efficiency increased with the increase of mass ratio of GO to TiO2 from 0.2% to 1%, then it decreased with the increase of mass ratio of GO to TiO2 from 1% to 5%. The zeta potentials of RGO-nanocomposites became more negative with the presence of humic acid (HA) due to the negatively charged HA adsorption, resulting in the shift of points of zero charge to lower values of pH. The aggregations of nanocomposites were more significant due to the bridging effect of HA. Furthermore, the aggregated particle sizes were larger for RGO-nanocomposites compared to other nanoparticles, due to the bindings of the carboxylic and phenolic functional groups in HA with the oxygen-containing functional groups in the RGO-nanocomposites. The microfiltration (MF) membrane was effective for the nanocomposites separation. In the continuous flow through submerged membrane photoreactor (sMPR) system, backwashing operation could efficiently reduce membrane fouling and recover TiO2, and thus indirectly facilitate the PG removal. Copyright © 2016. Published by Elsevier B.V.

  17. HBsAg blood screening and diagnosis: performance evaluation of the ARCHITECT HBsAg qualitative and ARCHITECT HBsAg qualitative confirmatory assays.

    Science.gov (United States)

    Popp, Christian; Krams, Doris; Beckert, Christian; Buenning, Carsten; Queirós, Lucinda; Piro, Loredana; Luciani, Marina; Roebbecke, Markus; Kapprell, Hans-Peter

    2011-08-01

    A low initial reactive rate for screening assays is important for time- and cost-effective infectious disease testing. Therefore, the new ARCHITECT HBsAg Qualitative screening assay, in conjunction with the new ARCHITECT HBsAg Qualitative Confirmatory assay, was introduced. As the role of hepatitis B surface antigen (HBsAg) as surrogate marker for HBV resolution and the monitoring of drug effectiveness are becoming increasingly important, the established ARCHITECT HBsAg Quantitative assay remains available on the market. Precision, sensitivity, and specificity of the newly developed screening assay were in the range of established HBsAg assays. Seroconversion sensitivity was slightly superior compared to other commercially available assays. An initial reactive rate of 0.2% (without HBsAg-confirmed positive samples of 0.17%) for the ARCHITECT HBsAg Qualitative assay was observed. As the new screening assay is a 1-step assay format, the "high-dose hook effect" was investigated to assess the risk of false-negative results, but even very high positive HBsAg samples obtained signals clearly above the cutoff. Copyright © 2011 Elsevier Inc. All rights reserved.

  18. AKTIVITAS ANTIBAKTERI KAIN KASA TERLAPISI TiO¬2/Ag AMORF, Ag, DAN KITOSAN/Ag TERHADAP BAKTERI GRAM NEGATIF DAN POSITIF (The Antibacterial Activity of Gauze Coated by Tio¬2/Ag Amorphous, Ag, and Chitosan/Ag Against Gram Negative and Positive Bacteria

    Directory of Open Access Journals (Sweden)

    Candra Purnawan

    2014-05-01

    Full Text Available ABSTRAK Pelapisan kain kasa dengan komposit TiO2/Ag amorf, kitosan/Ag, dan Ag telah dilakukan menggunakan metode dip coating dengan variasi urutan pelapisan. Komposit TiO2/Ag amorf disintesis dengan metode sol gel dalam pelarut etanol. Hasil sintesis dikarakterisasi menggunakan FTIR dan XRD. Kain kasa hasil pelapisan dikarakterisasi menggunakan XRD dan dilakukan uji antibakteri menggunakan metode optical density pada λ 600nm terhadap aktivitas bakteri Eschericia coli dan Stapylococcus aureus. Kain kasa dengan urutan pelapisan kitosan/Ag, komposit TiO2/Ag amorf, dan Ag memiliki daya antibakteri optimum. Daya antibakteri kain kasa terhadap E. coli sebesar 98, 66% setelah jam ke-24. Daya antibakteri tersebut lebih besar dibandingkan dengan daya antibakteri terhadap S. aureus yaitu 71,47% setelah jam ke-24.   ABSTRACT TiO2/Ag amorphous composite has been synthesized by sol gel method in ethanol. This composite  was characterized using FTIR and XRD. TiO2/Ag amorphous composite, chitosan/ Ag, and Ag coated in gauze using dip coating method with plating sequence variation. Coated gauze was characterized using XRD and antibacterial test was conducted by optical density at λ 600 nm against Escherichia coli and Staphylococcus aureus. The results showed that coated gauze with the sequence was chitosan/Ag, TiO2/Ag amorphous composite, and Ag was optimum antibacterial power. The inhibition against Escherichia coli was greater than Staphylococcus aureus. The inhibition against Escherichia coli was 98.66% for 24 hours and against Staphylococcus aureus was 71.47% for 24 hours.

  19. Nanoparticle Ag-enhanced textured-powder Bi-2212/Ag wire technology

    Science.gov (United States)

    Kellams, J. N.; McIntyre, P.; Pogue, N.; Vandergrifft, J.

    2015-12-01

    A new approach to the preparation of cores for Bi-2212/Ag wire is being developed. Nanoparticle Ag is homogeneously dispersed in Bi-2212 fine powder, and the mixture is uniaxially compressed to form highly textured, cold-sintered core rods. The rods can be assembled in a silver matrix, drawn to form multifilament wire, and restacked and drawn to form multifilament wire. Preliminary studies using tablet geometry demonstrate that a nonmelt heat treatment produces densification, grain growth, intergrowth among grains, and macroscopic current transport. The status of the development is reported.

  20. HBcrAg Identifies Patients Failing to Achieve HBeAg Seroconversion Treated with Pegylated Interferon Alfa-2b.

    Science.gov (United States)

    Ma, Hui; Yang, Rui-Feng; Li, Xiao-He; Jin, Qian; Wei, Lai

    2016-09-20

    We aimed to evaluate the usefulness of serum hepatitis B virus core-related antigens (HBcrAg) for predicting hepatitis B e antigen (HBeAg) seroconversion in HBeAg-positive chronic hepatitis B patients treated with conventional interferon (IFN) alfa-2b or pegylated IFN. Fifty-eight patients were enrolled: 29 for the training group and 29 for the validating group. HBcrAg was measured at baseline, week 12, end of the treatment, and 12- and 24-week follow-ups. Sixteen patients in the training group were enrolled in the long-term follow-up (LTFU), during which time the dynamics of the HBcrAg was monitored. The serum HBcrAg level gradually declined during treatment among the HBeAg seroconversion patients of the training group (from baseline, week 12, end of the treatment, 12-week follow-up to 24-week follow-up were 110,245 kU/ml, 3760 kU/ml, 7410 kU/ml, 715 kU/ml, 200 kU/ml, respectively). HBcrAg <19,565 kU/ml at week 24, HBcrAg <34,225 kU/ml at 12-week follow-up, and HBcrAg decrease ≥0.565 log10kU/ml from the baseline to the end of treatment (EOT) had negative predictive values (NPVs) of 100% for HBeAg seroconversion at the end of follow-up, whereas the positive predictive values (PPVs) were 30.77%, 26.67%, and 25.00%, respectively. The patients with HBeAg seroconversion at the end of 24-week follow-up remained in seroconversion during the LTFU, during which time their serum HBcrAg levels steadily declined or even became undetectable, ranging from 0 to 2.1 kU/ml. Effective antiviral treatment can decrease HBcrAg levels in the serum. The NPVs of HBcrAg for predicting HBeAg seroconversion at 24-week follow-up was 100%, but the PPVs were not satisfactory (all <31%). The serum HBcrAg levels of the patients with HBeAg seroconversion at the end of the 24-week follow-up steadily declined or even became undetectable during the LTFU.

  1. Ag-bridged Ag2O nanowire network/TiO2 nanotube array p-n heterojunction as a highly efficient and stable visible light photocatalyst.

    Science.gov (United States)

    Liu, Chengbin; Cao, Chenghao; Luo, Xubiao; Luo, Shenglian

    2015-03-21

    A unique Ag-bridged Ag2O nanowire network/TiO2 nanotube array p-n heterojunction (Ag-Ag2O/TiO2 NT) was fabricated by simple electrochemical method. Ag nanoparticles were firstly electrochemically deposited onto the surface of TiO2 NT and then were partly oxidized to Ag2O nanowires while the rest of Ag mother nanoparticles were located at the junctions of Ag2O nanowire network. The Ag-Ag2O/TiO2 NT heterostructure exhibited strong visible-light response, effective separation of photogenerated carriers, and high adsorption capacity. The integration of Ag-Ag2O self-stability structure and p-n heterojunction permitted high and stable photocatalytic activity of Ag-Ag2O/TiO2 NT heterostructure photocatalyst. Under 140-min visible light irradiation, the photocatalytic removal efficiency of both dye acid orange 7 (AO7) and industrial chemical p-nitrophenol (PNP) over Ag-Ag2O/TiO2 NT reached nearly 100% much higher than 17% for AO7 or 13% for PNP over bare TiO2 NT. After 5 successive cycles under 600-min simulated solar light irradiation, Ag-Ag2O/TiO2 NT remained highly stable photocatalytic activity. Copyright © 2014 Elsevier B.V. All rights reserved.

  2. Enhanced Visible Light Photocatalytic Degradation of Organic Pollutants over Flower-Like Bi2O2CO3 Dotted with Ag@AgBr

    Directory of Open Access Journals (Sweden)

    Shuanglong Lin

    2016-10-01

    Full Text Available A facile and feasible oil-in-water self-assembly approach was developed to synthesize flower-like Ag@AgBr/Bi2O2CO3 micro-composites. The photocatalytic activities of the samples were evaluated through methylene blue degradation under visible light irradiation. Compared to Bi2O2CO3, flower-like Ag@AgBr/Bi2O2CO3 micro-composites show enhanced photocatalytic activities. In addition, results indicate that both the physicochemical properties and associated photocatalytic activities of Ag@AgBr/Bi2O2CO3 composites are shown to be dependent on the loading quantity of Ag@AgBr. The highest photocatalytic performance was achieved at 7 wt % Ag@AgBr, degrading 95.18% methylene blue (MB after 20 min of irradiation, which is over 1.52 and 3.56 times more efficient than that of pure Ag@AgBr and pure Bi2O2CO3, respectively. Bisphenol A (BPA was also degraded to further demonstrate the degradation ability of Ag@AgBr/Bi2O2CO3. A photocatalytic mechanism for the degradation of organic compounds over Ag@AgBr/Bi2O2CO3 was proposed. Results from this study illustrate an entirely new approach to fabricate semiconductor composites containing Ag@AgX/bismuth (X = a halogen.

  3. Quantification of HBsAg to predict low levels and seroclearance in HBeAg-negative patients receiving nucleos(tide analogues.

    Directory of Open Access Journals (Sweden)

    Teresa Broquetas

    Full Text Available HBeAg-negative chronic hepatitis B patients require long-term nucleos(tide analogues(NAs because loss of surface antigen (HBsAg is unusual. Low quantitative HBsAg (qHBsAg levels can identify patients with higher probability of seroclearance. The aim of our study was to evaluate qHBsAg in HBeAg-negative patients receiving NAs to predict a reduction of HBsAg levels and seroclearance.Retrospective analysis of qHBsAg in HBeAg-negative patients before and at years 1, 3, 5, 8 and over of NAs treatment.From 1999 to 2015, HBsAg was quantified in 358 serum samples from 95 HBeAg-negative patients. Low qHBsAg (0.3 log IU/mL showing a positive and negative predictive value of 42% and 100% to identify patients achieving low levels of HBsAg.Reduction of qHBsAg is slow in HBeAg-negative patients receiving NAs, although low levels or faster qHBsAg decline may occur in 14%. A qHBsAg reduction >0.3 log IU/mL at year 3 can identify patients with a higher probability of achieving low levels and HBsAg seroclearance.

  4. Enhanced Visible Light Photocatalytic Degradation of Organic Pollutants over Flower-Like Bi2O2CO3 Dotted with Ag@AgBr

    Science.gov (United States)

    Lin, Shuanglong; Wang, Miao; Liu, Li; Liang, Yinghua; Cui, Wenquan; Zhang, Zisheng; Yun, Nan

    2016-01-01

    A facile and feasible oil-in-water self-assembly approach was developed to synthesize flower-like Ag@AgBr/Bi2O2CO3 micro-composites. The photocatalytic activities of the samples were evaluated through methylene blue degradation under visible light irradiation. Compared to Bi2O2CO3, flower-like Ag@AgBr/Bi2O2CO3 micro-composites show enhanced photocatalytic activities. In addition, results indicate that both the physicochemical properties and associated photocatalytic activities of Ag@AgBr/Bi2O2CO3 composites are shown to be dependent on the loading quantity of Ag@AgBr. The highest photocatalytic performance was achieved at 7 wt % Ag@AgBr, degrading 95.18% methylene blue (MB) after 20 min of irradiation, which is over 1.52 and 3.56 times more efficient than that of pure Ag@AgBr and pure Bi2O2CO3, respectively. Bisphenol A (BPA) was also degraded to further demonstrate the degradation ability of Ag@AgBr/Bi2O2CO3. A photocatalytic mechanism for the degradation of organic compounds over Ag@AgBr/Bi2O2CO3 was proposed. Results from this study illustrate an entirely new approach to fabricate semiconductor composites containing Ag@AgX/bismuth (X = a halogen). PMID:28774002

  5. Enhanced Photocatalytic Activity of Nanoparticle-Aggregated Ag-AgX(X = Cl, Br)@TiO2 Microspheres Under Visible Light

    Science.gov (United States)

    Zhang, Cuiling; Hua, Hao; Liu, Jianlin; Han, Xiangyu; Liu, Qipeng; Wei, Zidong; Shao, Chengbin; Hu, Chenguo

    2017-10-01

    Ag-AgX(X = Cl, Br)@TiO2 nanoparticle-aggregated spheres with different mass ratio of R = TiO2/Ag(X) from 35:1 to 5:1 were synthesized by a facile sol-gel technique with post-photoreduction. The photocatalytic activities of both Ag-AgCl@TiO2 and Ag-AgBr@TiO2 under visible light are effectively improved by 3 times relative to TiO2 NPAS under the simulated sunlight for the decomposition of methyl orange (MO). Ag-AgBr@TiO2 showed 30% improvement and less stable in photocatalytic activity than that of AgCl@TiO2. The role of Ag and AgX nanoparticles on the surface of Ag-AgX(X = Cl, Br)@TiO2 was discussed. Ag on these samples not only can efficiently harvest visible light especially for AgCl, but also efficiently separate excited electrons and holes via the fast electron transfer from AgX(X = Cl, Br) to metal Ag nanoparticles and then to TiO2-aggregated spheres on the surface of heterostructure. On the basis of their efficient and stable photocatalytic activities under visible-light irradiation, these photocatalysts could be widely used for degradation of organic pollutants in aqueous solution.

  6. Highly selective and quantitative colorimetric detection of mercury(II) ions by carrageenan-functionalized Ag/AgCl nanoparticles.

    Science.gov (United States)

    Narayanan, Kannan Badri; Han, Sung Soo

    2017-03-15

    The natural algal polysaccharide carrageenan was used for the greener synthesis of silver/silver chloride nanoparticles (Carr-Ag/AgCl NPs) without any toxic chemicals. We report the robust, highly selective, and sensitive colorimetric sensing of Hg2+ ions using Carr-Ag/AgCl NPs without any further surface modification. The dark-brown color of a solution of Carr-Ag/AgCl NPs turned to white in a concentration-dependent manner with the addition of Hg2+ ions, confirming the interaction of Carr-Ag/AgCl NPs with Hg2+ ions. The plot of the extinction ratio of absorbance at 350nm to 450nm (A350/A450) for Carr-Ag/AgCl NPs against the concentration of [Hg2+] ions was linear, and the calibration curve was A350/A450=1.05254+0.00318×CHg with a lower detection limit of 1μM. This portable and cost-effective method for mercury(II) ion sensing is widely applicable in on-field qualitative and quantitative measurements of [Hg2+] ions in environmental or biological samples. Copyright © 2016. Published by Elsevier Ltd.

  7. Hierarchical Ag/AgCl-TiO{sub 2} hollow spheres with enhanced visible-light photocatalytic activity

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Xu Long; Yin, Hao Yong [College of Materials Environment Engineering, Hangzhou Dianzi University, Hangzhou 310018 (China); Nie, Qiu Lin, E-mail: nieqiulin@hdu.edu.cn [College of Materials Environment Engineering, Hangzhou Dianzi University, Hangzhou 310018 (China); Wu, Wei Wei [College of Materials Environment Engineering, Hangzhou Dianzi University, Hangzhou 310018 (China); Zhang, Yang; LiYuan, Qiu [College of Science, Hangzhou Dianzi University, Hangzhou 310018 (China)

    2017-01-01

    The hierarchical Ag/AgCl-TiO{sub 2} hollow spheres were synthesized by depositing Ag/AgCl nanoparticles on TiO{sub 2} hollow spheres via a precipitation photoreduction method, and they were further characterized using TGA, SEM, TEM, XRD, XPS, UV–vis DRS and photoelectric chemical analysis. The analysis showed that the hierarchical Ag/AgCl-TiO{sub 2} hollow spheres exhibited the highest photocatalytic activity, which was approximately 13 times higher than that of TiO{sub 2} hollow spheres. The high photocatalytic activity of the composites is due to efficient electron-hole pairs separation at the photocatalyst interfaces, and localized surface plasmon resonance of Ag nanoparticles formed on AgCl particles in the degradation reaction. - Highlights: • TiO{sub 2} hollow spheres were prepared by a sacrificial template method. • The hollow spheres were modified with Ag/AgCl to form the heterojunctions. • The modification may produce synergistic effect of LSPR and hollow structure. • Visible light photocatalytic activity was enhanced on this hollow catalyst. • The mechanism of the improved photocatalytic performance was discussed.

  8. Preparation of mesoporous Ag/AgBr/TiO2 nanocomposites with comb-type polymer as template

    Directory of Open Access Journals (Sweden)

    Li XU

    Full Text Available The mesoporous TiO2 nanocomposites were fabricated in a water bath at lower temperatures using the sol-gel method with a comb-type polymer as template and tetrabutyl titanate as Ti source. The Ag/AgBr/TiO2 nanocomposites with higher specific surface areas were obtained by the introduction of Ag/AgBr on the surface of the mesoporous TiO2 using a deposition-precipitation method. The as-prepared nanocomposites were characterized by X-ray diffraction (XRD, N2 sorption analysis, transmission electron microscope (TEM and UV-vis diffuse reflectance spectroscopy (UV-vis DRS. The results showed that both the as-prepared TiO2 and Ag/AgBr/TiO2 exhibited mesoporous structure. The introduction of Ag/AgBr not only decreased the specific surface area of the mesoporous TiO2 from 346 m2/g to 253 m2/g, but also significantly increased its visible light photocatalytic activity. The degradation rate of methyl orange under visible light irradiation over Ag/AgBr/TiO2 was 145 and 60 times of those over the commercial TiO2 P25 and the mesoporous TiO2, respectively.

  9. 'One-step' controllable synthesis of Ag and Ag{sub 2}S nanocrystals on a large scale

    Energy Technology Data Exchange (ETDEWEB)

    Tian Chungui; Kang Zhenhui; Wang Enbo; Mao Baodong; Li Siheng; Su Zhongmin; Xu Lin [Key Laboratory of Polyoxometallate Science of Ministry of Education, Faculty of Chemistry, Northeast Normal University, Ren Min Street no. 5268, Changchun, Jilin 130024 (China)

    2006-11-28

    Ag and Ag{sub 2}S nanocrystals (NCs) were synthesized by a simple 'one-step' process. Dodecanethiol played three important roles in the synthesis: as the capping reagent, reducer (for the synthesis of Ag) and S{sup 2-} source (for the synthesis of Ag{sub 2}S). Due to the multifunctional characteristic of dodecanethiol, only two reactants (silver nitrate and dodecanethiol) are needed in the synthesis, avoiding the use of toxic organic solvents and a complex reaction procedure. X-ray powder diffraction and transmission electron microscopy studies indicated that both the phase (Ag or Ag{sub 2}S) and the particle size were controlled by reaction parameters. The infrared spectra studies indicated that the nanoparticles were stabilized by dodecanethiol. As a result, the particles were stable (no irreversible conglomeration) in the solid state and in solution for several months. In addition, a large quantity of Ag and Ag{sub 2}S NCs could be readily obtained. A possible formation and size evolution mechanism for Ag and Ag{sub 2}S NCs was proposed.

  10. In vitro evaluation of Ag-containing calcium phosphates: Effectiveness of Ag-incorporated β-tricalcium phosphate.

    Science.gov (United States)

    Gokcekaya, Ozkan; Ueda, Kyosuke; Ogasawara, Kouetsu; Kanetaka, Hiroyasu; Narushima, Takayuki

    2017-06-01

    Development of bioceramics with antibacterial activity and without cytotoxicity would be beneficial for preventing infection associated with implants. This study aimed to capitalize on the antibacterial properties of silver (Ag) incorporated in or coexisting in metallic form with calcium phosphates (CaPs). The in vitro dissolution behavior, antibacterial activity, and cytotoxicity of Ag-containing CaPs with different phase fractions of hydroxyapatite (HA) and β-tricalcium phosphate (β-TCP) were evaluated. The antibacterial activity of Ag-containing CaPs depended on the main phase of CaP, the chemical state of Ag, and the amount of incorporated Ag. Superior antibacterial activity was obtained from sustained release of Ag ions through continuous dissolution of Ag-incorporated β-TCP compared to that obtained for HA coexisting with metallic Ag particles. Ag-containing CaPs did not exhibit any toxic effect on V79 fibroblasts. Thus, these results demonstrated the effectiveness of Ag-incorporated β-TCP in preventing infection, with respect to long-term applications. Copyright © 2017 Elsevier B.V. All rights reserved.

  11. Insights into the adsorption and energy transfer of Ag clusters on the AgCl(100) surface.

    Science.gov (United States)

    Ma, Xiangchao; Dai, Ying; Guo, Meng; Zhu, Yingtao; Huang, Baibiao

    2013-06-14

    It is fundamental to uncover the real adsorption properties of Ag clusters on an AgCl surface and the energy transfer mechanisms at the interface to understand the highly active photocatalytic performance and the stability of the plasmonic photocatalyst Ag@AgCl. Based on density functional theory calculations we provide valuable insights into the binding nature of Ag clusters on AgCl surface, where the binding between Ag atoms in the cluster and on the surface plays a decisive role in determining the most stable adsorption configurations. Our results demonstrate that there is energy transfer from the plasmonic metals to substrate. The hot holes excited by the decay of surface plasmon resonance on the metals can diffuse into the Cl ions in the outermost two layers of the surface producing highly oxidative Cl atoms. The dipole-dipole interaction between the plasmonic metal clusters and substrate Cl ions can also generate electron-hole pairs in the surface layers. It is deduced that the positively charged nature of adsorbed clusters acting as electron trapping centers and reduction sites plays a crucial role in keeping the stability of the Ag@AgCl system during the photocatalytic process. Finally, the validity of the cluster adsorption model for energy transfer is verified with respect to the nucleation and aggregation process of Ag atoms on the AgCl surface and a detailed description of the formation and evolution of Ag nanoparticles on an AgCl surface is provided. The present study may be helpful for understanding and designing this novel plasmonic photocatalyst and can be useful for investigating other relevant photocatalysts as well.

  12. Highly efficient degradation of thidiazuron with Ag/AgCl- activated carbon composites under LED light irradiation

    Energy Technology Data Exchange (ETDEWEB)

    Yang, Yisi [College of Bioscience and Biotechnology, Hunan Agricultural University, Changsha 410128 (China); Hubei Key Laboratory for Processing and Application of Catalytic Materials, Huanggang Normal University, Huanggang 438000 (China); College of Chemical Engineering, Huanggang Normal University, Huanggang 438000 (China); Zhang, Yan [Hubei Key Laboratory for Processing and Application of Catalytic Materials, Huanggang Normal University, Huanggang 438000 (China); College of Chemical Engineering, Huanggang Normal University, Huanggang 438000 (China); Dong, Mingguang; Yan, Ting; Zhang, Maosheng [College of Chemical Engineering, Huanggang Normal University, Huanggang 438000 (China); Zeng, Qingru, E-mail: 40083763@qq.com [College of Bioscience and Biotechnology, Hunan Agricultural University, Changsha 410128 (China)

    2017-08-05

    Highlights: • Photocatalytic degradation of thidiazuron was performed in a neutral water matrix. • This was carried out in the presence of Ag/AgCl-activated carbon composites and LED light. • The pH effect and the dominant active species were explored. • Degradation products and pathways in water were studied for the first time. - Abstract: Thidiazuron (TDZ; 1-phenyl-3-(1,2,3-thiadiazol-5-yl)urea) is one of the most widely used defoliant and easy to dissolve in surface water. Risk associated with the pesticide is not clearly defined, so it is important to remove/degrade TDZ with an efficient and environment friendly technology. Here, we investigated the use of Ag/AgCl-activated carbon (Ag/AgCl–AC) composites in photocatalytic degradation of TDZ under LED light. By the synergic effect of Ag/AgCl and AC, the optimum Ag/carbon weight ratio of 2:1 exhibited superior visible-light photocatalytic activity, the highest removal efficiency was close to 91% in pH 7 matrix. Different types of Ag/AgCl–AC composites were tested, all showed much faster photodegradation kinetics than bare Ag/AgCl in 210 min. The degradation products as identified by HPLC–MS revealed that the hydroxylation by hydroxyl radicals and that of oxidation by superoxide radicals as well as holes were the two main pathways for TDZ degradation. Results revealed that the adsorption concentrated TDZ molecules and the photocatalytically generated radicals rapidly degradated TDZ, the two contributions functioned together for removal of the pollutant from water.

  13. Safe and Effective Ag Nanoparticles Immobilized Antimicrobial NanoNonwovens

    DEFF Research Database (Denmark)

    Song, Jie; Chen, Menglin; Regina, Viduthalai R.

    2012-01-01

    Silver nanoparticles (AgNPs) with large surface-to-volume ratio have been widely studied as a valuable material for their strong antimicrobial effect. However, the practical applications of AgNPs in health care and water purification are often hampered by the concern of their toxicity and possibi......Silver nanoparticles (AgNPs) with large surface-to-volume ratio have been widely studied as a valuable material for their strong antimicrobial effect. However, the practical applications of AgNPs in health care and water purification are often hampered by the concern of their toxicity...... was thus employed to degrade the polymer coating without loosening the AgNPs, resulting in an active antimicrobial nonwoven against Gram-positive Staphylococcus xylosus. The mechanism based on cellular uptake of silver ions via close contact to the surface of AgNPs is proposed. The novel nanononwoven...

  14. AgPi: Agents on Raspberry Pi

    Directory of Open Access Journals (Sweden)

    Tushar Semwal

    2016-10-01

    Full Text Available The Raspberry Pi and its variants have brought with them an aura of change in the world of embedded systems. With their impressive computation and communication capabilities and low footprint, these devices have thrown open the possibility of realizing a network of things in a very cost-effective manner. While such networks offer good solutions to prominent issues, they are indeed a long way from being smart or intelligent. Most of the currently available implementations of such a network of devices involve a centralized cloud-based server that contributes to making the necessary intelligent decisions, leaving these devices fairly underutilized. Though this paradigm provides for an easy and rapid solution, they have limited scalability, are less robust and at times prove to be expensive. In this paper, we introduce the concept of Agents on Raspberry Pi (AgPi as a cyber solution to enhance the smartness and flexibility of such embedded networks of physical devices in a decentralized manner. The use of a Multi-Agent System (MAS running on Raspberry Pis aids agents, both static and mobile, to govern the various activities within the network. Agents can act autonomously or on behalf of a human user and can collaborate, learn, adapt and act, thus contributing to embedded intelligence. This paper describes how Tartarus, a multi-agent platform, embedded on Raspberry Pis that constitute a network, can bring the best out of the system. To reveal the versatility of the concept of AgPi, an application for a Location-Aware and Tracking Service (LATS is presented. The results obtained from a comparison of data transfer cost between the conventional cloud-based approach with AgPi have also been included.

  15. Borohydride electro-oxidation by Ag-doped lanthanum chromites

    Indian Academy of Sciences (India)

    The electrocatalytic activity of Ag-doped lanthanum chromites electrode materials viz., LaCr0.4Ag0.6O3 and LaCr0.7Ag0.3O3 prepared by decomposing the precursor complex is studied. Pure LaCrO3 is synthesized by combustion route using oxalic acid as a fuel. The decomposition behaviour of the assynthesized powder ...

  16. Rare and forbidden kaon decays at the AGS

    Energy Technology Data Exchange (ETDEWEB)

    Kettell, S.

    1997-12-09

    An overview of the Rare Kaon Decay program at the AGS is presented, with particular emphasis on the three major experiments currently running and analyzing data. A brief overview of earlier kaon decay experiments and of the AGs performance improvements is also provided. This review concludes with a discussion of proposed and developing experiments planned to run in the year 2000 and beyond (AGS-2000).

  17. 11th AG STAB/DGLR Symposium

    CERN Document Server

    Heinemann, Hans-Joachim; Hilbig, Reinhard

    1999-01-01

    This volume contains the papers of the 11th Symposium of the AG STAB (German Aerospace Aerodynamics Association). In this association those scientists and engineers from universities, research-establishments and industry are involved, who are doing research and project work in numerical and experimental fluid mechanics and aerodynamics for aerospace and other applications. Many of the contributions are giving results from the "Luftfahrtforschungsprogramm der Bundesregierung (German Aeronautical Research Programme). Some of the papers report on work sponsored by the Deutsche Forschungsgemeinschaft, DFG, which also was presented at the symposium. The volume gives a broad overview over the ongoing work in this field in Germany.

  18. Anisotropic flow from AGS to LHC energies

    CERN Document Server

    Kolb, P F; Heinz, Ulrich W

    1999-01-01

    Within hydrodynamics we study the effects of the initial spatial anisotropy in non-central heavy-ion collisions on the momentum distributions of the emitted hadrons. We show that the elliptic flow measured at midrapidity in 158 A GeV/c Pb+Pb collisions can be quantitatively reproduced by hydrodynamic expansion, indicating early thermalization in the collision. We predict the excitation functions of the 2nd and 4th harmonic flow coefficients from AGS to LHC energies and discuss their sensitivity to the quark-hadron phase transition. (36 refs).

  19. Modelling of the AGS using Zgoubi - Status

    Energy Technology Data Exchange (ETDEWEB)

    Meot F.; Ahrens, L.; Dutheil, Y.; Glenn, J.; Huang, H.; Roser, T.; Schoefer, V.; Tsoupas, N.

    2012-05-20

    This paper summarizes the progress achieved so far, and discusses various outcomes, regarding the development of a model of the Alternating Gradient Synchrotron at the RHIC collider. The model, based on stepwise ray-tracing methods, includes beam and polarization dynamics. This is an on-going work, and a follow-on of code developments and particle and spin dynamics simulations that have been subject to earlier publications at IPAC and PAC [1, 2, 3]. A companion paper [4] gives additional informations, regarding the use of the measured magnetic field maps of the AGS main magnets.

  20. Transformation from Ag@Ag{sub 3}PO{sub 4} to Ag@Ag{sub 2}SO{sub 4} hybrid at room temperature: preparation and its visible light photocatalytic activity

    Energy Technology Data Exchange (ETDEWEB)

    Wei, Ting; Gao, Shanmin, E-mail: gaosm@ustc.edu; Wang, Qingyao; Xu, Hui [Ludong University, College of Chemistry and Materials Science (China); Wang, Zeyan; Huang, Baibiao, E-mail: bbhuang@sdu.edu.cn; Dai, Ying [Shandong University, State Key Laboratory of Crystal Materials (China)

    2017-02-15

    In the present study, Ag/Ag{sub 2}SO{sub 4} hybrid photocatalysts were obtained via a facile redox–precipitation reaction approach by using Ag@Ag{sub 3}PO{sub 4} nanocomposite as the precursor and KMnO{sub 4} as the oxidant. Multiple techniques, such as X-ray diffraction pattern (XRD), transmission electron microscope (TEM), high-resolution transmission electron microscopy (HRTEM), X-ray photoelectron spectroscopy (XPS), UV–vis diffuse reflectance spectroscopy (DRS) and Brunauer–Emmett–Teller (BET), photocurrent and electrochemical impedance spectroscopy (EIS), were applied to investigate the structures, morphologies, optical, and electronic properties of as-prepared samples. The photocatalytic activities were evaluated by photodegradation of organic rhodamine B (RhB) and methyl orange (MO) under visible light irradiation. It was found that pure Ag{sub 2}SO{sub 4} can partially transform into metallic Ag during the photocatalytic degradation of organic pollutants, but the Ag/Ag{sub 2}SO{sub 4} hybrids can maintain its structure stability and show enhanced visible light photocatalytic activity because of the surface plasma resonance effect of the metallic Ag.

  1. Phytotoxicity of Ag nanoparticles prepared by biogenic and chemical methods

    Science.gov (United States)

    Choudhury, Rupasree; Majumder, Manna; Roy, Dijendra Nath; Basumallick, Srijita; Misra, Tarun Kumar

    2016-06-01

    Silver nanoparticles (Ag NPs) are now widely used as antibacterial and antifungal materials in different consumer products. We report here the preparation of Ag NPs by neem leaves extract ( Azadirachta) reduction and trisodium citrate-sodium borohydride reduction methods, and study of their phytotoxicity. The nanoparticles were characterized by UV-Vis spectroscopy, FTIR, and atomic force microscopy (AFM) techniques. Both neem-coated and citrate-coated Ag NPs exhibit surface plasmon around 400 nm, and their average sizes measured by AFM are about 100 and 20 nm, respectively. Antibacterial and antifungal activities of these nanomaterials have been studied by simple pea seed germination and disk diffusion methods. It has been observed from the growth of root and shoot, citrate-coated Ag NPs significantly affect seedling growth, but neem-coated Ag NPs exhibit somehow mild toxicity toward germination process due to the nutrient supplements from neem. On the other hand, antifungal activity of neem-coated Ag NPs has been found much higher than that of citrate-coated Ag NPs due to the combined effects of antifungal activity of neem and Ag NPs. Present research primarily indicates a possible application of neem-coated Ag NPs as a potential fungicide.

  2. An optical humidity sensor based on Ag nanodendrites

    Energy Technology Data Exchange (ETDEWEB)

    Xu, Juncui, E-mail: xxjjcz20000214@yahoo.cn [School of Chemical Engineering, Hefei University of Technology and Anhui Key Laboratory of Controllable Chemical Reaction and Material Chemical Engineering, Hefei, Anhui 230009 (China); Department of Chemistry and Chemical Engineering, Hefei Normal University, Hefei, Anhui 230601 (China); Zhang, Weixin, E-mail: wxzhang@hfut.edu.cn [School of Chemical Engineering, Hefei University of Technology and Anhui Key Laboratory of Controllable Chemical Reaction and Material Chemical Engineering, Hefei, Anhui 230009 (China); Yang, Zeheng [School of Chemical Engineering, Hefei University of Technology and Anhui Key Laboratory of Controllable Chemical Reaction and Material Chemical Engineering, Hefei, Anhui 230009 (China)

    2013-09-01

    Cubic Ag dendritic nanostructure with ordered branches and Ag particles have been successfully prepared by soaking pretreated Zn plate into silver ammonia ion solution at 80 °C and reducing the silver ammonia ion solution with ascorbic acid in the presence of PVP, respectively. Field-emission scanning electron microscopy (FESEM) and transmission electron microscopy (TEM) images show that the overall length of the Ag nanodendrites is 3–10 μm, and the average diameter of the stems and branches are 100 nm and 50 nm, severally. The size of the Ag particles is in the range of 100–500 nm. The photoluminescence (PL) property of the samples reveals that the Ag dendritic nanostructures show stronger PL intensity than the Ag particles. A room temperature photoluminescence-type gas sensing device based on the pure Ag nanodendrites has been established to investigate their humidity sensing properties. For comparison, pure Ag particles-based sensors were also fabricated in the same condition. Compared with their counterparts, possibly due to its large surface area, Ag nanodendrites present better sensitivity, more excellent linearity and quicker recovery in a very wide humidity range at room temperature.

  3. Structure and thermal stability of AgCu chiral nanoparticles

    Science.gov (United States)

    Bochicchio, D.; Ferrando, R.

    2012-05-01

    The structure and thermal stability of AgCu core-shell chiral nanoparticles is investigated by means of global optimization searches and molecular-dynamics simulations within an atomistic model. The most energetically stable structures are searched for depending on the number N Ag of Ag atoms in the outer shell. Both icosahedral and C5 symmetry structures are considered. The thermal stability of the structures is studied for magic sizes and compositions by analyzing the melting transition. It is found that chiral shells are the most favourable in a wide range of N Ag and that the structures present a notable thermal stability.

  4. RHIC FY15 pp Run RHIC and AGS polarization analysis

    Energy Technology Data Exchange (ETDEWEB)

    Huang, H. [Brookhaven National Lab. (BNL), Upton, NY (United States); Adams, P. [Brookhaven National Lab. (BNL), Upton, NY (United States)

    2016-02-20

    The polarization information is important for the spin physics program in Relativistic Heavy Ion Collider (RHIC). There are discrepancies between AGS and RHIC polarization measurements. First, the face value of AGS polarization is higher than RHIC ones in general. Second, the measured polarization profile (described by the profile ratio R) is stronger in AGS than in RHIC. This note analyzes the polarization data from FY15 pp run period. The results show that the differences between AGS and RHIC polarization measurements are reasonable, but the R value difference is puzzling. The difference between blue and yellow ring is worth of spin simulation to explain.

  5. Fabrication of antimicrobial bacterial cellulose-Ag/AgCl nanocomposite using bacteria as versatile biofactory

    Science.gov (United States)

    Liu, Chuang; Yang, Dong; Wang, Yuangui; Shi, Jiafu; Jiang, Zhongyi

    2012-08-01

    In nature, a number of nanocomposites are formed through biomineralization-relevant processes under mild conditions. In the present study, a total "biologic" route to fabricate nanocomposite is reported. Non-pathogenic bacteria, Gluconacetobacter xylinum, was utilized as a versatile biofactory, which produced biopolymer bacterial cellulose (BC) and induced the formation of Ag/AgCl nanoparticles, yielding BC-Ag/AgCl nanocomposite. Scanning electron microscopy revealed that nanoparticles with average size of 17.4 nm were randomly embedded into the BC network; transmission electron microscopy and X-ray diffraction confirmed that the nanoparticles were mixtures of face-centered cubic silver and silver chloride nanoparticles. Moreover, the content of silver in the BC nanocomposite is around 0.05 wt%, determined by atomic absorption spectrometry and X-ray photoelectron spectroscopy analysis. The entire process of nanocomposite fabrication was conducted at ambient environment without utilizing toxic agents or producing hazardous products, which is not only environmentally friendly but also with less chances to generate harmful products to human bodies as biomedical materials. The resultant nanocomposite displayed the desirable activity in inhibiting bacterial growth of both Gram-positive Staphylococcus aureus and Gram-negative Escherichia coli microorganisms on agar plate and in liquid culture, indicating the potential of the material as antimicrobial wound dressing materials. This work demonstrated the feasibility of using microorganism to fabricate nanocomposite, especially for biomedical materials.

  6. Fabrication of antimicrobial bacterial cellulose-Ag/AgCl nanocomposite using bacteria as versatile biofactory

    Energy Technology Data Exchange (ETDEWEB)

    Liu Chuang [Tianjin University, Key Laboratory for Green Technology, School of Chemical Engineering and Technology (China); Yang Dong; Wang Yuangui [Tianjin University, Department of Biochemical Engineering and Key Laboratory of Systems Bioengineering of Ministry of Education, School of Chemical Engineering and Technology (China); Shi Jiafu; Jiang Zhongyi, E-mail: zhyjiang@tju.edu.cn [Tianjin University, Key Laboratory for Green Technology, School of Chemical Engineering and Technology (China)

    2012-08-15

    In nature, a number of nanocomposites are formed through biomineralization-relevant processes under mild conditions. In the present study, a total 'biologic' route to fabricate nanocomposite is reported. Non-pathogenic bacteria, Gluconacetobacter xylinum, was utilized as a versatile biofactory, which produced biopolymer bacterial cellulose (BC) and induced the formation of Ag/AgCl nanoparticles, yielding BC-Ag/AgCl nanocomposite. Scanning electron microscopy revealed that nanoparticles with average size of 17.4 nm were randomly embedded into the BC network; transmission electron microscopy and X-ray diffraction confirmed that the nanoparticles were mixtures of face-centered cubic silver and silver chloride nanoparticles. Moreover, the content of silver in the BC nanocomposite is around 0.05 wt%, determined by atomic absorption spectrometry and X-ray photoelectron spectroscopy analysis. The entire process of nanocomposite fabrication was conducted at ambient environment without utilizing toxic agents or producing hazardous products, which is not only environmentally friendly but also with less chances to generate harmful products to human bodies as biomedical materials. The resultant nanocomposite displayed the desirable activity in inhibiting bacterial growth of both Gram-positive Staphylococcus aureus and Gram-negative Escherichia coli microorganisms on agar plate and in liquid culture, indicating the potential of the material as antimicrobial wound dressing materials. This work demonstrated the feasibility of using microorganism to fabricate nanocomposite, especially for biomedical materials.

  7. Nano-galvanic coupling for enhanced Ag+ release in ZrCN-Ag films : Antibacterial application

    NARCIS (Netherlands)

    Calderon, S.; Ferreri, I.; Henriques, M.; De Hosson, J. T. M.; Cavaleiro, A.; Carvalho, S.

    2016-01-01

    The antibacterial properties of materials developed for medical devices with embedded silver nanoparticles are enhanced by controlling the release of silver ions. In this study, a simple experimental procedure for the augmentation of the silver ion release from ZrCN-Ag coatings is described. The

  8. Precursor configurations and post-rupture evolution of Ag-CO-Ag single-molecule junctions.

    Science.gov (United States)

    Balogh, Zoltán; Visontai, Dávid; Makk, Péter; Gillemot, Katalin; Oroszlány, László; Pósa, László; Lambert, Colin; Halbritter, András

    2014-12-21

    Experimental correlation analysis and first-principles theory are used to probe the structure and evolution of Ag-CO-Ag single-molecule junctions both before the formation and after the rupture of the junctions. Two dimensional correlation histograms and conditional histograms demonstrate that prior to the single-molecule bridge configuration the CO molecule is already bound parallel to the Ag single-atom contact. This molecular precursor configuration is accompanied by the opening of additional conductance channels compared to the single-channel transport in pure Ag monoatomic junctions. To investigate the post-rupture evolution of the junction we introduce a cross-correlation analysis between the opening and the subsequent closing conductance traces. This analysis implies that the molecule is bound rigidly to the apex of one electrode, and so the same single-molecule configuration is re-established as the junction is closed. The experimental results are confirmed by ab initio simulations of the evolution of contact geometries, transmission eigenvalues and scattering wavefunctions.

  9. Development of carbon dots modified fluorescent molecular imprinted Polymer@Ag/AgCl nanoparticle for hepatocellular carcinoma marker

    Science.gov (United States)

    Karfa, Paramita; Madhuri, Rashmi; Sharma, Prashant K.

    2017-05-01

    In this work, a sensitive and selective fluorescent molecularly imprinted polymer (MIP) was developed for detection of hepatocellular carcinoma (HCC) biomarker i.e. alpha feto protein (AFP) using Ag/AgCl as platform. Here, the carbon dots and Ag/AgCl nanoparticles were functionalized with vinyl groups and used as functional monomer for synthesis of AFP-imprinted polymer. The imprinted polymer shows a linear range of 3.96 ng mL-1 to 80.0 ng mL-1 with detection limit of 0.42 ng mL-1.The adsorption property of the MIP@Ag/AgCl was studied and shows the high affinity binding towards their target analyte without any cross-reactivity and false-positive or false-negative results.

  10. Structures and segregation patterns of Ag-Cu and Ag-Ni nanoalloys adsorbed on MgO(0 0 1)

    Science.gov (United States)

    Bochicchio, Davide; Ferrando, Riccardo; Panizon, Emanuele; Rossi, Giulia

    2016-02-01

    Low-energy geometric structures and segregation patterns of Ag-Cu and Ag-Ni nanoparticles adsorbed on MgO(0 0 1) are searched for by global optimisation methods within an atomistic potential model. Sizes betwen 100 and 300 atoms are considered for several compositions. In all cases, Ag segregates to the nanoparticle surface, so that Cu@Ag and Ni@Ag core-shell arrangements are found, with off-centre cores for Ag-rich compositions. The behaviours of Ag-Cu and Ag-Ni differ at the interface with the MgO substrate. For Ag-Cu, some Cu atoms are at the interface even for compositions that are very rich in Ag, where Ag-Ni nanoparticles present an interface completely made of Ag atoms. Ag-Ni and Ag-Cu also differ concerning their geometric structures. With increasing Ag content, in Ag-Cu we find the structural sequence faulted fcc \\to icosahedral \\to fcc, while in Ag-Ni we find the sequence hcp \\to faulted fcc-faulted hcp \\to icosahedral \\to fcc.

  11. Nano Ag@AgBr surface-sensitized Bi{sub 2}WO{sub 6} photocatalyst: oil-in-water synthesis and enhanced photocatalytic degradation

    Energy Technology Data Exchange (ETDEWEB)

    Lin, Shuanglong; Liu, Li; Hu, Jinshan; Liang, Yinghua, E-mail: liangyh@heuu.edu.cn; Cui, Wenquan, E-mail: wkcui@163.com

    2015-01-01

    Graphical abstract: - Highlights: • The plasmatic Ag@AgBr surface-sensitized Bi{sub 2}WO{sub 6} composite photocatalysts. • Ag@AgBr greatly increased visible-light absorption for Bi{sub 2}WO{sub 6}. • The plasmonic photocatalysts exhibited enhanced activity for the degradation of MB, phenol and salicylic acid. - Abstract: Nano Ag@AgBr decorated on the surface of flower-like Bi{sub 2}WO{sub 6} (hereafter designated Ag@AgBr/Bi{sub 2}WO{sub 6}) were prepared via a facile oil-in-water self-assembly method. The photocatalysts were characterized by X-ray diffraction (XRD), scanning electron microscopy (SEM), transmission electron microscopy (TEM), UV–vis diffuse reflectance spectroscopy (DRS), etc. The characterization results indicated that nano Ag@AgBr was observed to be evenly dispersed on the surface of Bi{sub 2}WO{sub 6}, and was approximately 20 nm in size. Ag@AgBr/Bi{sub 2}WO{sub 6} composites exhibited excellent UV–vis absorption, due to quantum dimension effect of Ag@AgBr, the surface plasmonic resonance (SPR) of Ag nanoparticles and the special flower-like structure of Bi{sub 2}WO{sub 6}. The photoelectrochemical measurement verified that the suitable band potential of Ag@AgBr and Bi{sub 2}WO{sub 6} and the existence of metal Ag resulted in the high efficiency in charge separation of the composite. The photocatalytic activities of the Ag@AgBr/Bi{sub 2}WO{sub 6} samples were examined under visible-light irradiation for the degradation of methylene blue (MB). The composite presented excellent photocatalytic activity due to the synergetic effect of Bi{sub 2}WO{sub 6}, AgBr, and Ag nanoparticles. The Ag@AgBr(20 wt.%)/Bi{sub 2}WO{sub 6} sample exhibited the best photocatalytic activity, degrading 95.03% MB after irradiation for 2 h, which was respectively 1.29 times and 1.28 times higher than that of Ag@AgBr and Bi{sub 2}WO{sub 6} photocatalyst. Meanwhile, phenol and salicylic acid were degraded to further prove the degradation ability of Ag@AgBr/Bi{sub 2

  12. Improvement of photocatalytic activities of Ag/P25 hybrid systems by controlled morphology of Ag nanoprisms

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Ti, E-mail: r01527017@ntu.edu.tw [Department of Materials Science and Engineering, National Taiwan University, Taipei 10617, Taiwan (China); Chao, Bo-Kai, E-mail: d98527007@ntu.edu.tw [Department of Materials Science and Engineering, National Taiwan University, Taipei 10617, Taiwan (China); Kuo, Yu-Lin, E-mail: ylkuo@mail.ntust.edu.tw [Department of Mechanical Engineering, National Taiwan University of Science and Technology, Taipei 10607, Taiwan (China); Hsueh, Chun-Hway, E-mail: hsuehc@ntu.edu.tw [Department of Materials Science and Engineering, National Taiwan University, Taipei 10617, Taiwan (China)

    2017-05-01

    Constructing hybrid systems with noble metal nanostructures is one known way to improve the poor photocatalysis efficiency of TiO{sub 2} under visible light. In our study, two different Ag nanostructures were prepared: (1) Ag nanospheres synthesized by chemical reduction method, and (2) Ag nanoprisms transformed from nanospheres with an additional photo-conversion process. Both Ag-TiO{sub 2} hybrid systems were prepared by mixing various concentrations of Ag solutions with commercial TiO{sub 2} powder (P25), and they were then utilized as photocatalysts for the photodecolorization test of methyl blue under various light sources (fluorescent, UV light and red LED lamps) irradiations. Results of the photodecolorization tests showed that Ag nanostructures could evidently enhance the photocatalytic activity of TiO{sub 2} under different light sources, while an optimal composition of 0.432 wt% Ag nanoprisms/TiO{sub 2} displayed superior photocatalytic properties under visible light irradiations (fluorescent and red LED lamps). The enhanced photocatalytic activities could be mainly attributed to the mechanisms of hot electrons injection and resonant energy transfer by the localized surface plasmon resonance of Ag nanostructures and the electronic states favorable of charge separation at the interface between metals and semiconductors. - Highlights: • We used Ag nanostructures to improve photocatalysis efficiency of TiO{sub 2}. • Ag nanoprisms were more efficient than Ag nanospheres under visible light. • Ag nanoprisms/P25 is about 7 times more efficient than P25 under fluorescent lamp. • Mechanisms rely on hot electrons injection and resonant energy transfer by LSPR.

  13. Plasmon-assisted degradation of methylene blue with Ag/AgCl/montmorillonite nanocomposite under visible light

    Science.gov (United States)

    Sohrabnezhad, Sh.; Zanjanchi, M. A.; Razavi, M.

    2014-09-01

    Metal-semiconductor compounds, such as Ag/AgX (X = Cl, Br, I), enable visible light absorption and separation of photogenerated electron-hole through surface plasmon resonance (SPR) effect. However, the electron-hole generated and separated by light are vulnerable in Ag/AgX phase because of the occurrence of secondary recombined. In order to more effectively utilize the SPR photocatalytic effect, nanoparticles are located in a matrix. In this article, Ag/AgCl nanoparticles were synthesized in montmorillonite (MMT) matrix using dispersion method and light irradiation. The structure, composition and optical properties of such material were investigated by transmission electron microscopy (TEM), UV-visible diffuse reflectance spectroscopy (UV-Vis DRS), X-ray diffraction (XRD) and FTIR. Powder X-ray diffraction showed intercalation of Ag/AgCl nanoparticles into the clay layers. The as-prepared plasmonic photocatalyst exhibited an enhanced and stable photoactivity for the degradation of methylene blue (MB) under visible light. The high activity was attributed to the surface plasmon resonance (SPR) exhibited by Ag nanoparticles on the surface of AgCl. The detection of reactive species by radical scavengers displays that rad O2- and rad OH- are the main reactive species for the degradation of MB under visible light irradiation. The studies showed that 20 min illumination under visible light can complete degradation of methylene blue (MB), and indicate a high stability of photocatalytic degradation. The mechanism of separation of the photo-generated electrons and holes at the Ag/AgCl-MMT nanocomposite was discussed.

  14. One-pot synthesis of ternary Ag₂CO₃/Ag/AgCl photocatalyst in natural geothermal water with enhanced photocatalytic activity under visible light irradiation.

    Science.gov (United States)

    Yao, Xiaxi; Liu, Xiaoheng

    2014-09-15

    Geothermal water is a clean, cheap and renewable resource and it is widely distributed all over the world. In this work, ternary Ag2CO3/Ag/AgCl photocatalyst has been successfully synthesized via a one-pot precipitation method in natural geothermal water at room temperature, wherein the geothermal water serves as the source of chlorine and carbonate. The results suggest that the Ag/AgCl nanoparticles are anchored on the surface of Ag2CO3 and Ag2CO3/Ag/AgCl composite shows strong absorption ability in the visible light region. The evaluation of the photocatalytic activity indicates that the as-synthesized Ag2CO3/Ag/AgCl photocatalyst exhibits higher photocatalytic performance for the degradation of methylene blue (MB) aqueous solution under visible light irradiation than one-component (Ag2CO3), two-component (Ag/AgCl, Ag2CO3/AgCl) and the mechanical mixture of Ag2CO3 and Ag/AgCl. The trapping experiments confirmed that holes (h(+)) and (•)O2(-) were the two main active species in the photocatalytic process. Finally, a possible Z-scheme photocatalytic mechanism of the charge transfer was proposed for the enhanced photocatalytic performance. This work may open up new insights into the application of cheap geothermal water resources in the word and provide new opportunities for facile fabrication of Ag/AgCl-based photocatalysts. Copyright © 2014 Elsevier B.V. All rights reserved.

  15. One-pot synthesis of ternary Ag{sub 2}CO{sub 3}/Ag/AgCl photocatalyst in natural geothermal water with enhanced photocatalytic activity under visible light irradiation

    Energy Technology Data Exchange (ETDEWEB)

    Yao, Xiaxi; Liu, Xiaoheng, E-mail: xhliu@mail.njust.edu.cn

    2014-09-15

    Graphical abstract: - Highlights: • Ag{sub 2}CO{sub 3}/Ag/AgCl composite was synthesized in geothermal water by a one-pot method. • Geothermal water served as the source of chlorine and carbonate. • Ag{sub 2}CO{sub 3}/Ag/AgCl exhibited the enhanced photocatalytic activity and stability. • The efficient charge carrier separation is attributed to the Z-scheme construction. - Abstract: Geothermal water is a clean, cheap and renewable resource and it is widely distributed all over the world. In this work, ternary Ag{sub 2}CO{sub 3}/Ag/AgCl photocatalyst has been successfully synthesized via a one-pot precipitation method in natural geothermal water at room temperature, wherein the geothermal water serves as the source of chlorine and carbonate. The results suggest that the Ag/AgCl nanoparticles are anchored on the surface of Ag{sub 2}CO{sub 3} and Ag{sub 2}CO{sub 3}/Ag/AgCl composite shows strong absorption ability in the visible light region. The evaluation of the photocatalytic activity indicates that the as-synthesized Ag{sub 2}CO{sub 3}/Ag/AgCl photocatalyst exhibits higher photocatalytic performance for the degradation of methylene blue (MB) aqueous solution under visible light irradiation than one-component (Ag{sub 2}CO{sub 3}), two-component (Ag/AgCl, Ag{sub 2}CO{sub 3}/AgCl) and the mechanical mixture of Ag{sub 2}CO{sub 3} and Ag/AgCl. The trapping experiments confirmed that holes (h{sup +}) and {sup •} O{sub 2}{sup −} were the two main active species in the photocatalytic process. Finally, a possible Z-scheme photocatalytic mechanism of the charge transfer was proposed for the enhanced photocatalytic performance. This work may open up new insights into the application of cheap geothermal water resources in the word and provide new opportunities for facile fabrication of Ag/AgCl-based photocatalysts.

  16. Micro-PIXE study of Ag in digestive glands of a nano-Ag fed arthropod ( Porcellio scaber, Isopoda, Crustacea)

    Science.gov (United States)

    Tkalec, Živa Pipan; Drobne, Damjana; Vogel-Mikuš, Katarina; Pongrac, Paula; Regvar, Marjana; Štrus, Jasna; Pelicon, Primož; Vavpetič, Primož; Grlj, Nataša; Remškar, Maja

    2011-10-01

    Micro-proton induced X-ray emission (micro-PIXE) method was applied to study the micro-localization of silver (Ag) in digestive glands of a terrestrial arthropod (Porcellio scaber) after feeding on silver nanoparticles (nano-Ag) dosed food. The aim of our work was to assess whether feeding on nano-Ag results in the assimilation of silver (Ag) in digestive gland cells. To study micro-localization and elemental distribution of Ag, the animals were fed on food dosed with nanoparticles for 14 days under controlled laboratory conditions. At the end of the feeding exposure, the animals were dissected and digestive glands prepared for micro-PIXE analyses and TEM investigation. The results obtained by micro-PIXE documented high amounts of Ag inside S-cells of the digestive gland epithelium; however, TEM investigation did not show particle aggregates inside digestive gland cells. Also no adverse effect on feeding behavior was recorded what is a measure of toxic effects. We explain the presence of Ag inside the cells as a result of the assimilation of dissoluted Ag ions from ingested nano-Ag particles. Assimilation of excessive amounts of ingested metal ions in S-cells is a well known metal detoxification mechanism in isopods. We discuss the advantages of using micro-PIXE for the micro-localization of elements in biological tissue in studies of interactions between nanoparticles and biological systems.

  17. Identification of Ag-acceptors in $^{111}Ag^{111}Cd$ doped ZnTe and CdTe

    CERN Document Server

    Hamann, J; Deicher, M; Filz, T; Lany, S; Ostheimer, V; Strasser, F; Wolf, H; Wichert, T

    2000-01-01

    Nominally undoped ZnTe and CdTe crystals were implanted with radioactive /sup 111/Ag, which decays to /sup 111/Cd, and investigated by photoluminescence spectroscopy (PL). In ZnTe, the PL lines caused by an acceptor level at 121 meV are observed: the principal bound exciton (PBE) line, the donor-acceptor pair (DAP) band, and the two-hole transition lines. In CdTe, the PBE line and the DAP band that correspond to an acceptor level at 108 meV appear. Since the intensities of all these PL lines decrease in good agreement with the half-life of /sup 111/Ag of 178.8 h, both acceptor levels are concluded to be associated with defects containing a single Ag atom. Therefore, the earlier assignments to substitutional Ag on Zn- and Cd-lattice sites in the respective II-VI semiconductors are confirmed. The assignments in the literature of the S/sub 1/, S /sub 2/, and S/sub 3/ lines in ZnTe and the X/sub 1//sup Ag/, X/sub 2 //sup Ag//C/sub 1//sup Ag/, and C/sub 2//sup Ag/ lines in CdTe to Ag- related defect complexes are ...

  18. Micro-PIXE study of Ag in digestive glands of a nano-Ag fed arthropod (Porcellio scaber, Isopoda, Crustacea)

    Energy Technology Data Exchange (ETDEWEB)

    Tkalec, Ziva Pipan [Department of Biology, University of Ljubljana, Vecna pot 111, SI- 1000 Ljubljana (Slovenia); Drobne, Damjana [Department of Biology, University of Ljubljana, Vecna pot 111, SI- 1000 Ljubljana (Slovenia); Centre of Excellence, Advanced Materials and Technologies for the Future (CO NAMASTE), Jozef Stefan Institute, Jamova 39, SI-1000 Ljubljana (Slovenia); Vogel-Mikus, Katarina [Department of Biology, University of Ljubljana, Vecna pot 111, SI- 1000 Ljubljana (Slovenia); Pongrac, Paula [Department of Biology, University of Ljubljana, Vecna pot 111, SI- 1000 Ljubljana (Slovenia); Jozef Stefan Institute, Jamova 39, SI-1000 Ljubljana (Slovenia); Regvar, Marjana; Strus, Jasna [Department of Biology, University of Ljubljana, Vecna pot 111, SI- 1000 Ljubljana (Slovenia); Pelicon, Primoz, E-mail: primoz.pelicon@ijs.si [Jozef Stefan Institute, Jamova 39, SI-1000 Ljubljana (Slovenia); Vavpetic, Primoz; Grlj, Natasa [Jozef Stefan Institute, Jamova 39, SI-1000 Ljubljana (Slovenia); Remskar, Maja [Jozef Stefan Institute, Jamova 39, SI-1000 Ljubljana (Slovenia); Centre of Excellence, Advanced Materials and Technologies for the Future (CO NAMASTE), Jozef Stefan Institute, Jamova 39, SI-1000 Ljubljana (Slovenia)

    2011-10-15

    Micro-proton induced X-ray emission (micro-PIXE) method was applied to study the micro-localization of silver (Ag) in digestive glands of a terrestrial arthropod (Porcellio scaber) after feeding on silver nanoparticles (nano-Ag) dosed food. The aim of our work was to assess whether feeding on nano-Ag results in the assimilation of silver (Ag) in digestive gland cells. To study micro-localization and elemental distribution of Ag, the animals were fed on food dosed with nanoparticles for 14 days under controlled laboratory conditions. At the end of the feeding exposure, the animals were dissected and digestive glands prepared for micro-PIXE analyses and TEM investigation. The results obtained by micro-PIXE documented high amounts of Ag inside S-cells of the digestive gland epithelium; however, TEM investigation did not show particle aggregates inside digestive gland cells. Also no adverse effect on feeding behavior was recorded what is a measure of toxic effects. We explain the presence of Ag inside the cells as a result of the assimilation of dissoluted Ag ions from ingested nano-Ag particles. Assimilation of excessive amounts of ingested metal ions in S-cells is a well known metal detoxification mechanism in isopods. We discuss the advantages of using micro-PIXE for the micro-localization of elements in biological tissue in studies of interactions between nanoparticles and biological systems.

  19. No response to hepatitis B vaccine in infants born to HBsAg(+) mothers is associated to the transplacental transfer of HBsAg.

    Science.gov (United States)

    Wang, Jing; He, Yingli; Jin, Dongfang; Liu, Jinfeng; Zheng, Jie; Yuan, Ningxia; Bai, Yun; Yan, Taotao; Yang, Yuan; Liu, Yong; Zhang, Shulin; Zhao, Yingren; Chen, Tianyan

    2017-08-01

    No or low hepatitis B (HB) vaccine response is more frequent in infants from HBsAg(+) mothers than those from HBsAg(-). Our previous study found temporary positivity of HBsAg in infants from HBsAg(+) mothers. In this study, we hypothesized that HBsAg in infant blunt immune response to standard hepatitis B vaccination. A total of 328 consecutive HBsAg(+) mothers and their offspring were enrolled. Blood samples were taken from mothers and their infants and quantified for HBsAg, anti-HBs titer and HBV DNA load concentration; Placenta samples were collected to stain for HBsAg. First, 6.7% infants (22/328) showed anti-HBs titer lower than 10 mIU/mL after HB vaccination (non-response to HB vaccine). HBsAg(+) newborns showed higher risk of non-response than HBsAg(-) infants (13.0% versus 5.0%, p = 0.016). Infants from high HBsAg titer mothers displayed higher risk of HBsAg positivity at birth than those from low titer mothers (45.3% versus 2.8%, p < 0.001). HBsAg titer in mothers of HBsAg(+) newborns was much higher than mothers of HBsAg(-) newborns (p < 0.001). All those data supported HBsAg can be transferred through placenta. Our hypothesis was further reinforced by immunostaining with specific antibody against HBsAg, a substantial higher prevalence (87.5% versus 30.8%, p = 0.024) and stronger immunostaining (p = 0.008) was demonstrated in HBsAg(+) group comparing with placenta of the HBsAg(-) group. No response to HB vaccine in infants of HBsAg(+) mothers was associated to the transplacental transfer of HBsAg.

  20. Preparation and characterization of SrTiO3-Ag/AgCl hybrid composite with promoted plasmonic visible light excited photocatalysis

    Science.gov (United States)

    Shen, Hongfang; Wei, Hongyu; Pan, Zhidong; Lu, Youjun; Wang, Yanmin

    2017-11-01

    An efficient visible light responsive photocatalyst hybrid composite SrTiO3-Ag/AgCl was prepared via hydrothermal method and subsequent chemical precipitation/in-situ photoreduction at room temperature. The phase structure, morphology, element mapping distribution, surface chemical composition, specific surface area, and light absorption ability of the samples were characterized. The transient photocurrent response and electrochemical impedance under visible light illumination indicate that SrTiO3-Ag/AgCl composite possesses a more intense photocurrent response and a smaller surface resistance than SrTiO3 and Ag/AgCl due to the lower electrons-holes recombination. SrTiO3-Ag/AgCl composite exhibits an obvious promoted visible light excited photovcatalytic activity in photodecomposition of methyl orange, rhodamine B and phenol, compared to SrTiO3 and Ag/AgCl. A possible photocatalytic mechanism was proposed, indicating that the synergistic effect of surface plasmonic resonance of Ag0 photoreduced from AgCl and decreased the recombination rate of photogenerated carriers through transferring electrons from the surface of Ag0 to SrTiO3 promote the excellent photocatalytic activity of SrTiO3-Ag/AgCl. Moreover, the photodegradation reaction process of methyl orange, rhodamine B and phenol on SrTiO3-Ag/AgCl follows the pseudo-first-order kinetic model, and the reaction rate constants are approximately 10 times greater than those on Ag/AgCl. Four-recycling photocatalytic process of methyl orange on SrTiO3-Ag/AgCl also indicates a superior stability and durability.

  1. Deutsche Bahn AG`s Energy-saving Programme 2005; Das Energiesparprogramm 2005 der Deutschen Bahn AG

    Energy Technology Data Exchange (ETDEWEB)

    Koppatsch, G. [Deutsche Bahn AG, Berlin (Germany). Abt. Umweltmanagement/ Systeme/Umweltcontrolling

    1996-01-01

    With its `Energy-saving Programme 2005` the Deutsche Bahn AG is setting up a strategic alliance between ecology and economy as a contribution to environment-friendly mobility for the time after the turn of the century and at the same time to continuing entrepreneurial development. It is also an expression of the growing importance of environmental protection in the DB organization, that sees it not just as a necessary evil, but as a necessity for society and for the possibilities of the company. Decisive for an effective role for the railways in reducing CO{sub 2} emissions in traffic is a larger share of the transport market. The liberalization of this market and the creation of equal competitive conditions for all of Europe`s transport carriers is an important precondition for achieving this end. It cannot be brought about by a national transport policy alone, but calls for action by the European Union as a whole. The technical and technological conditions for networked international rail traffic in Europe need to be substantially improved. The railways themselves, but especially the UIC, are called upon here. The merits of the railway, with high utilization in passenger and freight transport and by way of further technical and technological development, must be exploited to the full. (orig.) [Deutsch] Die Begrenztheit der natuerlichen Energieressourcen der Erde macht deren schonende Inanspruchnahme zu einer wesentlichen Voraussetzung fuer eine nachhaltige Wirtschaftsentwicklung. Steigende Rohstoffpreise verstaerken diesen Effekt. Die Senkung der CO{sub 2}-Emissionen steht vor dem Szenario einer Klimakatastrophe im Interesse der Weltoeffentlichkeit. Von dem umweltfreundlichen Verkehrstraeger Bahn erwartet man einen spuerbaren Beitrag zur Sicherung einer umweltvertraeglichen Mobilitaet. Der Beitrag gibt einen Einblick in die strategische Zielstellung der Deutschen Bahn AG zur Senkung des Energieverbrauches und der CO{sub 2}-Emissionen. (orig.)

  2. Anti-corrosive and anti-microbial properties of nanocrystalline Ni-Ag coatings

    Energy Technology Data Exchange (ETDEWEB)

    Raghupathy, Y.; Natarajan, K.A.; Srivastava, Chandan, E-mail: csrivastava@materials.iisc.ernet.in

    2016-04-15

    Graphical abstract: - Highlights: • Electrodeposition yielded phase-segregated, nanocrystalline Ni-Ag coatings. • Ni-Ag alloys exhibited smaller Ni crystals compared to pure Ni. • Ultra fine Ni grains of size 12–14 nm favoured Ni-Ag solid solution. • Nanocrystalline Ag resisted bio-fouling by Sulphate Reducing bacteria. • Ni-Ag outperformed pure Ni in corrosion and bio-corrosion tests. - Abstract: Anti-corrosive and anti-bacterial properties of electrodeposited nanocrystalline Ni-Ag coatings are illustrated. Pure Ni, Ni-7 at.% Ag, & Ni-14 at.% Ag coatings were electrodeposited on Cu substrate. Coating consisted of Ni-rich and Ag-rich solid solution phases. With increase in the Ag content, the corrosion resistance of the Ni-Ag coating initially increased and then decreased. The initial increase was due to the Ni-Ag solid solution. The subsequent decrease was due to the increased galvanic coupling between the Ag-rich and Ni-rich phases. For all Ag contents, the corrosion resistance of the Ni-Ag coating was higher than the pure Ni coating. Exposure to Sulphate Reducing Bacteria (SRB) revealed that the extent of bio-fouling decreased with increase in the Ag content. After 2 month exposure to SRB, the Ni-Ag coatings demonstrated less loss in corrosion resistance (58% for Ni-7 at.% Ag and 20% for Ni-14 at.% Ag) when compared pure Ni coating (115%).

  3. Synthesis, characterization and photocatalytic activities of Ag-N ...

    African Journals Online (AJOL)

    Ag-N-codoped zinc oxide nanoparticles were synthesized by a one-step impregnation of Ag in N-doped ZnO nanoparticles. The morphologies and structures of the as-synthesized nanomaterials were investigated by using X-ray diffraction (XRD), transmission electron microscopy (TEM), and UV-Vis spectrophotometric ...

  4. Quadratite, AgCdAsS3

    DEFF Research Database (Denmark)

    Bindi, Luca; Spry, Paul G.; Bonazzi, Paola

    2013-01-01

    of BAB slabs [A: (Cd,Ag)CdS2 atomic plane; B: (Ag,Pb)AsS2 atomic plane] along [001]. The rectangular unit cell of these slabs is oriented diagonally to the a axes of quadratite and consecutive slabs are related via interlayer twofold rotation operations parallel either to [100] or to [010...

  5. Interface controlled growth of nanostructures in discontinuous Ag ...

    Indian Academy of Sciences (India)

    The first set of film–substrate interfaces consisted of Ag and Au films grown on borosilicate glass and carbon coated Cu grids used as substrates. ... Ion beam sputter deposition; discontinuous thin films; Ag; Au; film–substrate interface. 1. Introduction ..... Precise control of the film–substrate interactions leads to a very large ...

  6. Early invasive prenatal diagnosis in HBsAg-positive women

    NARCIS (Netherlands)

    P.M. Grosheide (Pia Maria); H.W.P. Quartero (H. W P); S.W. Schalm (Solko); R.A. Heijtink; C.G.M.L. Christiaens

    1994-01-01

    textabstractFrom 1982 to 1989, pregnant women in two large city hospitals in The Netherlands had serum samples screened for hepatitis B surface antigen (HBsAg). Infants of mothers found to be HBsAg-positive received hepatitis B immune globulin immediately after birth and hepatitis B vaccine in the

  7. Facile growth of Ag@ Pt bimetallic nanorods on electrochemically ...

    Indian Academy of Sciences (India)

    An efficient transducer was constructed by the direct growth of bimetallic Ag@Pt nanorods (NRDs) on L−tryptophan functionalized electrochemically reduced graphene oxide (L−ERGO) ... On the other hand, L−ERGO nanosheets tend to facilitate an effective immobilization of low density Ag seeds (Agseeds) on its surface.

  8. AGS vertical beta function measurements for Run 15

    Energy Technology Data Exchange (ETDEWEB)

    Harper, C. [Brookhaven National Lab. (BNL), Upton, NY (United States); Ahrens, L. [Brookhaven National Lab. (BNL), Upton, NY (United States); Huang, H. [Brookhaven National Lab. (BNL), Upton, NY (United States); Schoefer, V. [Brookhaven National Lab. (BNL), Upton, NY (United States)

    2016-10-07

    One key parameter for running the AGS efficiently is by maintaining a low emittance. To measure emittance, one needs to measure the beta function throughout the cycle. This can be done by measuring the beta function at the ionization profile monitors (IPM) in the AGS. This tech note delves into the motivation, the measurement, and some strides that were made throughout Run15.

  9. Electrochemical sensing and photocatalysis using Ag-TiO 2 ...

    Indian Academy of Sciences (India)

    Anatase Ag-TiO2 microwires with high sensitivity and photocatalytic activity were synthesized via polyol synthesis route followed by a simple surface modification and chemical reduction approach for attachment of silver. The superior performance of the Ag-TiO2 composite microwires is attributed to improved surface ...

  10. Removal of Ag{sup +} from water environment using a novel magnetic thiourea-chitosan imprinted Ag{sup +}

    Energy Technology Data Exchange (ETDEWEB)

    Fan, Lulu, E-mail: fanlu1949@126.com [College of Chemistry and Chemical Engineering, University of Jinan, Jinan 250022 (China); Luo, Chuannan, E-mail: chm_luocn@ujn.edu.cn [College of Chemistry and Chemical Engineering, University of Jinan, Jinan 250022 (China); Lv, Zhen; Lu, Fuguang; Qiu, Huamin [College of Chemistry and Chemical Engineering, University of Jinan, Jinan 250022 (China)

    2011-10-30

    Highlights: {yields} Coating modified chitosan on magnetic fluids, which were using Ag(I) as imprinted ions, is a new method to expand function of the chitosan. {yields} The method can improve the surface area for adsorption of Ag{sup +} and reduce the required dosage for the adsorption of Ag(I). {yields} The imprinted magnetic chitosan can be used effectively and selectively to remove Ag(I) ions from aqueous solutions. {yields} It shows the facile, fast separation process of magnetic chitosan during the experiments. The absorbent has a good application prospect. - Abstract: A novel, thiourea-chitosan coating on the surface of magnetite (Fe{sub 3}O{sub 4}) (Ag-TCM) was successfully synthesized using Ag(I) as imprinted ions for adsorption and removal of Ag(I) ions from aqueous solutions. The thermal stability, chemical structure and magnetic property of the Ag-TCM were characterized by the scanning electron microscope (SEM), Fourier transform infrared spectrometer (FT-IR) and vibrating sample magnetometer (VSM), respectively. Batch adsorption experiments were performed to evaluate the adsorption conditions, selectivity and reusability. The results showed that the maximum adsorption capacity was 4.93 mmol/g, observed at pH 5 and temperature 30 {sup o}C. Equilibrium adsorption was achieved within 50 min. The kinetic data, obtained at the optimum pH 5, could be fitted with a pseudo-second order equation. Adsorption process could be well described by Langmuir adsorption isotherms and the maximum adsorption capacity calculated from Langmuir equation was 5.29 mmol/g. The selectivity coefficient of Ag(I) ions and other metal cations onto Ag-TCM indicated an overall preference for Ag(I) ions, which was much higher than non-imprinted thiourea-chitosan beads. Moreover, the sorbent was stable and easily recovered, the adsorption capacity was about 90% of the initial saturation adsorption capacity after being used five times.

  11. Bodemweerstand tegen Rhizoctonia solani AG 2-2IIIB is onafhankelijk van rotatie; thema bodemweerbaarheid

    NARCIS (Netherlands)

    Schneider, J.H.M.; Bakker, Y.; Westerdijk, C.E.

    2005-01-01

    De bodemschimmel Rhizoctonia solani is onderverdeeld in zogenaamde anastomose groepen (AGs). De verschilllende AGs verschillen onder andere in waardplantenreeks. R.solani AG 2-2IIIB is een belangrijke ziekteverwekker in suikerbiet, lelie en vollegrondsgroenten. Waardplanten geteeld voor bieten,

  12. Unique Properties of Core Shell Ag@Au Nanoparticles for the Aptasensing of Bacterial Cells

    National Research Council Canada - National Science Library

    Hamidi-Asl, Ezat; Dardenne, Freddy; Pilehvar, Sanaz; Blust, Ronny; De Wael, Karolien

    2016-01-01

    ...) such as gold nanoparticles (Au), silver nanoparticles (Ag), hollow gold nanospheres (HGN), hollow silver nanospheres (HSN), silver–gold core shell (Ag@Au), gold–silver core shell (Au@Ag), and silver...

  13. Functional analysis of the α-1,3-glucan synthase genes agsA and agsB in Aspergillus nidulans: agsB is the major α-1,3-glucan synthase in this fungus.

    Directory of Open Access Journals (Sweden)

    Akira Yoshimi

    Full Text Available Although α-1,3-glucan is one of the major cell wall polysaccharides in filamentous fungi, the physiological roles of α-1,3-glucan remain unclear. The model fungus Aspergillus nidulans possesses two α-1,3-glucan synthase (AGS genes, agsA and agsB. For functional analysis of these genes, we constructed several mutant strains in A. nidulans: agsA disruption, agsB disruption, and double-disruption strains. We also constructed several CagsB strains in which agsB expression was controlled by the inducible alcA promoter, with or without the agsA-disrupting mutation. The agsA disruption strains did not show markedly different phenotypes from those of the wild-type strain. The agsB disruption strains formed dispersed hyphal cells under liquid culture conditions, regardless of the agsA genetic background. Dispersed hyphal cells were also observed in liquid culture of the CagsB strains when agsB expression was repressed, whereas these strains grew normally in plate culture even under the agsB-repressed conditions. Fractionation of the cell wall based on the alkali solubility of its components, quantification of sugars, and (13C-NMR spectroscopic analysis revealed that α-1,3-glucan was the main component of the alkali-soluble fraction in the wild-type and agsA disruption strains, but almost no α-1,3-glucan was found in the alkali-soluble fraction derived from either the agsB disruption strain or the CagsB strain under the agsB-repressed conditions, regardless of the agsA genetic background. Taken together, our data demonstrate that the two AGS genes are dispensable in A. nidulans, but that AgsB is required for normal growth characteristics under liquid culture conditions and is the major AGS in this species.

  14. Antifungal Applications of Ag-Decorated Hydroxyapatite Nanoparticles

    Directory of Open Access Journals (Sweden)

    C. A. Zamperini

    2013-01-01

    Full Text Available Pure hydroxyapatite (HA and hydroxyapatite decorated with silver (HA@Ag nanoparticles were synthesized and characterized. The antifungal effect of HA@Ag nanoparticles in a distilled water solution was evaluated against Candida albicans. The origin of the antifungal activity of the HA@Ag is also discussed. The results obtained showed that the HA nanorod morphology remained the same with Ag ions decorations on the HA structure which were deposited in the form of nanospheres. Interaction where occurred between the structure and its defect density variation in the interfacial HA@Ag and intrafacial HA region with the fungal medium resulted in antifungal activity. The reaction mechanisms involved oxygen and water adsorption which formed an active complex cluster. The decomposition and desorption of the final products as well as the electron/hole recombination process have an important role in fungicidal effects.

  15. Medium term investment planning at the Pfalzwerke AG; Mittelfristige Investitionsplanung bei der Pfalzwerke AG

    Energy Technology Data Exchange (ETDEWEB)

    Maar, K. [Pfalzwerke AG, Ludwigshafen (Germany). Abt. Informationsverarbeitung, Grundsatzplanung, Technische Dokumentation

    1998-01-12

    Investment objects in electricity supply industry are often used for a long period. The long-term development of an enterprise is therefore highly influenced by investments. In order to consider important influences early, Pfalzwerke AG designed an investment forecast model. This model permits to evaluate composition, medium term tendencies and amount of planned investments. Hereafter structure and connection of the model with the process of investment planning are described. (orig.) [Deutsch] In der Elektrizitaetswirtschaft haben Investitionsobjekte in der Regel eine lange Nutzungsdauer. Die Unternehmensentwicklung wird daher durch Investitionen langfristig beeinflusst. Um wichtige Rahmenbedingungen fruehzeitig in die Investitionsplanung einbeziehen zu koennen, wurde bei der Pfalzwerke AG ein Investitionsmodell konzipiert. Das Modell ermoeglicht es, geplante Investitionen in Abstimmung mit der Unternehmensplanung hinsichtlich Struktur, mittelfristiger Entwicklungstendenzen und Hoehe zu bewerten. Die Verfasserin beschreibt Aufbau und Einbindung des Modells in den Prozess der Investitionsplanung. (orig.)

  16. Microwave-assisted solvothermal synthesis of flower-like Ag/AgBr/BiOBr microspheres and their high efficient photocatalytic degradation for p-nitrophenol

    Energy Technology Data Exchange (ETDEWEB)

    Li, Tingting, E-mail: tingtingli1983@hotmail.com [Department of Chemistry and Chemical Engineering, Key Laboratory of Environmental Biology and Pollution Control, Hunan University, Changsha 410082 (China); State Key Laboratory of Chemo/Biosensing and Chemometrics, Hunan University, Changsha 410082 (China); Department of Environment and Chemical Engineering, Key Laboratory of Jiangxi Province for Ecological Diagnosis, Remediation and Pollution Control, Nanchang Hangkong University, Nanchang 330063 (China); Luo, Shenglian, E-mail: sllou@hnu.edu.cn [Department of Chemistry and Chemical Engineering, Key Laboratory of Environmental Biology and Pollution Control, Hunan University, Changsha 410082 (China); State Key Laboratory of Chemo/Biosensing and Chemometrics, Hunan University, Changsha 410082 (China); Department of Environment and Chemical Engineering, Key Laboratory of Jiangxi Province for Ecological Diagnosis, Remediation and Pollution Control, Nanchang Hangkong University, Nanchang 330063 (China); Yang, Lixia [Department of Environment and Chemical Engineering, Key Laboratory of Jiangxi Province for Ecological Diagnosis, Remediation and Pollution Control, Nanchang Hangkong University, Nanchang 330063 (China)

    2013-10-15

    Flower-like Ag/AgBr/BiOBr microspheres were successfully fabricated by the approach of microwave-assisted solvothermal and in situ photo-assisted reduction. A reactive ionic liquid 1-hexadecyl-3-methylimidazolium bromide ([C{sub 16}mim]Br) was employed as Br source in the presence of surfactant polyvinylpyrrolidone (PVP). The photocatalytic activity of Ag/AgBr/BiOBr towards the decomposition of p-nitrophenol under visible light irradiation was evaluated. The results indicated that Ag/AgBr/BiOBr showed enhanced photocatalytic activity towards p-nitrophenol, comparing with P25, BiOBr and Ag/AgBr. More than 96% of p-nitrophenol was decomposed in 3.5 h under visible-light irradation. The excellent photocatalytic activity of flower-like Ag/AgBr/BiOBr microspheres can be attributed to the large specific surface area, strong visible-light absorption, suitable energy band structure and surface plasmon resonance effect of Ag nanoparticles. The possible photocatalytic mechanism was proposed based on the active species test and band gap structure analysis. - Graphical abstract: The photocatalytic reaction mechanisms of the as-prepared Ag/AgBr/BiOBr. Display Omitted - Highlights: • Successful synthesis of flower-like Ag/AgBr/BiOBr microspheres. • The Ag/AgBr/BiOBr showed much higher photocatalytic activity towards p-nitrophenol as compared to BiOBr and Ag/AgBr. • The reasons for the excellent photocatalytic activity are the large specific surface area, strong visible-light absorption and surface plasmon resonance effect of Ag nanoparticles. • The O{sub 2}·{sup −}, Br{sup 0} and photogenerated h{sup +} play key roles in the photocatalytic degradation process.

  17. Rf beam control for the AGS Booster

    Energy Technology Data Exchange (ETDEWEB)

    Brennan, J.M.

    1994-09-26

    RF beam control systems for hadron synchrotrons have evolved over the past three decades into an essentially standard design. The key difference between hadron and lepton machines is the absence of radiation damping and existence of significant frequency variation in the case of hadrons. Although the motion of the hadron in the potential well of the rf wave is inherently stable it is not strongly damped. Damping must be provided by electronic feedback through the accelerating system. This feedback is typically called the phase loop. The technology of the rf beam control system for the AGS Booster synchrotron is described. First, the overall philosophy of the design is explained in terms of a conventional servo system that regulates the beam horizontal position in the vacuum chamber. The concept of beam transfer functions is fundamental to the mathematics of the design process and is reviewed. The beam transfer functions required for this design are derived from first principles. An overview of the beam signal pick-ups and high level rf equipment is given. The major subsystems, the frequency program, the heterodyne system, and beam feedback loops, are described in detail. Beyond accelerating the beam, the rf system must also synchronize the bunches in the Booster to the buckets in the AGS before transfer. The technical challenge in this process is heightened by the need to accomplish synchronization while the frequency is still changing. Details of the synchronization system are given. This report is intended to serve two purposes. One is to document the hardware and performance of the systems that have been built. The other is to serve as a tutorial vehicle from which the non-expert can not only learn the details of this system but also learn the principles of beam control that have led to the particular design choices made.

  18. Potentiated electron transference in α-Ag2WO4 microcrystals with Ag nanofilaments as microbial agent.

    Science.gov (United States)

    Longo, Valéria M; De Foggi, Camila C; Ferrer, Mateus M; Gouveia, Amanda F; André, Rafaela S; Avansi, Waldir; Vergani, Carlos E; Machado, Ana L; Andrés, Juan; Cavalcante, Laécio S; Hernandes, Antonio C; Longo, Elson

    2014-08-07

    This study is a framework proposal for understanding the antimicrobacterial effect of both α-Ag2WO4 microcrystals (AWO) synthesized using a microwave hydrothermal (MH) method and α-Ag2WO4 microcrystals with Ag metallic nanofilaments (AWO:Ag) obtained by irradiation employing an electron beam to combat against planktonic cells of methicillin-resistant Staphylococcus aureus (MRSA). These samples were characterized by X-ray diffraction (XRD), FT-Raman spectroscopy, ultraviolet visible (UV-vis) measurements, field emission scanning electron microscopy (FE-SEM), transmission electron microscopy (TEM), and high resolution transmission electron microscopy (HRTEM). The results reveal that both AWO and AWO:Ag solutions have bacteriostatic and bactericidal effects, but the irradiated sample is more efficient; i.e., a 4-fold of the MRSA planktonic cells as compared to the nonirradiated sample was observed. In addition, first principles calculations were performed to obtain structural and electronic properties of AWO and metallic Ag, which provides strong quantitative support for an antimicrobacterial mechanism based on the enhancement of electron transfer processes between α-Ag2WO4 and Ag nanoparticles.

  19. One-pot synthesis of visible-light-driven plasmonic photocatalyst Ag/AgCl in ionic liquid.

    Science.gov (United States)

    Xu, Hui; Li, Huaming; Xia, Jiexiang; Yin, Sheng; Luo, Zhijun; Liu, Ling; Xu, Li

    2011-01-01

    Plasmonic photocatalyst Ag/AgCl was prepared by in situ hydrothermal method with the contribution of 1-octyl-3-methylimidazolium chloride ([Omim]Cl), in which the [Omim]Cl ionic liquid acted not only as a precursor but also as a reducing reagent in the process of formation of Ag⁰. The samples were characterized by X-ray diffraction (XRD), scanning electron microscopy (SEM), diffuse reflectance spectroscopy (DRS), X-ray photoelectron spectroscopy (XPS), and thermogravimetric and differential scanning calorimetry (TG-DSC). The photocatalytic activity of the composites were evaluated by degradation of methyl orange (MO) under visible light irradiation. The experimental results showed that the high activity and stability of Ag/AgCl photocatalysts under visible-light irradiation were due to their localized surface plasmon resonance (LSPR). Based on the characterization of the structure and photocatalytic performance, the LSPR was determined by synergetic effect of many factors, such as particle size of metallic Ag, contents of the Ag⁰ nanoparticles, and the extent of metallic Ag dispersing. A photocatalytic mechanism of the Ag/AgCl photocatalyst was also proposed.

  20. One-step synthesis of Ag2S/Ag@MoS2 nanocomposites for SERS and photocatalytic applications

    Science.gov (United States)

    Wu, Jie; Zhou, Yifeng; Nie, Wangyan; Chen, Pengpeng

    2018-01-01

    This paper reported a one-step synthesis of Ag2S/Ag@MoS2 nanocomposites and its applications in the surface-enhanced Raman scattering (SERS) detection and photocatalytic degradation of organic pollutants. The nanocomposites were well characterized by transmission electron microscopy (TEM), X-ray diffraction (XRD), cyclic voltammograms (CV), the Brunauer-Emmett-Teller (BET), and Fourier transforms infrared spectra (FTIR). The AgNPs were uniformly dispersed on the MoS2 nanosheets and the particle size of the AgNPs was about 10-30 nm. These Ag2S/Ag@MoS2 nanocomposites offered sensitive SERS signals for the detection of R6G with the limit of detections as low as 10-10 M. The photocatalytic activity of the composite catalyst was studied by the degradation of methylene blue (MB) dye under light illumination. The apparent rate constant of MB degradation for the obtained catalyst could reach 6.6 × 10-2 min-1, indicating that the novel Ag2S/Ag@MoS2 nanocomposites can be explored for organic pollutant's detection and degradation.

  1. Screening different Brassica spp. germplasm for resistance to Rhizoctonia solani AG-2-1 and AG-8

    Science.gov (United States)

    Poor stands of canola seedlings in Pacific Northwest (PNW) have been associated with Rhizoctonia solani AG-2-1 and AG-8. A total of eighty five genotypes of Brassica napus, B. rapa, B. carinata, B. juncea and Sinapsis alba were evaluated in the growth chamber for their resistance to both R. solani A...

  2. Enhancement of the visible light activity and stability of Ag{sub 2}CO{sub 3} by formation of AgI/Ag{sub 2}CO{sub 3} heterojunction

    Energy Technology Data Exchange (ETDEWEB)

    Yu, Changlin, E-mail: yuchanglinjx@163.com [School of Metallurgy and Chemical Engineering, Jiangxi University of Science and Technology, Ganzhou, Jiangxi, 341000 (China); Wei, Longfu [School of Metallurgy and Chemical Engineering, Jiangxi University of Science and Technology, Ganzhou, Jiangxi, 341000 (China); Research Institute of Photocatalysis, State Key Laboratory of Photocatalysis on Energy and Environment, Fuzhou University, Fuzhou 350002 (China); Zhou, Wanqin; Chen, Jianchai; Fan, Qizhe [School of Metallurgy and Chemical Engineering, Jiangxi University of Science and Technology, Ganzhou, Jiangxi, 341000 (China); Liu, Hong, E-mail: liuhong@cigit.ac.cn [Chongqing Institute of Green and Intelligent Technology, Chinese Academy of Sciences, Chongqing 400714 (China)

    2014-11-15

    Highlights: • A novel AgI/Ag{sub 2}CO{sub 3} heterojunction was prepared via coprecipitation process. • AgI/Ag{sub 2}CO{sub 3} heterojunction increase e{sup −}/h{sup +} pairs separation. • The production of {sup •} OH and O{sub 2}{sup •} {sup −} radicals was promoted. • High photocatalytic activity and stability were obtained over AgI/Ag{sub 2}CO{sub 3}. - Abstract: An insurmountable problem for silver-based semiconductor photocatalysts is their poor stability. Here, at room temperature, AgI with different concentrations (5%, 10%, 20% and 30%) were coupled into Ag{sub 2}CO{sub 3}, producing a series of novel AgI/Ag{sub 2}CO{sub 3} composite photocatalysts. The effects of AgI addition on the Ag{sub 2}CO{sub 3} catalyst for photocatalytic degradation of methyl orange (MO) under visible light irradiation have been investigated. Some physicochemical technologies like N{sub 2} physical adsorption/desorption, powder X-ray diffraction (XRD), scanning electron microscopy (SEM), transmission electron microscopy (TEM), energy-dispersive X-ray (EDX) spectroscopy, X-ray photoelectron spectroscopy (XPS), and UV–vis diffuse reflectance spectroscopy (UV–vis DRS) were applied to characterize these products. Results show that the photocatalytic degradation activity of AgI/Ag{sub 2}CO{sub 3} photocatalyst is much higher than that of pure AgI and Ag{sub 2}CO{sub 3}. With the optimal content of AgI (20 wt%), the AgI/Ag{sub 2}CO{sub 3} exhibits the highest photocatalytic degradation efficiency. Its first order reaction rate constant (0.54 h{sup −1}) is 20 times of that of AgI (0.026 h{sup −1}) and 3.6 times of that of Ag{sub 2}CO{sub 3} (0.15 h{sup −1}). The characterizations and theory calculation show that AgI and Ag{sub 2}CO{sub 3} have suitably matched band gap structures. The formation of AgI/Ag{sub 2}CO{sub 3} heterojunction with intimate interface could effectively increase the separation efficiency of the e{sup −}/h{sup +} pairs and promote the

  3. Dynamical and passive characteristics of the Ag/TlGaSeS/Ag RF resonators

    Energy Technology Data Exchange (ETDEWEB)

    Qasrawi, A.F. [Group of Physics, Faculty of Engineering, Atilim University, 06836 Ankara (Turkey); Department of Physics, Arab-American University, Jenin, West Bank, Palestine; Elayyat, Shadia M.S. (Department of Physics, Arab-American University, Jenin, West Bank, Palestine); Gasanly, N.M. [Department of Physics, Middle East Technical University, 06800 Ankara (Turkey)

    2012-06-15

    Ag contacts on the surface of the TlGaSeS single crystals are observed to exhibit Schottky characteristics. The ideality factor of the Ag/ TlGaSeS/Ag device decreased from 5.2 to 1.3 by the reduction of series resistance effect on the I-V characteristics. Cheung's model analysis revealed a series resistance and barrier height of 40.6 K{omega} and 0.32 V, respectively. The device was run on the passive mode by injection with an alternating ac signal of variable frequency in the frequency range of 0-120 MHz and recoding the device capacitance. Several resonance-antiresonance positions in the range of 27-350 KHz were observed. The tangent loss factor of the passive device was observed to decrease with increasing frequency. It exhibited a very low loss value of the order of 10{sup -5} at 120 MHz. Such property is a characteristic of high performance tunable device being suitable as processor clock controller. (Copyright copyright 2012 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  4. Reversible conversion between AgCl and Ag in AgCl-doped RSiO{sub 3/2}-TiO{sub 2} films prepared by a sol-gel technique

    Energy Technology Data Exchange (ETDEWEB)

    Kawamura, Go, E-mail: gokawamura@ee.tut.ac.jp [Department of Electrical and Electronic Information Engineering, Toyohashi University of Technology, Toyohashi, Aichi 441-8580 (Japan); Tsurumi, Yuuki [Department of Environmental and Life Sciences, Toyohashi University of Technology, Toyohashi, Aichi 441-8580 (Japan); Muto, Hiroyuki [Department of Electrical and Electronic Information Engineering, Toyohashi University of Technology, Toyohashi, Aichi 441-8580 (Japan); Department of Environmental and Life Sciences, Toyohashi University of Technology, Toyohashi, Aichi 441-8580 (Japan); Sakai, Mototsugu; Inoue, Mitsuteru [Department of Electrical and Electronic Information Engineering, Toyohashi University of Technology, Toyohashi, Aichi 441-8580 (Japan); Matsuda, Atsunori [Department of Electrical and Electronic Information Engineering, Toyohashi University of Technology, Toyohashi, Aichi 441-8580 (Japan); Department of Environmental and Life Sciences, Toyohashi University of Technology, Toyohashi, Aichi 441-8580 (Japan)

    2011-10-17

    Highlights: {center_dot} The reversible redox behavior between AgCl and Ag in RSiO{sub 3/2}-TiO{sub 2} film is studied. {center_dot} TiO{sub 2} component induces Cl to remain in the film after conversion of AgCl to Ag. {center_dot} The survival of Cl is essential for reconversion of Ag to AgCl. {center_dot} The film shows potential to be applied as rewritable holographic material. - Abstract: The reversible redox behavior exhibited by AgCl-doped organosilsesquioxane-titania gel films is studied. Films prepared by the sol-gel method show reversible color changes with blue laser irradiation and subsequent heat treatment, which is based on the formation of Ag and AgCl nanoparticles, respectively. Two-beam interference exposure experiments reveal that the films have potential to be applied as rewritable holographic materials. A large titania content is essential for the conversion of Ag to AgCl because it induces the Cl to remain near the Ag nanoparticles during blue laser irradiation, allowing the Cl to react with neighboring Ag nanoparticles to reform AgCl upon subsequent heat treatment.

  5. Formation of canker lesions on stems and black scurf on tubers in experimentally inoculated potato plants by isolates of AG2-1, AG3 and AG5 of Rhizoctonia solani: a pilot study and literature review

    Directory of Open Access Journals (Sweden)

    M.J. LEHTONEN

    2008-12-01

    Full Text Available Development of black scurf on potato tubers (cv. Nicola was compared in plants inoculated with isolates of Rhizoctonia solani of three anastomosis groups (AG2-1, AG3 and AG5 which occur in potato crops in Finland. All isolates induced stem canker lesions but only isolates of AG3 formed efficiently black scurf on progeny tubers. Among the AG2-1 and AG5 isolates tested, only one AG2-1 isolate formed a few sclerotia on 13.5 % of the progeny tubers in one experiment. The data indicate that isolates of AG3 differ from those of AG2-1 and AG5 in having a higher ability to form sclerotia on tubers. Therefore, while AG2-1 and AG5 isolates have a broader host range, AG3 is more efficient in producing black scurf, which provides this anastomosis group with more efficient means of dissemination on seed potatoes. These differences probably explain the predominance of AG3 (98.9 % of isolates in potato crops in Finland and other northern potato production areas.;

  6. A Simple Method for the Preparation of TiO2 /Ag-AgCl@Polypyrrole Composite and Its Enhanced Visible-Light Photocatalytic Activity.

    Science.gov (United States)

    Yao, Tongjie; Shi, Lei; Wang, Hao; Wang, Fangxiao; Wu, Jie; Zhang, Xiao; Sun, Jianmin; Cui, Tieyu

    2016-01-01

    A novel and facile method was developed to prepare a visible-light driven TiO2 /Ag-AgCl@polypyrrole (PPy) photocatalyst with Ag-AgCl nanoparticles supported on TiO2 nanofibers and covered by a thin PPy shell. During the synthesis, the PPy shell and Ag-AgCl nanoparticles were prepared simultaneously onto TiO2 nanofibers, which simplified the preparation procedure. In addition, because Ag-AgCl aggregates were fabricated via partly etching the Ag nanoparticles, their size was well controlled at the nanoscale, which was beneficial for improvement of the contact surface area. Compared with reference photocatalysts, the TiO2 /Ag-AgCl@PPy composite exhibited an enhanced photodegradation activity towards rhodamine B under visible-light irradiation. The superior photocatalytic property originated from synergistic effects between TiO2 nanofibers, Ag-AgCl nanoparticles and the PPy shell. Furthermore, the TiO2 /Ag-AgCl@PPy composite could be easily separated and recycled without obvious reduction in activity. © 2016 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  7. Fabrication of graphene oxide enwrapped Z-scheme Ag2SO3/AgBr nanoparticles with enhanced visible-light photocatalysis

    Science.gov (United States)

    Wan, Yujuan; Liang, Chunyan; Xia, Yue; Huang, Wei; Li, Zelin

    2017-02-01

    A novel graphene oxide (GO) enwrapped Ag2SO3/AgBr (GO/Ag2SO3/AgBr) composite was fabricated through a facile solution approach via electrostatic interaction and precipitation transformation reaction for the first time. The results of XRD, Raman, SEM, TEM and XPS confirmed the structure, morphology and composition of the GO/Ag2SO3/AgBr composite very well. The Ag2SO3/AgBr nanoparticles were found to be encapsulated by GO sheets. The photocatalytic activity of the composite was investigated by the degradation of methyl orange (MO), rhodamine B (RhB) and methylene blue (MB) in water under visible light. The incorporation of GO sheets not only significantly enhanced the photocatalytic activity but also improved the reusability of Ag2SO3/AgBr nanoparticles. The photocatalytic ability of GO/Ag2SO3/AgBr can be maintained at a high level for 4 times cycle experiments. The trapping experiments confirmed that holes and superoxide ion radicals were the main active species responsible for the degradation reaction. A plasmonic Z-scheme photocatalytic mechanism was proposed to illustrate the possible transferred and separated behavior of electron-hole pairs among Ag, Ag2SO3, AgBr and GO quaternary system under visible light irradiation.

  8. Posintro™-HBsAg, a modified ISCOM including HBsAg, induces strong cellular and humoral responses

    DEFF Research Database (Denmark)

    Schiött, Asa; Larsson, Kristina; Manniche, Søren

    2011-01-01

    To improve the hepatitis B vaccines on the market new adjuvant systems have to substitute aluminium. In this study the hepatitis B surface antigen (HBsAg) was incorporated into a novel adjuvant system, the Posintro™, a modification of the traditional immune stimulatory complexes (ISCOMs). This new...... HBsAg vaccine formulation, Posintro™-HBsAg, was compared to two commercial hepatitis B vaccines including aluminium or monophosphoryl lipid A (MPL) and the two adjuvant systems MF59 and QS21 in their efficiency to prime both cellular and humoral immune responses. The Posintro™-HBsAg induced....... The results demonstrate that this novel experimental vaccine formulation, the Posintro™-HBsAg, is strongly immunogenic and can induce both class I and class II responses in experimental animals. This shows promise both for the protection against hepatitis B virus infection and as a potential therapeutic...

  9. AgSbSe{sub 2} and AgSb(S,Se){sub 2} thin films for photovoltaic applications

    Energy Technology Data Exchange (ETDEWEB)

    Garza, J.G. [Facultad de Ingenieria Mecanica y Electrica, Universidad Autonoma de Nuevo Leon, San Nicolas de los Garza, Nuevo Leon (Mexico); Shaji, S. [Facultad de Ingenieria Mecanica y Electrica, Universidad Autonoma de Nuevo Leon, San Nicolas de los Garza, Nuevo Leon (Mexico); Facultad de Ingenieria Mecanica y Electrica, CIIDIT - Universidad Autonoma de Nuevo Leon, Apodaca, Nuevo Leon (Mexico); Rodriguez, A.C.; Das Roy, T.K. [Facultad de Ingenieria Mecanica y Electrica, Universidad Autonoma de Nuevo Leon, San Nicolas de los Garza, Nuevo Leon (Mexico); Krishnan, B., E-mail: kbindu_k@yahoo.com [Facultad de Ingenieria Mecanica y Electrica, Universidad Autonoma de Nuevo Leon, San Nicolas de los Garza, Nuevo Leon (Mexico); Facultad de Ingenieria Mecanica y Electrica, CIIDIT - Universidad Autonoma de Nuevo Leon, Apodaca, Nuevo Leon (Mexico)

    2011-10-01

    Silver antimony selenide (AgSbSe{sub 2}) thin films were prepared by heating sequentially deposited multilayers of antimony sulphide (Sb{sub 2}S{sub 3}), silver selenide (Ag{sub 2}Se), selenium (Se) and silver (Ag). Sb{sub 2}S{sub 3} thin film was prepared from a chemical bath containing SbCl{sub 3} and Na{sub 2}S{sub 2}O{sub 3}, Ag{sub 2}Se from a solution containing AgNO{sub 3} and Na{sub 2}SeSO{sub 3} and Se thin films from an acidified solution of Na{sub 2}SeSO{sub 3}, at room temperature on glass substrates. Ag thin film was deposited by thermal evaporation. The annealing temperature was 350 deg. C in vacuum (10{sup -3} Torr) for 1 h. X-ray diffraction analysis showed that the thin films formed were polycrystalline AgSbSe{sub 2} or AgSb(S,Se){sub 2} depending on selenium content in the precursor films. Morphology and elemental analysis of these films were done using scanning electron microscopy and energy dispersive X-ray spectroscopy. Optical band gap was evaluated from the UV-visible absorption spectra of these films. Electrical characterizations were done using Hall effect and photocurrent measurements. A photovoltaic structure: glass/ITO/CdS/AgSbSe{sub 2}/Al was formed, in which CdS was deposited by chemical bath deposition. J-V characteristics of this structure showed V{sub oc} = 435 mV and J{sub sc} = 0.08 mA/cm{sup 2} under illumination using a tungsten halogen lamp. Preparation of a photovoltaic structure using AgSbSe{sub 2} as an absorber material by a non-toxic selenization process is achieved.

  10. Toluene removal by sequential adsorption-plasma catalytic process: Effects of Ag and Mn impregnation sequence on Ag-Mn/γ-Al2O3.

    Science.gov (United States)

    Qin, Caihong; Huang, Xuemin; Dang, Xiaoqing; Huang, Jiayu; Teng, Jingjing; Kang, Zhongli

    2016-11-01

    A series of Ag-Mn/γ-Al2O3 were prepared under different Ag/Mn impregnation sequence and tested in the sequential adsorption-plasma catalytic removal of toluene. When Mn was impregnated first, the resulting catalyst, Ag-Mn(F)/γ-Al2O3, had longer breakthrough time, gave less emission of toluene, had higher CO2 selectivity, and had better carbon balance and COx yield compared to catalysts prepared via other impregnation sequences. After 120 min of NTP treatment, the carbon balance of Ag-Mn(F)/γ-Al2O3 was 91%, with 87% as COx contributions. A Brunauer-Emmett-Teller (BET) analysis and X-ray photoelectron spectroscopy (XPS) results show that, the impregnation sequence impacts the BET surface area and the ratio and existing state of Ag on the surface of the catalysts. The longer breakthrough time when using Ag-Mn(F)/γ-Al2O3 as catalyst is attributed to the large amount of Ag(+) on the surface. Ag(+) is a new active site for toluene adsorption. When Ag was impregnated first (Ag(F)-Mn/γ-Al2O3) or Ag and Mn co-impregnated (Ag-Mn-C/γ-Al2O3), the predominant specie was Ag(+). Both Ag(0) and Ag(+) species were detected on Ag-Mn(F)/γ-Al2O3. Ag(0) cooperation with MnOx may promote the migration of surface active oxygen. This would facilitate the oxidation of adsorbed toluene with CC bond already weakened by Ag(+) and would result in higher CO2 selectivity and better carbon balance as seen in the Ag-Mn(F)/γ-Al2O3 system. Copyright © 2016 Elsevier Ltd. All rights reserved.

  11. Enzyme immobilization on Ag nanoparticles/polyaniline nanocomposites.

    Science.gov (United States)

    Crespilho, Frank N; Iost, Rodrigo M; Travain, Silmar A; Oliveira, Osvaldo N; Zucolotto, Valtencir

    2009-06-15

    We show a simple strategy to obtain an efficient enzymatic bioelectrochemical device, in which urease was immobilized on electroactive nanostructured membranes (ENMs) made with polyaniline and silver nanoparticles (AgNP) stabilized in polyvinyl alcohol (PAni/PVA-AgNP). Fabrication of the modified electrodes comprised the chemical deposition of polyaniline followed by drop-coating of PVA-AgNP and urease, resulting in a final ITO/PAni/PVA-AgNP/urease electrode configuration. For comparison, the electrochemical performance of ITO/PAni/urease electrodes (without Ag nanoparticles) was also studied. The performance of the modified electrodes toward urea hydrolysis was investigated via amperometric measurements, revealing a fast increase in cathodic current with a well-defined peak upon addition of urea to the electrolytic solution. The cathodic currents for the ITO/PAni/PVA-AgNP/urease electrodes were significantly higher than for the ITO/PAni/urease electrodes. The friendly environment provided by the ITO/PAni/PVA-AgNP electrode to the immobilized enzyme promoted efficient catalytic conversion of urea into ammonium and bicarbonate ions. Using the Michaelis-Menten kinetics equation, a K(M)(app) of 2.7 mmol L(-1) was obtained, indicating that the electrode architecture employed may be advantageous for fabrication of enzymatic devices with improved biocatalytic properties.

  12. Enhancement of Ag nanoparticles concentration by prior ion implantation

    Science.gov (United States)

    Mu, Xiaoyu; Wang, Jun; Liu, Changlong

    2017-09-01

    Thermally grown SiO2 layer on Si substrates were singly or sequentially implanted with Zn or Cu and Ag ions at the same fluence of 2 × 1016/cm2. The profiles of implanted species, structure, and spatial distribution of the formed nanoparticles (NPs) have been characterized by the cross-sectional transmission electron microscope (XTEM) and Rutherford backscattering spectrometry (RBS). It is found that pre-implantation of Zn or Cu ions could suppress the self sputtering of Ag atoms during post Ag ion implantation, which gives rise to fabrication of Ag NPs with a high density. Moreover, it has also been demonstrated that the suppressing effect strongly depends on the applied energy and mobility of pre-implanted ions. The possible mechanism for the enhanced Ag NPs concentration has been discussed in combination with SRIM simulations. Both vacancy-like defects acting as the increased nucleation sites for Ag NPs and a high diffusivity of prior implanted ions in SiO2 play key roles in enhancing the deposition of Ag implants.

  13. Photoinduced absorption of Ag nanoparticles deposited on ITO substrate

    Energy Technology Data Exchange (ETDEWEB)

    Ozga, K., E-mail: cate.ozga@wp.pl [Chair of Public Health, Czestochowa University of Technology, Al. Armii Krajowej 36B, 42-200 Czestochowa (Poland); Oyama, M. [Department of Material Chemisrty, Graduate School of Engineering, Kyoto University, Nishikyo-ku, Kyoto 615-8520 (Japan); Szota, M. [Institute of Materials Science and Engineering, Technical University of Czestochowa, al. Armii Krajowej 19, 42-200 Czestochowa (Poland); Nabialek, M. [Institute of Physics, Czestochowa University of Technology, Al. Armii Krajowej 19, 42-200 Czestochowa (Poland); Kityk, I.V. [Electrical Engineering Department, Czestochowa University of Technology, Al. Armii Krajowej 17/19, 42-200 Czestochowa (Poland); Slezak, A. [Chair of Public Health, Czestochowa University of Technology, Al. Armii Krajowej 36B, 42-200 Czestochowa (Poland); Umar, A.A. [Institute of Micronegineering and Nanoelectronics Universiti Kebangsaan Malaysia 43600 UKM bangi, Selangor D.E. (Malaysia); Nouneh, K. [INANOTECH, Institute of Nanomaterials and Nanotechnology, MAScIR (Moroccan Advanced Science, Innovation and Research Foundation), ENSET, Av. Armee Royale, 10100, Rabat (Morocco)

    2011-06-15

    Research highlights: > We study photoinduced absorption for two Ag NP deposited on the ITO. > The higher resistance eof the NP favors larger photoinduced changes. > Principal role is played by nanointerfaces. - Abstract: Substantial changes of absorption after illumination by 300 mW continuous wave green laser at 532 nm were observed. The effect of indium tin oxide (ITO) substrate was explored versus Ag nanoparticles (AgNPs) size, their regularity and surface plasmon resonance. The ITO substrate features play a crucial role for the formation of homogenous AgNPs. The attachments of AgNPs on ITO surface as well as their homogeneity are significantly changed under the influence of the laser treatment. We study the Ag NP deposited on the two different substrates which play a crucial role in the photoinduced absorption. The dependence of the photoinduced absorption versus the time of optical treatment is explained within a framework of the photopolarization of the particular trapping levels on the borders between the ITO substrate and the Ag NP.

  14. Study of Ag and Au Nanoparticles Synthesized by Arc Discharge in Deionized Water

    Directory of Open Access Journals (Sweden)

    Der-Chi Tien

    2010-01-01

    Full Text Available The paper presents a study of Ag and Au nanofluids synthesized by the arc discharge method (ADM in deionized water. The metallic Ag nanoparticle (Ag0 and ionic Ag (Ag+ have played an important role in the battle against germs which are becoming more drug-resistant every year. Our study indicates that Ag nanoparticle suspension (SNPS fabricated by using ADM without added surfactants exclusively contains the metallic Ag nanoparticle and ionic Ag. Besides that, the ADM in deionized water has also been employed for the fabrication process of Au nanoparticles. The experimental results indicate that the prepared Ag nanoparticles can react with the dissolved H2CO3 in deionized water, leading to the formation of Ag2CO3. Significantly different to Ag, the prepared Au nanoparticles with their surfaces bonded by oxygen are suspended in deionized water by the formation of hydrogen bonded with the neighboring water molecules.

  15. Ag-loaded mesoporous bioactive glasses against Enterococcus faecalis biofilm in root canal of human teeth.

    Science.gov (United States)

    Fan, Wei; Wu, Daming; Ma, Tengjiao; Fan, Bing

    2015-01-01

    Ag-loaded mesoporous bioactive glass (Ag-MBG) powders were synthesized and characterized. The ions release of Ag-MBGs in Tris-HCl and the pH stability of simulated body fluids after immersing Ag-MBGs were tested. Root canals were inoculated with Enterococcus faecalis for 4 weeks, and the antibacterial activity of MBGs, Ag-MBGs and calcium hydroxide against E. faecalis biofilm were evaluated. Results showed that Ag-MBGs possessed highly ordered mesoporous structure with silver nanoparticles deposited in the mesopores, which enabled a sustained Ag ions released. The biofilms treated with Ag-MBGs showed a significant structural disruption compared with MBGs. These results indicated that Ag-MBGs possess a potent antibacterial effect against E.faecalis biofilm in root canal, and the antibacterial activity was induced by the release of Ag ions from Ag-MBGs.

  16. Tribological Properties of Ag/bscco Self-Lubricating Composites

    Science.gov (United States)

    Dong, Lirong; Li, Changsheng; Hua, Tang

    The superconductors Bi2Sr2CaCu2Ox (Bi2212 ) and Ag/Bi2212 composites samples were prepared by the powder metallurgy method. The frictional behaviors of Bi2212 pins in contact with stainless steel plate were examined from -196 to 20°C on friction and wear tester. When the temperature was lower than the superconducting transition temperature, the friction coefficient of Bi2212 dropped sharply, and it kept 0.11 with increase of the test time. The microstructure and morphology of Ag/Bi2212 composites were investigated by means of X-ray diffraction (XRD), transmission electronic microscope (TEM) and high resolution transmission electronic microscope (HRTEM). The elemental compositions of the worn surfaces of Ag/Bi2212 composites were determined by using energy dispersive X-ray analysis (EDXA). The results showed that the superconducting structure of Bi2212 was not changed and Ag was distributed in the Bi2212 matrix. Ag doping improved the toughness of oxide ceramics Bi2212. The friction test results of Ag/Bi2212 composites showed the tribological properties were improved at room temperature. The friction coefficient of 10%Ag/Bi2212 against stainless steel showed a lower value (0.2) and the wear rate of 15%Ag/Bi2212 was minimum (9.5×10-5 mm3·(N·m)-1 ). The lubrication of soft metallic film and load of hard matrix were the mechanism of decreased friction and anti-wear of Ag/Bi2212 composites.

  17. Liquidus Projection and Thermodynamic Modeling of a Sn-Ag-Zn System

    Science.gov (United States)

    Chen, Sinn-wen; Chiu, Wan-ting; Gierlotka, Wojciech; Chang, Jui-shen; Wang, Chao-hong

    2017-12-01

    Sn-Ag-Zn alloys are promising Pb-free solders. In this study, the Sn-Ag-Zn liquidus projection was determined, and the Sn-Ag-Zn thermodynamic modeling was developed. Various Sn-Ag-Zn alloys were prepared. Their as-cast microstructures and primary solidification phases were examined. The invariant reaction temperatures of the ternary Sn-Ag-Zn system were determined. The liquidus projection of the Sn-Ag-Zn ternary system was constructed. It was found that the Sn-Ag-Zn ternary system has eight primary solidification phases: ɛ2-AgZn3, γ-Ag5Zn8, β-AgZn, ζ-Ag4Sn, (Ag), ɛ1-Ag3Sn, β-(Sn) and (Zn) phases. There are eight ternary invariant reactions, and the liquid + (Ag) = β-AgZn + ζ-Ag4Sn reaction is of the highest temperature at 935.5 K. Thermodynamic modeling of the ternary Sn-Ag-Zn system was also carried out in this study based on the thermodynamic models of the three constituent binary systems and the experimentally determined liquidus projection. The liquidus projection and the isothermal sections are calculated. The calculated and experimentally determined liquidus projections are in good agreement.

  18. The Antimicrobial Properties of Silver Nanoparticles in Bacillus subtilis Are Mediated by Released Ag+ Ions.

    Directory of Open Access Journals (Sweden)

    Yi-Huang Hsueh

    Full Text Available The superior antimicrobial properties of silver nanoparticles (Ag NPs are well-documented, but the exact mechanisms underlying Ag-NP microbial toxicity remain the subject of intense debate. Here, we show that Ag-NP concentrations as low as 10 ppm exert significant toxicity against Bacillus subtilis, a beneficial bacterium ubiquitous in the soil. Growth arrest and chromosomal DNA degradation were observed, and flow cytometric quantification of propidium iodide (PI staining also revealed that Ag-NP concentrations of 25 ppm and above increased membrane permeability. RedoxSensor content analysis and Phag-GFP expression analysis further indicated that reductase activity and cytosolic protein expression decreased in B. subtilis cells treated with 10-50 ppm of Ag NPs. We conducted X-ray absorption near-edge structure (XANES and extended X-ray absorption fine structure (EXAFS analyses to directly clarify the valence and fine structure of Ag atoms in B. subtilis cells placed in contact with Ag NPs. The results confirmed the Ag species in Ag NP-treated B. subtilis cells as Ag2O, indicating that Ag-NP toxicity is likely mediated by released Ag+ ions from Ag NPs, which penetrate bacterial cells and are subsequently oxidized intracellularly to Ag2O. These findings provide conclusive evidence for the role of Ag+ ions in Ag-NP microbial toxicity, and suggest that the impact of inappropriately disposed Ag NPs to soil and water ecosystems may warrant further investigation.

  19. Thermodynamic modelling of the Ag-Cu-Ti ternary system.

    OpenAIRE

    Dezellus, Olivier; Arroyave, Raymundo; Fries, Suzana G.

    2011-01-01

    International audience; The Ag-Cu-Ti system is important for brazing applications, particularly for ceramic joining. This system is characterized by numerous intermetallics in the {Cu-Ti} binary and the existence of a miscibility gap in the liq. phase. For applications, knowledge of the phase equil., invariant reactions in the temp. range of interest and thermodn. activity values (mainly of Ti) are important. Thermodn. model parameters for all the stable phases in the Ag-Cu, Cu-Ti and Ag-Ti s...

  20. Structural and optical properties of Si-doped Ag clusters

    KAUST Repository

    Mokkath, Junais Habeeb

    2014-03-06

    The structural and optical properties of AgN and Ag N-1Si1 (neutral, cationic, and anionic) clusters (N = 5 to 12) are systematically investigated using the density functional based tight binding method and time-dependent density functional theory, providing insight into recent experiments. The gap between the highest occupied and lowest unoccupied molecular orbitals and therefore the optical spectrum vary significantly under Si doping, which enables flexible tuning of the chemical and optical properties of Ag clusters. © 2014 American Chemical Society.

  1. Highly stable and efficient Ag/AgCl-TiO{sub 2} photocatalyst: Preparation, characterization, and application in the treatment of aqueous hazardous pollutants

    Energy Technology Data Exchange (ETDEWEB)

    Guo, Jian-Feng; Ma, Bowen; Yin, Anyuan; Fan, Kangnian [Department of Chemistry and Shanghai Key Laboratory of Molecular Catalysis and Innovative Materials, Fudan University, Shanghai 200433 (China); Dai, Wei-Lin, E-mail: wldai@fudan.edu.cn [Department of Chemistry and Shanghai Key Laboratory of Molecular Catalysis and Innovative Materials, Fudan University, Shanghai 200433 (China)

    2012-04-15

    Graphical abstract: A new plasmonic photocatalyst of Ag-AgCl/TiO{sub 2} was prepared by deposition-precipitation and photoreduction. This photocatalyst exhibited efficient photocatalytic activity for the degradation of 4-chlorophenol and photoreduction Cr(VI) under visible light irradiation. Highlights: Black-Right-Pointing-Pointer The preparation procedure for Ag-AgCl/TiO{sub 2} was convenient and feasible. Black-Right-Pointing-Pointer Ag-AgCl/TiO{sub 2} was very efficient under visible-light irradiation. Black-Right-Pointing-Pointer Ag-AgCl/TiO{sub 2} can photodegrade 4-chlorophenol and Cr(VI) effectively. Black-Right-Pointing-Pointer The surface plasmon resonance effect of Ag{sup 0} nanoparticles played a key role. - Abstract: A new plasmonic photocatalyst of Ag-AgCl-TiO{sub 2} was prepared by deposition-precipitation and photoreduction. This photocatalyst exhibited efficient photocatalytic activity for the degradation of 4-chlorophenol and photoreduction of Cr(VI) ion under visible light irradiation. Its high photocatalytic activity can be attributed to the surface plasmon resonance effect of Ag nanoparticles, which were highly dispersed on the surface of Ag-AgCl-TiO{sub 2}. N{sub 2} adsorption and desorption isotherm spectra, X-ray diffraction, X-ray photoelectron spectroscopy, and transmission electron microscopy were used to determine the correlation between the micro-structure and the catalytic properties of the as-prepared photocatalysts.

  2. Biomedical Potential of Ultrafine Ag/AgCl Nanoparticles Coated on Graphene with Special Reference to Antimicrobial Performances and Burn Wound Healing.

    Science.gov (United States)

    Zhou, Yazhou; Chen, Ru; He, Tingting; Xu, Kai; Du, Dan; Zhao, Nan; Cheng, Xiaonong; Yang, Juan; Shi, Haifeng; Lin, Yuehe

    2016-06-22

    In recent years, researchers have proven the release of silver ions (Ag(+)) from silver nanoparticles (Ag NPs) significantly affects their toxicity to bacteria and other organisms. Due to the difficulty in maintaining a steady flux of a high concentration of Ag(+), it is still challenging to develop a highly efficient, stable, and biocompatible Ag NP-based antimicrobial material. To circumvent this issue, we developed a new Ag-based bactericide through the fabrication of sunlight-driven and ultrafine silver/silver chloride anchored on reduced graphene oxide (Ag/AgCl/rGO). This stable Ag/AgCl nanophotocatalyst with negligible release of Ag(+) generated a high amount of oxidative radicals, killing the bacteria, thus achieving both high bactericidal efficiency and stability. Moreover, functionalization of the nanomaterial with poly(diallyldimethylammonium chloride) (PDDA) gives it a highly adsorptive capacity, which allows it to capture the bacteria and possibly enhances the bactericidal activity. In vivo histopathological studies showed that the Ag/AgCl/rGO nanomaterial could obviously promote the regeneration of the epidermis, which indicated the good biomedical potential of Ag/AgCl/rGO nanomaterial in burn wound healing.

  3. Synthesis of AG@AgCl Core-Shell Structure Nanowires and Its Photocatalytic Oxidation of Arsenic (III) Under Visible Light.

    Science.gov (United States)

    Qin, Yanyan; Cui, Yanping; Tian, Zhen; Wu, Yangling; Li, Yilian

    2017-12-01

    Ag@AgCl core-shell nanowires were synthesized by oxidation of Ag nanowires with moderate FeCl 3 , which exhibited excellent photocatalytic activity for As(III) oxidation under visible light. It was proved that the photocatalytic oxidation efficiency was significantly dependent on the mole ratio of Ag:AgCl. The oxidation rate of As(III) over Ag@AgCl core-shell nanowires first increased with the decrease of Ag 0 percentage, up until the optimized synthesis mole ratio of Ag nanowires:FeCl 3 was 2.32:2.20, with 0.023 mg L -1  min -1 As(III) oxidation rate; subsequently, the oxidation rate dropped with the further decrease of Ag 0 percentage. Effects of the pH, ionic strength, and concentration of humic acid on Ag@AgCl photocatalytic ability were also studied. Trapping experiments using radical scavengers confirmed that h + and ·O 2 - acted as the main active species during the visible-light-driven photocatalytic process for As(III) oxidation. The recycling experiments validated that Ag@AgCl core-shell nanowires were a kind of efficient and stable photocatalyst for As(III) oxidation under visible-light irradiation.

  4. Amino acid substitutions at positions 122 and 145 of hepatitis B virus surface antigen (HBsAg) determine the antigenicity and immunogenicity of HBsAg and influence in vivo HBsAg clearance.

    Science.gov (United States)

    Wu, Chunchen; Deng, Wanyu; Deng, Liu; Cao, Liang; Qin, Bo; Li, Songxia; Wang, Yun; Pei, Rongjuan; Yang, Dongliang; Lu, Mengji; Chen, Xinwen

    2012-04-01

    A variety of amino acid substitutions, such as K122I and G145R, have been identified around or within the a determinant of hepatitis B surface antigen (HBsAg), impair HBsAg secretion and antibody binding, and may be responsible for immune escape in patients. In this study, we examined how different substitutions at amino acid positions 122 and 145 of HBsAg influence HBsAg expression, secretion, and recognition by anti-HBs antibodies. The results showed that the hydrophobicity, the presence of the phenyl group, and the charges in the side chain of the amino acid residues at position 145 reduced HBsAg secretion and impaired reactivity with anti-HBs antibodies. Only the substitution K122I at position 122 affected HBsAg secretion and recognition by anti-HBs antibodies. Genetic immunization in mice demonstrated that the priming of anti-HBs antibody response was strongly impaired by the substitutions K122I, G145R, and others, like G145I, G145W, and G145E. Mice preimmunized with wild-type HBsAg (wtHBsAg) or variant HBsAg (vtHBsAg) were challenged by hydrodynamic injection (HI) with a replication-competent hepatitis B virus (HBV) clone. HBsAg persisted in peripheral blood for at least 3 days after HI in mice preimmunized with vtHBsAg but was undetectable in mice preimmunized with wtHBsAg, indicating that vtHBsAgs fail to induce proper immune responses for efficient HBsAg clearance. In conclusion, the biochemical properties of amino acid residues at positions 122 and 145 of HBsAg have a major effect on antigenicity and immunogenicity. In addition, the presence of proper anti-HBs antibodies is indispensable for the neutralization and clearance of HBsAg during HBV infection.

  5. Synthesis and characterization of Ag-containing calcium phosphates with various Ca/P ratios

    Energy Technology Data Exchange (ETDEWEB)

    Gokcekaya, Ozkan, E-mail: gokcekaya@dc.tohoku.ac.jp [Department of Materials Processing, Tohoku University, 6-6-02 Aza Aoba, Aramaki, Aoba-ku, Sendai, Miyagi 980-8579 (Japan); Ueda, Kyosuke; Narushima, Takayuki [Department of Materials Processing, Tohoku University, 6-6-02 Aza Aoba, Aramaki, Aoba-ku, Sendai, Miyagi 980-8579 (Japan); Ergun, Celaletdin [Faculty of Mechanical Engineering, Istanbul Technical University, 65 Inonu Street, Gumussuyu, Istanbul 34437 (Turkey)

    2015-08-01

    Ag-containing calcium phosphate (CaP) powders were synthesized by a precipitation method using aqueous solutions of calcium nitrate, silver nitrate, and ammonium phosphate. The powders were sintered at temperatures ranging from 1173 to 1473 K. The charged atomic ratios of (Ca + Ag)/P and Ag/(Ca + Ag) in solution were varied from 1.33 to 1.67 and from 0 to 0.30, respectively. The Ag content in the as-precipitated CaP powders increased with the charged Ag/(Ca + Ag) atomic ratio in solution and was lower than the charged Ag/(Ca + Ag) value. The as-precipitated CaP powders consisted of hydroxyapatite (HA) as the main phase. Ag nanoparticles were observed on the as-precipitated HA particles under all conditions of Ag addition. After the sintering, HA, β-TCP (tricalcium phosphate), α-TCP, and β-CPP (calcium pyrophosphate) were mainly detected as CaPs on the basis of the Ca/P atomic ratio of the as-precipitated powders. The addition of Ag stabilized the β-TCP phase, and the distribution of Ag in β-TCP was homogeneous. A metallic Ag phase coexisted with HA. The solubility of Ag in HA was estimated to be 0.0019–0.0061 (Ag/(Ca + Ag)) atomic ratio, which was lower than that in β-TCP (higher than 0.0536) and higher than that of β-CPP (below the detection limit of analyses). - Highlights: • The HA powders with Ag nanoparticles were synthesized by a precipitation method. • Metallic Ag particles were detected with the HA phase after sintering. • The distribution of Ag in β-TCP was homogeneous after sintering. • The addition of Ag stabilized the β-ΤCP phase. • β-TCP exhibited higher solubility of Ag than HA and β-CPP.

  6. Photoinduced transformations in a thin-film waveguide AgCl-Ag composition under a green (532 nm) laser beam

    Science.gov (United States)

    Ageev, L. A.; Miloslavskii, V. K.; Lymar, V. I.; Reznikova, V. M.

    2013-12-01

    A linearly polarized ( E 0) laser beam (λ = 532 nm) causes photoinduced transformations in an AgCl-Ag composition consisting of a thin waveguide AgCl film on glass covered by a layer of Ag nanoparticles. Before the illumination the sample exhibits an absorption band due to localized plasmons in nanoparticles. The illumination excites plasmons and leads to scattering of waveguide TE0 modes. The interference of modes with the incident light beam leads to the development of a periodic structure, the lines of which are formed by Ag particles and directed along E 0. The measured structure period coincides with the result of calculation based on solving the dispersion equation for the TE0-mode. Measurement of absorption in the E ‖ E 0 polarization reveals dichroism and a spectral hole (at λ ≈ nm). It is shown that the structures formed remain on the substrate after removing AgCl in a fixing agent. The dichroism value and dispersion change after fixing. The character of dichroism prior to fixing is recovered after depositing an AgCl layer (with the parameters retained) on the fixed film.

  7. One-step synthesis of Ag/AgCl/GO composite: A photocatalyst of extraordinary photoactivity and stability.

    Science.gov (United States)

    Liu, Lin; Deng, Jiatao; Niu, Tongjun; Zheng, Gang; Zhang, Pei; Jin, Yong; Jiao, Zhifeng; Sun, Xiaosong

    2017-05-01

    Recently, the photocatalytic applications of silver chloride have been paid closed attention for the excellent ability to photodegrade organic pollutants. Comparing with other catalysts, the silver chloride presents outstanding photocatalytic activity. However, it also suffers from the poor photocatalytic stability. This very paper is focusing on the one-step wet chemical process of preparing Ag/AgCl/GO photocatalyst with high photocatalytic activity and stability. The detailed characterizations were particularly carried out in order to investigate the photo-catalytic activity and stability. Meanwhile the morphology, chemical composition as well as crystalline structure were investigated. It is found that the as-prepared Ag/AgCl/GO composite exhibited an ultrahigh photocatalytic activity and stability in the process of photodegrading RhB. The unique catalytic activity has been discussed based on the SPR effect in Ag nanoparticles on AgCl surface and the separation of photo-generated electron-hole pairs, the primary benefit of the stability owes a great deal to GO which can capture the photo-generated electrons in case they reduce Ag+ ion or recombine the excited holes. Copyright © 2016. Published by Elsevier Inc.

  8. Pt@Ag and Pd@Ag core/shell nanoparticles for catalytic degradation of Congo red in aqueous solution.

    Science.gov (United States)

    Salem, Mohamed A; Bakr, Eman A; El-Attar, Heba G

    2018-01-05

    Platinum/silver (Pt@Ag) and palladium/silver (Pd@Ag) core/shell NPs have been synthesized in two steps reaction using the citrate method. The progress of nanoparticle formation was followed by the UV/Vis spectroscopy. Transmission electron microscopy revealed spherical shaped core/shell nanoparticles with average particle diameter 32.17nm for Pt@Ag and 8.8nm for Pd@Ag. The core/shell NPs were further characterized by FT-IR and XRD. Reductive degradation of the Congo red dye was chosen to demonstrate the excellent catalytic activity of these core/shell nanostructures. The nanocatalysts act as electron mediators for the transfer of electrons from the reducing agent (NaBH4) to the dye molecules. Effect of reaction parameters such as nanocatalyst dose, dye and NaBH4 concentrations on the dye degradation was investigated. A comparison between the catalytic activities of both nanocatalysts was made to realize which of them the best in catalytic performance. Pd@Ag was the higher in catalytic activity over Pt@Ag. Such greater activity is originated from the smaller particle size and larger surface area. Pd@Ag nanocatalyst was catalytically stable through four subsequent reaction runs under the utilized reaction conditions. These findings can thus be considered as possible economical alternative for environmental safety against water pollution by dyes. Copyright © 2017. Published by Elsevier B.V.

  9. Pt@Ag and Pd@Ag core/shell nanoparticles for catalytic degradation of Congo red in aqueous solution

    Science.gov (United States)

    Salem, Mohamed A.; Bakr, Eman A.; El-Attar, Heba G.

    2018-01-01

    Platinum/silver (Pt@Ag) and palladium/silver (Pd@Ag) core/shell NPs have been synthesized in two steps reaction using the citrate method. The progress of nanoparticle formation was followed by the UV/Vis spectroscopy. Transmission electron microscopy revealed spherical shaped core/shell nanoparticles with average particle diameter 32.17 nm for Pt@Ag and 8.8 nm for Pd@Ag. The core/shell NPs were further characterized by FT-IR and XRD. Reductive degradation of the Congo red dye was chosen to demonstrate the excellent catalytic activity of these core/shell nanostructures. The nanocatalysts act as electron mediators for the transfer of electrons from the reducing agent (NaBH4) to the dye molecules. Effect of reaction parameters such as nanocatalyst dose, dye and NaBH4 concentrations on the dye degradation was investigated. A comparison between the catalytic activities of both nanocatalysts was made to realize which of them the best in catalytic performance. Pd@Ag was the higher in catalytic activity over Pt@Ag. Such greater activity is originated from the smaller particle size and larger surface area. Pd@Ag nanocatalyst was catalytically stable through four subsequent reaction runs under the utilized reaction conditions. These findings can thus be considered as possible economical alternative for environmental safety against water pollution by dyes.

  10. Enteroantigen (eAg)-binding B lymphocytes in the mouse - phenotype, distribution, function and eAg-specific antibody secretion

    DEFF Research Database (Denmark)

    Venning, Freja Albjerg; Trempenau, Mette Louise; Schmidt, Esben

    2013-01-01

    Studies reporting beneficial effects of B lymphocytes in autoimmune diseases have been accumulating and a regulatory role for certain B cell subsets is hence getting more and more recognition. Recently, B cells were shown to exhibit a regulatory effect in a T cell transfer model of colitis. Here, B...... cells exposed to enteroantigen (eAg) ex vivo abrogated the colitogenic effect if co-transplanted with Treg-depleted (CD4+CD25-) T cells into severe combined immune deficiency (SCID) mice. These data may imply a role for B cells that bind eAg (eAg+ B cells) in the immunopathology of colitis. Here, we...... report the detection of a subset of eAg+ B cells, including both B2 and B1 lineages, and show that these cells are present in all peripheral lymphoid organs of the mouse including the peritoneal cavity. eAg+ B cells are far more efficient as eAg-presenting cells than unfractionated splenocytes or eAg- B...

  11. Development of heat resistant Pb-free joints by TLPS process of Ag and Sn-Bi-Ag alloy powders

    Directory of Open Access Journals (Sweden)

    Ohnuma I.

    2012-01-01

    Full Text Available TLPS (Transient Liquid Phase Sintering process is a candidate method of heat-resistant bonding, which makes use of the reaction between low-melting temperature powder of Sn-Bi base alloys and reactive powder of Ag. During heat treatment above the melting temperature of a Sn-Bi base alloy, the molten Sn-Bi reacts rapidly with solid Ag particles, which results in the formation of heat-resistant intermetallic compound (IMC. In this study, the TLPS properties between Sn-17Bi-1Ag (at.% powder with its liquidus temperature of 200°C and pure Ag powder were investigated. During differential scanning calorimetry (DSC measurement, an exothermic reaction and an endothermic reaction occurred, which correspond to the formation of the e-Ag3Sn IMC phase and the melting of the Sn-17Bi-1Ag alloy, respectively. After the overall measurement, the obtained reactant consists of the Ag3Sn-IMC and Bi-rich phases, both of which start melting above 250°C, with a small amount of the residual Sn-Bi eutectic phase. These results suggest that the TLPS process can be applied for Pb-free heatresistant bonding.

  12. Biosynthesis of Au, Ag and Au-Ag nanoparticles using edible mushroom extract

    Science.gov (United States)

    Philip, Daizy

    2009-07-01

    Integration of green chemistry principles to nanotechnology is one of the key issues in nanoscience research. There is growing need to develop environmentally benign metal nanoparticle synthesis process that do not use toxic chemicals in the synthesis protocols to avoid adverse effects in medical applications. Here, it is a report on extracellular synthesis method for the preparation of Au, Ag and Au-Ag nanoparticles in water, using the extract of Volvariella volvacea, a naturally occurring edible mushroom, as reducing and protecting agents. Gold nanoparticles of different sizes (20-150 nm) and shapes from triangular nanoprisms to nearly spherical and hexagonal are obtained by this novel method. The size and shape of gold nanoparticles are also found to depend on temperature of the extract. The silver nanoparticles are spherical with size ˜15 nm. There is increased productivity of nanoparticles as shown by sharp and intense surface plasmon resonance bands for the nanoparticles prepared using an excess of the extract. The Au-Ag nanoparticles prepared by co-reduction has only one plasmon band due to alloying of the constituents. All the synthesized nanoparticles are found to be photoluminescent and are highly crystalline as shown by SAED and XRD patterns with fcc phase oriented along the (1 1 1) plane. FTIR measurements were carried out to identify the possible biomolecules responsible for capping and efficient stabilization of the nanoparticles. It is found that Au nanoparticles are bound to proteins through free amino groups and silver nanoparticles through the carboxylate group of the amino acid residues. The position and intensity of the emission band is found to depend on composition of the nanoparticles indicating the possible use in therapeutic applications.

  13. Photocatalytic oxidation removal of Hg{sup 0} using ternary Ag/AgI-Ag{sub 2}CO{sub 3} hybrids in wet scrubbing process under fluorescent light

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Anchao, E-mail: aczhang@qq.com [School of Mechanical and Power Engineering, Henan Polytechnic University, Jiaozuo, 454000 (China); Zhang, Lixiang; Chen, Xiaozhuan; Zhu, Qifeng; Liu, Zhichao [School of Mechanical and Power Engineering, Henan Polytechnic University, Jiaozuo, 454000 (China); Xiang, Jun, E-mail: xiangjun@mail.hust.edu.cn [State Key Laboratory of Coal Combustion, Huazhong University of Science and Technology, Wuhan, 430074 (China)

    2017-01-15

    Highlights: • Ag/AgI-Ag{sub 2}CO{sub 3} hybrids were employed for Hg{sup 0} removal under fluorescent light. • Superoxide radical (·O{sub 2}{sup −}) played a key role in Hg{sup 0} removal. • NO exhibited a significant effect on Hg{sup 0} removal in comparison to SO{sub 2}. • The mechanism for enhanced Hg{sup 0} removal over Ag/AgI-Ag{sub 2}CO{sub 3} was proposed. - Abstract: A series of ternary Ag/AgI-Ag{sub 2}CO{sub 3} photocatalysts synthesized using a facile coprecipitation method were employed to investigate their performances of Hg{sup 0} removal in a wet scrubbing reactor. The hybrids were characterized by N{sub 2} adsorption-desorption, XRD, SEM-EDS, HRTEM, XPS, DRS and ESR. The photocatalytic activities of Hg{sup 0} removal were evaluated under fluorescent light. The results showed that AgI content, fluorescent light irradiation, reaction temperature all showed significant influences on Hg{sup 0} removal. NO exhibited significant effect on Hg{sup 0} removal in comparison to SO{sub 2}. Among these ternary Ag/AgI-Ag{sub 2}CO{sub 3} hybrids, Ag/AgI(0.1)-Ag{sub 2}CO{sub 3} showed the highest Hg{sup 0} removal efficiency, which could be ascribed to the effective separation of photogenerated electron-hole pairs between AgI and Ag{sub 2}CO{sub 3} and the surface plasmon resonance (SPR) effect in the visible region by metallic silver nanoparticles (Ag{sup 0} NPs). The trapping studies of reactive radicals showed that the superoxide radicals (·O{sub 2}{sup −}) may play a key role in Hg{sup 0} removal under fluorescent light. According to the experimental and characterization results, a possible photocatalytic oxidation mechanism for enhanced Hg{sup 0} removal over Ag/AgI(0.1)-Ag{sub 2}CO{sub 3} hybrid under fluorescent light was proposed.

  14. Magnetic behaviour of layered Ag(II) fluorides

    Science.gov (United States)

    McLain, Sylvia E.; Dolgos, Michelle R.; Tennant, D. Alan; Turner, John F. C.; Barnes, Ted; Proffen, Thomas; Sales, Brian C.; Bewley, Robert I.

    2006-07-01

    Fluoride phases that contain the spin-1/2 4d9 Ag(II) ion have recently been predicted to have interesting or unusual magnetochemistry, owing to their structural similarity to the 3d9 Cu(II) cuprates and the covalence associated with this unusual oxidation state of silver. Here we present a comprehensive study of structure and magnetism in the layered Ag(II) fluoride Cs2AgF4, using magnetic susceptometry, inelastic neutron scattering techniques and both X-ray and neutron powder diffraction. We find that this material is well described as a two-dimensional ferromagnet, in sharp contrast to the high-TC cuprates and a previous report in the literature. Analyses of the structural data show that Cs2AgF4 is orbitally ordered at all temperatures of measurement. Therefore, we suggest that orbital ordering may be the origin of the ferromagnetism we observe in this material.

  15. Low thermal emissivity surfaces using AgNW thin films

    Science.gov (United States)

    Pantoja, Elisa; Bhatt, Rajendra; Liu, Anping; Gupta, Mool C.

    2017-12-01

    The properties of silver nanowire (AgNW) films in the optical and infrared spectral regime offer an interesting opportunity for a broad range of applications that require low-emissivity coatings. This work reports a method to reduce the thermal emissivity of substrates by the formation of low-emissivity AgNW coating films from solution. The spectral emissivity was characterized by thermal imaging with an FLIR camera, followed by Fourier transform infrared spectroscopy. In a combined experimental and simulation study, we provide fundamental data of the transmittance, reflectance, haze, and emissivity of AgNW thin films. Emissivity values were finely tuned by modifying the concentration of the metal nanowires in the films. The simulation models based on the transfer matrix method developed for the AgNW thin films provided optical values that show a good agreement with the measurements.

  16. Avoidance of Ag nanoparticles by earthworms, Eisenia fetida

    DEFF Research Database (Denmark)

    Mariyadas, Jennifer; Mónica, Amorim; Scott-Fordsmand, Janeck James

    2013-01-01

    Earthworms are key sentinel organisms playing an important role in improving the soil structure. Here we tested the avoidance behaviour of earthworms, Eisenia fetida to silver nanoparticles (Ag NPs). Silver nanoparticles are widely used in a range of consumer products mainly as antibacterial agents...... and thus causes potential risk to the environment once these particles are released into the environment [1]. In our tests, we were able to show that the earthworms avoided commercially fabricated silver nanoparticles in a dose and time dependent manner. The earthworms were exposed to 3 nanoparticles: NM......300K, Ag (PVP Coated), Ag (Non Coated) and a soluble salt AgNO3; the avoidance behaviour was noted for different time intervals. Immediate avoidance at 24 hours was observed for the highest concentrations for all the test substances. And, periodical avoidance was observed for other concentrations...

  17. Modeling the AgInSbTe Memristor

    Directory of Open Access Journals (Sweden)

    J. Yu

    2015-09-01

    Full Text Available The AgInSbTe memristor shows gradual resistance tuning characteristics, which makes it a potential candidate to emulate biological plastic synapses. The working mechanism of the device is complex, and both intrinsic charge-trapping mechanism and extrinsic electrochemical metallization effect are confirmed in the AgInSbTe memristor. Mathematical model of the AgInSbTe memristor has not been given before. We propose the flux-voltage controlled memristor model. With piecewise linear approximation technique, we deliver the flux-voltage controlled memristor model of the AgInSbTe memristor based on the experiment data. Our model fits the data well. The flux-voltage controlled memristor model and the piecewise linear approximation method are also suitable for modeling other kinds of memristor devices based on experiment data.

  18. Antimicrobial activity of tantalum oxide coatings decorated with Ag nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Cao, Huiliang, E-mail: hlc@mail.sic.ac.cn; Meng, Fanhao; Liu, Xuanyong, E-mail: xyliu@mail.sic.ac.cn [State Key Laboratory of High Performance Ceramics and Superfine Microstructure, Shanghai Institute of Ceramics, Chinese Academy of Sciences, Shanghai 200050 (China)

    2016-07-15

    Silver plasma immersion ion implantation was used to decorate silver nanoparticles (Ag NPs) on tantalum oxide (TO) coatings. The coatings acted against bacterial cells (Staphylococcus epidermidis) in the dark by disrupting their integrity. The action was independent of silver release and likely driven by the electron storage capability of the Schottky barriers established at the interfaces between Ag NPs and the TO support. Moreover, no apparent side effect on the adhesion and differentiation of rat bone mesenchymal stem cells was detected when using Ag NPs-modified TO coatings. These results demonstrate that decoration of tantalum oxide using Ag NPs could be a promising procedure for improving the antibacterial properties for orthopedic and dental implants.

  19. Heparin Increases Food Intake through AgRP Neurons

    Directory of Open Access Journals (Sweden)

    Canjun Zhu

    2017-09-01

    Full Text Available Although the widely used anticoagulant drug heparin has been shown to have many other biological functions independent of its anticoagulant role, its effects on energy homeostasis are unknown. Here, we demonstrate that heparin level is negatively associated with nutritional states and that heparin treatment increases food intake and body weight gain. By using electrophysiological, pharmacological, molecular biological, and chemogenetic approaches, we provide evidence that heparin increases food intake by stimulating AgRP neurons and increasing AgRP release. Our results support a model whereby heparin competes with insulin for insulin receptor binding on AgRP neurons, and by doing so it inhibits FoxO1 activity to promote AgRP release and feeding. Heparin may be a potential drug target for food intake regulation and body weight control.

  20. Effects of reducing agents on the synthesis of Ag/rGO nanocomposites

    Science.gov (United States)

    Li, Yaya; Song, Qiong; Fan, Bingbing; Zhang, Rui

    2017-01-01

    A facile and rapid microwave-assisted green route has been used for the formation of Ag nanoparticles (AgNPs) and the reduction of graphene oxide (GO) simultaneously with five different reducing agents, sodium hydroxide (NaOH), potassium hydroxide (KOH), sodium citrate, urea and ascorbic acid. The experimental results show that the structural properties and phase of Ag/reduced graphene oxide (Ag/rGO) nanocomposites are connected with reducing agent. AgNPs can be uniformly and compactly anchored on reduced GO (rGO) surface in the microwave field for 2 min by the assist of NaOH or KOH as reducing agent. The OH- can not only accelerate the ionization of acidic functional groups but also act as the nucleophile for Ag+. By addition of sodium citrate and urea, the GO sample remains its original structure, and Ag+ tends to form Ag2CO3, which then decomposes into Ag2O. While in the urea solution, Ag2O turns into [Ag(NH3)2]+ ions with abundant urea, then [Ag(NH3)2]+ ions are reduced to Ag0 by electrons, which leads to both Ag and Ag2O phase coexisting in the urea treated samples. In addition, it can be found that NaOH shows the best results in terms of the crystallinity and purity of Ag grains anchored on rGO surface.

  1. Study on antibacterial activity of chemically synthesized PANI-Ag-Au nanocomposite

    Energy Technology Data Exchange (ETDEWEB)

    Boomi, Pandi [Department of Industrial Chemistry, School of Chemical Sciences, Alagappa University, Karaikudi 630 003, Tamil Nadu (India); Prabu, Halliah Gurumallesh, E-mail: hgprabu2010@gmail.com [Department of Industrial Chemistry, School of Chemical Sciences, Alagappa University, Karaikudi 630 003, Tamil Nadu (India); Manisankar, Paramasivam [Department of Industrial Chemistry, School of Chemical Sciences, Alagappa University, Karaikudi 630 003, Tamil Nadu (India); Ravikumar, Sundaram [Department of Oceanography and Coastal Area Studies, School of Marine Sciences, Alagappa University, Thondi Campus 623 409, Tamil Nadu (India)

    2014-05-01

    Graphical abstract: - Highlights: • New method of synthesizing PANI-Ag-Au nanocomposite. • Surface Plasmon resonance and formation of composite at nano level were analyzed. • HR-TEM study revealed uniform distribution of nanoparticles. • PANI-Ag-Au nanocomposite exhibited good antibacterial activity. - Abstract: Pristine polyaniline (PANI), PANI-Ag, PANI-Au and PANI-Ag-Au nanocomposites have been successfully synthesized by chemical oxidative polymerization method using aniline as monomer, ammonium persulphate as oxidant and metal (Ag, Au and Ag-Au) colloids. UV-Vis analysis exhibited surface Plasmon resonances of Ag, Au, Ag-Au nanoparticles. FT-IR spectra revealed the shift in peak position of N-H stretching. X-ray diffraction (XRD) results confirm the presence of Ag, Au and Au-Ag nanoparticles. HR-TEM images show nanosizes of Ag, Au, Ag-Au and the incorporation of such nanoparticles into the PANI matrix. Pristine PANI, PANI-Ag, PANI-Au and PANI-Ag-Au nanocomposites were tested for antibacterial activity by agar well diffusion method. PANI-Ag-Au nanocomposite exhibited higher antibacterial activity against both gram-positive [Streptococcus sp. (MTCC 890), Staphylococcus sp. (MTCC 96)] and gram-negative bacteria [Escherichia coli (MTCC 1671) and Klebsiella sp. (MTCC 7407)] when compared with PANI-Ag nanocomposite, PANI-Au nanocomposite and pristine PANI. The novelty of this study is the polymer-bimetal synthesis and its antibacterial potential.

  2. Antibacterial effect assessment of ZnS: Ag nanoparticles

    OpenAIRE

    Najme Parvin; Gholamreza Amiri; Vajihe Karbasizadeh

    2016-01-01

    Objective(s): A large ratio of surface to volume of nanoparticles in comparison with bulk ones, will increase the cell penetration and therefore their toxicity. Materials and Methods: Chemical precipitation method was used in order to synthesis of ZnS:Ag quantum dots. Their Physical properties and characteristics were assessed by X-ray diffraction, Ultra Violet-Visible Spectrophotometer, Transmission Electron Microscope and it was shown that the obtained ZnS:Ag quantum dots are cubic with hig...

  3. Datenqualitäts-Modell der Volkswagen Financial Services AG

    Science.gov (United States)

    Moser, Helena

    Im Rahmen der Vertriebsaktivitäten und der umfangreichen rechtlichen und regulatorischen Anforderungen u. a. Basel II hat die Volkswagen Financial Services AG (nachfolgend VW FS AG) beschlossen, dem Thema Datenqualität und Datenqualitätsmanagement, insbesondere unter dem Blickwinkel der Konzern Leitlinien Kundennähe, Schaffung von Werten und Höchstleistung, eine hohe Priorität einzuräumen.

  4. Study of diffusion of Ag in Cu single crystals

    CERN Document Server

    Wang, R

    2002-01-01

    4.0 MeV sup 7 Li sup + sup + RBS and AES were used for investigations of thermal diffusion of Ag in Cu single crystals. The annealing of samples was carried out in vacuum in the temperature range from 498 to 613 K. The element depth concentration profiles transformed from RBS spectra indicate that the diffusion of Ag into Cu is a typical volume diffusion. The Arrhenius parameters corresponding to the diffusion were obtained.

  5. Performance testing of a prototype Pd-Ag diffuser

    Energy Technology Data Exchange (ETDEWEB)

    Morgan, G. A. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Hodge, B. J. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL)

    2016-09-21

    The fusion fuel cycle has gained significant attention over the last decade as interest in fusion programs has increased. One of the critical components of the fusion process is the tritium fuel cycle. The tritium fuel cycle is designed to supply and recycle process tritium at a specific throughput rate. One of the most important processes within the tritium fuel cycle is the clean-up of the of the process tritium. This step will initially separate the hydrogen isotopes (H2, D2, and T2) from the rest of the process gas using Pd-Ag diffusers or permeators. The Pd-Ag diffuser is an integral component for any tritium purification system; whether part of the United States’ defense mission or fusion programs. Domestic manufacturers of Pd-Ag diffusers are extremely limited and only a few manufacturers exist. Johnson-Matthey (JM) Pd-Ag diffusers (permeators) have previously been evaluated for the separation of hydrogen isotopes from non-hydrogen gas species in the process. JM is no longer manufacturing Pd-Ag diffusers and a replacement vendor needs to be identified to support future needs. A prototype Pd-Ag diffuser has been manufactured by Power and Energy, and is considered a potential replacement for the JM diffuser for tritium service. New diffuser designs for a tritium facility for any fusion energy applications must be characterized by evaluating their operating envelope prior to installation in a tritium processing facility. The prototype Pd-Ag diffuser was characterized to determine the overall performance as a function of the permeation of hydrogen through the membrane. The tests described in this report consider the effects of feed gas compositions, feed flow rates, pump configuration and internal tube pressure on the permeation of H2 through the Pd-Ag tubes.

  6. Effect of thermal annealing on the microstructures and photocatalytic performance of silver orthophosphate: The synergistic mechanism of Ag vacancies and metallic Ag

    Energy Technology Data Exchange (ETDEWEB)

    Yan, Tingjiang, E-mail: tingjiangn@163.com [The Key Laboratory of Life-Organic Analysis, College of Chemistry and Chemical Engineering, Qufu Normal University, Qufu, Shandong 273165 (China); State Key Laboratory of Structural Chemistry, Fujian Institute of Research on the Structure of Matter, Chinese Academy of Sciences, Fuzhou, Fujian 350002 (China); Guan, Wenfei; Xiao, Ying; Tian, Jun; Qiao, Zheng; Zhai, Huishan; Li, Wenjuan; You, Jinmao [The Key Laboratory of Life-Organic Analysis, College of Chemistry and Chemical Engineering, Qufu Normal University, Qufu, Shandong 273165 (China)

    2017-01-01

    Highlights: • Ag{sub 3}PO{sub 4} was initially prepared via ion-exchange reaction and then annealed in air. • Thermal annealing also resulted in the formation of metallic Ag and Ag vacancies. • The annealed samples exhibited superior activity to the pristine sample. • Both Ag vacancies and metallic Ag contributed to the high activity. - Abstract: In this work, a simple thermal annealing route has been developed to improve the photocatalytic performance of silver orthophosphate (Ag{sub 3}PO{sub 4}) photocatalyst toward organic pollutants degradation under visible light irradiation. The experimental results indicated that thermal treatment of Ag{sub 3}PO{sub 4} led to an obvious lattice shift towards right and significantly narrowed band gap energies due to the formation of Ag vacancies and metallic Ag during Ag{sub 3}PO{sub 4} decomposition. These structural variations notably affected the photocatalytic performance of Ag{sub 3}PO{sub 4} photocatalysts. The activity of the annealed samples was found to be significantly enhanced toward the degradation of MO dye. The highest activity was observed over the sample annealed at 400 °C, which exceeded that of pristine Ag{sub 3}PO{sub 4} by a factor of about 21 times. By means of photoluminescence spectroscopy and photoelectrochemical measurements, we propose that the enormous enhancement in activity was mainly attributed to the efficient separation of photogenerated electrons and holes driven by the synergistic effect of Ag vacancies and metallic Ag. The strong interaction between annealed particles also inhibited the dissolution of Ag{sup +} from Ag{sub 3}PO{sub 4} into aqueous solution, contributing to an improved photocatalytic stability. The strategy presented here provides an ideal platform for the design of other highly efficient and stable Ag-based photocatalysts for broad applications in the field of photocatalysis.

  7. Influence of the surface properties on bactericidal and fungicidal activity of magnetron sputtered Ti–Ag and Nb–Ag thin films

    Energy Technology Data Exchange (ETDEWEB)

    Wojcieszak, D., E-mail: damian.wojcieszak@pwr.edu.pl [Faculty of Microsystem Electronics and Photonics, Wroclaw University of Technology, Janiszewskiego 11/17, 50-372 Wrocław (Poland); Mazur, M.; Kaczmarek, D. [Faculty of Microsystem Electronics and Photonics, Wroclaw University of Technology, Janiszewskiego 11/17, 50-372 Wrocław (Poland); Mazur, P. [Institute of Experimental Physics, University of Wrocław, Max Born 9, 50-204 Wrocław (Poland); Szponar, B. [Institute of Immunology and Experimental Therapy, Polish Academy of Sciences, Rudolfa Weigla 12, 53–114 Wrocław (Poland); Domaradzki, J. [Faculty of Microsystem Electronics and Photonics, Wroclaw University of Technology, Janiszewskiego 11/17, 50-372 Wrocław (Poland); Kepinski, L. [Institute of Low Temperature and Structure Research, Polish Academy of Sciences, Okólna 2, 50-422 Wrocław (Poland)

    2016-05-01

    In this study the comparative investigations of structural, surface and bactericidal properties of Ti–Ag and Nb–Ag thin films have been carried out. Ti–Ag and Nb–Ag coatings were deposited on silicon and fused silica substrates by magnetron co-sputtering method using innovative multi-target apparatus. The physicochemical properties of prepared thin films were examined with the aid of X-ray diffraction, grazing incidence X-ray diffraction, scanning electron microscopy, atomic force microscopy and X-ray photoelectron spectroscopy methods. Moreover, the wettability of the surface was determined. It was found that both, Ti–Ag and Nb–Ag thin films were nanocrystalline. In the case of Ag–Ti film presence of AgTi{sub 3} and Ag phases was identified, while in the structure of Nb–Ag only silver occurred in a crystal form. In both cases the average size of crystallites was ca. 11 nm. Moreover, according to scanning electron microscopy and atomic force microscopy investigations the surface of Nb–Ag thin films was covered with Ag-agglomerates, while Ti–Ag surface was smooth and devoid of silver particles. Studies of biological activity of deposited coatings in contact with Bacillus subtilis, Pseudomonas aeruginosa, Enterococcus hirae, Klebisiella pneumoniae, Escherichia coli, Staphylococcus aureus and Candida albicans were performed. It was found that prepared coatings were bactericidal and fungicidal even in a short term-contact, i.e. after 2 h. - Highlights: • Surface and biological properties of Ti–Ag and Nb–Ag thin films were examined. • Ag content was related to sputtering yields and nucleation of Ti and Nb. • For Nb–Ag film the agglomeration of silver at the surface was observed. • Composition and surface topography had an impact on antimicrobial properties. • Fine-grained surface was important in Ag ions release process.

  8. Fabrication of graphene oxide enwrapped Z-scheme Ag{sub 2}SO{sub 3}/AgBr nanoparticles with enhanced visible-light photocatalysis

    Energy Technology Data Exchange (ETDEWEB)

    Wan, Yujuan; Liang, Chunyan; Xia, Yue, E-mail: xiayue_chem@126.com; Huang, Wei; Li, Zelin

    2017-02-28

    Highlights: • A novel GO/Ag{sub 2}SO{sub 3}/AgBr composite was prepared via a solution method. • It showed enhanced photocatalytic performance to degrade dyes under visible light irradiation. • Its photocatalytic ability was effectively maintained for 4 cycles without sacrificial reagents. - Abstract: A novel graphene oxide (GO) enwrapped Ag{sub 2}SO{sub 3}/AgBr (GO/Ag{sub 2}SO{sub 3}/AgBr) composite was fabricated through a facile solution approach via electrostatic interaction and precipitation transformation reaction for the first time. The results of XRD, Raman, SEM, TEM and XPS confirmed the structure, morphology and composition of the GO/Ag{sub 2}SO{sub 3}/AgBr composite very well. The Ag{sub 2}SO{sub 3}/AgBr nanoparticles were found to be encapsulated by GO sheets. The photocatalytic activity of the composite was investigated by the degradation of methyl orange (MO), rhodamine B (RhB) and methylene blue (MB) in water under visible light. The incorporation of GO sheets not only significantly enhanced the photocatalytic activity but also improved the reusability of Ag{sub 2}SO{sub 3}/AgBr nanoparticles. The photocatalytic ability of GO/Ag{sub 2}SO{sub 3}/AgBr can be maintained at a high level for 4 times cycle experiments. The trapping experiments confirmed that holes and superoxide ion radicals were the main active species responsible for the degradation reaction. A plasmonic Z-scheme photocatalytic mechanism was proposed to illustrate the possible transferred and separated behavior of electron-hole pairs among Ag, Ag{sub 2}SO{sub 3}, AgBr and GO quaternary system under visible light irradiation.

  9. Fabrication of Z-scheme plasmonic photocatalyst Ag@AgBr/g-C₃N₄ with enhanced visible-light photocatalytic activity.

    Science.gov (United States)

    Yang, Yuxin; Guo, Wan; Guo, Yingna; Zhao, Yahui; Yuan, Xing; Guo, Yihang

    2014-04-30

    A series of Ag@AgBr grafted graphitic carbon nitride (Ag@AgBr/g-C3N4) plasmonic photocatalysts are fabricated through photoreducing AgBr/g-C3N4 hybrids prepared by deposition-precipitation method. The phase and chemical structures, electronic and optical properties as well as morphologies of Ag@AgBr/g-C3N4 heterostructures are well-characterized. Subsequently, the photocatalytic activity of Ag@AgBr/g-C3N4 is evaluated by the degradation of methyl orange (MO) and rhodamin B (RB) under visible-light irradiation. The enhanced photocatalytic activity of Ag@AgBr/g-C3N4 compared with g-C3N4 and Ag@AgBr is obtained and explained in terms of the efficient visible-light utilization efficiency as well as the construction of Z-scheme, which keeps photogenerated electrons and holes with high reduction and oxidation capability, evidenced by photoelectrochemical tests and free radical and hole scavenging experiments. Based on the intermediates identified in the reaction system, the photocatalytic degradation pathway of MO is put forward. Copyright © 2014 Elsevier B.V. All rights reserved.

  10. Investigation of Ag-TiO2 Interfacial Reaction of Highly Stable Ag Nanowire Transparent Conductive Film with Conformal TiO2 Coating by Atomic Layer Deposition.

    Science.gov (United States)

    Yeh, Ming-Hua; Chen, Po-Hsun; Yang, Yi-Ching; Chen, Guan-Hong; Chen, Hsueh-Shih

    2017-03-29

    The atomic layer deposition (ALD) technique is applied to coat Ag nanowires (NWs) with a highly uniform and conformal TiO2 layer to improve the stability and sustainability of Ag NW transparent conductive films (TCFs) at high temperatures. The TiO2 layer can be directly deposited on Ag NWs with a surface polyvinylpyrrolidone (PVP) coat that acts a bed for TiO2 seeding in the ALD process. The ALD TiO2 layer significantly enhances the thermal stability at least 100 fold when aged between 200-400 °C and also provides an extra function of violet-blue light filtration for Ag NW TCFs. Investigation into the interaction between TiO2 and Ag reveals that the conformal TiO2 shell could effectively prevent Ag from 1D-to-3D ripening. However, Ag could penetrate the conformal TiO2 shell and form nanocrystals on the TiO2 shell surface when it is aged at 400 °C. According to experimental data and thermodynamic evaluation, the Ag penetration leads to an interlayer composed of mixed Ag-Ag2O-amorphous carbon phases and TiO2-x at the Ag-TiO2 interface, which is thought to be caused by extremely high vapor pressure of Ag at the Ag-TiO2 interface at a higher temperature (e.g., 400 °C).

  11. One-step preparation of nanostructured AgCl/Ag photocatalyst dispersed on exfoliated montmorillonite by clay-mediated in situ reduction

    Science.gov (United States)

    Wu, Jianning; Zhang, Xiaoyuan; Liu, Chang; Meng, Guihua; Guo, Xuhong; Liu, Zhiyong

    2017-06-01

    Novel and facile method for the preparation of AgCl/Ag nanoparticles supported on exfoliated montmorillonite which reduced partial Ag+ ions to Ag0 in one step at room temperature is reported for the first time. In this method, organically modified montmorillonite (OMMT) serves as a mild and effective reducing agent for Ag+ ions, and acts as an outstanding stabilizer for the resulting AgCl/Ag nanoparticles. Owing to the larger basal spacing [d(100)] for OMMT, AgCl/Ag nanoparticles spread on the thin layers of exfoliated montmorillonite could improve the photocatalytic activity by exposing higher surface area. As expected, AgCl/Ag/montmorillonite materials exhibit high visible-light catalytic activity due to the separation of photogenerated electron-hole through surface plasmon resonance (SPR) effect. The studies showed that the degradation of methylene blue (MB) can be completed in 20 min illumination under visible light. The photocatalysis mechanism of separation of the photogenerated electrons and holes at the AgCl/Ag/montmorillonite nanocomposites was also discussed.

  12. In situ ion exchange synthesis of strongly coupled Ag@AgCl/g-C₃N₄ porous nanosheets as plasmonic photocatalyst for highly efficient visible-light photocatalysis.

    Science.gov (United States)

    Zhang, Shouwei; Li, Jiaxing; Wang, Xiangke; Huang, Yongshun; Zeng, Meiyi; Xu, Jinzhang

    2014-12-24

    A novel efficient Ag@AgCl/g-C3N4 plasmonic photocatalyst was synthesized by a rational in situ ion exchange approach between exfoliated g-C3N4 nanosheets with porous 2D morphology and AgNO3. The as-prepared Ag@AgCl-9/g-C3N4 plasmonic photocatalyst exhibited excellent photocatalytic performance under visible light irradiation for rhodamine B degradation with a rate constant of 0.1954 min(-1), which is ∼41.6 and ∼16.8 times higher than those of the g-C3N4 (∼0.0047 min(-1)) and Ag/AgCl (∼0.0116 min(-1)), respectively. The degradation of methylene blue, methyl orange, and colorless phenol further confirmed the broad spectrum photocatalytic degradation abilities of Ag@AgCl-9/g-C3N4. These results suggested that an integration of the synergetic effect of suitable size plasmonic Ag@AgCl and strong coupling effect between the Ag@AgCl nanoparticles and the exfoliated porous g-C3N4 nanosheets was superior for visible-light-responsive and fast separation of photogenerated electron-hole pairs, thus significantly improving the photocatalytic efficiency. This work may provide a novel concept for the rational design of stable and high performance g-C3N4-based plasmonic photocatalysts for unique photochemical reaction.

  13. Synthesis and characterization of cube-like Ag@AgCl-doped TiO2/fly ash cenospheres with enhanced visible-light photocatalytic activity

    Science.gov (United States)

    Liu, Shaomin; Zhu, Jinglin; Yang, Qing; Xu, Pengpeng; Ge, Jianhua; Guo, Xuetao

    2016-03-01

    A cube-like Ag@AgCl-doped TiO2/fly ash cenosphere composite (denoted Ag@AgCl-TiO2/fly ash cenospheres) was successfully synthesized via a two-step approach. The as-prepared catalysts were characterized by scanning electron microscopy, X-ray diffraction, diffuse reflectance ultraviolet-visible spectroscopy, Brunauer-Emmett-Teller, and X-ray photoelectron spectroscopy. The photocatalytic experiment showed that the rhodamine B degradation rate with Ag@AgCl-TiO2/fly ash cenospheres was 1.56 and 1.33 times higher than that with AgCl-TiO2/fly ash cenospheres and Ag@AgCl, respectively. The degradation ratio of rhodamine B with Ag@AgCl-TiO2/fly ash cenospheres was nearly 100% within 120 min under visible light. Analysis of active species indicated that radO2- and h+ dominated the reaction, and radOH participated in the photocatalytic reactions as an active species. A mechanism for the photocatalytic degradation by the Ag@AgCl-TiO2/fly-ash cenospheres was also proposed based on the experimental results.

  14. Swelling characteristics and drug release kinetics of Ag/PVA hydrogel nanocomposites

    Science.gov (United States)

    Swaroop, K.; Somashekarappa, H. M.

    2017-05-01

    Ag/PVA hydrogels nanocomposites (HNC's) of different Ag concentrations were synthesized using gamma irradiation technique. The prepared hydrogels were characterized using powder XRD, UV, SEM and TEM analysis. The equilibrium and dynamic swelling properties of different concentrations of Ag/PVA HNC's were studied. It has been observed that the swelling properties of the Ag/PVA HNC's increase with the Ag concentration. L-ascorbic acid was loaded to Ag/PVA HNC's and the release data was monitored by the absorption wavelength at 252 nm. The results indicate that both swelling and the ascorbic acid release process of Ag/PVA HNC's follows non-Fickian mechanism.

  15. AuAg alloy nanomolecules with 38 metal atoms

    Science.gov (United States)

    Kumara, Chanaka; Dass, Amala

    2012-06-01

    Au38-nAgn(SCH2CH2Ph)24 alloy nanomolecules were synthesized, purified and characterized by MALDI TOF mass spectrometry. Similar to 25 and unlike 144 metal atom count AuAg alloy nanomolecules, incorporation of Ag atoms here results in loss or smearing out of distinct UV-vis features. We propose that the short and long staples contain Au atoms, while the inner core consists of both Au and Ag atoms.Au38-nAgn(SCH2CH2Ph)24 alloy nanomolecules were synthesized, purified and characterized by MALDI TOF mass spectrometry. Similar to 25 and unlike 144 metal atom count AuAg alloy nanomolecules, incorporation of Ag atoms here results in loss or smearing out of distinct UV-vis features. We propose that the short and long staples contain Au atoms, while the inner core consists of both Au and Ag atoms. Electronic supplementary information (ESI) available. See DOI: 10.1039/c2nr11781a

  16. Synthesis and Property of Ag(NP)/catechin/Gelatin Nanofiber

    Science.gov (United States)

    Nasir, Muhamad; Apriani, Dita

    2017-12-01

    Nanomaterial play important role future industry such as for the medical, food, pharmaceutical and cosmetic industry. Ag (NP) and catechin exhibit antibacterial property. Ag(NP) with diameter around 15 nm was synthesis by microwaved method. We have successfully produce Ag(NP)/catechin/gelatin nanofiber composite by electrospinning process. Ag(NP)/catechin/gelatin nanofiber was synthesized by using gelatin from tuna fish, polyethylene oxide (PEO), acetic acid as solvent and silver nanoparticle(NP)/catechin as bioactive component, respectively. Morphology and structure of bioactive catechin-gelatin nanofiber were characterized by scanning electron microscopy (SEM) and fourier transform infrared spectroscopy (FTIR), respectively. SEM analysis showed that morphology of nanofiber composite was smooth and had average diameter 398.97 nm. FTIR analysis results were used to confirm structure of catechin-gelatin nanofiber. It was confirmed by FTIR that specific vibration band peak amide A (N-H) at 3286,209 cm-1, amide B (N-H) 3069,396 cm-1, amide I (C=O) at 1643,813 cm-1, amide II (N-H and CN) at 1538,949 cm-1, amide III (C-N) at 1276,789 cm-1, C-O-C from polyethylene oxide at 1146,418 cm-1, respectively. When examined to S. Aureus bacteria, Ag/catechin/gelatin nanofiber show inhabitation performance around 40.44%. Ag(NP)/catechin/gelatin nanofiber has potential application antibacterial medical application.

  17. Antibacterial activity of graphene supported FeAg bimetallic nanocomposites.

    Science.gov (United States)

    Ahmad, Ayyaz; Qureshi, Abdul Sattar; Li, Li; Bao, Jie; Jia, Xin; Xu, Yisheng; Guo, Xuhong

    2016-07-01

    We report the simple one pot synthesis of iron-silver (FeAg) bimetallic nanoparticles with different compositions on graphene support. The nanoparticles are well dispersed on the graphene sheet as revealed by the TEM, XRD, and Raman spectra. The antibacterial activity of graphene-FeAg nanocomposite (NC) towards Bacillus subtilis, Escherichia coli, and Staphylococcus aureus was investigated by colony counting method. Graphene-FeAg NC demonstrates excellent antibacterial activity as compared to FeAg bimetallic without graphene. To understand the antibacterial mechanism of the NC, oxidative stress caused by reactive oxygen species (ROS) and the glutathione (GSH) oxidation were investigated in the system. It has been observed that ROS production and GSH oxidation are concentration dependent while the increase in silver content up to 50% generally enhances the ROS production while ROS decreases on further increase in silver content. Graphene loaded FeAg NC demonstrates higher GSH oxidation capacity than bare FeAg bimetallic nanocomposite. The mechanism study suggests that the antibacterial activity is probably due to membrane and oxidative stress produced by the nanocomposites. The possible antibacterial pathway mainly includes the non-ROS oxidative stress (GSH oxidation) while ROS play minor role. Copyright © 2016 Elsevier B.V. All rights reserved.

  18. Quantifying the origin of released Ag+ ions from nanosilver.

    Science.gov (United States)

    Sotiriou, Georgios A; Meyer, Andreas; Knijnenburg, Jesper T N; Panke, Sven; Pratsinis, Sotiris E

    2012-11-13

    Nanosilver is most attractive for its bactericidal properties in modern textiles, food packaging, and biomedical applications. Concerns, however, about released Ag(+) ions during dispersion of nanosilver in liquids have limited its broad use. Here, nanosilver supported on nanostructured silica is made with closely controlled Ag size both by dry (flame aerosol) and by wet chemistry (impregnation) processes without any surface functionalization that could interfere with its ion release. It is characterized by electron microscopy, atomic absorption spectroscopy, and X-ray diffraction, and its Ag(+) ion release in deionized water is monitored electrochemically. The dispersion method of nanosilver in solutions affects its dissolution rate but not the final Ag(+) ion concentration. By systematically comparing nanosilver size distributions to their equilibrium Ag(+) ion concentrations, it is revealed that the latter correspond precisely to dissolution of one to two surface silver oxide monolayers, depending on particle diameter. When, however, the nanosilver is selectively conditioned by either washing or H(2) reduction, the oxide layers are removed, drastically minimizing Ag(+) ion leaching and its antibacterial activity against E. coli . That way the bactericidal activity of nanosilver is confined to contact with its surface rather than to rampant ions. This leads to silver nanoparticles with antibacterial properties that are essential for medical tools and hospital applications.

  19. Spectroscopic laser parameters of Ag/CdTe nanostructure

    Energy Technology Data Exchange (ETDEWEB)

    Giba, A.E., E-mail: alaadin85@niles.edu.eg [Department of Laser Science and Interaction, National Institute of Laser Enhanced Science, Cairo University, 12613 Giza (Egypt); Gadallah, A.-S. [Department of Laser Science and Interaction, National Institute of Laser Enhanced Science, Cairo University, 12613 Giza (Egypt); Mohamed, M.B. [Department of Laser Applications in Metrology, Photochemistry & Agriculture, National Institute of Laser Enhanced Science, Cairo University, 12613 Giza (Egypt); Azzouz, I.M. [Department of Laser Science and Interaction, National Institute of Laser Enhanced Science, Cairo University, 12613 Giza (Egypt)

    2015-11-15

    We report spectroscopic laser parameters analysis for CdTe quantum dots (QDs) in the presence of Ag nanoparticles (NPs). Absorption and emission cross-sections of about 2 nm-particle size of aqueous CdTe QDs were estimated, when different contents of about 40 nm Ag nanoparticles were added. The fluorescence, radiative lifetimes and the energy transfer between Ag NPs and CdTe QDs have been investigated. Lasing parameters that evaluate the possibility of getting laser action for these nanomaterials were calculated. The energy transfer mechanism between Ag NPs and CdTe QDs was occurred by Forster resonance energy transfer (FRET) as the average distance between them is about 50 nm. - Highlights: • Absorption and emission cross sections of Ag/CdTe have been calculated. • Lasing parameters of these nanomaterials have been also estimated. • The energy transfer mechanism between Ag NPs and CdTe QDs was determined. • Our findings are promising candidate for photonic devices.

  20. Speciation and Lability of Ag-, AgCl- and Ag2S-Nanoparticles in Soil Determined by X-ray Absorption Spectroscopy and Diffusive Gradients in Thin Films

    Science.gov (United States)

    Long-term speciation and lability of silver (Ag-), silver chloride (AgCl-) and silver sulfide nanoparticles (Ag2S-NPs) in soil were studied by X-ray absorption spectroscopy (XAS), and newly developed "nano" Diffusive Gradients in Thin Films (DGT) devices. These nano-D...

  1. Synthesis of Ag or Pt Nanoparticles by Hydrolysis of Either Ag2Na or PtNa

    Directory of Open Access Journals (Sweden)

    Huabin Wang

    2008-01-01

    Full Text Available Ag and Pt nanoparticles have successfully been synthesized by hydrolysis of either Ag2Na or PtNa at room temperature. The oxidation of sodium in the Pt-Na pellets was much faster than that in the Ag-Na pellets since Pt is a catalyst for H2O formation reaction from hydrogen and oxygen at room temperature. The hydrolysis byproduct, NaOH, has a high solubility and easily is removed. This method offers a simple method of preparing transition metal nanoparticles. The Ag and Pt nanoparticles prepared by this method were crystalline in nature, and spherical in shape with a mean size of around 10 nm.

  2. Hydrothermal Synthesis and Mechanism of Unusual Zigzag Ag 2 Te and Ag 2 Te/C Core-Shell Nanostructures

    National Research Council Canada - National Science Library

    Saima Manzoor; Yumin Liu; Zhongyuan Yu; Xiuli Fu; Guijun Ban

    2014-01-01

      A single step surfactant-assisted hydrothermal route has been developed for the synthesis of zigzag silver telluride nanowires with diameter of 50-60 nm and length of several tens of micrometers. Silver nitrate (AgNO3...

  3. Transparent Conducting Film Fabricated by Metal Mesh Method with Ag and Cu@Ag Mixture Nanoparticle Pastes

    Directory of Open Access Journals (Sweden)

    Hyun Min Nam

    2017-05-01

    Full Text Available Transparent conducting electrode film is highly desirable for application in touch screen panels (TSPs, flexible and wearable displays, sensors, and actuators. A sputtered film of indium tin oxide (ITO shows high transmittance (90% at low sheet resistance (50 Ω/cm2. However, ITO films lack mechanical flexibility, especially under bending stress, and have limitation in application to large-area TSPs (over 15 inches due to the trade-off in high transmittance and low sheet resistance properties. One promising solution is to use metal mesh-type transparent conducting film, especially for touch panel application. In this work, we investigated such inter-related issues as UV imprinting process to make a trench layer pattern, the synthesis of core-shell-type Ag and Cu@Ag composite nanoparticles and their paste formulation, the filling of Ag and Cu@Ag mixture nanoparticle paste to the trench layer, and touch panel fabrication processes.

  4. Silver bioaccumulation dynamics in a freshwater invertebrate after aqueous and dietary exposures to nanosized and ionic Ag

    Science.gov (United States)

    le Croteau, Marie-Noe; Misra, Superb K.; Luoma, Samuel N.; Valsami-Jones, Eugenia

    2011-01-01

    We compared silver (Ag) bioavailability and toxicity to a freshwater gastropod after exposure to ionic silver (Ag+) and to Ag nanoparticles (Ag NPs) capped with citrate or with humic acid. Silver form, exposure route, and capping agent influence Ag bioaccumulation dynamics in Lymnaea stagnalis. Snails efficiently accumulated Ag from all forms after either aqueous or dietary exposure. For both exposure routes, uptake rates were faster for Ag+ than for Ag NPs. Snails efficiently assimilated Ag from Ag NPs mixed with diatoms (assimilation efficiency (AE) ranged from 49 to 58%) and from diatoms pre-exposed to Ag+ (AE of 73%). In the diet, Ag NPs damaged digestion. Snails ate less and inefficiently processed the ingested food, which adversely impacted their growth. Loss rates of Ag were faster after waterborne exposure to Ag NPs than after exposure to dissolved Ag+. Once Ag was taken up from diet, whether from Ag+ or Ag NPs, Ag was lost extremely slowly. Large Ag body concentrations are thus expected in L. stagnalis after dietborne exposures, especially to citrate-capped Ag NPs. Ingestion of Ag associated with particulate materials appears as the most important vector of uptake. Nanosilver exposure from food might trigger important environmental risks.

  5. Half-life determination for {sup 108}Ag and {sup 110}Ag

    Energy Technology Data Exchange (ETDEWEB)

    Zahn, Guilherme S.; Genezini, Frederico A. [Instituto de Pesquisas Energéticas e Nucleares - IPEN-CNEN/SP, P.O. Box 11049, São Paulo, 05422-970 (Brazil)

    2014-11-11

    In this work, the half-life of the short-lived silver radionuclides {sup 108}Ag and {sup 110}Ag were measured by following the activity of samples after they were irradiated in the IEA-R1 reactor. The results were then fitted using a non-paralizable dead time correction to the regular exponential decay and the individual half-life values obtained were then analyzed using both the Normalized Residuals and the Rajeval techniques, in order to reach the most exact and precise final values. To check the validity of dead-time correction, a second correction method was also employed by means of counting a long-lived {sup 60}Co radioactive source together with the samples as a livetime chronometer. The final half-live values obtained using both dead-time correction methods were in good agreement, showing that the correction was properly assessed. The results obtained are partially compatible with the literature values, but with a lower uncertainty, and allow a discussion on the last ENSDF compilations' values.

  6. Indentation Size Effect on Ag Nanoparticle-Modified Graphene/Sn-Ag-Cu Solders

    Science.gov (United States)

    Xu, L. Y.; Zhang, S. T.; Jing, H. Y.; Wang, L. X.; Wei, J.; Kong, X. C.; Han, Y. D.

    2018-01-01

    This paper presents the results for the indentation size effect (ISE) on the creep stress exponent and hardness of 0.03 wt.% Ag-modified graphene nanosheet Sn-Ag-Cu solder alloys, using constant loading/holding and multi-cycle (CMC) loading methods, respectively. At each maximum load, with increasing indentation depth, the creep exponent first decreased and then increased. At the same strain rate, the stress exponent also showed the same tendency, increasing as the indentation depth (peak load) increased and then decreased. The hardness was measured continuously with increasing indentation depth by the CMC loading method. The hardness did not exhibit a decrease as the indentation depth increased, which differs from the classical description of the ISE. After an initial decrease, the hardness then increased and finally decreased as the indentation depth increased. This study reviews the existing theories and formulations describing ISE with hardening effects. The experimental results fit well with the empirical formulation. The phenomenon of ISE accompanied by hardening effects has been explained physically via the interaction between geometrically necessary dislocations and grain boundaries.

  7. Indentation Size Effect on Ag Nanoparticle-Modified Graphene/Sn-Ag-Cu Solders

    Science.gov (United States)

    Xu, L. Y.; Zhang, S. T.; Jing, H. Y.; Wang, L. X.; Wei, J.; Kong, X. C.; Han, Y. D.

    2017-10-01

    This paper presents the results for the indentation size effect (ISE) on the creep stress exponent and hardness of 0.03 wt.% Ag-modified graphene nanosheet Sn-Ag-Cu solder alloys, using constant loading/holding and multi-cycle (CMC) loading methods, respectively. At each maximum load, with increasing indentation depth, the creep exponent first decreased and then increased. At the same strain rate, the stress exponent also showed the same tendency, increasing as the indentation depth (peak load) increased and then decreased. The hardness was measured continuously with increasing indentation depth by the CMC loading method. The hardness did not exhibit a decrease as the indentation depth increased, which differs from the classical description of the ISE. After an initial decrease, the hardness then increased and finally decreased as the indentation depth increased. This study reviews the existing theories and formulations describing ISE with hardening effects. The experimental results fit well with the empirical formulation. The phenomenon of ISE accompanied by hardening effects has been explained physically via the interaction between geometrically necessary dislocations and grain boundaries.

  8. Study of Ag induced bimetallic (Au-Ag) nanowires on silicon (5 5 12) surfaces: Experiment and theoretical aspects

    Science.gov (United States)

    Bhukta, Anjan; Bagarti, Trilochan; Guha, Puspendu; Ravulapalli, Sathyavathi; Satpati, Biswarup; Rakshit, Bipul; Maiti, Paramita; Parlapalli, Venkata Satyam

    2017-10-01

    The reconstructed vicinal (high index) silicon surfaces, such as, Si (5 5 12) composes row-like structures that can be used as templates for growing aligned nanowires. By using a sub-monolayers of Ag, prior to Au deposition on reconstructed Si (5 512) surface, intermixing of Au and Ag, enhancement of aspect ratio of bimetallic Au-Ag nanowires with tunable morphology is reported. This is attributed to a combined effect of pre-grown Ag strips as nucleation centers for incoming Au ad-atoms and anisotropic Au-Ag intermixing. To achieve optimum conditions for the growth of larger aspect ratio Au-Ag nanostructures, the growth kinetics have been studied by varying growth and annealing temperatures. At ≈400 °C, the Ag diffused into silicon substrate and the inter-diffusion found to inhibit the formation of Au-Ag bimetallic nanostructures. Controlled experiments under ultra-high vacuum condition in a molecular beam epitaxy system and in-situ scanning tunneling microscopy measurements along with ex-situ scanning transmission and secondary electron microscopy measurements have been carried out to understand the bimetallic nanostructure growth. Kinetic Monte Carlo (KMC) simulations based on kinematics of ad-atoms on an anisotropic template with a solid on solid model in which the relative ratios of binding energies (that are obtained from the Density Functional Theory) have been used and the KMC simulations results agree with the experimental observations. Advantage of having bimetallic structures as effective substrates for Surface enhanced Raman spectroscopy application is demonstrated by detecting Rhodamine 6 G (R6G) molecule at the concentration of 10-7M.

  9. Plasticity and microstructure of epitaxial Ag/Ni multilayers; Mechanische Eigenschaften und Mikrostruktur epitaktischer Ag/Ni-Multilagenschichten

    Energy Technology Data Exchange (ETDEWEB)

    Schmidt, Tobias K.

    2007-10-15

    To meet the still increasing technical demands of new materials, it is required to improve basic knowledge of thin films and multilayers. This thesis describes the microstructure and mechanical behaviour of thin epitaxial Ag/Ni-multilayers. Former investigations were only done on polycrystalline multilayers or epitaxial single layers. The manufacture of epitaxial Ag/Ni-multilayers on (111) orientated Si-substrates was performed by a magnetron sputtering technique under ultra high vacuum (UHV). The thickness of the alternating Ag- and Ni-layers varies between 100 and 400 nm, the thickness of the whole film varies between 200 and 800 nm. Hardness and flow stress of Ag/Ni-multilayers were measured with a nanoindentation technique, a substrate curvature method and by X-ray diffraction. The hardness of these multilayers varies between 1.5 and 2.0 GPa. The Ag single film hardness is 0.5 GPa and Ni film 1.8 GPa. The flow stress of the Ag/Ni-multilayers varies between 350 and 800 MPa. The Ag single layer shows a flow stress of 100 MPa and Ni of 450 MPa. Both hardness and flow stress increase with decreasing layer thickness. In situ TEM and HRTEM experiments showed a semicoherent Ag/Ni-interface. It was observed that these interfaces act as sources and sinks. Dislocation loops formed at the interface expand and shrink according to the stress state. They combine with loops from the opposite interface or with the interface itself and form threading dislocations. Dislocation loops penetrating an interface were not observed. Results were compared with various models which simulate flow stress in thin films and multilayers. The most important models are calculated by Nix-Freund, the Source-model after von Blanckenhagen and the Hall-Petch-model. (orig.)

  10. Synthesis and properties of calix[4]arene telluropodant ethers as Ag+ selective sensors and Ag+, Hg2+ extractants

    Directory of Open Access Journals (Sweden)

    Yang Lu

    2009-10-01

    Full Text Available Three novel phenyltelluroalkoxyl functionalized tweezer-like calix[4]arenes 6–8 and two monophenyltelluropropoxyl functionalized calix[4]arenes 10 (cone conformer and 12 (partial cone conformer were synthesized and characterized. They are good Ag+-selective ionophores in ion-selective electrodes evaluated by electromotive force measurements of polymer membrane electrodes. The tweezer-like ionophores 6–8 showed excellent extraction ability towards Ag+ and Hg2+.

  11. Transformation of AgCl nanoparticles in a sewer system--A field study.

    Science.gov (United States)

    Kaegi, Ralf; Voegelin, Andreas; Sinnet, Brian; Zuleeg, Steffen; Siegrist, Hansruedi; Burkhardt, Michael

    2015-12-01

    Silver nanoparticles (Ag-NP) are increasingly used in consumer products and their release during the use phase may negatively affect aquatic ecosystems. Research efforts, so far, have mainly addressed the application and use of metallic Ag(0)-NP. However, as shown by recent studies on the release of Ag from textiles, other forms of Ag, especially silver chloride (AgCl), are released in much larger quantities than metallic Ag(0). In this field study, we report the release of AgCl-NP from a point source (industrial laundry that applied AgCl-NP during a piloting phase over a period of several months to protect textiles from bacterial regrowth) to the public sewer system and investigate the transformation of Ag during its transport in the sewer system and in the municipal wastewater treatment plant (WWTP). During the study period, the laundry discharged ~85 g of Ag per day, which dominated the Ag loads in the sewer system from the respective catchment (72-95%) and the Ag in the digested WWTP sludge (67%). Combined results from electron microscopy and X-ray absorption spectroscopy revealed that the Ag discharged from the laundry to the sewer consisted of about one third AgCl and two thirds Ag2S, both forms primarily occurring as nanoparticles with diametersAgCl was transformed into nanoparticulate Ag2S. Ag2S-NP also dominated the Ag speciation in the digested sludge. In line with results from earlier studies, the very low Ag concentrations measured in the effluent of the WWTP (95%). Copyright © 2015 Elsevier B.V. All rights reserved.

  12. Unique Properties of Core Shell Ag@Au Nanoparticles for the Aptasensing of Bacterial Cells

    OpenAIRE

    Ezat Hamidi-Asl; Freddy Dardenne; Sanaz Pilehvar; Ronny Blust; Karolien De Wael

    2016-01-01

    In this article, it is shown that the efficiency of an electrochemical aptasensing device is influenced by the use of different nanoparticles (NPs) such as gold nanoparticles (Au), silver nanoparticles (Ag), hollow gold nanospheres (HGN), hollow silver nanospheres (HSN), silver–gold core shell (Ag@Au), gold–silver core shell (Au@Ag), and silver–gold alloy nanoparticles (Ag/Au). Among these nanomaterials, Ag@Au core shell NPs are advantageous for aptasensing applications because the core impro...

  13. Performance of the new AGS RFQ preinjector

    Energy Technology Data Exchange (ETDEWEB)

    Alessi, J.G.; Brennan, J.M.; Brodowski, J.; Brown, H.N.; Kponou, A.; LoDestro, V.; Montemurro, P.; Prelec, K.; Witkover, R.; Gough, R.; Staples, J.

    1989-01-01

    In the fall of 1988, the 750 keV Cockcroft-Walton (C-W) preinjector for the AGS 200 MeV H/sup /minus// linac was replaced by an RFQ, in what has proved to be a very successful upgrade. The motivations for the upgrade included improved reliability, simpler maintenance, and the added convenience of having the ion source located at nearly ground potential. At the same time, the controls and instrumentation in the preinjector area were modernized. The linac has been operating full time with this RFQ preinjector since January 1, 1989, and the reliability has been excellent. The source, RFQ, and linac operate at a 5 Hz repetition rate, and the beam pulse width is approximately 450 ..mu..s. At this time, the H/sup /minus// current at 200 MeV is typically 23-25 mA, the same as previous operation with the C-W, although the capability is there to reach higher currents in the future. The layout of the new preinjector is shown in Figure 1. An important consideration in the layout of this line was the decision to leave the final 2.4 m section before the linac intact, so the optics of a second C-W injector line and polarized H/sup /minus// injection from another RFQ remained the same. The resulting line has a distance of almost 6 m from the RFQ to the linac, and there are three ''rebuncher'' cavities to maintain the bunching of the beam from the RFQ. The following sections will describe some details of the preinjector line, and then discuss the installation and performance.

  14. Microstructure, mechanical properties, bio-corrosion properties and antibacterial properties of Ti–Ag sintered alloys

    Energy Technology Data Exchange (ETDEWEB)

    Chen, Mian [Key Lab. for Anisotropy and Texture of Materials, Education Ministry of China, Northeastern University, Shenyang 110819 (China); Zhang, Erlin, E-mail: zhangel@atm.neu.edu.cn [Key Lab. for Anisotropy and Texture of Materials, Education Ministry of China, Northeastern University, Shenyang 110819 (China); Zhang, Lan [State Key Laboratory for Mechanical Behavior of Materials, Xi' an Jiaotong University, Xi' an 710049 (China)

    2016-05-01

    In this research, Ag element was selected as an antibacterial agent to develop an antibacterial Ti–Ag alloy by a powder metallurgy. The microstructure, phase constitution, mechanical properties, corrosion resistance and antibacterial properties of the Ti–Ag sintered alloys have been systematically studied by X-ray diffraction (XRD), scanning electron microscope (SEM), compressive test, electrochemical measurements and antibacterial test. The effects of the Ag powder size and the Ag content on the antibacterial property and mechanical property as well as the anticorrosion property have been investigated. The microstructure results have shown that Ti–Ag phase, residual pure Ag and Ti were the mainly phases in Ti–Ag(S75) sintered alloy while Ti{sub 2}Ag was synthesized in Ti–Ag(S10) sintered alloy. The mechanical test indicated that Ti–Ag sintered alloy showed a much higher hardness and the compressive yield strength than cp-Ti but the mechanical properties were slightly reduced with the increase of Ag content. Electrochemical results showed that Ag powder size had a significant effect on the corrosion resistance of Ti–Ag sintered alloy. Ag content increased the corrosion resistance in a dose dependent way under a homogeneous microstructure. Antibacterial tests have demonstrated that antibacterial Ti–Ag alloy was successfully prepared. It was also shown that the Ag powder particle size and the Ag content influenced the antibacterial activity seriously. The reduction in the Ag powder size was benefit to the improvement in the antibacterial property and the Ag content has to be at least 3 wt.% in order to obtain a strong and stable antibacterial activity against Staphylococcus aureus bacteria. The bacterial mechanism was thought to be related to the Ti{sub 2}Ag and its distribution. - Highlights: • Ti–Ag alloy with up to 99% antibacterial rate was developed by powder metallurgy. • The effects of the Ag powder size and the Ag content on the

  15. Egg White Templated Synthesis of Ag and Au@Ag Alloy Microspheres for Surface-Enhanced Raman Spectroscopy Research.

    Science.gov (United States)

    Li, Min; Zhang, Ying; Wang, Xiansong; Cui, Daxiang

    2016-01-01

    Herein, we report the green synthesis of Ag and Au@Ag microspheres by using the aqueous extracts of the egg white as well as their application as substrates for surface-enhanced Raman spectroscopy (SERS) detection. Both microspheres are prepared via the green synthesis method (room temperature, in aqueous solution and a benign reducer). The as-prepared urchin-like Ag microspheres have an average diameter of 600-800 nm, which is made up of some nanopricks with an average length of 10-40 nm. Meanwhile, the Au@Ag architectures prepared by galvanic replacement keep nearly similar size, which is also composed of some compact nanoparticles with an average diameter of about 10-40 nm. These products are characterized by X-ray diffraction (XRD), scanning electron microscopy (SEM), transmission electronic microscopy (TEM), and Fourier transform infrared spectrophotometer (FTIR). The study on SERS activities is also carried out for both microspheres. It is found that Au@Ag microspheres possess much higher SERS activity than Ag microspheres. Our work may shed light on the design and synthesis of self-assembled 3D micro/nano-architectures for the use of SERS, catalysis, biosensors, nanomedicine, etc.

  16. A novel P/Ag/Ag2O/Ag3PO4/TiO2 composite film for water purification and antibacterial application under solar light irradiation.

    Science.gov (United States)

    Zhu, Qi; Hu, Xiaohong; Stanislaus, Mishma S; Zhang, Nan; Xiao, Ruida; Liu, Na; Yang, Yingnan

    2017-01-15

    TiO2-based thin films have been intensively studied in recent years to develop efficient photocatalyst films to degrade refractory organics and inactivate bacteria for wastewater treatment. In the present work, P/Ag/Ag2O/Ag3PO4/TiO2 composite films on the inner-surface of glass tube were successfully prepared via sol-gel approach. P/Ag/Ag2O/Ag3PO4/TiO2 composite films with 3 coating layers, synthesized at 400°C for 2h, showed the optimal photocatalytic performance for rhodamine B (Rh B) degradation. The results indicated that degradation ratio of Rh B by P/Ag/Ag2O/Ag3PO4/TiO2 composite film reached 99.9% after 60min under simulated solar light, while just 67.9% of Rh B was degraded by pure TiO2 film. Moreover, repeatability experiments indicated that even after five recycling runs, the photodegradation ratio of Rh B over composite film maintained at 99.9%, demonstrating its high stability. Photocatalytic inactivation of E. coli with initial concentration of 107CFU/mL also showed around 100% of sterilization ratio under simulated solar light irradiation in 5min by the composite film. The radical trapping experiments implied that the major active species of P/Ag/Ag2O/Ag3PO4/TiO2 composite films were photo-generated holes and O2- radicals. The proposed photocatalytic mechanism shows that the transfer of photo-induced electrons and holes may reduce the recombination efficiency of electron-hole pairs and potential photodecomposition of composite film, resulting in enhanced photocatalytic ability of P/Ag/Ag2O/Ag3PO4/TiO2 composite films. Copyright © 2016 Elsevier B.V. All rights reserved.

  17. Integrated mRNA and micro RNA profiling reveals epigenetic mechanism of differential sensitivity of Jurkat T cells to AgNPs and Ag ions.

    Science.gov (United States)

    Eom, Hyun-Jeong; Chatterjee, Nivedita; Lee, Jeongsoo; Choi, Jinhee

    2014-08-17

    In our previous in vitro study of the toxicity on silver nanoparticles (AgNPs), we observed a dramatically higher sensitivity of Jurkat T cells to AgNPs than to Ag ions, and DNA damage and apoptosis were found to be involved in that toxicity. In this study, to understand underlying mechanism of different sensitivity of Jurket T cells to AgNPs and Ag ions, mRNA microarray and micro RNA microarray were concomitantly conducted on AgNPs and Ag ions exposed Jurkat T cells. Surprisingly only a small number of genes were differentially expressed by exposure to each of the silver (15 altered mRNA by AgNPs exposure, whereas 4 altered mRNA by Ag ions exposure, as determined 1.5-fold change as the cut-off value). miRNA microarray revealed that the expression of 63 miRNAs was altered by AgNPs exposure, whereas that of 32 miRNAs was altered by Ag ions exposure. An integrated analysis of mRNA and miRNA expression revealed that the expression of hsa-miR-219-5p, was negatively correlated with the expression of metallothionein 1F (MT1F) and tribbles homolog 3 (TRIB3), in cells exposed to AgNPs; whereas, the expression of hsa-miR-654-3p was negatively correlated with the expression of mRNA, endonuclease G-like 1 (EDGL1) in cells exposed to Ag ions. Network analysis were further conducted on mRNA-miRNA pairs, which revealed that miR-219-5p-MT1F and -TRIB3 pairs by AgNPs are being involved in various cellular processes, such as, oxidative stress, cell cycle and apoptosis, whereas, miR-654-3p and ENDOGL1 pair by Ag ions generated a much simpler network. The putative target genes of AgNPs-induced miR-504, miR-33 and miR-302 identified by Tarbase 6.0 are also found to be involved in DNA damage and apoptosis. These results collectively suggest that distinct epigenetic regulation may be an underlying mechanism of different sensitivity of Jurkat T cells to AgNPs and Ag ion. Further identification of putative target genes of DE miRNA by AgNPs and Ag ions may provide additional clues for the

  18. Ag@AgCl QDs decorated g-C3N4 nanoplates: The photoinduced charge transfer behavior under visible light and full arc irradiation

    Science.gov (United States)

    Li, Junqi; Hao, Hongjuan; Zhou, Jian; Li, Weijie; Lei, Nan; Guo, Liu

    2017-11-01

    The quantum dots (QDs) Ag@AgCl decorated g-C3N4 nanoplates was synthesized via a facile oil-in-water self-assembly method, which possessed high dispersion by characterization of scanning electron microscopy (SEM) and transmission electron microscopy (TEM). The as-obtained Ag@AgCl/g-C3N4 nano-heterostructure contained a wide band gap of AgCl nanoparticles (NPs), the surface plasmon resonance (SPR) of Ag NPs and a narrow band gap of g-C3N4 nanoplates. The AgCl NPs with a wide band gap was excited under UV-light, which played a key role on the photoinduced charge transfer of Ag@AgCl/g-C3N4. Under the visible light irradiation, the electrons transfered to the CB of AgCl (electron acceptor) and the holes lefted in the VB of g-C3N4. Nevertheless, under the full arc irradiation, the electrons and holes stayed in the CB of g-C3N4 and VB of AgCl, respectively, then the AgCl was electron donor. The photoinduced charge transfer behavior of Ag@AgCl/g-C3N4 was verified by the photoelectrochemical measurements under the visible light and the full arc irradiation. The results showed that the difference of charge transfer behavior under visible light and the full arc influences on the photoinduced charge transfer ability, further leading to changing the water redox potential in the Ag@AgCl/g-C3N4 nano-heterostructure

  19. Distinct metal-exchange pathways of doped Ag25 nanoclusters

    KAUST Repository

    Bootharaju, Megalamane Siddaramappa

    2016-09-09

    Atomically precise metal nanoclusters (NCs) containing more than one type of metal atom (i.e., doped or alloyed), due to synergistic effects, open new avenues for engineering the catalytic and optical properties of NCs in a manner that homometal NCs cannot. Unfortunately, it is still a major challenge to controllably introduce multimetallic dopants in NCs, understanding the dopants\\' positions, mechanism, and synergistic effects. To overcome these challenges, we designed a metal-exchange approach involving NCs as molecular templates and metal ions as the source of the incoming dopant. In particular, two structurally similar monodoped silver-rich NCs, [MAg24(SR)(18)](2-) (M = Pd/Pt and SR: thiolate), were synthesized as templates to study their mechanistic transformation in response to the introduction of gold atoms. The controllable incorporation of Au atoms into the MAg24 framework facilitated the elucidation of distinct doping pathways through high-resolution mass spectrometry, optical spectroscopy and elemental analysis. Interestingly, gold replaced the central Pd atom of [PdAg24(SR)(18)](2-) clusters to produce predominantly bimetallic [AuAg24(SR)(18)](-) clusters along with a minor product of an [Au2Ag23(SR)(18)](-) cluster. In contrast, the central Pt atom remained intact in [PtAg24(SR)(18)](2-) clusters, and gold replaced the noncentral Ag atoms to form trimetallic [AuxPtAg24-x(SR)(18)](2-) NCs, where x = 1-2, with a portion of the starting [PtAg24(SR)(18)](2-) NCs remaining. This study reveals some of the unusual metal-exchange pathways of doped NCs and the important role played by the initial metal dopant in directing the position of a second dopant in the final product.

  20. Interface modulation of bacteriogenic Ag/AgCl nanoparticles by boosting the catalytic activity for reduction reactions using Co2+ ions.

    Science.gov (United States)

    Zhou, Hao; Che, Lin; Guo, Xuyun; Wang, Xue; Zhan, Jingjing; Wu, Minghuo; Hu, Yufeng; Yi, Xianliang; Zhang, Xuwang; Liu, Lifen

    2017-05-02

    Boosting the low catalytic activity of bacteriogenic Ag/AgCl nanoparticles (NPs) by adding Co2+ in a model reaction, i.e. p-nitrophenol (PNP) reduction, was observed. Under optimal conditions, Co-Ag/AgCl NPs show an apparent rate constant (kapp) of 0.0837 s-1 upon PNP reduction. Considering the trace amount of Co-Ag/AgCl NPs used in catalysis (about 1.2 μg), the activity parameter κ (which is the ratio of kapp and catalyst mass) can reach more than 6.97 × 104 s-1 g-1, which is 214-fold higher than that of pristine Ag/AgCl NPs. Meanwhile, this κ value is also the highest value reported to date. In addition, the biogenic Co-Ag/AgCl NPs exhibit superior catalytic activities over other substrates, such as m-nitrophenol, o-nitrophenol, methyl orange and rhodamine B. The activity enhancement mechanism is supposed to be that Co2+ acts as a Lewis acid, and coordinates with the surface peptides to affect the electric field distribution at the Ag/AgCl NP interface.

  1. Photo-catalytic activity of Plasmonic Ag@AgCl nanoparticles (synthesized via a green route) for the effective degradation of Victoria Blue B from aqueous phase.

    Science.gov (United States)

    Devi, Th Babita; Begum, Shamima; Ahmaruzzaman, M

    2016-07-01

    This study reports a green process for the fabrication of Ag@AgCl (silver@silver chloride) nanoparticles by using Aquilaria agallocha (AA) leaves juice without using any external reagents. The effect of various reaction parameters, such as reaction temperature, reaction time and concentration of Aquilaria agallocha leaves juice in the formation of nanoparticles have also been investigated. From the FTIR spectra of leaves juice and phytochemicals test, it was found that flavonoids present in the leaves are responsible for the reduction of Ag(+) ions to Ag(0) species and leads to the formation of Ag@AgCl NPs. The synthesized Ag@AgCl NPs were utilized for the removal of toxic and hazardous dyes, such as Victoria Blue B from aqueous phase. Approximately, 99.46% degradation of Victoria Blue B dye were observed with Ag@AgCl NPs. Furthermore, the photocatalytic activity of the Ag@AgCl nanoparticles was unchanged after 5cycles of operation. Copyright © 2016 Elsevier B.V. All rights reserved.

  2. Controlled preparation of Ag nanoparticle films by a modified photocatalytic method on TiO{sub 2} films with Ag seeds for surface-enhanced Raman scattering

    Energy Technology Data Exchange (ETDEWEB)

    Fu, Xin; Pan, Lujun, E-mail: lpan@dlut.edu.cn; Li, Shuai; Wang, Qiao; Qin, Jun; Huang, Yingying

    2016-02-15

    Graphical abstract: - Highlights: • Uniform Ag nanoparticle films were synthesized by a modified photocatalytic method on TiO{sub 2} films with Ag seeds for surface-enhanced Raman scattering. • This modified photocatalytic method combine the advantages of the spurting method (high nucleation density) and the traditional photocatalytic method (suitable particle size). • The Raman enhancement of as-prepared Ag NP films was calculated by finite-difference time-domain to validate the experiment data. - Abstract: Uniform Ag nanoparticle (NP) films were synthesized by a modified photocatalytic method on TiO{sub 2} films with Ag seeds for surface-enhanced Raman scattering, which combine the advantages of the spurting method (high nucleation density) and the traditional photocatalytic method (suitable particle size). The Ag seeds were prepared by magnetron sputtering with different time, which would adjust the distribution and transfer of electrons on the surface of TiO{sub 2} film in the process of photocatalytic reduction. The distribution and morphology of Ag NP films can be adjusted by the sputtering time and the UV irradiation time. The Raman enhancement of as-prepared Ag NP films was calculated by finite-difference time-domain to validate the experiment data. It is found that the Ag NP films synthesized on TiO{sub 2} films with suitable pre-deposited Ag seeds exhibit a much higher Raman enhancement activity than the optimum Ag NP film synthesized directly on the TiO{sub 2} film without Ag seeds.

  3. Calculation of thermodynamic functions of saturated solid solution of AgIn2Te3I compound in the Ag-In-Te-I system

    Science.gov (United States)

    Moroz, Mykola; Prokhorenko, Sergiy; Prokhorenko, Myroslava; Reshetnyak, Oleksandr

    2017-01-01

    Triangulation of Ag-In-Te-I system in the vicinity of AgIn2Te3I compound was investigated by X-ray diffraction and differential thermal analysis methods. The spatial position of the phase region AgIn2Te3I-InTe-Ag2Te-AgI regarding the figurative point of silver was used in order to write the equation of virtual potential-forming reaction. Potential-forming reaction was performed in electrochemical cell (ECC) of the type (-) C | Ag | Ag3GeS3I(Br) glass | D | C (+) where C are inert (graphite) electrodes; Ag and D are the electrodes of the ECC; D represents the alloy of four-phase region; Ag3GeS3I glass is a membrane with purely ionic Ag+ conductivity). Linear dependence of the EMF of cell on temperature in the range of 440-480 K was used to calculate the standard thermodynamic functions of saturated solid solution of AgIn2Te3I compound in Ag-In-Te-I system.

  4. Visible-light-driven Ag/AgBr/ZnFe2O4composites with excellent photocatalytic activity for E. coli disinfection and organic pollutant degradation.

    Science.gov (United States)

    Xu, Yuanguo; Liu, Qingqing; Liu, Chenchen; Zhai, Yunpeng; Xie, Meng; Huang, Liying; Xu, Hui; Li, Huaming; Jing, Junjie

    2018-02-15

    Visible-light-driven (VLD) Ag/AgBr/ZnFe 2 O 4 composites with different weight ratios of ZnFe 2 O 4 were synthesized via a facile hydrothermal method. The ZnFe 2 O 4 was evenly dispersed on the surface of Ag/AgBr particles with the diameter about 20 nm. The obtained Ag/AgBr/ZnFe 2 O 4 composites exhibited the high bacterial disinfection efficiency and inactivated bacteria after 120 min visible illumination, which was better than those of with pure ZnFe 2 O 4 and Ag/AgBr. Due to the introduction of ZnFe 2 O 4 , the Ag/AgBr/ZnFe 2 O 4 inactivated bacterial cells through the generation of H 2 O 2 , which generated from the electron reduction on the conduction band of ZnFe 2 O 4 in the system. The photocatalytic experiments indicated that as-prepared samples showed the good photocatalytic performance toward degradation of methyl orange (MO) dye. In a word, the Ag/AgBr/ZnFe 2 O 4 composites, as the antibacterial photocatalyst, is a promising candidate material in wastewater decontamination. Copyright © 2017 Elsevier Inc. All rights reserved.

  5. Ultrasonic-assisted preparation of plasmonic ZnO/Ag/Ag2WO4nanocomposites with high visible-light photocatalytic performance for degradation of organic pollutants.

    Science.gov (United States)

    Pirhashemi, Mahsa; Habibi-Yangjeh, Aziz

    2017-04-01

    In this work, plasmonic ternary ZnO/Ag/Ag 2 WO 4 nanocomposites as efficient visible-light-driven photocatalysts prepared by a facile ultrasonic-irradiation method. The as-prepared samples were characterized by XRD, SEM, TEM, EDX, XPS, UV-vis DRS, FT-IR, and PL techniques. The photocatalytic performance of the prepared ZnO/Ag/Ag 2 WO 4 nanocomposites were evaluated by photodegradations of rhodamine B, methylene blue, methyl orange, and fuchsine under visible-light irradiation. The optimal nanocomposite with 15wt% of Ag/Ag 2 WO 4 to ZnO showed the highest photocatalytic activity for RhB degradation, which is about 95 and 19 times higher than those of the Ag/Ag 2 WO 4 and ZnO samples, respectively. The highly enhanced activity of the ZnO/Ag/Ag 2 WO 4 (15%) nanocomposite was attributed to the surface plasmon resonance effect of metallic silver and the formation of heterojunctions between the counterparts, which effectively suppresses recombination of the photogenerated charge carriers. Lastly, the plasmon-enhanced photocatalytic mechanism associated with the ZnO/Ag/Ag 2 WO 4 nanocomposites was discussed. Copyright © 2016 Elsevier Inc. All rights reserved.

  6. The Synthesis and Characterization of Ag/Ag2O/TiO2/NGP Composites as Adsorbents and Photocatalysts for Wastewater Removal

    Science.gov (United States)

    Taufik, A.; Prakoso, S. P.; Saleh, R.

    2017-03-01

    An Ag/Ag2O/TiO2/NGP with different nanographene platelets (NGP) weight percents was synthesized using the hydrothermal method. The NGP weight percent was 5, 10, and 15 weight percent, respectively. The structural properties of the samples were characterized by X-ray diffraction. The optical properties of the samples were investigated by UV-Vis spectroscopy and their thermal properties were investigated by Thermo Gravimetric Analysis and Differential Thermal Analysis. The existence of a cubic structure from Ag and Ag2O, an anatase from TiO2, and a graphitic like structure from NGP indicated that the samples were successfully formed. The maximum light absorption at 435 nm indicated the existence of surface plasmon resonance (SPR) from silver nanoparticles. The phase transformation of Ag2O to Ag occurred at 435 °C. Adsorption and the photocatalytic performance were investigated in the degradation of methylene blue from the aqueous solution. The adsorption ability of Ag/Ag2O/TiO2/NGP composites increased by increasing the NGP weight percent. The adsorption process of MB followed pseudo-second-order kinetic reactions. The photocatalytic activity of Ag/Ag2O/TiO2/NGP showed that Ag/Ag2O/TiO2/NGP with a 10 weight percent NGP exhibited the highest photocatalytic performance, with a removal ability of approximately 96 percent.

  7. A new family of clusters containing a silver-centered tetracapped [Ag@Ag4(μ3-P)4] tetrahedron, inscribed within a N12icosahedron.

    Science.gov (United States)

    Artem'ev, Alexander V; Bagryanskaya, Irina Yu; Doronina, Evgeniya P; Tolstoy, Peter M; Gushchin, Artem L; Rakhmanova, Mariana I; Ivanov, Alexander Yu; Suturina, Anastasiya O

    2017-09-26

    An unprecedented silver-centered P-tetracapped [Ag@Ag 4 (μ 3 -P) 4 ] tetrahedron inscribed within a N 12 icosahedral cage has been discovered in the novel family of luminescent clusters. The latter are easily self-assembled by reacting Ag I salts with tris(2-pyridyl)phosphine (Py 3 P).

  8. Environmentally benign chitosan as reductant and supporter for synthesis of Ag/AgCl/chitosan composites by one-step and their photocatalytic degradation performance under visible-light irradiation

    Science.gov (United States)

    Wang, Hao; Wu, Yuhan; Wu, Pengcheng; Chen, Shanshan; Guo, Xuhong; Meng, Guihua; Peng, Banghua; Wu, Jianning; Liu, Zhiyong

    2017-06-01

    A novel Ag/AgCl/chitosan composite photocatalyst was successfully prepared by a simple one-step method. During this progress, environmentally benign chitosan not only served as reductant to reduce Ag+ to Ag0 species, but also acted as supporter for Ag/AgCl nanoparticles. XRD, SEM, EDX, UV-vis DRS and XPS were employed to characterize the as-prepared simples. SEM images of Ag/AgCl/chitosan composites revealed that Ag/AgCl nanoparticles were successfully loaded onto chitosan without obvious aggregation. All Ag/AgCl/chitosan composites exhibited efficient photocatalytic activity for the degradation of rhodamine B (RhB) under visible-light irradiation. The result of photocatalytic degradation experiment indicated that 20% of the mass ratio of AgCl to chitosan was the optimum, and after 40 min photocatalytic reaction, the degradation rate reached about 96%.

  9. Thermal properties of radiolytically synthesized PVA/Ag nanocomposites

    Directory of Open Access Journals (Sweden)

    Krklješ Aleksandra N.

    2007-01-01

    Full Text Available The radiolytic method was used to synthesize two types of nanocomposites with silver, PVA/Ag by film casting and PVA hydrogel/Ag nanocomposites. This method is particularly suitable for generating metal nanoparticles in solution. The radiolytic species (solvated electrons and secondary radicals exhibit strong reducing properties such that metal ions are reduced at each encounter. Metal atoms then tend to grow into larger clusters. It was found that solid or swollen polymers are able to stabilize small crystallites against spontaneous growth via aggregation. Using differential scanning calorimetry (DSC, the melting behavior and kinetics of the PVA/Ag nanocomposites were investigated and compared to those of pure PVA. The melting as well as crystallization behavior of polymers is crucial because it governs the thermal properties, impact resistance and stress strain properties. Understanding the melting behavior is significant not only to tailor the properties of nanocomposites but to investigate the interactions between the constituents. The DSC curves of pure PVA and prepared nanocomposites show only one melting peak between 175 and 230°C, indicating that the melting behavior of these two systems are analogous. In both cases, with increasing heating rate, the melting peak shifts to a higher temperature, but with increasing Ag content the peak melting temperature is lower. When specimens are heated at high heating rate, the motion of PVA molecular chains cannot follow the heating temperature on time due to the influence of heat hysteresis, which leads to a higher peak melting temperature. When Ag nanoparticles are added they increase the heat transfer among the PVA molecular chains decreasing the melting temperature. The Ag content is a major factor affecting the degree of crystallinity. It was observed that at low nanofiller content, up to the 0.5 wt%, the degree of crystallinity of the nanocomposites increased, while at a higher content the

  10. Integrated HSE management system of RWE Dea AG; Integriertes HSE-Managementsystem der RWE Dea AG

    Energy Technology Data Exchange (ETDEWEB)

    Schuhbauer, W. [RWE Dea AG, Hamburg (Germany)

    2005-05-01

    The core competences of RWE Dea AG are exploration and production of natural gas and petroleum. RWE Dea has more than 100 years of experience in drilling and production. It has foreign interests in Norway, Britain, Egypt, Libya, Kazakhstan, Poland and Denmark, some of which are worked in cooperation with competent partners. In Germany, RWE Dea focuses on natural gas exploration and production in Niedersachsen between the Elbe and Weser rivers, the development of the Mittelplate offshore field on the west coast of Schleswig-Holstein, and the operation of large-volume underground natural gas storage caverns in Bavaria. As its activities are related to health, safety and environment, RWE Dea developed a special management system for these aspects. (orig.)

  11. A low proportion of HBeAg among HBsAg-positive pregnant women with known HIV status could suggest low perinatal transmission of HBV in Cameroon

    Directory of Open Access Journals (Sweden)

    Kfutwah Anfumbom KW

    2012-03-01

    Full Text Available Abstract Background Transmission of hepatitis B virus (HBV from HBV-positive mothers to their infants is common and usually occurs when the mother is hepatitis B e antigen (HBeAg positive and/or has a high HBV DNA load. In this study, we determined the prevalence of hepatitis B surface antigen (HBsAg and HBeAg among pregnant women with known HIV status. Findings A total of 650 pregnant women with a mean age of 26.2 years including 301 HIV-positives and 349 HIV-negatives were screened for HBsAg (Monolisa AgHBs Plus Biorad, France. Among the HBsAg-positives, HBeAg and anti-HBe were tested (Monolisa Ag HBe Plus Biorad, France. Overall, 51 (7.85% were positive for HBsAg. The prevalence of HBsAg was not statistically different between HIV-positive and HIV-negative pregnant women [28/301 (9.3% vs 23/349 (6.59%; p = 0.2]. None of the 45 HBsAg-positive samples was reactive for HBeAg. Conclusions Our study indicates a high prevalence of HBsAg with very low proportion of HBeAg in Cameroonian pregnant women. Since perinatal transmission of HBV is mostly effective when the mother is also HBeAg-positive, our data could suggest that perinatal transmissions play a minor role in HBV prevalence in Cameroon. In line with previous African studies, these findings further suggests that horizontal transmission could be the most common mechanism of HBV infections in Cameroon.

  12. Synthesis of photoactive AgCl/SBA-15 by conversion of silver nanoparticles into stable AgCl nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Zienkiewicz-Strzalka, M., E-mail: gosiazienkiewicz@wp.pl [Department of Crystallography, Faculty of Chemistry, Maria Curie-Sklodowska University, sq. Maria Curie-Sklodowska 3, 20-031 Lublin (Poland); Pikus, S. [Department of Crystallography, Faculty of Chemistry, Maria Curie-Sklodowska University, sq. Maria Curie-Sklodowska 3, 20-031 Lublin (Poland)

    2013-01-15

    Highlights: Black-Right-Pointing-Pointer A new material AgCl/SBA-15 was synthesized and characterized. Black-Right-Pointing-Pointer New simple and effective approach of preparation was proposed. Black-Right-Pointing-Pointer AgCl/SBA-15 material was tested as an active agent during photodegradation of phenol and its photoactivity was confirmed. Black-Right-Pointing-Pointer The photoactive properties depend on AgCl nanoparticles present in the composite. - Abstract: In this work the results of synthesis the ordered mesoporous silica (SBA-15) in the presence of stable silver nanoparticles were presented. It has been proven that the proposed method leads to the synthesis of SBA-15 nanocomposite containing silver chloride nanoparticles, formed by the transformation of silver nanoparticles in the acidic conditions. Proposed one-pot procedure is simple and the one requirement is to prepare a stable solution of silver nanoparticles. In this work, silver nanoparticles were obtained during chemical reduction of [Ag(NH{sub 3}){sub 2}]{sup +} ions by formaldehyde. Silver nanoparticles solution can be used as a silver chloride source due to the application of the same polymer as a stabilizer of nanocrystals and structure directing agent of SBA-15. The final AgCl/SBA-15 materials show excellent structural ordering characteristic for this type of materials confirmed by diffraction measurements in range of small angles 2{theta}, transmission electron microscopy (TEM) and nitrogen adsorption/desorption measurements. AgCl nanoparticles were identified by diffraction measurements as chlorargyrite phase. The presence of silver nanoparticles in initial solution and their absence after synthesis were confirmed by UV-vis measurements. The photoactivity of obtained AgCl/SBA-15 composite was tested in reaction of organic impurities photodegradation.

  13. Tribological properties of CrAgN thin films

    Directory of Open Access Journals (Sweden)

    Peter Jurči

    2013-02-01

    Full Text Available CrN and CrAgN thin films were magnetron sputtered onto the substrate made from Vanadis 6 cold work tool steel. The films were examined on tribological properties using a high temperature Pin-on-disc tribometer. Obtained results show that there is almost no effect of Ag addition on the friction coefficient when tested at a room temperature against alumina. The testing against the same counterpart at higher temperature gave positive effect of the silver addition on the m. The testing against 100Cr6 ball bearing steel gave higher friction coefficient than that against alumina while the testing against CuSn6-bronze led to much lower m. When tested at a room temperature, the wear performance of the films was positively affected only in the case of the CrAg3N film developed at 500 oC. On the other hand, addition of 3 wt% Ag into the CrN increased the wear performance at elevated temperatures while the addition of 15 wt% Ag has made the film too soft and sensitive to wear.

  14. AgMIP Training in Multiple Crop Models and Tools

    Science.gov (United States)

    Boote, Kenneth J.; Porter, Cheryl H.; Hargreaves, John; Hoogenboom, Gerrit; Thornburn, Peter; Mutter, Carolyn

    2015-01-01

    The Agricultural Model Intercomparison and Improvement Project (AgMIP) has the goal of using multiple crop models to evaluate climate impacts on agricultural production and food security in developed and developing countries. There are several major limitations that must be overcome to achieve this goal, including the need to train AgMIP regional research team (RRT) crop modelers to use models other than the ones they are currently familiar with, plus the need to harmonize and interconvert the disparate input file formats used for the various models. Two activities were followed to address these shortcomings among AgMIP RRTs to enable them to use multiple models to evaluate climate impacts on crop production and food security. We designed and conducted courses in which participants trained on two different sets of crop models, with emphasis on the model of least experience. In a second activity, the AgMIP IT group created templates for inputting data on soils, management, weather, and crops into AgMIP harmonized databases, and developed translation tools for converting the harmonized data into files that are ready for multiple crop model simulations. The strategies for creating and conducting the multi-model course and developing entry and translation tools are reviewed in this chapter.

  15. Microstructure and mechanical properties of Mg-Zn-Ag alloys

    Energy Technology Data Exchange (ETDEWEB)

    Park, S.C.; Lim, J.D. [Materials Research Team, R and D Div., Hyundai Motor Co. and Kia Motors Corp., Kyunggi-do (Korea); Eliezer, D. [Dept. of Materials Engineering, Ben-Gurion Univ. of the Negev, Beer-Sheva (Israel); Shin, K.S. [School of Materials Science and Engineering, Seoul National Univ. (Korea); CAAM, POSTECH, Pohang (Korea)

    2003-07-01

    The majority of Mg components currently in use in the automotive and electronic industries are produced by conventional casting processes. However, there is a strong need to develop new high strength wrought alloys for wide-spread application of Mg alloys in near future. In the present study, new Mg-Zn-Ag alloys were developed and characterized. In order to evaluate the effects of Ag addition on the mechanical properties of the extruded Mg-Zn alloys, the age hardening response and mechanical properties were examined with different amounts of alloying element. The microstructures of the specimens were examined with optical microscopy and transmission electron microscopy. The grain sizes of the alloys in as-extruded condition were markedly reduced with the addition of Ag. The hardness was found to increase more rapidly in the alloys with double aging treatment compared to those with single aging treatment. The peak hardness was also found to be higher in the alloys with double aging treatment. In all heat treatment conditions, the hardness of the Mg-Zn-Ag alloys were found to be higher than those of the Mg-Zn alloys. The addition of Ag to the Mg-Zn alloys increased the tensile strength with a small decrease in tensile elongation in the peak double aging condition. (orig.)

  16. Palatability Can Drive Feeding Independent of AgRP Neurons.

    Science.gov (United States)

    Denis, Raphaël G P; Joly-Amado, Aurélie; Webber, Emily; Langlet, Fanny; Schaeffer, Marie; Padilla, Stéphanie L; Cansell, Céline; Dehouck, Bénédicte; Castel, Julien; Delbès, Anne-Sophie; Martinez, Sarah; Lacombe, Amélie; Rouch, Claude; Kassis, Nadim; Fehrentz, Jean-Alain; Martinez, Jean; Verdié, Pascal; Hnasko, Thomas S; Palmiter, Richard D; Krashes, Michael J; Güler, Ali D; Magnan, Christophe; Luquet, Serge

    2015-10-06

    Feeding behavior is exquisitely regulated by homeostatic and hedonic neural substrates that integrate energy demand as well as the reinforcing and rewarding aspects of food. Understanding the net contribution of homeostatic and reward-driven feeding has become critical because of the ubiquitous source of energy-dense foods and the consequent obesity epidemic. Hypothalamic agouti-related peptide-secreting neurons (AgRP neurons) provide the primary orexigenic drive of homeostatic feeding. Using models of neuronal inhibition or ablation, we demonstrate that the feeding response to a fast ghrelin or serotonin receptor agonist relies on AgRP neurons. However, when palatable food is provided, AgRP neurons are dispensable for an appropriate feeding response. In addition, AgRP-ablated mice present exacerbated stress-induced anorexia and palatable food intake--a hallmark of comfort feeding. These results suggest that, when AgRP neuron activity is impaired, neural circuits sensitive to emotion and stress are engaged and modulated by food palatability and dopamine signaling. Copyright © 2015 Elsevier Inc. All rights reserved.

  17. TRIBOLOGICAL PROPERTIES OF CrAgN THIN FILMS

    Directory of Open Access Journals (Sweden)

    Peter Jurči

    2013-04-01

    Full Text Available CrN and CrAgN thin films were magnetron sputtered onto the substrate made from Vanadis 6 cold work tool steel. The films were examined on tribological properties using a high temperature Pin-on-disc tribometer. Obtained results show that there is almost no effect of Ag addition on the friction coefficient when tested at a room temperature against alumina. The testing against the same counterpart at higher temperature gave positive effect of the silver addition on the friction coefficient. The testing against 100Cr6 ball bearing steel gave higher friction coefficient than that against alumina while the testing against CuSn6-bronze led to much lower μ. When tested at a room temperature, the wear performance of the films was positively affected only in the case of the CrAg3N film developed at 500 °C. On the other hand, addition of 3 wt% Ag into the CrN increased the wear performance at elevated temperatures while the addition of 15 wt% Ag has made the film too soft and sensitive to wear.

  18. Ag-graphene hybrid conductive ink for writing electronics.

    Science.gov (United States)

    Xu, L Y; Yang, G Y; Jing, H Y; Wei, J; Han, Y D

    2014-02-07

    With the aim of preparing a method for the writing of electronics on paper by the use of common commercial rollerball pens loaded with conductive ink, hybrid conductive ink composed of Ag nanoparticles (15 wt%) and graphene-Ag composite nanosheets (0.15 wt%) formed by depositing Ag nanoparticles (∼10 nm) onto graphene sheets was prepared for the first time. Owing to the electrical pathway effect of graphene and the decreased contact resistance of graphene junctions by depositing Ag nanoparticles (NPs) onto graphene sheets, the concentration of Ag NPs was significantly reduced while maintaining high conductivity at a curing temperature of 100 ° C. A typical resistivity value measured was 1.9 × 10(-7) Ω m, which is 12 times the value for bulk silver. Even over thousands of bending cycles or rolling, the resistance values of writing tracks only increase slightly. The stability and flexibility of the writing circuits are good, demonstrating the promising future of this hybrid ink and direct writing method.

  19. Aniline chlorination by in situ formed Ag-Cl complexes under simulated solar light irradiation.

    Science.gov (United States)

    Hu, Xuefeng; Wang, Xiaowen; Dong, Liuliu; Chang, Fei; Luo, Yongming

    2015-01-01

    Ag speciation in a chloride medium was dependent upon the Cl/Ag ratio after releasing into surface water. In this study, the photoreaction of in situ formed Ag-Cl species and their effects on aniline photochlorination were systematically investigated. Our results suggested that formation of chloroaniline was strongly relevant to the Cl/Ag ratio and could be interpreted using the thermodynamically expected speciation of Ag in the presence of Cl-. AgCl was the main species responsible for the photochlorination of aniline. Both photoinduced hole and •OH drove the oxidation of Cl- to radical •Cl, which promoted the chlorination of aniline. Ag0 formation was observed from the surface plasmon resonance absorption during AgCl photoreaction. This study revealed that Ag+ released into Cl--containing water may result in the formation of chlorinated intermediates of organic compounds under solar light irradiation.

  20. Transformation of AgCl nanoparticles in a sewer system — A field study

    Energy Technology Data Exchange (ETDEWEB)

    Kaegi, Ralf, E-mail: ralf.kaegi@eawag.ch [Eawag, Swiss Federal Institute of Aquatic Science and Technology, Überlandstrasse 133, 8600 Dübendorf (Switzerland); Voegelin, Andreas; Sinnet, Brian [Eawag, Swiss Federal Institute of Aquatic Science and Technology, Überlandstrasse 133, 8600 Dübendorf (Switzerland); Zuleeg, Steffen [KUSTER + HAGER Group, Oberstrasse 222, 9014 St. Gallen (Switzerland); Siegrist, Hansruedi [Eawag, Swiss Federal Institute of Aquatic Science and Technology, Überlandstrasse 133, 8600 Dübendorf (Switzerland); Burkhardt, Michael [HSR University of Applied Sciences, Institute of Environmental and Process Engineering (UMTEC), Oberseestrasse 10, 8640 Rapperswil (Switzerland)

    2015-12-01

    Silver nanoparticles (Ag-NP) are increasingly used in consumer products and their release during the use phase may negatively affect aquatic ecosystems. Research efforts, so far, have mainly addressed the application and use of metallic Ag(0)-NP. However, as shown by recent studies on the release of Ag from textiles, other forms of Ag, especially silver chloride (AgCl), are released in much larger quantities than metallic Ag(0). In this field study, we report the release of AgCl-NP from a point source (industrial laundry that applied AgCl-NP during a piloting phase over a period of several months to protect textiles from bacterial regrowth) to the public sewer system and investigate the transformation of Ag during its transport in the sewer system and in the municipal wastewater treatment plant (WWTP). During the study period, the laundry discharged ~ 85 g of Ag per day, which dominated the Ag loads in the sewer system from the respective catchment (72–95%) and the Ag in the digested WWTP sludge (67%). Combined results from electron microscopy and X-ray absorption spectroscopy revealed that the Ag discharged from the laundry to the sewer consisted of about one third AgCl and two thirds Ag{sub 2}S, both forms primarily occurring as nanoparticles with diameters < 100 nm. During the 800 m transport in the sewer channel to the nearby WWTP, corresponding to a travel time of ~ 30 min, the remaining AgCl was transformed into nanoparticulate Ag{sub 2}S. Ag{sub 2}S-NP also dominated the Ag speciation in the digested sludge. In line with results from earlier studies, the very low Ag concentrations measured in the effluent of the WWTP (< 0.5 μg L{sup −1}) confirmed the very high removal efficiency of Ag from the wastewater stream (> 95%). - Highlights: • First field study on the transformation of AgCl nanoparticles released from a point source into the municipal sewer system. • Transformation of AgCl-NP into Ag{sub 2}S already occurred during 30-min transport in the

  1. Reversible emission evolution from Ag activated zeolite Na-A upon dehydration/hydration

    Energy Technology Data Exchange (ETDEWEB)

    Lin, Hui, E-mail: linh8112@163.com, E-mail: fujii@eedept.kobe-u.ac.jp; Imakita, Kenji; Fujii, Minoru, E-mail: linh8112@163.com, E-mail: fujii@eedept.kobe-u.ac.jp [Department of Electrical and Electronic Engineering, Graduate School of Engineering, Kobe University, Rokkodai, Nada, Kobe 657-8501 (Japan)

    2014-11-24

    Reversible emission evolution of thermally treated Ag activated zeolite Na-A upon dehydration/hydration in vacuum/water vapor was observed. The phenomenon was observed even for the sample with low Ag{sup +}-Na{sup +} exchanging (8.3%), indicating that the emission from Ag activated zeolites may not come from Ag clusters while from the surrounding coordinated Ag{sup +} ions or Ag{sup 0} atoms. It was disclosed that the characteristic yellow-green emission at ∼560 ± 15 nm is strongly associated with the coordinating water molecules to the Ag{sup +} ions or Ag{sup 0} atoms, which is clear evidence for that the efficient emission from Ag activated zeolites may not originate from the quantum confinement effect.

  2. The role of exopolymeric substances in the bioaccumulation and toxicity of Ag nanoparticles to algae

    Science.gov (United States)

    Zhou, Kaijun; Hu, Yi; Zhang, Luqing; Yang, Kun; Lin, Daohui

    2016-09-01

    Exopolymeric substances (EPS) have an important role in bioaccumulation and toxicity of nanoparticles (NPs) to algae, which warrants specific studies. The interaction of EPS with citrate and polyvinyl pyrrolidone (PVP) coated AgNPs (C-AgNPs and P-AgNPs, respectively) and its roles in bioaccumulation and toxicity of the AgNPs to Chlorella pyrenoidosa were investigated. The amino and aromatic carboxylic groups in the EPS were involved in the EPS-AgNP interactions. Compared with Ag+, C-AgNPs had comparable total bioaccumulation but greater absorption by intact algae with EPS; P-AgNPs had the smallest total bioaccumulation and were mainly adsorbed on algal surfaces. With EPS removed, the total bioaccumulations and surface adsorptions for the three Ag species decreased but the cell internalizations increased; the 96 h half growth inhibition concentrations decreased, indicating EPS alleviated the algal toxicity of Ag. The cell-internalized but not the adsorbed AgNPs could contribute to the nanotoxicity. The EPS could bind both AgNPs and Ag+, and thus inhibited the cell internalization and the nanotoxicity. However, the EPS-bound Ag on the cell surfaces would migrate along with the algae and be biologically amplified in the aquatic food chains, presenting ecological risks. These results are helpful for understanding the fate and ecological effects of NPs.

  3. Study on antibacterial activity of chemically synthesized PANI-Ag-Au nanocomposite

    Science.gov (United States)

    Boomi, Pandi; Prabu, Halliah Gurumallesh; Manisankar, Paramasivam; Ravikumar, Sundaram

    2014-05-01

    Pristine polyaniline (PANI), PANI-Ag, PANI-Au and PANI-Ag-Au nanocomposites have been successfully synthesized by chemical oxidative polymerization method using aniline as monomer, ammonium persulphate as oxidant and metal (Ag, Au and Ag-Au) colloids. UV-Vis analysis exhibited surface Plasmon resonances of Ag, Au, Ag-Au nanoparticles. FT-IR spectra revealed the shift in peak position of N-H stretching. X-ray diffraction (XRD) results confirm the presence of Ag, Au and Au-Ag nanoparticles. HR-TEM images show nanosizes of Ag, Au, Ag-Au and the incorporation of such nanoparticles into the PANI matrix. Pristine PANI, PANI-Ag, PANI-Au and PANI-Ag-Au nanocomposites were tested for antibacterial activity by agar well diffusion method. PANI-Ag-Au nanocomposite exhibited higher antibacterial activity against both gram-positive [Streptococcus sp. (MTCC 890), Staphylococcus sp. (MTCC 96)] and gram-negative bacteria [Escherichia coli (MTCC 1671) and Klebsiella sp. (MTCC 7407)] when compared with PANI-Ag nanocomposite, PANI-Au nanocomposite and pristine PANI. The novelty of this study is the polymer-bimetal synthesis and its antibacterial potential.

  4. Fabrication of a novel visible-light-driven photocatalyst Ag-AgI-TiO{sub 2} nanoparticles supported on carbon nanofibers

    Energy Technology Data Exchange (ETDEWEB)

    Yu, Dandan; Bai, Jie, E-mail: baijie@imut.edu.cn; Liang, Haiou; Wang, Junzhong; Li, Chunping

    2015-09-15

    Graphical abstract: - Highlights: • Visible-light-induced Ag-AgI-TiO{sub 2}/CNFs nanocomposites had been successfully prepared. • Ag-AgI-TiO{sub 2}/CNFs could be easily separated and recycled from an aqueous solution. • The application of CNFs acting as supporters made the photocatalysts have high adsorption capacity. • Ag-AgI-TiO{sub 2}/CNFs could efficiently degrade different organic dyes. - Abstract: Novel visible-light-driven photocatalysts Ag-AgI-TiO{sub 2} nanoparticles embedded onto carbon nanofibers were successfully prepared. Electrospinning technology followed by high-temperature calcination was adopted for the fabrication of carbon nanofibers (CNFs) acting as a supporter. Ag-TiO{sub 2}/CNFs nanocomposites were prepared by combining in situ reduction with physical adsorption process. Ag-AgI-TiO{sub 2}/CNFs were synthesized by oxidizing some silver nanoparticles (Ag NPs) contained in Ag-TiO{sub 2}/CNFs to silver iodine (AgI) via chemical oxidation method using iodine (I{sub 2}) as oxidation agents. The as-prepared nanocomposites were characterized by X-ray diffraction (XRD), X-ray photoelectron spectroscopy (XPS), scanning electron microscopy (SEM), transmission electron microscopy (TEM), UV–vis diffuse reflectance spectra (DRS), and Fourier transform infrared spectroscopy (FTIR). The as-fabricated Ag-AgI-TiO{sub 2}/CNFs showed high efficient adsorption and photocatalytic activity for decomposition of methyl orange (MO), acid red 18 (AR18), methylene blue (MB), and fluorescence sodium under visible light irradiation, which were attributed to the synergistic effects between the high adsorption capacity, good conductivity of carbon nanofibers, and the extraordinary plasma effect of Ag-AgI nanoparticles. In addition, the as-prepared composites could be easily separated from the solution phase due to the large length–diameter ratio of CNFs. The mechanism for the enhanced photocatalytic activity concerned with Ag-AgI-TiO{sub 2}/CNFs was proposed.

  5. Asymmetrical Precipitation of Ag3Sn Intermetallic Compounds Induced by Thermomigration of Ag in Pb-Free Microbumps During Solid-State Aging

    Science.gov (United States)

    Su, Yu-Ping; Wu, Chun-Sen; Ouyang, Fan-Yi

    2016-01-01

    Three-dimensional integrated circuit technology has become a major trend in electronics packaging in the microelectronics industry. To effectively remove heat from stacked integrated circuitry, a temperature gradient must be established across the chips. Furthermore, because of the trend toward higher device current density, Joule heating is more serious and temperature gradients across soldered joints are expected to increase. In this study we used heat-sink and heat-source devices to establish a temperature gradient across SnAg microbumps to investigate the thermomigration behavior of Ag in SnAg solder. Compared with isothermal conditions, small Ag3Sn particles near the hot end were dissolved and redistributed toward the cold end under a temperature gradient. The results indicated that temperature gradient-induced movement of Ag atoms occurred from the hot side toward the cold side, and asymmetrical precipitation of Ag3Sn resulted. The mechanism of growth of the intermetallic compound (IMC) Ag3Sn, caused by thermomigration of Ag, is discussed. The rate of growth Ag3Sn IMC at the cold side was found to increase linearly with solid-aging time under a temperature gradient. To understand the force driving Ag diffusion under the temperature gradient, the molar heat of transport ( Q*) of Ag in Sn was calculated as +13.34 kJ/mole.

  6. Ag/AgCl decorated Bi4Ti3O12 nanosheet with highly exposed (001) facets for enhanced photocatalytic degradation of Rhodamine B, Carbamazepine and Tetracycline

    Science.gov (United States)

    Shi, Bingtao; Yin, Haoyong; Gong, Jianying; Nie, Qiulin

    2017-10-01

    The Ag/AgCl decorated Bi4Ti3O12 nanosheet with highly exposed (001) facets was successfully synthesized via a facile method and characterized by TEM, SEM, XRD, XPS and DRS. The Bi4Ti3O12 was developed into the layered structure with (001) facets highly exposed and thickness less than 50 nm. The Ag/AgCl nanoparticles less than 10 nm were uniformly decorated on the surface of Bi4Ti3O12 nanosheet. The photocatalytic performance of the photocatalysts was carried out through the decomposition of Rhodamine B, Carbamazepine and Tetracycline aqueous solution under visible-light irradiation. Ag/AgCl/Bi4Ti3O12 nanosheet showed superior photocatalytic activities on all of these organic pollutants. As a result, rate constant of the Ag/AgCl/Bi4Ti3O12 nanosheet is 5.7 times of Bi4Ti3O12 nanosheet for Rhodamine B degradation and 3.4 times for Tetracycline degradation and much higher for Carbamazepine degradation. The synthesized Ag/AgCl/Bi4Ti3O12 nanosheet also exhibited high reusability for the photodegradation reaction. Additionally, a conceivable visible-light photocatalysis mechanism was proposed in detail. The enhancement of photocatalytic performance of the catalyst may be attributed to the synergetic effects the internal electric fields between Bi4Ti3O12 nanosheet and the SPR effect of Ag nanoparticles.

  7. Thermoelectric Properties of Ag-Doped Bi2(Se,Te)3 Compounds: Dual Electronic Nature of Ag-Related Lattice Defects.

    Science.gov (United States)

    Lu, Meng-Pei; Liao, Chien-Neng; Huang, Jing-Yi; Hsu, Hung-Chang

    2015-08-03

    Effects of Ag doping and thermal annealing temperature on thermoelectric transport properties of Bi2(Se,Te)3 compounds are investigated. On the basis of the comprehensive analysis of carrier concentration, Hall mobility, and lattice parameter, we identified two Ag-related interstitial (Agi) and substitutional (AgBi) defects that modulate in different ways the thermoelectric properties of Ag-doped Bi2(Se,Te)3 compounds. When Ag content is less than 0.5 wt %, Agi plays an important role in stabilizing crystal structure and suppressing the formation of donor-like Te vacancy (VTe) defects, leading to the decrease in carrier concentration with increasing Ag content. For the heavily doped Bi2(Se,Te)3 compounds (>0.5 wt % Ag), the increasing concentration of AgBi is held responsible for the increase of electron concentration because formation of AgBi defects is accompanied by annihilation of hole carriers. The analysis of Seebeck coefficients and temperature-dependent electrical properties suggests that electrons in Ag-doped Bi2(Se,Te)3 compounds are subject to a mixed mode of impurity scattering and lattice scattering. A 10% enhancement of thermoelectric figure-of-merit at room temperature was achieved for 1 wt % Ag-doped Bi2(Se,Te)3 as compared to pristine Bi2(Se,Te)3.

  8. One-pot preparation of nanoporous Ag-Cu@Ag core-shell alloy with enhanced oxidative stability and robust antibacterial activity.

    Science.gov (United States)

    Liu, Xue; Du, Jing; Shao, Yang; Zhao, Shao-Fan; Yao, Ke-Fu

    2017-08-31

    Metallic core-shell nanostructures have inspired prominent research interests due to their better performances in catalytic, optical, electric, and magnetic applications as well as the less cost of noble metal than monometallic nanostructures, but limited by the complicated and expensive synthesis approaches. Development of one-pot and inexpensive method for metallic core-shell nanostructures' synthesis is therefore of great significance. A novel Cu network supported nanoporous Ag-Cu alloy with an Ag shell and an Ag-Cu core was successfully synthesized by one-pot chemical dealloying of Zr-Cu-Ag-Al-O amorphous/crystalline composite, which provides a new way to prepare metallic core-shell nanostructures by a simple method. The prepared nanoporous Ag-Cu@Ag core-shell alloy demonstrates excellent air-stability at room temperature and enhanced oxidative stability even compared with other reported Cu@Ag core-shell micro-particles. In addition, the nanoporous Ag-Cu@Ag core-shell alloy also possesses robust antibacterial activity against E. Coli DH5α. The simple and low-cost synthesis method as well as the excellent oxidative stability promises the nanoporous Ag-Cu@Ag core-shell alloy potentially wide applications.

  9. Fabrication, characterization and photocatalytic properties of Ag/AgI/BiOI heteronanostructures supported on rectorite via a cation-exchange method

    Energy Technology Data Exchange (ETDEWEB)

    Chen, Yunfang [School of Chemistry and Environment, South China Normal University, Guangzhou 510006, Guangdong (China); Fang, Jianzhang, E-mail: fangjzh@scnu.edu.cn [School of Chemistry and Environment, South China Normal University, Guangzhou 510006, Guangdong (China); Guangdong Technology Research Center for Ecological Management and Remediation of Urban Water System, Guangzhou 510006 (China); Lu, Shaoyou [Shenzhen Center for Disease Control and Prevention, Shenzhen 518055 (China); Wu, Yan; Chen, Dazhi; Huang, Liyan [Institute of Engineering Technology of Guangdong Province, Key Laboratory of Water Environmental Pollution Control of Guangdong Province, Guangzhou 510440 (China); Xu, Weicheng; Zhu, Ximiao [School of Chemistry and Environment, South China Normal University, Guangzhou 510006, Guangdong (China); Fang, Zhanqiang [School of Chemistry and Environment, South China Normal University, Guangzhou 510006, Guangdong (China); Guangdong Technology Research Center for Ecological Management and Remediation of Urban Water System, Guangzhou 510006 (China)

    2015-04-15

    Highlights: • Ag/AgI/BiOI-rectorite was prepared by twice cation-exchange process. • Ag/AgI/BiOI-rectorite photocatalyst possessed SPR and adsorption capacity. • Ag/AgI/BiOI-rectorite exhibited highly photocatalytic activity. • Trapped holes and ·O{sub 2}{sup −} were formed active species in the photocatalytic system. - Abstract: In this work, a new plasmonic photocatalyst Ag/AgI/BiOI-rectorite was prepared via a cation exchange process. The photocatalyst had been characterized by X-ray powder diffraction (XRD), Raman spectra, nitrogen sorption (BET), field-emission scanning electron microscope (FE-SEM), X-ray photoelectron spectroscopy (XPS) and UV–vis diffuse reflectance spectroscopy (DRS). The photocatalytic activity, which was evaluated by degradation of rhodamine B (RhB) and bisphenol A (BPA) under visible light irradiation, was enhanced significantly by loading Ag/AgI/BiOI nanoparticles onto rectorite. The photogenerated holes and superoxide radical (·O{sub 2}{sup −}) were both formed as active species for the photocatalytic reactions under visible light irradiation. The existence of metallic Ag particles, which possess the surface plasmon resonance effect, acted as an indispensable role in the photocatalytic reaction.

  10. Facile formation of Ag{sub 2}WO{sub 4}/AgX (X = Cl, Br, I) hybrid nanorods with enhanced visible-light-driven photoelectrochemical properties

    Energy Technology Data Exchange (ETDEWEB)

    Li, Jingjing; Yu, Caiyun [Key Laboratory of the Ministry of Education for Advanced Catalysis Materials, Institute of Physical Chemistry, Zhejiang Normal University, Jinhua 321004 (China); Zheng, Changcheng [Mathematics and Physics Centre, Xi’an Jiaotong-Liverpool University, Suzhou 215123 (China); Etogo, Atangana; Xie, Yunlong; Zhong, Yijun [Key Laboratory of the Ministry of Education for Advanced Catalysis Materials, Institute of Physical Chemistry, Zhejiang Normal University, Jinhua 321004 (China); Hu, Yong, E-mail: yonghu@zjnu.edu.cn [Key Laboratory of the Ministry of Education for Advanced Catalysis Materials, Institute of Physical Chemistry, Zhejiang Normal University, Jinhua 321004 (China)

    2015-01-15

    Highlights: • Ag{sub 2}WO{sub 4}/AgX hybrid nanorods were prepared by a facile in-situ anion exchange reaction. • Ag{sub 2}WO{sub 4} nanorods and different X{sup −} ions were reacted in water at room temperature. • The hybrids possess significantly enhanced photoelectrochemical properties. • Ag{sub 2}WO{sub 4}/AgBr hybrids exhibit the highest photocatalytic activity among three samples. • The active species tests were also investigated to confirm photocatalytic mechanism. - Abstract: In this work, we demonstrated a general strategy for the preparation of a series of uniform Ag{sub 2}WO{sub 4}/AgX (X = Cl, Br, I) hybrid nanorods by a facile in-situ anion exchange reaction occurring at room temperature between pregrown Ag{sub 2}WO{sub 4} nanorods and different X{sup −} ions in water. Compared with Ag{sub 2}WO{sub 4} nanorods, further investigation has revealed that the as-prepared hybrid nanorods possess significantly enhanced photocurrent response and photocatalytic activity in degrading methyl orange (MO) under visible-light irradiation. In particular, the Ag{sub 2}WO{sub 4}/AgBr hybrid nanorods exhibit the highest photocatalytic activity among the three kinds of samples. The active species tests indicate that superoxide anion radicals and photogenerated holes are responsible for the enhanced photocatalytic performance.

  11. Photoluminescence enhancement of quantum dots on Ag nanoneedles.

    Science.gov (United States)

    Ahmed, Syed Rahin; Cha, Hee Ryoung; Park, Jung Youn; Park, Enoch Y; Lee, Dongyun; Lee, Jaebeom

    2012-08-07

    Noble metal nanostructure allows us to tune optical and electrical properties, which has high utility for real-world application. We studied surface plasmon-induced emission of semiconductor quantum dots (QDs) on engineered metallic nanostructures. Highly passive organic ZnS-capped CdSe QDs were spin-coated on poly-(methyl methacrylate)-covered Ag films, which brought QDs near the metallic surface. We obtained the enhanced electromagnetic field and reduced fluorescence lifetimes from CdSe/ZnS QDs due to the strong coupling of emitter wave function with the Ag plasmon resonance. Observed changes include a six-fold increase in the fluorescence intensity and striking reduction in fluorescence lifetimes of CdSe/ZnS QDs on rough Ag nanoneedle compared to the case of smooth surfaces. The advantages of using those nanocomposites are expected for high-efficiency light-emitting diodes, platform fabrication of biological and environmental monitoring, and high-contrast imaging.

  12. Electroless Ag coating of fly ash cenospheres using polyaniline activator

    Science.gov (United States)

    Wang, Wei; Li, Qin; Li, Ying; Xu, Hui; Zhai, Jianping

    2009-11-01

    The electroless Ag coating of fly ash cenospheres employing polyaniline activator was investigated after polyaniline activator was coated on the surfaces of the cenosphere particles by in situ chemical polymerization. The composites were characterized by scanning electron microscopy, Fourier transform infrared spectroscopy, UV-visible absorption spectroscopy, x-ray diffraction and thermogravimetric analysis (TGA). The results indicate that a small amount of polyaniline activator was deposited in a discontinuous way on the surfaces of the cenosphere particles. Due to the activation of polyaniline, relatively compact and continuous Ag layer with a thickness of about 4 µm was obtained under the given electroless plating condition. The possible interaction between polyaniline and silver ions and the mechanism of Ag deposition were also investigated by the x-ray photoelectron spectroscopy technique.

  13. Electroless Ag coating of fly ash cenospheres using polyaniline activator

    Energy Technology Data Exchange (ETDEWEB)

    Wang Wei; Li Qin; Li Ying; Xu Hui; Zhai Jianping, E-mail: jpzhai@nju.edu.c [State Key Laboratory of Pollution Control and Resource Reuse, and School of the Environment, Nanjing University, Nanjing 210093 (China)

    2009-11-07

    The electroless Ag coating of fly ash cenospheres employing polyaniline activator was investigated after polyaniline activator was coated on the surfaces of the cenosphere particles by in situ chemical polymerization. The composites were characterized by scanning electron microscopy, Fourier transform infrared spectroscopy, UV-visible absorption spectroscopy, x-ray diffraction and thermogravimetric analysis (TGA). The results indicate that a small amount of polyaniline activator was deposited in a discontinuous way on the surfaces of the cenosphere particles. Due to the activation of polyaniline, relatively compact and continuous Ag layer with a thickness of about 4 {mu}m was obtained under the given electroless plating condition. The possible interaction between polyaniline and silver ions and the mechanism of Ag deposition were also investigated by the x-ray photoelectron spectroscopy technique.

  14. Hollow Au–Ag Alloy Nanorices and Their Optical Properties

    Directory of Open Access Journals (Sweden)

    Keke Yu

    2017-09-01

    Full Text Available Hollow noble metal nanoparticles have excellent performance not only in surface catalysis but also in optics. In this work, the hollow Au–Ag alloy nanorices are fabricated by the galvanic replacement reaction. The dark-field spectrum points out that there is a big difference in the optical properties between the pure Ag nanorices and the hollow alloy nanorices that exhibit highly tunable localized surface plasmon resonances (LSPR and that possess larger radiative damping, which is also indicated by the finite element method. Furthermore, the surface enhanced Raman scattering (SERS and oxidation test indicate that hollow Au–Ag alloy nanorices show good anti-oxidation and have broad application prospects in surface-plasmon-related fields.

  15. Object-oriented programming techniques for the AGS Booster

    Energy Technology Data Exchange (ETDEWEB)

    Skelly, J.F.

    1991-12-31

    The applications software developed for the control system of the AGS Booster Project was written in the object-oriented language, C++. A the start of the Booster Project, the programming staff of the AGS Controls Section comprised some dozen programmer/analysts, all highly fluent in C but novices in C++. During the coarse of this project, nearly the entire staff converted to using C++ for a large fraction of their assignments. Over 100 C++ software modules are now available for Booster and general AGS use, of which a large fraction are broadly applicable tools. The transition from C to C++ from a managerial perspective is discussed and an overview is provided of the ways in which object classes have been applied in Booster software development.

  16. Coverage dependence of the structure of tetracene on Ag(110)

    Energy Technology Data Exchange (ETDEWEB)

    Huang Han; Song Fei; Lu Bin; Zhang Hanjie; Dou Weidong; Li Haiyang; He Pimo; Bao Shining [Physics Department, Zhejiang University, Hangzhou 310027 (China); Chen Qiao [Department of Chemistry, School of Life Sciences, University of Sussex, Falmer, Brighton BN1 9QJ (United Kingdom); Zhou Wuzong [School of Chemistry, University of St Andrews, St Andrews KY16 9ST (United Kingdom)], E-mail: phybao@zju.edu.cn, E-mail: qiao.chen@sussex.ac.uk

    2008-08-06

    The ordered adsorption structures of tetracene on Ag(110) have been studied by low energy electron diffraction (LEED), scanning tunneling microscopy (STM) and density functional theory (DFT) calculations. At a low coverage, as calibrated with LEED, both p(4 x 4) and c(8 x 4) ordered structures are simultaneously formed on an Ag(110) surface at room temperature. STM images suggest the molecular plane is parallel to the Ag surface with its long molecular axis aligned along the [001] azimuth. DFT optimization reveals a separation of 0.3 nm between the molecular plane and substrate surface while the center of the tetracene molecule is on the long bridge site. Increasing coverage slightly, a ({sub 2}{sup 6} {sub 5}{sup 2}) structure is formed while the adsorbed molecules maintain the flat-lying geometry with adjacent molecules alternating their height relative to the surface.

  17. Thermal Behavior of Ag Micro/Nano Wires Formed by Low-Temperature Sintering of Ag Nanoparticles

    Science.gov (United States)

    Wang, Wen; Zhong, Yinghui; Li, Dongxue; Wang, Pan; Cai, Yuwei; Duan, Zhiyong

    2015-12-01

    Ag nanoparticles of 30 nm size were deposited onto a Si substrate to form Ag microwires. The nanoparticles were transformed into continuous Ag wires with low-temperature heat treatment at temperatures not higher than 200°C. The morphology, electrical properties, and interface of the sintered Ag nanoparticle wires are described. It is shown that the neck between the nanoparticles begins to form at 150°C, and obvious metallization was found at 170°C. The changes of the crystal structure of the Ag wires at different sintering temperatures were analyzed by x-ray diffractometry. The grain boundary resistance decreased as the crystal grain size increased above 130 nm. The corresponding resistivity of the microstructure is close to that of the bulk. Through the comparison between the Mayadas-Shatzkes's model and experimental data, the range of the grain boundary reflection coefficient C at different temperatures is obtained. This research lays the foundation for the study of nanoimprint lithography with a pseudoplastic metal nanoparticle fluid.

  18. Optical nano-structuring in light-sensitive AgCl-Ag waveguide thin films: wavelength effect.

    Science.gov (United States)

    Talebi, Razieh; Nahal, Arashmid; Bashouti, Muhammad Y; Christiansen, Silke H

    2014-12-15

    Irradiation of photosensitive thin films results in the nanostructures formation in the interaction area. Here, we investigate how the formation of nanostructures in photosensitive waveguide AgCl thin films, doped by Ag nanoparticles, can be customized by tuning the wavelength of the incident beam. We found, silver nanoparticles are pushed towards the interference pattern minima created by the interference of the incident beam with the excited TEn-modes of the AgCl-Ag waveguide. The interference pattern determines the grating constant of the resulting spontaneous periodic nanostructures. Also, our studies indicate a strong dependence of the shape and size distribution of the formed Ag nano-coalescences on the wavelength of the incident beam. It also influences on the surface coverage of the sample by the formed silver nanoparticles and on period of the self-organized nano-gratings. It is found, exposure time and intensity of the incident light are the most determinant parameters for the quality and finesse of our nanostructures. More intense incident light with shorter exposure time generates more regular nanostructures with smaller nano-coalescences and, produces gratings with higher diffraction efficiency. At constant intensity longer exposure time produces more complete nanostructures because of optical positive feedback. We observed exposure with longer wavelength produces finer gratings.

  19. One pot green synthesis of Ag, Au and Au-Ag alloy nanoparticles using isonicotinic acid hydrazide and starch.

    Science.gov (United States)

    Malathi, Sampath; Ezhilarasu, Tamilarasu; Abiraman, Tamilselvan; Balasubramanian, Sengottuvelan

    2014-10-13

    Gold-silver alloy nanoparticles were synthesized via chemical reduction of varying mole fractions of chloroauric acid (HAuCl4) and silver nitrate (AgNO3) by environmentally benign isonicotinic acid hydrazide (INH) in the presence of starch as a capping agent in aqueous medium. The absorption spectra of Au-Ag nanoparticles show blue shift with increasing silver content indicating the formation of alloy nanoparticles. When the Ag content in the alloy decreases the size of the nanoparticles increases and as a result of which the oxidation potential also increases. The emission maximum undergoes a red shift from 443 to 614 nm. The nanoparticles are monodisperse and spherical with an average particle size of 3-18 nm. The catalytic behavior of alloy nanoparticles indicate that the rate constant for the reduction of 4-nitro phenol to 4-amino phenol increases exponentially from metallic Ag to metallic Au as Au content increases in the Au-Ag alloy nanoparticles. Copyright © 2014 Elsevier Ltd. All rights reserved.

  20. Breaking tolerance in hepatitis B surface antigen (HBsAg) transgenic mice by vaccination with cross-reactive, natural HBsAg variants

    DEFF Research Database (Denmark)

    Schirmbeck, Reinhold; Dikopoulos, Nektarios; Kwissa, Marcin

    2003-01-01

    Processing exogenous hepatitis B surface antigen (HBsAg) of the hepatitis B virus (HBV) generates the K(b)-binding S(208-215) epitope 1; processing endogenous HBsAg generates the K(b)-binding S(190-197) epitope 2. Cross-reactive CD8(+) T cell responses were primed to epitope 1 but not epitope 2......-tg mice by HBsAg(adw2); these specific CD8(+) T cells cross-reacted with epitope 1 processed from the transgene-encoded HBsAg(ayw). The liver of vaccinated HBsAg(ayw) transgenic mice showed severe histopathology and contained functional (IFNgamma-producing), cross-reactive CD8(+) T cells, and vaccinated...... HBs-tg mice showed reduced antigenemia. Hence, vaccination with natural HBsAg variants from different HBV sero/genotypes can prime cross-reactive, specific CD8(+) T cell immunity that breaks tolerance to HBsAg....

  1. Nanoscale Wire Bonding of Individual Ag Nanowires on Au Substrate at Room Temperature

    Science.gov (United States)

    Peng, Peng; Guo, Wei; Zhu, Ying; Liu, Lei; Zou, Guisheng; Zhou, Y. Norman

    2017-07-01

    The controllable wire bonding of individual Ag nanowires onto a Au electrode was achieved at room temperature. The plastic deformation induced by pressure using nanoindentation could break the protective organic shell on the surface of the Ag nanowires and cause atomic contact to promote the diffusion and nanojoining at the Ag and Au interface. Severe slip bands were observed in the Ag nanowires after the deformation. A metallic bond was formed at the interface, with the Ag diffusing into the Au more than the Au diffused into the Ag. This nanoscale wire bonding might present opportunities for nanoscale packaging and nanodevice design.

  2. Primary immunization-like response without hepatitis following transfusion of HBeAg-positive blood

    DEFF Research Database (Denmark)

    Gluud, C; Aldershvile, J; Kryger, P

    1983-01-01

    An accidental transfusion of hepatitis B surface antigen (HBsAg) and hepatitis B e antigen (HBeAg) positive whole blood was given to a 19-yr-old male, bleeding after tonsillectomy. Serum obtained from the patient before the transfusion revealed no hepatitis B antigens or antibodies. After...... the transfusion the patient became HBsAg-positive, cleared this antigen and developed antibodies to both HBsAg and HBeAg. The transfusion blood was positive for total antibody and IgM antibody to hepatitis B core antigen (HBcAg). The patient's blood became positive for these antibodies after the transfusion...

  3. Nanocrystalline Ag microflowers as a versatile SERS platform

    Science.gov (United States)

    Mettela, Gangaiah; Siddhanta, Soumik; Narayana, Chandrabhas; Kulkarni, Giridhar U.

    2014-06-01

    In this paper, the synthesis of Ag microflowers for use as manipulable and reusable substrates in surface enhanced Raman spectroscopy (SERS) is demonstrated, working with ultra-low volumes of the analyte. Flower-like AgBr crystallites with a growth direction of were first obtained by thermolysing a complex obtained by the stabilization of (AgCl2)- anions with tetraoctylammonium bromide. NaBH4 reduction leads to the formation of porous Ag microflowers (50-100 μm) with interconnected nanoparticles. The coupling of the nanoparticles in the microflower results in broadband extinction from visible to IR wavelengths, facilitating SERS using both red and green wavelengths. Using thiophenol as test analyte, uniform SERS enhancement factors in the range of 106-108 have been achieved from different parts of the microflower. The microflowers have been used for labeled and non-labeled detection of both single- and double-stranded DNA and using simple manipulation techniques, SERS data have been collected from ultra-low volumes of the analyte solution (~0.34 nL). The reusability of the substrate for SERS over multiple cycles involving a rapid and efficient wet chemical cleaning procedure is also demonstrated. Finally, by placing the microflower in a microfluidic device, chemical reactions have been examined in situ.In this paper, the synthesis of Ag microflowers for use as manipulable and reusable substrates in surface enhanced Raman spectroscopy (SERS) is demonstrated, working with ultra-low volumes of the analyte. Flower-like AgBr crystallites with a growth direction of were first obtained by thermolysing a complex obtained by the stabilization of (AgCl2)- anions with tetraoctylammonium bromide. NaBH4 reduction leads to the formation of porous Ag microflowers (50-100 μm) with interconnected nanoparticles. The coupling of the nanoparticles in the microflower results in broadband extinction from visible to IR wavelengths, facilitating SERS using both red and green wavelengths

  4. Thermal spin transfer torque in Fe|Ag|YIG multilayers

    Science.gov (United States)

    Tang, Hui-Min; Jia, Xing-Tao; Wang, Shi-Zhuo

    2017-06-01

    We investigated the thermal spin transfer effect in FM|NM|YIG multilayers using the first principles scattering theory. At room temperature, the spin Seebeck torque T SSE 1:0 μJ/(K·m2) in an Ag|Fe|Ag|YIG multilayer, which is around 40% larger than that estimated from mixing conductance. The quantum effects such as interlayer exchange coupling between FM and YIG could be responsible for the enhancements. Based on the LLG equation, we predict that a temperature bias of 10 K can reverse the magnetic configurations, circularly, in a multilayer at room temperature.

  5. First principle study of PEO-AgI polymer systems

    Science.gov (United States)

    Rao, B. Keshav; Verma, Mohan L.

    2017-07-01

    First principle calculations based on density functional theory is performed to analyze cation (Ag+) conductivity in polyethylene oxide (PEO) based systems. The relaxed polymer structures are simulated, bond lengths and the charge density distributions around interacting atoms provides the strong bonding nature between higher electro-negative oxygen and silver atoms. Projected density of states and density of states explain s-p hybridization between orbitals, to increase in cation concentration in polymer systems, to reduce in the forbidden energy gap and to increase the ionic conductivity due to gradual increase the number of dispersing AgI molecules in polymer systems.

  6. Soil type influence on Ag Nanoparticles by earthworms, Eisenia fetida

    DEFF Research Database (Denmark)

    Mariyadas, Jennifer; Mónica, Amorim; Scott-Fordsmand, Janeck James

    2014-01-01

    Earthworms are key sentinel organisms playing an important role in improving the soil structure. Here we tested the importance of soil type on the toxicity to silver nanoparticles (Ag NPs) to earthworms, Eisenia fetida. Silver nanoparticles are widely used in a range of consumer products mainly...... matter content, clay and cation exchange capacity along with the metal solution activity will provide insight into the bioavailability of metals in different soils, hence For each of the soil type the fate of the AgNPs was also measured....

  7. Partitions of AG(4,3) into Maximal Caps

    OpenAIRE

    Follett, Michael; Kalail, Kyle; McMahon, Elizabeth; Pelland, Catherine; Won, Robert

    2013-01-01

    In a geometry, a maximal cap is a collection of points of largest size containing no lines. In AG(4,3), maximal caps contain 20 points. The 81 points of AG(4,3) can be partitioned into 4 mutually disjoint maximal caps together with a single point P, where every pair of points that makes a line with P lies entirely inside one of those caps. The caps in a partition can be paired up so that both pairs are either in exactly one partition or they are both in two different partitions. This differen...

  8. Synthesis of AgBr/Ag{sub 4}P{sub 2}O{sub 7} composite photocatalyst and enhanced photocatalytic performance

    Energy Technology Data Exchange (ETDEWEB)

    Song, Limin; Li, Yamiao; Tian, Haifeng [College of Environment and Chemical Engineering and State Key Laboratory of Hollow-Fiber Membrane Materials and Membrane Processes, Tianjin Polytechnic University, No. 399 Binshuixidao Street, Xiqing District, Tianjin 300387 (China); Wu, Xiaoqing [Institute of Composite Materials, Tianjin Polytechnic University, No. 399 Binshuixidao Street, Xiqing District, Tianjin 300387 (China); Fang, Sheng [College of Environment and Chemical Engineering and State Key Laboratory of Hollow-Fiber Membrane Materials and Membrane Processes, Tianjin Polytechnic University, No. 399 Binshuixidao Street, Xiqing District, Tianjin 300387 (China); Zhang, Shujuan, E-mail: songlmnk@sohu.com [College of Science, Tianjin University of Science and Technology, No. 29 Shisan Street, Kaifa District, Tianjin 300457 (China)

    2014-11-15

    Highlights: • Ag{sub 4}P{sub 2}O{sub 7} can be used in photocatalytic degradation of dyes. • AgBr/Ag{sub 4}P{sub 2}O{sub 7} shows higher activity under visible light irradiation. • The kinetics of activity and enhanced photocatalytic mechanism were analyzed. - Abstract: Ag{sub 4}P{sub 2}O{sub 7} and AgBr/Ag{sub 4}P{sub 2}O{sub 7} photocatalysts were synthesized by a simple precipitation reaction, and their structures were characterized by X-ray powder diffraction, scanning electronic microscopy, Brunauer–Emmett–Teller surface area analysis, X-ray photoemission spectroscopy, UV–vis absorption spectroscopy, photoluminescence, and surface photovoltage techniques. Photocatalytic degradations of methylene blue over Ag{sub 4}P{sub 2}O{sub 7} and AgBr/Ag{sub 4}P{sub 2}O{sub 7} were also studied under visible light irradiation. AgBr/Ag{sub 4}P{sub 2}O{sub 7} exhibited excellent photocatalytic efficiency, with the activity higher than that of Ag{sub 4}P{sub 2}O{sub 7}. The band gap and valence band of Ag{sub 4}P{sub 2}O{sub 7} were 2.67 eV and 1.93 eV, respectively. Ag{sub 4}P{sub 2}O{sub 7} failed to produce ·OH radicals by directly oxidizing OH{sup −} because the oxidation potential of OH{sup −} was 2.7 eV. Therefore, electrons excited by light reacted with O{sub 2} to produce ·O{sub 2}{sup −} radicals that then formed ·OH radicals. Finally, ·OH radicals oxidized MB molecules. The matching energy bands of Ag{sub 4}P{sub 2}O{sub 7} and AgBr in the AgBr/Ag{sub 4}P{sub 2}O{sub 7} heterocatalysts effectively separated the photo-induced charges, which may enhance the photocatalytic activity of Ag{sub 4}P{sub 2}O{sub 7}.

  9. Synthesis and characterization of Ag-containing calcium phosphates with various Ca/P ratios.

    Science.gov (United States)

    Gokcekaya, Ozkan; Ueda, Kyosuke; Narushima, Takayuki; Ergun, Celaletdin

    2015-08-01

    Ag-containing calcium phosphate (CaP) powders were synthesized by a precipitation method using aqueous solutions of calcium nitrate, silver nitrate, and ammonium phosphate. The powders were sintered at temperatures ranging from 1173 to 1473 K. The charged atomic ratios of (Ca+Ag)/P and Ag/(Ca+Ag) in solution were varied from 1.33 to 1.67 and from 0 to 0.30, respectively. The Ag content in the as-precipitated CaP powders increased with the charged Ag/(Ca+Ag) atomic ratio in solution and was lower than the charged Ag/(Ca+Ag) value. The as-precipitated CaP powders consisted of hydroxyapatite (HA) as the main phase. Ag nanoparticles were observed on the as-precipitated HA particles under all conditions of Ag addition. After the sintering, HA, β-TCP (tricalcium phosphate), α-TCP, and β-CPP (calcium pyrophosphate) were mainly detected as CaPs on the basis of the Ca/P atomic ratio of the as-precipitated powders. The addition of Ag stabilized the β-TCP phase, and the distribution of Ag in β-TCP was homogeneous. A metallic Ag phase coexisted with HA. The solubility of Ag in HA was estimated to be 0.0019-0.0061 (Ag/(Ca+Ag)) atomic ratio, which was lower than that in β-TCP (higher than 0.0536) and higher than that of β-CPP (below the detection limit of analyses). Copyright © 2015 Elsevier B.V. All rights reserved.

  10. Controllable Charge Transfer in Ag-TiO2 Composite Structure for SERS Application

    Directory of Open Access Journals (Sweden)

    Yaxin Wang

    2017-06-01

    Full Text Available The nanocaps array of TiO2/Ag bilayer with different Ag thicknesses and co-sputtering TiO2-Ag monolayer with different TiO2 contents were fabricated on a two-dimensional colloidal array substrate for the investigation of Surface enhanced Raman scattering (SERS properties. For the TiO2/Ag bilayer, when the Ag thickness increased, SERS intensity decreased. Meanwhile, a significant enhancement was observed when the sublayer Ag was 10 nm compared to the pure Ag monolayer, which was ascribed to the metal-semiconductor synergistic effect that electromagnetic mechanism (EM provided by roughness surface and charge-transfer (CT enhancement mechanism from TiO2-Ag composite components. In comparison to the TiO2/Ag bilayer, the co-sputtered TiO2-Ag monolayer decreased the aggregation of Ag particles and led to the formation of small Ag particles, which showed that TiO2 could effectively inhibit the aggregation and growth of Ag nanoparticles.

  11. Polyester fabric coated with Ag/ZnO composite film by magnetron sputtering

    Energy Technology Data Exchange (ETDEWEB)

    Yuan, Xiaohong, E-mail: yxhong1981_2004@126.com [Key Laboratory of Eco-Textiles, Ministry of Education, Jiangnan University, Wuxi 214122, Jiangsu (China); Faculty of Clothing and Design, Minjiang University, Fuzhou 350121, Fujian (China); Xu, Wenzheng, E-mail: xwz8199@126.com [Key Laboratory of Eco-Textiles, Ministry of Education, Jiangnan University, Wuxi 214122, Jiangsu (China); Huang, Fenglin, E-mail: windhuang325@163.com [Key Laboratory of Eco-Textiles, Ministry of Education, Jiangnan University, Wuxi 214122, Jiangsu (China); Chen, Dongsheng, E-mail: mjuchen@126.com [Faculty of Clothing and Design, Minjiang University, Fuzhou 350121, Fujian (China); Wei, Qufu, E-mail: qfwei@jiangnan.edu.cn [Key Laboratory of Eco-Textiles, Ministry of Education, Jiangnan University, Wuxi 214122, Jiangsu (China)

    2016-12-30

    Highlights: • Ag/ZnO composite film was successfully deposited on polyester fabric by magnetron sputtering technique. • Ag film was easily oxidized into Ag{sub 2}O film in high vacuum oxygen environment. • The zinc film coated on the surface of Ag film before RF reactive sputtering could protect the silver film from oxidation. • Polyester fabric coated with Ag/ZnO composite film can obtained structural color. • The anti-ultraviolet and antistatic properties of polyester fabric coated with Ag/ZnO composite film all were good. - Abstract: Ag/ZnO composite film was successfully deposited on polyester fabric by using direct current (DC) magnetron sputtering and radio frequency (RF) magnetron reaction sputtering techniques with pure silver (Ag) and zinc (Zn) targets. X-ray photoelectron spectroscopy (XPS) and X-ray diffraction (XRD) were used to examine the deposited film on the fabric. It was found that the zinc film coated on Ag film before RF reactive sputtering could protect the silver film from oxidation. Anti-ultraviolet property and antistatic property of the coated samples using different magnetron sputtering methods were also investigated. The experimental results showed that Ag film was oxidized into in Ag{sub 2}O film in high vacuum oxygen environment. The deposition of Zn film on the surface of the fabric coated with Ag film before RF reactive sputtering, could successfully obtained Ag/ZnO composite film, and also generated structural color on the polyester fabric.

  12. Effects of Bi Addition on the Microstructure and Mechanical Properties of Nanocrystalline Ag Coatings

    Directory of Open Access Journals (Sweden)

    Yuxin Wang

    2017-08-01

    Full Text Available In this study we investigated the effects of Bi addition on the microstructure and mechanical properties of an electrodeposited nanocrystalline Ag coating. Microstructural features were investigated with transmission electron microscopy (TEM. The results indicate that the addition of Bi introduced nanometer-scale Ag-Bi solid solution particles and more internal defects to the initial Ag microstructures. The anisotropic elastic-plastic properties of the Ag nanocrystalline coating with and without Bi addition were examined with nanoindentation experiments in conjunction with the recently-developed inverse method. The results indicate that the as-deposited nanocrystalline Ag coating contained high mechanical anisotropy. With the addition of 1 atomic percent (at% Bi, the anisotropy within Ag-Bi coating was very small, and yield strength of the nanocrystalline Ag-Bi alloy in both longitudinal and transverse directions were improved by over 100% compared to that of Ag. On the other hand, the strain-hardening exponent of Ag-Bi was reduced to 0.055 from the original 0.16 of the Ag coating. Furthermore, the addition of Bi only slightly increased the electrical resistivity of the Ag-Bi coating in comparison to Ag. Results of our study indicate that Bi addition is a promising method for improving the mechanical and physical performances of Ag coating for electrical contacts.

  13. The irradiation influence on the properties of silver sulfide (Ag2S) colloidal nanoparticles

    Science.gov (United States)

    Rempel, S. V.; Kuznetsova, Yu. V.; Gerasimov, E. Yu.; Rempel', A. A.

    2017-08-01

    The aqueous solutions of different stability containing silver sulfide (Ag2S) nanoparticles are studied. The stable, transparent, and turbid solutions have been subjected to daylight for 7 months, to ultraviolet and laser irradiation, as well as to an electron beam. Solar radiation is found to favor the Ag2S reduction to Ag and/or the formation of Ag2S/Ag hybrid nanoparticles in the solution. At a high amount of hybrid nanoparticles, the exciton-plasmon interaction causes asymmetry in the absorption spectra. The exposure of Ag2S particles precipitated from the solution with the electron beam leads to the reversible growth of Ag threads. The possible exciton-plasmon interplay mechanisms in Ag2S/Ag hybrid nanoparticles are considered. The physical mechanisms of the changing Ag2S stoichiometry, the formation of metallic Ag and Ag2S/Ag hybrid nanoparticles are the generation of hot carriers and the energy transfer (exciton-plasmon interaction) in a metal-semiconductor hybrid nanosystem are elucidated, as well.

  14. Brookhaven Nursing Home, Donaghmore, Ballyraggett, Kilkenny.

    LENUS (Irish Health Repository)

    Harrington, Deirdre M.

    2011-10-28

    Abstract Background Adolescent females have been highlighted as a particularly sedentary population and the possible negative effects of a sedentary lifestyle are being uncovered. However, much of the past sedentary research is based on self-report or uses indirect methods to quantity sedentary time. Total time spent sedentary and the possible intricate sedentary patterns of adolescent females have not been described using objective and direct measure of body inclination. The objectives of this article are to examine the sedentary levels and patterns of a group of adolescent females using the ActivPAL™ and to highlight possible differences in sedentary levels and patterns across the week and within the school day. A full methodological description of how the data was analyzed is also presented. Methods One hundred and eleven adolescent females, age 15-18 yrs, were recruited from urban and rural areas in the Republic of Ireland. Participants wore an ActivPAL physical activity monitor for a 7.5 day period. The ActivPAL directly reports total time spent sitting\\/lying every 15 seconds and accumulation (frequency and duration) of sedentary activity was examined using a customized MATLAB ® computer software programme. Results While no significant difference was found in the total time spent sitting\\/lying over the full 24 hour day between weekday and weekend day (18.8 vs. 18.9 hours; p = .911), significantly more sedentary bouts of 1 to 5 minutes and 21 to 40 minutes in duration were accumulated on weekdays compared to weekend days (p < .001). The mean length of each sedentary bout was also longer (9.8 vs. 8.8 minutes; p < .001). When school hours (9 am-3 pm) and after school hours (4 pm-10 pm) were compared, there was no difference in total time spent sedentary (3.9 hours; p = .796) but the pattern of accumulation of the sedentary time differed. There were a greater number of bouts of > 20 minutes duration during school hours than after school hours (4.7 vs. 3.5 bouts; p < .001) while after school time consisted of shorter bouts < 20 minutes. Conclusions School is highlighted as a particularly sedentary setting for adolescent females. Interventions to decrease sedentary time at school and the use of wearable devices which distinguish posture should be encouraged when examining sedentary patterns and behaviors in this population.

  15. Brookhaven highlights, July 1976-September 1978

    Energy Technology Data Exchange (ETDEWEB)

    1979-11-01

    Some of the most significant research accomplishments during this 27-month period are presented. Although some data are given, this report is primarily descriptive in outlook; detailed information on completed work should be sought from the references cited herein or from the usual sources of physics research information. The report is organized as follows: High-energy Physics (general introduction, physics research, accelerators, ISABELLE); Nuclear and Solid State Physics, and Chemistry; Life Sciences (biology, medicine); Applied Energy Science (energy and the environment, reactor systems and safety, National Nuclear Data Center, nuclear materials safeguards); Support Activities (applied mathematics, instrumentation, reactors, safety and environmental protection); and General and Administrative. 117 figures, 16 tables, 315 references. (RWR)

  16. Submonolayer nucleation and growth and the initial stage of multilayer kinetic roughening during Ag/Ag (100) homoepitaxy

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, C.

    1996-08-01

    A comprehensive Scanning Tunneling Microscopy (STM) study of submonolayer nucleation and growth of 2D islands in Ag/Ag(100) homoepitaxy for temperature between 295K and 370K is presented. The initial stages of multilayer kinetic roughening is also studied. Analysis of an appropriate model for metal (100) homoepitaxy, produces estimates of 350 meV for the terrace diffusion barrier, 400 meV for the adatom bond energy, and 25 meV for the additional Ehrlich-Schwoebel step-edge barrier.

  17. Relining pipes in the Stadtwerke Chemnitz AG district heating network; Rohrrelining im Fernwaermenetz der Stadtwerke Chemnitz AG. Flexwell-Fernheizkabel

    Energy Technology Data Exchange (ETDEWEB)

    Baumgart, G. [Stadtwerke Chemnitz AG (Germany)

    2003-04-01

    The pipe relining procedure was used successfully by Stadtwerke Chemnitz AG during renovation of a preinsulated bonded pipe. The profitability analysis showed that partial insertion of a Flexwell pipe into the existing media pipe of the preinsulated bond pipe was the most effective procedure. The cost saving compared to other methods is due to a greatly reduced construction requirement. (orig.) [German] Zur Sanierung einer Fernwaermetrasse setzte die Stadtwerke Chemnitz AG das Verfahren des Rohrrelining ein. Damit konnte eine technisch anspruchsvolle und wirtschaftlich sinnvolle Erneuerung der Fernwaermetrasse in sehr kurzer Zeit realisiert werden. Der Autor beschreibt das Verfahren, die notwendigen vorbereitenden Massnahmen und die Erfahrungen bei der Baudurchfuehrung. (orig.)

  18. ZnWO{sub 4} nanorods decorated with Ag/AgBr nanoparticles as highly efficient visible-light-responsive photocatalyst for dye AR18 photodegradation

    Energy Technology Data Exchange (ETDEWEB)

    Li, Kebin, E-mail: kebinlee314@gmail.com [College of Chemistry and Material Science, Key Laboratory of Synthetic and Natural Function Molecule Chemistry of Ministry of Education, Northwest University, Xi’an 710069 (China); Xue, Jie; Zhang, Yanhui [College of Chemistry and Material Science, Key Laboratory of Synthetic and Natural Function Molecule Chemistry of Ministry of Education, Northwest University, Xi’an 710069 (China); Wei, Hong [Key Laboratory of Northwest Water Resources, Environment and Ecology, Ministry of Education, Xi’an University of Technology, Xi’an 710048 (China); Liu, Yalan; Dong, Chengxing [College of Chemistry and Material Science, Key Laboratory of Synthetic and Natural Function Molecule Chemistry of Ministry of Education, Northwest University, Xi’an 710069 (China)

    2014-11-30

    Graphical abstract: - Highlights: • Ag/AgBr-sensitized ZnWO{sub 4} nanorod heterojunction was fabricated and characterized. • The composite showed the enhanced visible-light activity for AR18 photodegradation. • The enhancement mechanism and the catalytic degradation mechanism were revealed. • The effects of various parameters on AR18 photodegradation kinetics were examined. - Abstract: A novel Ag-AgBr/ZnWO{sub 4} nanorod heterostructure composite was prepared via a facile deposition–precipitation method with ZnWO{sub 4} nanorods as the substrate, and characterized by XRD, SEM-EDX, TEM, XPS, and DRS to confirm its structure, morphology, composition, and optical property. The composite was used as a photocatalyst to destroy azo dye Acid Red 18 (AR18) under visible light irradiation. The effects of catalyst composition, solution pH, catalyst loading, and initial dye concentration on photocatalytic degradation rate and efficiency were examined. It was revealed that the photocatalytic activity of Ag-AgBr/ZnWO{sub 4} nanojunction system was higher than that of the single ZnWO{sub 4} or Ag-AgBr for AR18 degradation under visible light irradiation. The optimal content of Ag-AgBr in Ag-AgBr/ZnWO{sub 4} composite was 0.58:1 of Ag/W molar ratio using in the catalyst preparation. Acid pH and decreasing dye initial concentration were favorable to AR18 photodegradation, but the catalyst loading had an optimal value. The catalyst was stable and recyclable, after five successive cycles the photoactivity was fully maintained and the XRD patterns of AgBr displayed no evident change. Photoluminescence spectra revealed the enhanced photocatalytic activity and stability were closely related to the efficient separation of photogenerated carriers in Ag-AgBr/ZnWO{sub 4} nanojunction system. Superoxide radicals and holes were found to be main active species for AR18 photodegradation. Finally, the possible mechanism for AR18 degradation over Ag-AgBr/ZnWO{sub 4} nanorods under

  19. Self-regulated route to ternary hybrid nanocrystals of Ag-Ag2S-CdS with near-infrared photoluminescence and enhanced photothermal conversion

    Science.gov (United States)

    Zhu, Guoxing; Bao, Chunlin; Liu, Yuanjun; Shen, Xiaoping; Xi, Chunyan; Xu, Zheng; Ji, Zhenyuan

    2014-09-01

    Developing hybrid nanocrystals is a hot topic in materials science. Herein, a ternary hybrid nanocrystal, Ag-Ag2S-CdS, combining near infrared emission and photothermal conversion properties was demonstrated. The ternary Ag-Ag2S-CdS hybrid nanocrystals with cubic shape and uniform size were synthesized by a simple one-pot and one-step colloidal method. The growth process is self-regulated with the formation order of Ag2S, Ag, and CdS, sequentially. The formation of Ag originates from the partial reduction of Ag2S, while the formation of CdS is through an Ag2S catalytic mechanism based on its superionic feature. The obtained ternary hybrid nanocrystals show near infrared emission and photothermal conversion properties in a lab-on-a-particle system. Importantly, an enhanced effect is observed for the photothermal conversion, which is mainly due to the presence of heterointerfaces among the crystals. This work will not only advance the synthesis chemistry of multi-component hybrid nanocrystals but also provide a possible route for the design of advanced multi-model materials used in bio-related fields.Developing hybrid nanocrystals is a hot topic in materials science. Herein, a ternary hybrid nanocrystal, Ag-Ag2S-CdS, combining near infrared emission and photothermal conversion properties was demonstrated. The ternary Ag-Ag2S-CdS hybrid nanocrystals with cubic shape and uniform size were synthesized by a simple one-pot and one-step colloidal method. The growth process is self-regulated with the formation order of Ag2S, Ag, and CdS, sequentially. The formation of Ag originates from the partial reduction of Ag2S, while the formation of CdS is through an Ag2S catalytic mechanism based on its superionic feature. The obtained ternary hybrid nanocrystals show near infrared emission and photothermal conversion properties in a lab-on-a-particle system. Importantly, an enhanced effect is observed for the photothermal conversion, which is mainly due to the presence of

  20. Seven-Year Treatment Outcome of Entecavir in a Real-World Cohort: Effects on Clinical Parameters, HBsAg and HBcrAg Levels.

    Science.gov (United States)

    Lam, Yuk-Fai; Seto, Wai-Kay; Wong, Danny; Cheung, Ka-Shing; Fung, James; Mak, Lung-Yi; Yuen, John; Chong, Chun-Kong; Lai, Ching-Lung; Yuen, Man-Fung

    2017-10-26

    We aimed to determine the levels of alanine aminotransferase (ALT), hepatitis B virus DNA (HBV DNA), HBsAg, and a novel viral marker (hepatitis B core-related antigen (HBcrAg)); hepatitis B e antigen (HBeAg) seroconversion and drug resistance rates after 7 years of entecavir treatment in chronic hepatitis B (CHB) patients. Two hundred and twenty-two Chinese CHB patients on continuous entecavir treatment were recruited. Serologic, virologic, biochemical outcomes, and the occurrence of entecavir signature mutations were determined. The rates of ALT normalization, HBeAg seroconversion, and undetectable HBV DNA were 98.3%, 82.1%, and 98.7%, respectively, after 7 years of entecavir treatment. The genotypic resistance rate was 1.2%. Decline of HBsAg level was modest with a median decline rate of 0.107 log IU/ml/year. Among patients with baseline HBsAg <1,000 IU/ml and annual HBsAg decline rate of ≥0.166 log IU/ml, all have HBsAg of <200 IU/ml (a level highly predictive for HBsAg seroclearance) at year 7. In contrast, in patients with baseline HBsAg ≥1,000 IU/ml and annual HBsAg decline rate of <0.166 log IU/ml, 95.5% had HBsAg of ≥200 IU/ml at year 7. Decline of HBcrAg levels was moderate with a median decline rate of 0.244 log kU/ml/year. Forty-seven patients (32.0%) had undetectable HBcrAg level at year 7. Long-term entecavir therapy continued to have good responses with low drug resistance rate. However, the decline of HBsAg with treatment was suboptimal. HBcrAg level declined at a relatively better rate. Baseline HBsAg level of <1,000 IU/ml and annual decline of 0.166 log IU/ml could be used to predict HBsAg response.

  1. Visible-light photoactive Ag-AgBr/α-Ag3VO4 nanostructures prepared in a water-soluble ionic liquid for degradation of wastewater

    Science.gov (United States)

    Padervand, Mohsen

    2016-11-01

    Ag-AgBr/α-Ag3VO4 photocatalysts, prepared by an ionic liquid-assisted precipitation method, were used as an efficient visible light-driven photocatalytic system for removal of wastewater and pathogenic bacteria from the aqueous medium. X-ray diffraction powder, diffuse reflectance spectroscopy, Fourier transform infrared, scanning electron microscopy, and nitrogen adsorption-desorption isotherm (BET) analysis methods were used to characterize the nanostructures. Photodegradation mechanism was investigated and the results showed that the prepared samples were too efficient for the degradation of Acid Blue 92 (AB92) azo dye, and E. coli cells under visible light. The photogenerated electron-hole pairs reacted with the species in the solution and produced super active radicals such as {{O}}{{{H}}^ \\cdot }, {{H}}{{{O}}^ \\cdot }_{{2}}, and {{{O}}^{ \\cdot - }}_{{2}} which are responsible for the degradation of the environmental pollutions. TEM images were used to clarify the antibacterial activity of the products. Finally, as a practical application of the prepared photocatalysts, their ability evaluated for degradation of a real wastewater sample which was provided from the textile industries.

  2. File list: His.Dig.50.AllAg.Intestine,_Small [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available His.Dig.50.AllAg.Intestine,_Small hg19 Histone Digestive tract Intestine, Small htt...p://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/His.Dig.50.AllAg.Intestine,_Small.bed ...

  3. File list: Unc.Dig.05.AllAg.Intestinal_crypt [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Unc.Dig.05.AllAg.Intestinal_crypt mm9 Unclassified Digestive tract Intestinal crypt... http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Unc.Dig.05.AllAg.Intestinal_crypt.bed ...

  4. Data of evolutionary structure change: 1YDVA-1AG1T [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1YDVA-1AG1T 1YDV 1AG1 A T --RKYFVAANWKCNGTLESIKSLTNSFNNLDFDPSKLDV...EPVWAIGTGKVATPQQAQEAHALIRSWVSSKIGADVAGELRILYGGSVNGKNARTLYQQRDVNGFLVGGASLKPEFVDIIKATQ -- EEEE HH...in> 1YDV A 1YDVA NLDFDPSKLDV 1YDV A 1YDVA

  5. Data of evolutionary structure change: 1YDVA-1AG1O [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1YDVA-1AG1O 1YDV 1AG1 A O --RKYFVAANWKCNGTLESIKSLTNSFNNLDFDPSKLDV...SGAFTGEVSLPILKDFGVNWIVLGHSERRAYYGETNEIVADKVAAAVASGFMVIACIGETLQERESGRTAVVVLTQIAAIAKKLKKADWAKVVIAYEPVWAIGTGKVATPQQAQEAHALIRSWVSSKIGADVA.../index> 1YDV A 1YDVA 1 1YDV A 1YDVA...> CYS CA 492 1YDV A 1YDVA

  6. File list: His.Dig.50.AllAg.Intestinal_adenoma [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available His.Dig.50.AllAg.Intestinal_adenoma mm9 Histone Digestive tract Intestinal adenoma ...http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/His.Dig.50.AllAg.Intestinal_adenoma.bed ...

  7. File list: His.Dig.05.AllAg.Intestinal_crypt [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available His.Dig.05.AllAg.Intestinal_crypt mm9 Histone Digestive tract Intestinal crypt http...://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/His.Dig.05.AllAg.Intestinal_crypt.bed ...

  8. File list: His.Dig.20.AllAg.Intestinal_adenoma [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available His.Dig.20.AllAg.Intestinal_adenoma mm9 Histone Digestive tract Intestinal adenoma ...http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/His.Dig.20.AllAg.Intestinal_adenoma.bed ...

  9. File list: Unc.Dig.10.AllAg.Intestine,_Small [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Unc.Dig.10.AllAg.Intestine,_Small hg19 Unclassified Digestive tract Intestine, Small... http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/Unc.Dig.10.AllAg.Intestine,_Small.bed ...

  10. File list: His.Dig.50.AllAg.Intestine,_Small [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available His.Dig.50.AllAg.Intestine,_Small mm9 Histone Digestive tract Intestine, Small http...://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/His.Dig.50.AllAg.Intestine,_Small.bed ...

  11. File list: Pol.Dig.05.AllAg.Intestine,_Small [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Pol.Dig.05.AllAg.Intestine,_Small hg19 RNA polymerase Digestive tract Intestine, Small... http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/Pol.Dig.05.AllAg.Intestine,_Small.bed ...

  12. File list: His.Dig.05.AllAg.Intestine,_Small [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available His.Dig.05.AllAg.Intestine,_Small mm9 Histone Digestive tract Intestine, Small http...://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/His.Dig.05.AllAg.Intestine,_Small.bed ...

  13. File list: His.Dig.10.AllAg.Intestine,_Small [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available His.Dig.10.AllAg.Intestine,_Small mm9 Histone Digestive tract Intestine, Small http...://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/His.Dig.10.AllAg.Intestine,_Small.bed ...

  14. File list: His.Dig.10.AllAg.Intestine,_Small [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available His.Dig.10.AllAg.Intestine,_Small hg19 Histone Digestive tract Intestine, Small htt...p://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/His.Dig.10.AllAg.Intestine,_Small.bed ...

  15. File list: Unc.Dig.20.AllAg.Intestine,_Small [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Unc.Dig.20.AllAg.Intestine,_Small mm9 Unclassified Digestive tract Intestine, Small... http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Unc.Dig.20.AllAg.Intestine,_Small.bed ...

  16. File list: Unc.Dig.05.AllAg.Intestine,_Small [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Unc.Dig.05.AllAg.Intestine,_Small hg19 Unclassified Digestive tract Intestine, Small... http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/Unc.Dig.05.AllAg.Intestine,_Small.bed ...

  17. File list: Unc.Dig.50.AllAg.Intestine,_Small [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Unc.Dig.50.AllAg.Intestine,_Small mm9 Unclassified Digestive tract Intestine, Small... http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Unc.Dig.50.AllAg.Intestine,_Small.bed ...

  18. File list: Unc.Dig.50.AllAg.Intestine,_Small [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Unc.Dig.50.AllAg.Intestine,_Small hg19 Unclassified Digestive tract Intestine, Small... http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/Unc.Dig.50.AllAg.Intestine,_Small.bed ...

  19. File list: Pol.Dig.20.AllAg.Intestine,_Small [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Pol.Dig.20.AllAg.Intestine,_Small mm9 RNA polymerase Digestive tract Intestine, Small... http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Pol.Dig.20.AllAg.Intestine,_Small.bed ...

  20. File list: Pol.Dig.05.AllAg.Intestine,_Small [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Pol.Dig.05.AllAg.Intestine,_Small mm9 RNA polymerase Digestive tract Intestine, Small... http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Pol.Dig.05.AllAg.Intestine,_Small.bed ...