WorldWideScience

Sample records for bromide specifically inhibits

  1. 4-Bromophenacyl bromide specifically inhibits rhoptry secretion during Toxoplasma invasion.

    Science.gov (United States)

    Ravindran, Sandeep; Lodoen, Melissa B; Verhelst, Steven H L; Bogyo, Matthew; Boothroyd, John C

    2009-01-01

    Toxoplasma gondii is a eukaryotic parasite of the phylum Apicomplexa that is able to infect a wide variety of host cells. During its active invasion process it secretes proteins from discrete secretory organelles: the micronemes, rhoptries and dense granules. Although a number of rhoptry proteins have been shown to be involved in important interactions with the host cell, very little is known about the mechanism of secretion of any Toxoplasma protein into the host cell. We used a chemical inhibitor of phospholipase A2s, 4-bromophenacyl bromide (4-BPB), to look at the role of such lipases in the secretion of Toxoplasma proteins. We found that 4-BPB was a potent inhibitor of rhoptry secretion in Toxoplasma invasion. This drug specifically blocked rhoptry secretion but not microneme secretion, thus effectively showing that the two processes can be de-coupled. It affected parasite motility and invasion, but not attachment or egress. Using propargyl- or azido-derivatives of the drug (so-called click chemistry derivatives) and a series of 4-BPB-resistant mutants, we found that the drug has a very large number of target proteins in the parasite that are involved in at least two key steps: invasion and intracellular growth. This potent compound, the modified "click-chemistry" forms of it, and the resistant mutants should serve as useful tools to further study the processes of Toxoplasma early invasion, in general, and rhoptry secretion, in particular. PMID:19956582

  2. Aclidinium bromide combined with formoterol inhibits remodeling parameters in lung epithelial cells through cAMP.

    Science.gov (United States)

    Lambers, Christopher; Costa, Luigi; Ying, Qi; Zhong, Jun; Lardinois, Didier; Dekan, Gerhard; Schuller, Elisabeth; Roth, Michael

    2015-12-01

    Combined muscarinic receptor antagonists and long acting β2-agonists improve symptom control in chronic obstructive pulmonary disease (COPD) significantly. In clinical studies aclidinium bromide achieved better beneficial effects than other bronchodilators; however, the underlying molecular mechanisms are unknown. This study assessed the effect of aclidinium bromide combined with formoterol on COPD lung (n=20) and non-COPD lung (n=10) derived epithelial cells stimulated with TGF-β1+carbachol on: (i) the generation of mesenchymal cells in relation to epithelial cells, (II) extracellular matrix (ECM) deposition, and (iii) the interaction of ECM on the generation of epithelial and mesenchymal cells. TGF-β1+carbachol enhanced the generation of mesenchymal cells, which was significantly reduced by aclidinium bromide or formoterol. The effect of combined drugs was additive. Inhibition of p38 MAP kinase and Smad by specific inhibitors or aclidinium bromide reduced the generation of mesenchymal cells. In mesenchymal cells, TGF-β1+carbachol induced the deposition of collagen-I and fibronectin which was prevented by both drugs dose-dependently. Formoterol alone reduced collagen-I deposition via cAMP, this however, was overruled by TGF-β1+carbachol and rescued by aclidinium bromide. Inhibition of fibronectin was cAMP independent, but involved p38 MAP kinase and Smad. Seeding epithelial cells on ECM collagen-I and fibronectin induced mesenchymal cell generation, which was reduced by aclidinium bromide and formoterol. Our results suggest that the beneficial effect of aclidinium bromide and formoterol involves cAMP affecting both, the accumulation of mesenchymal cells and ECM remodeling, which may explain the beneficial effect of the drugs on lung function in COPD. PMID:26546746

  3. Inhibition of methoxamine-induced bronchoconstriction by ipratropium bromide and disodium cromoglycate in asthmatic subjects.

    OpenAIRE

    Black, J.; Vincenc, K; Salome, C.

    1985-01-01

    We compared the effects of pretreatment with saline, ipratropium bromide, and disodium cromoglycate (DSCG) on bronchoconstriction induced by methoxamine--an alpha-adrenoceptor agonist, in asthmatic subjects. All 12 patients bronchoconstricted in response to methoxamine after saline. The PD20 (the dose of methoxamine causing a 20% fall in forced expiratory volume in 1 s [FEV1]) ranged from 0.3-18 mumol. Ipratropium bromide (200 micrograms administered by aerosol) significantly inhibited (P les...

  4. Mechanism of HERG potassium channel inhibition by tetra-n-octylammonium bromide and benzethonium chloride

    Energy Technology Data Exchange (ETDEWEB)

    Long, Yan; Lin, Zuoxian [Key Laboratory of Regenerative Biology, Guangzhou Institute of Biomedicine and Health, Chinese Academy of Sciences, Guangzhou 510530 (China); Xia, Menghang; Zheng, Wei [National Center for Advancing Translational Sciences, National Institutes of Health, Bethesda, MD 20892 (United States); Li, Zhiyuan, E-mail: li_zhiyuan@gibh.ac.cn [Key Laboratory of Regenerative Biology, Guangzhou Institute of Biomedicine and Health, Chinese Academy of Sciences, Guangzhou 510530 (China)

    2013-03-01

    Tetra-n-octylammonium bromide and benzethonium chloride are synthetic quaternary ammonium salts that are widely used in hospitals and industries for the disinfection and surface treatment and as the preservative agent. Recently, the activities of HERG channel inhibition by these compounds have been found to have potential risks to induce the long QT syndrome and cardiac arrhythmia, although the mechanism of action is still elusive. This study was conducted to investigate the mechanism of HERG channel inhibition by these compounds by using whole-cell patch clamp experiments in a CHO cell line stably expressing HERG channels. Tetra-n-octylammonium bromide and benzethonium chloride exhibited concentration-dependent inhibitions of HERG channel currents with IC{sub 50} values of 4 nM and 17 nM, respectively, which were also voltage-dependent and use-dependent. Both compounds shifted the channel activation I–V curves in a hyperpolarized direction for 10–15 mV and accelerated channel activation and inactivation processes by 2-fold. In addition, tetra-n-octylammonium bromide shifted the inactivation I–V curve in a hyperpolarized direction for 24.4 mV and slowed the rate of channel deactivation by 2-fold, whereas benzethonium chloride did not. The results indicate that tetra-n-octylammonium bromide and benzethonium chloride are open-channel blockers that inhibit HERG channels in the voltage-dependent, use-dependent and state-dependent manners. - Highlights: ► Tetra-n-octylammonium and benzethonium are potent HERG channel inhibitors. ► Channel activation and inactivation processes are accelerated by the two compounds. ► Both compounds are the open-channel blockers to HERG channels. ► HERG channel inhibition by both compounds is use-, voltage- and state dependent. ► The in vivo risk of QT prolongation needs to be studied for the two compounds.

  5. 4-Bromophenacyl Bromide Specifically Inhibits Rhoptry Secretion during Toxoplasma Invasion

    OpenAIRE

    Sandeep Ravindran; Lodoen, Melissa B.; Verhelst, Steven H.L.; Matthew Bogyo; Boothroyd, John C.

    2009-01-01

    Toxoplasma gondii is a eukaryotic parasite of the phylum Apicomplexa that is able to infect a wide variety of host cells. During its active invasion process it secretes proteins from discrete secretory organelles: the micronemes, rhoptries and dense granules. Although a number of rhoptry proteins have been shown to be involved in important interactions with the host cell, very little is known about the mechanism of secretion of any Toxoplasma protein into the host cell. We used a chemical inh...

  6. Inhibition of the colonic motor response to eating by pinaverium bromide in irritable bowel syndrome patients.

    Science.gov (United States)

    Fioramonti, J; Frexinos, J; Staumont, G; Bueno, L

    1988-01-01

    The effect of pinaverium bromide on the colonic motor response to eating was investigated in 10 irritable bowel syndrome patients, by means of an intraluminal probe supporting 8 groups of electrodes. At each site examined from transverse to sigmoid colon, the electromyograms exhibited 2 kinds of spike bursts: short spike bursts (SSB) localized at one electrode, and long spike bursts (LSB), isolated, propagated orally or aborally over a few centimeters, or aborally propagated over the whole length of the colon investigated (migrating long spike bursts, MLSB). Recordings were continuously performed over 24 hr. Each patient received at 7.00 p.m. on day 1 and at noon on day 2 an 800-1000 Kcal meal preceded by IV administration of pinaverium bromide (4 mg) or placebo. After placebo administration, the duration of LSB activity and the number of MLSB were significantly increased over 3 postprandial hr by comparison with the 2 hr preceding the meal. After pinaverium injection no significant postprandial change in LSB and MLSB activity was noted. The SSB activity was not modified after the meals preceded by placebo or pinaverium injection. These results suggest that the inhibitory action of pinaverium bromide on postprandial colonic motility may support the clinical efficacy of this agent in the treatment of the irritable bowel syndrome. PMID:3371838

  7. Synergism and antagonism in Iron base metallic glass corrosion inhibition by Thiosemicarbazone Compounds and Bromide Ions

    International Nuclear Information System (INIS)

    The synergistic and antagonism action caused by Br ions on the corrosion inhibition of fe78B13Si19 glassy alloy in 0.2 M Na2SO4 in absence and presence 10 (to power-4) M of some thiosemicarbazone derivatives have been investigated using potentiodynamic polarization, a.c. impedance techniques and morphological study. Results show that the addition of Br ions to sulphate solution inhibit the corrosion process by acting as an electron transfer barrier due to direct adsorption of these ions on alloy surface. A synergistic effect exists when fixed concentration of studied thiosemicarbazone derivatives and low concentration Br ions are used together to prevent glassy alloy corrosion in Na2SO4. The increase in surface coverage values in the presence at low concentrations Br ions indicates that an insoluble complex formed by undergoing a joint adsorption. The synergism parameter (S) is defined and calculated by the surface coverage values. The parameter in the case of small amount of Br found to be more than unity, indicating that the enhanced inhibition efficiency caused by the addition of Br ions is only due to synergism and there is a definite contribution from the inhibitor molecule. (author)

  8. Solid-phase plate-reader quantification of specific PCR products by measurement of band-specific ethidium bromide fluorescence.

    Science.gov (United States)

    McCarthy, Michael T; O'Callaghan, Christopher A

    2014-02-15

    Real-time PCR is widely employed to quantify PCR products across a range of applications. However, accurate real-time PCR is not always technically feasible, and alternative methods for PCR product quantification can be expensive and time consuming to validate. We have developed an inexpensive, rapid, and immediately accessible protocol to quantify PCR products, by measuring ethidium bromide fluorescence of PCR products excised from agarose gels. This protocol has relevance to a broad range of methods in molecular biology where quantification of PCR products is necessary.

  9. Growth inhibition and oxidative stress induced by 1-octyl-3-methylimidazolium bromide on the marine diatom Skeletonema costatum.

    Science.gov (United States)

    Deng, Xiang-Yuan; Hu, Xiao-Li; Cheng, Jie; Ma, Zhi-Xin; Gao, Kun

    2016-10-01

    Marine diatom Skeletonema costatum is an important prey in the marine food web and is often used as a standard test organism in ecotoxicological studies. In this study, in vivo experiments were performed to analyze the effects of 1-octyl-3-methylimidazolium bromide ([C8mim]Br) on the growth, photosynthetic activity, and oxidative stress in S. costatum using 96h growth tests with a batch-culture system. The growth of S. costatum was significantly inhibited by [C8mim]Br with 48 and 96h-EC50 of 17.9 and 39.9mgL(-1), respectively. The maximum quantum yield (Fv/Fm) and the light use efficiency (α) were inhibited by [C8mim]Br, which affected the growth of S. costatum. Subsequent biochemical assays in S. costatum revealed that [C8mim]Br induced changes of Chl a content, soluble protein content, and SOD activity, which had significant increases in low [C8mim]Br treatments (≤20mgL(-1)), but decreased in high [C8mim]Br exposures (≥40mgL(-1)). The increase of SOD activity at low concentrations (≤20mgL(-1)) may be considered as an active defense of S. costatum against [C8mim]Br stress by reactive oxygen species (ROS) quenching. In addition, [C8mim]Br increased ROS level and malondialdehyde (MDA) content in S. costatum, suggesting that the physiological effects of [C8mim]Br are resulted from ROS generation. PMID:27318558

  10. A sensitive and specific liquid chromatography/tandem mass spectrometry method for determination of pinaverium bromide in human plasma: application to a pharmacokinetic study in healthy volunteers.

    Science.gov (United States)

    Ren, Jin-Min; Zhao, Xi; Wang, Chuan-Ping; Sun, Qian; Yin, Li-Xin; Zhang, Zhi-Qing

    2011-12-01

    A sensitive and specific method using liquid chromatography-electrospray tandem mass spectrometry (LC-MS/MS) for the determination of pinaverium bromide in human plasma was developed and validated. Pinaverium bromide and an internal standard (paclitaxel) were isolated from plasma samples by precipitating plasma, and determined by LC-MS/MS in multiple-reaction monitoring mode. The main metabolite of pinaverium bromide and endogenous substances in plasma did not show any interference. The calibration curve was linear over the plasma concentration range of 10.0-10000.0 pg/mL with a correlation coefficient of 0.9979. The relative standard derivations intra- and inter-day at 30.0, 300.0 and 8000.0 pg/mL in plasma were less than 15%. The absolute recoveries of pinaverium bromide and the internal standard were 99.7-111.7 and 106.2%, respectively. The lower limit of quantitation was 10 pg/mL. The analytical method was successfully applied to study the pharmacokinetics of pinaverium bromide tablets in healthy Chinese volunteers. PMID:21308709

  11. Inhibition of Dual Specific Oncolytic Adenovirus on Esophageal Cancer via Activation of Caspases by a Mitochondrial-dependent Pathway

    Institute of Scientific and Technical Information of China (English)

    SU Jia-qiang; CHI Bao-rong; LI Xiao; LIU Lei; LIU Li-ming; QI Yan-xin; WANG Zhuo-yue; JIN Ning-yi

    2012-01-01

    We investigated the anti-tumor effects of dual cancer specific-oncolytic adenovirus Ad-VP on esophageal cancer(EC).The anti-tumor activity of Ad-VP was compared with that of the control recombinant adenoviruses (Ad-GP,Ad-Apoptin,Ad-EGFP) in human esophageal cancer cell EC-109 and human normal liver cell L02 in vitro.In 3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyltetrazolium bromide(MTT) assays,the growth of EC-109 cells was slightly inhibited by Ad-GP.Ad-Apoptin and Ad-EGFP.However,Ad-VP induced a significant cytotoxic effect.Infection of EC-109 cells with Ad-VP resulted in a significant induction of apoptosis of them in vitro,detected by 4′,6-diamidino-2-phenylindole(DAPI) or acridine orange and ethidium bromide staining.The results of Western blot and flow cytometric assay indicate the loss of mitochondrial membrane potential(△ψm),the release of cytochrome c and the activation of caspase-3,6 and 7 in Ad-VP infiected EC-109 cells.In contrast,all these assays show almost no effects of the recombinant adenoviruses on L02 cells.These results demonstrate that the treatment of tumors with Ad-VP selectively inhibits tumor growth and induces apoptosis of esophageal cancer cells.Ad-VP may provide a novel and powerful strategy for cancer gene therapy.

  12. Single dendrite-targeting interneurons generate branch-specific inhibition.

    Directory of Open Access Journals (Sweden)

    Caleb eStokes

    2014-11-01

    Full Text Available Microcircuits composed of dendrite-targeting inhibitory interneurons and pyramidal cells are fundamental elements of cortical networks, however, the impact of individual interneurons on pyramidal dendrites is unclear. Here, we combine paired recordings and calcium imaging to determine the spatial domain over which single dendrite-targeting interneurons influence pyramidal cells in olfactory cortex. We show that a major action of individual interneurons is to inhibit dendrites in a branch-specific fashion.

  13. Inhibition of mitotic-specific histone phophorylation by sodium arsenite

    Energy Technology Data Exchange (ETDEWEB)

    Cobo, J.M. [Universidad de Alcala de Henares, Madrid (Spain); Valdez, J.G.; Gurley, L.R. [Los Alamos National Lab., NM (United States)

    1994-10-01

    Synchronized cultures of Chinese hamster cells (line CHO) were used to measure the effects of 10{mu}M sodium arsenite on histone phosphorylation. This treatment caused cell proliferation to be temporarily arrested, after which the cells spontaneously resumed cell proliferation in a radiomimetric manner. Immediately following treatment, it was found that sodium arsenite affected only mitotic-specific HI and H3 phosphorylations. Neither interphase, nor mitotic, H2A and H4 phosphorylations were affected, nor was interphase HI Phosphorylation affected. The phosphorylation of HI was inhibited only in mitosis, reducing HI phosphorylation to 38.1% of control levels, which was the level of interphase HI phosphorylation. The phosphorylation of both H3 variants was inhibited in mitosis, the less hydrophobic H3 to 19% and the more hydrophobic H3 to 24% of control levels. These results suggest that sodium arsenite may inhibite cell proliferation by interfering with the cyclin B/p34{sup cdc2} histone kinase activity which is thought to play a key role in regulating the cell cycle. It has been proposed by our laboratory that HI and H3 phosphorylations play a role in restructuring interphase chromatin into metaphase chromosomes. Interference of this process by sodium arsenite may lead to structurally damaged chromosomes resulting in the increased cancer risks known to be produced by arsenic exposure from the environment.

  14. Natural Polyphenols Inhibit Lysine-Specific Demethylase-1 in vitro.

    Science.gov (United States)

    Abdulla, Arian; Zhao, Xiaoping; Yang, Fajun

    2013-03-01

    Natural polyphenols, such as resveratrol, have beneficial functions on major human diseases such as cancer, diabetes, and cardiovascular disease. Besides acting as antioxidants, some of these polyphenols can also target proteins to modulate specific biological pathways. The lysine-specific histone demethylase LSD1 plays important roles in cell growth, differentiation and nutrient metabolism. Here, we studied the effect of natural polyphenols resveratrol, curcumin, quercetin and analogs on LSD1. Using in vitro LSD1 enzymatic assays, we show that resveratrol, curcumin and quercetin displayed a potent inhibitory effect on the LSD1 activity and were more potent than the known LSD1 inhibitor trans-2-phenylcyclopropylamine (TCP). The new function of resveratrol, curcumin and quercetin is independent of their antioxidant properties, as other antioxidants had no effect on LSD1 under the similar conditions. In C2C12 fibroblasts, resveratrol and curcumin can efficiently inhibit myogenic expression and differentiation, for which LSD1 is required. Thus, our study has identified LSD1 as a novel target of bioactive natural compounds, such as resveratrol, curcumin and quercetin, and such finding suggests that LSD1 inhibition can at least partially contribute to some of the previously observed beneficial effects of these compounds. PMID:23662249

  15. [The clinical pharmacological profile of pinaverium bromide].

    Science.gov (United States)

    Guslandi, M

    1994-04-01

    Pinaverium bromide is a locally acting spasmolytic agent of the digestive tract. Its mechanism of action relies upon inhibition of calcium ion entrance into smooth muscle cells (calcium-antagonist effect). In humans pinaverium facilitates gastric emptying and decreases intestinal transit time in patients with constipation. Pinaverium is very effective in improving symptoms of irritable bowel syndrome (abdominal pain, gas, diarrhea or constipation). In this respect the drug proved to be significantly superior to placebo, at least as effective as trimebutine and on the whole more active than otilonium and prifinium bromide, being always extremely well tolerated. PMID:8028745

  16. The synergistic effect of Na{sub 3}PO{sub 4} and benzotriazole on the inhibition of copper corrosion in tetra-n-butylammonium bromide aerated aqueous solution

    Energy Technology Data Exchange (ETDEWEB)

    Liu, S.; Dong, J.; Guan, W.W.; Duan, J.M.; Jiang, R.Y. [Department of Applied Chemistry, South China University of Technology, Guangzhou 510640 (China); Feng, Z.P.; Song, W.J. [Guangzhou Institute of Energy Conversion, CAS, Guangzhou 510640 (China)

    2012-11-15

    The effect of Na{sub 3}PO{sub 4} and the mixture of benzotriazole (BTA) and Na{sub 3}PO{sub 4} (SP) on the corrosion of copper in 17 wt% (0.534 mol/L) tetra-n-butylammonium bromide (TBAB) aerated aqueous solution has been investigated by means of weight-loss test, potentiodynamic polarization test, electrochemical impedance spectroscopy (EIS), and scanning electron microscopy/energy dispersive X-ray techniques. The experimental results showed that a dosage of Na{sub 3}PO{sub 4} stimulated the copper corrosion, and the corrosion rate increased with increasing Na{sub 3}PO{sub 4} concentration, whereas the mixture of BTA and Na{sub 3}PO{sub 4} could protect copper in aqueous TBAB solution. The inhibition action of the mixture of BTA and Na{sub 3}PO{sub 4} on the corrosion of copper is mainly due to the inhibition of the anodic process of corrosion. The inhibition efficiency of a mixture consisting of 2 g/L BTA and 1 g/L Na{sub 3}PO{sub 4} was about 96%. The mixture of BTA and Na{sub 3}PO{sub 4} inhibits the corrosion of copper better than BTA by itself, indicating that Na{sub 3}PO{sub 4} has a synergistic role with BTA on the corrosion inhibition of copper in TBAB aqueous solution. (Copyright copyright 2012 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  17. Cerium incorporated MCM-48 (Ce-MCM-48) as a catalyst to inhibit bromate formation during ozonation of bromide-containing water: Efficacy and mechanism.

    Science.gov (United States)

    Li, Weiwei; Lu, Xiaowei; Xu, Ke; Qu, Jiuhui; Qiang, Zhimin

    2015-12-01

    The composite mesoporous sieve Ce-MCM-48 (cerium incorporated MCM-48) with different Si/Ce molar ratios were synthesized hydrothermally and characterized with X-ray diffraction, X-ray photoelectron spectroscopy, BET surface area, and pHpzc. Results indicate that Ce-MCM-48, especially with a Si/Ce molar ratio of 66 (i.e., Ce66-MCM-48), could significantly inhibit bromate (BrO3(-)) formation during ozonation of Br(-)-containing water, achieving 91% of inhibition efficiency at pH 7.6 and 25 °C. An acidic or alkaline pH decreased the inhibition efficiency of Ce66-MCM-48 to some extent, but reaction temperature ranging from 15 to 30 °C had no significant impact. By comparing the bromine mass balance, aqueous O3 decomposition, and newly formed H2O2 between O3 and O3/Ce66-MCM-48 processes, the inhibition mechanism was proposed: Ce66-MCM-48 promoted aqueous O3 decomposition to generate hydroxyl radicals (OH) that could merge into H2O2, so the oxidative transformation of Br(-) and HOBr/OBr(-) by O3 and OH was primarily suppressed. The catalytic ability of Ce66-MCM-48 was continuously regenerated through the circulating reactions between Ce(III) and Ce(IV) occurring on the catalyst surface. Besides its inhibition on BrO3(-) formation, Ce66-MCM-48 could also enhance the degradation of refractory organic micropollutants. Because of these distinct merits, Ce66-MCM-48 has potential applications to water treatment by ozone.

  18. Cerium incorporated MCM-48 (Ce-MCM-48) as a catalyst to inhibit bromate formation during ozonation of bromide-containing water: Efficacy and mechanism.

    Science.gov (United States)

    Li, Weiwei; Lu, Xiaowei; Xu, Ke; Qu, Jiuhui; Qiang, Zhimin

    2015-12-01

    The composite mesoporous sieve Ce-MCM-48 (cerium incorporated MCM-48) with different Si/Ce molar ratios were synthesized hydrothermally and characterized with X-ray diffraction, X-ray photoelectron spectroscopy, BET surface area, and pHpzc. Results indicate that Ce-MCM-48, especially with a Si/Ce molar ratio of 66 (i.e., Ce66-MCM-48), could significantly inhibit bromate (BrO3(-)) formation during ozonation of Br(-)-containing water, achieving 91% of inhibition efficiency at pH 7.6 and 25 °C. An acidic or alkaline pH decreased the inhibition efficiency of Ce66-MCM-48 to some extent, but reaction temperature ranging from 15 to 30 °C had no significant impact. By comparing the bromine mass balance, aqueous O3 decomposition, and newly formed H2O2 between O3 and O3/Ce66-MCM-48 processes, the inhibition mechanism was proposed: Ce66-MCM-48 promoted aqueous O3 decomposition to generate hydroxyl radicals (OH) that could merge into H2O2, so the oxidative transformation of Br(-) and HOBr/OBr(-) by O3 and OH was primarily suppressed. The catalytic ability of Ce66-MCM-48 was continuously regenerated through the circulating reactions between Ce(III) and Ce(IV) occurring on the catalyst surface. Besides its inhibition on BrO3(-) formation, Ce66-MCM-48 could also enhance the degradation of refractory organic micropollutants. Because of these distinct merits, Ce66-MCM-48 has potential applications to water treatment by ozone. PMID:26072989

  19. Effects of pinaverium bromide on Oddi's sphincter.

    Science.gov (United States)

    DiSomma, C; Reboa, G; Patrone, M G; Mortola, G P; Sala, G; Ciampini, M

    1986-01-01

    Twelve to 15 days after cholecystectomy, endocholedochal pressure was measured in ten patients before and one hour after oral administration of 15 mg of pinaverium bromide (six patients) or placebo. The mean endocholedochal pressure was 7.1 +/- 0.25 mmHg before and 3.1 +/- 0.2 mmHg after pinaverium (P less than 0.01), and 7.0 +/- 0.2 and 6.8 +/- 1.2 mmHg in the placebo-treated patients. The results suggest that pinaverium bromide has a specific effect on the common bile duct and probably on Oddi's sphincter. PMID:3815457

  20. Detection of lipopolysaccharides by ethidium bromide staining after sodium dodecyl sulfate-polyacrylamide gel electrophoresis.

    OpenAIRE

    Kido, N; Ohta, M; Kato, N

    1990-01-01

    A rapid and easy method for staining lipopolysaccharides with ethidium bromide is described. Lipopolysaccharides could be visualized by ethidium bromide with almost the same sensitivity as found with the silver-staining method in less than 30 min. The ethidium bromide-staining method was particularly suitable for staining lipopolysaccharides possessing acidic O-specific polysaccharides, which were poorly visualized by silver staining.

  1. Rapacuronium bromide (Organon Teknika).

    Science.gov (United States)

    Plowman, A N

    1999-07-01

    Organon Teknika's rapacuronium bromide (Org-9487), the 16-N-allyl, 17-beta-propionate analog of vecuronium bromide, is in phase III clinical trials in the US and Europe for potential use as an anesthetic. It is a steroidal neuromuscular blocking drug characterized by low potency, rapid rate of block development and short time course of neuromuscular blocking action as compared with other non-depolarizing compounds [170210,221422]. A multicenter, randomized, assessor-blind, placebo-controlled, dose-finding study in patients undergoing tracheal intubation showed that the drug produced a dose dependent neuromuscular block. Doses of 1.5 to 2 mg/kg allowed rapid intubation and short duration of action [273336]. Another study showed that the drug does not cause cardiovascular side-effects [273336]. A meeting was held in Europe on 8 February 1999 to brief company employees on the registration and release of rapacuronium [319211] for which the company anticipates a launch in late 1999 [320706]. Organon estimates that the market value of Org-9487 is between dollar 100 m and dollar 250 m a year, each for Europe and the US [221422].

  2. Natural Polyphenols Inhibit Lysine-Specific Demethylase-1 in vitro

    OpenAIRE

    Abdulla, Arian; Zhao, Xiaoping; Yang, Fajun

    2013-01-01

    Natural polyphenols, such as resveratrol, have beneficial functions on major human diseases such as cancer, diabetes, and cardiovascular disease. Besides acting as antioxidants, some of these polyphenols can also target proteins to modulate specific biological pathways. The lysine-specific histone demethylase LSD1 plays important roles in cell growth, differentiation and nutrient metabolism. Here, we studied the effect of natural polyphenols resveratrol, curcumin, quercetin and analogs on LSD...

  3. Sequence specific inhibition of DNA restriction enzyme cleavage by PNA

    DEFF Research Database (Denmark)

    Nielsen, P.E.; Egholm, M.; Berg, R.H.;

    1993-01-01

    Plasmids containing double-stranded 10-mer PNA (peptide nucleic acid chimera) targets proximally flanked by two restriction enzyme sites were challenged with the complementary PNA or PNAs having one or two mismatches, and the effect on the restriction enzyme cleavage of the flanking sites...... was assayed. The following PNAs were used: T10-LysNH2, T5CT4-LysNH2 and T2CT2CT4-LysNH2 and the corresponding targets cloned into pUC 19 were flanked by BamH1, Sal1 or Pstl sites, respectively. In all cases it was found that complete inhibition of restriction enzyme cleavage was obtained...

  4. Methylnaltrexone bromide methanol monosolvate

    Directory of Open Access Journals (Sweden)

    Xinbo Zhou

    2012-03-01

    Full Text Available In the title compound [systematic name: (4R,4aS,7aR,12bS-3-cyclopropylmethyl-4a,9-hydroxy-7-oxo-2,3,4,4a,5,6,7,7a-octahydro-1H-4,12-methanobenzofuro[3,2-e]isoquinolin-3-ium bromide methanol monosolvate], C21H26NO4+·Br−·CH3OH, two of the three six-membered rings adopt chair conformations while the third, which contains a C=C double bond, adopts an approximate half-boat conformation. The 2,3-dihydrofuran ring adopts an envelope conformation. In the crystal, the components are linked by O—H...O and O—H...Br hydrogen bonds. The absolute stereochemistry was inferred from one of the starting materials.

  5. Iron bromide vapor laser

    Science.gov (United States)

    Sukhanov, V. B.; Shiyanov, D. V.; Trigub, M. V.; Dimaki, V. A.; Evtushenko, G. S.

    2016-03-01

    We have studied the characteristics of a pulsed gas-discharge laser on iron bromide vapor generating radiation with a wavelength of 452.9 nm at a pulse repetition frequency (PRF) of 5-30 kHz. The maximum output power amounted to 10 mW at a PRF within 5-15 kHz for a voltage of 20-25 kV applied to electrodes of the discharge tube. Addition of HBr to the medium produced leveling of the radial profile of emission. Initial weak lasing at a wavelength of 868.9 nm was observed for the first time, which ceased with buildup of the main 452.9-nm line.

  6. Inhibition of Bcl-2 expression by a novel tumor-specific RNA interference system increases chemosensitivity to 5-fluorouracil in Hela cells

    Institute of Scientific and Technical Information of China (English)

    Sheng-lin HUANG; Yi WU; Hai YU; Ping ZHANG; Xing-qian ZHANG; Lei YING; Han-fang ZHAO

    2006-01-01

    Aim: RNA interference (RNAi) has been proposed as a potential treatment for cancer, but the lack of cellular targets limits its use in cancer gene therapy. No current technology has achieved direct tumor-specific gene silencing using RNAi.In the present study we attempt to develop a tumor-specific RNAi system using the human telomerase reverse transcriptase (hTERT) promoter; furthermore, we analyzed its inhibitive effect on Bcl-2 expression. Methods: The vectors containing a small hairpin RNA (shRNA) to target exogenous reporters [firefly luciferase and enhanced green fluorescent protein (EGFP)] and endogenous gene (Bcl-2)were constructed. Luciferase expression was determined by dual luciferase assay.Reverse transcription-polymerase chain reaction (RT-PCR), fluorescence microscopy and fluorescence-activated cell sorting (FACS) were used to measure EGFP expression. Inhibition of Bcl-2 was evaluated by RT-PCR and Western blotting.Cell proliferation and viability were measured by using 3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyl-2H-tetrazolium bromide (MTT) assay. FACS was used to analyze the cell cycle distribution profile. Results: We showed that with the hTERT promoter directly driving shRNA transcription, expression of the exogenous reporters (LUC and EGFP) in tumor cells, but not normal cells, was specifically inhibited in vitro. The hTERT promoter-driven shRNA also depressed the expression of Bcl-2. Inhibition of Bcl-2 did not affect cell proliferation, but increased the chemosensitivity of HeLa cells to 5-fluorouracil. Conclusion: The present study describes an efficient RNAi system for gene silencing that is specific to tumor cells using the hTERT promoter. Suppression of Bcl-2 by using this system sensitized HeLa cells to 5-fluorouracil. This system may be useful for RNAi therapy.

  7. Specific inhibition of Photobacterium phosphoreum extends the shelf life of modified-atmosphere-packed cod fillets

    DEFF Research Database (Denmark)

    Dalgaard, Paw; Munoz, L.G.; Mejlholm, Ole

    1998-01-01

    Inhibition of the specific spoilage organism, Photobacterium phosphoreum, was studied in model substrates and in modified- atmosphere-packed cod fillets. The objective was to determine how inhibition of this organism influenced spoilage. The spoilage reactions limiting shelf life were studied rat...

  8. Action of pinaverium bromide on calmodulin-regulated functions.

    Science.gov (United States)

    Wuytack, F; De Schutter, G; Casteels, R

    1985-08-01

    Pinaverium bromide at concentrations below 10(-5) M did not inhibit calmodulin-dependent enzymes such as phosphodiesterase and the Ca transport ATPase of the plasma membrane. At higher concentrations the compound interacted with the stimulation of those enzymes by calmodulin and also inhibited the calmodulin-independent activity. A similar inhibitory action was observed for the NaK ATPase. It is concluded that the inhibitory action of pinaverium bromide on smooth muscle concentration at concentrations below 10(-5) M was due to its interaction with the voltage-dependent Ca channels and not to its interference with the calmodulin-dependent activation of the contractile proteins. PMID:2995077

  9. Effects of pinaverium bromide and verapamil on the motility of the rat isolated colon.

    Science.gov (United States)

    Baumgartner, A; Drack, E; Halter, F; Scheurer, U

    1985-09-01

    Pinaverium bromide was 30 times less potent than verapamil in inhibiting intraluminal pressure responses of in vitro rat colonic segments to barium chloride, acetylcholine, FK 33-824 or field stimulation. The inhibitory effects of both verapamil and pinaverium bromide on the pressure responses to field stimulation were antagonized similarly by exogenous calcium administration. These results support the concept that pinaverium bromide acts on calcium channels in the smooth muscle cell membrane. PMID:4052731

  10. Effects of pinaverium bromide and verapamil on the motility of the rat isolated colon.

    OpenAIRE

    Baumgartner, A.; Drack, E.; Halter, F; Scheurer, U.

    1985-01-01

    Pinaverium bromide was 30 times less potent than verapamil in inhibiting intraluminal pressure responses of in vitro rat colonic segments to barium chloride, acetylcholine, FK 33-824 or field stimulation. The inhibitory effects of both verapamil and pinaverium bromide on the pressure responses to field stimulation were antagonized similarly by exogenous calcium administration. These results support the concept that pinaverium bromide acts on calcium channels in the smooth muscle cell membrane.

  11. Kinetic Studies on the Irreversible Inhibition of Restriction Endonuclease Pst I by Site-Specific Inhibitors

    Institute of Scientific and Technical Information of China (English)

    2001-01-01

    The irreversible modifying effects on Pst I of several inhibitors have been studied with the irreversible inhibition kinetic theory of single substrate reaction provided by Tsou,C. L. Pyridoxal phosphate (PLP), p-chloromercuribenzoic acid (PCMB),diisopropyl fluorophosphate (DFP), 2,3-diacetyl (DAC) and N-ethyl-5-phenylisoxazoliun-3'-sulfonate (woodward's reagent K, WRK ) modify the lysine, cysine,serteine, arginine and carboxyl groups of the protein molecule respectively. These five inhibitors have been found to inhibit both the prime activity and star activity of Pst 1. Used with the irreversible inhibition theory,the apparent inhibition rate constant, A and the microcosmic inhibition rate constants, k+0 and k′ +o of every inhibitor were calculated. We also found that their inhibition effects belong to the noncompetitive irreversible inhibition. Results show that among the groups to be modified, some have nothing to do with the combination with the substrate, and some may have, but any of them isn't the only factor involved in the specific binding.Despite all this, they may take part in the catalysis of enzyme or have important effects on maintaining the active structure of enzyme molecules. Furthermore, serine and arginine residues are related to the alteration of Pst I conformation and then influence the ability of Pst I recognizing and incising DNA specifically.

  12. Specific Bifidobacterium strains isolated from elderly subjects inhibit growth of Staphylococcus aureus.

    Science.gov (United States)

    Lahtinen, Sampo J; Jalonen, Lotta; Ouwehand, Arthur C; Salminen, Seppo J

    2007-06-10

    Cell-free, pH-controlled supernatants of thirty-eight Bifidobacterium strains isolated from healthy elderly subjects were subjected to antimicrobial activity assay. Bioluminescent indicator strains Staphylococcus aureus RN4220, Escherichia coli K-12, and Salmonella enterica serovar Typhimurium ATCC 14028 were used as targets of antimicrobial activity. The effect of nutrient depletion on the inhibition was eliminated with spent-culture controls. Three out of thirty-eight Bifidobacterium strains were capable of inhibiting the growth of S. aureus. The inhibition was equal to 23.2+/-19.1% to 50.4+/-26.7% of the inhibition caused by 50 IU/ml nisin. Reuterin-producing positive strain Lactobacillus reuteri SD2112 was capable of 86.0+/-24.6% inhibition, but Bifidobacterium lactis Bb-12, a known probiotic strain, showed no inhibition. None of the strains was capable of inhibiting the growth of E. coli or S. enterica. The observed inhibition by bifidobacteria was related to hydrogen peroxide formation and possible production of heat-stable proteinaceous compounds. The results suggest that production of antimicrobial substances other than organic acids is not common among Bifidobacterium strains typical of elderly subjects. However, specific strains were identified which showed considerable inhibitory activity against S. aureus. PMID:17462772

  13. Antipeptide antibody that specifically inhibits insulin receptor autophosphorylation and protein kinase activity

    International Nuclear Information System (INIS)

    Two site-specific antibodies that immunoprecipitate the human insulin receptor have been prepared by immunizing rabbits with chemically synthesized peptides derived from the cDNA-predicted amino acid sequence of the β subunit of the proreceptor. Antibodies to the carboxyl terminus (AbP5) and to a domain around tyrosine-960 (AbP4) specifically recognize the β subunit of the receptor on immunoblots. Both antibodies immunoprecipitated 125I-labeled insulin-receptor complexes and the autophosphorylated receptor. Although neither antibody inhibited insulin binding to the receptor, both insulin-dependent autophosphorylation and exogenous substrate phosphorylation were inhibited by AbP4. Inhibition by AbP4 was dependent upon the phosphorylation state of the receptor; it was not detected when the receptor was autophosphorylated prior to addition of AbP4. AbP4 did not inhibit activity of the related epidermal growth factor (EGF)-receptor tyrosine protein kinase nor did it inhibit the activity of cAMP-dependent kinase or protein kinase C. The observation that an antibody directed to residues 952-967 of the proreceptor neutralizes the protein kinase activity of the β subunit suggest that this region may play a critical role in the function of the hormone-dependent, protein tyrosine-specific kinase activity of the insulin receptor

  14. Targeted in vivo inhibition of specific protein-protein interactions using recombinant antibodies.

    Directory of Open Access Journals (Sweden)

    Matej Zábrady

    Full Text Available With the growing availability of genomic sequence information, there is an increasing need for gene function analysis. Antibody-mediated "silencing" represents an intriguing alternative for the precise inhibition of a particular function of biomolecules. Here, we describe a method for selecting recombinant antibodies with a specific purpose in mind, which is to inhibit intrinsic protein-protein interactions in the cytosol of plant cells. Experimental procedures were designed for conveniently evaluating desired properties of recombinant antibodies in consecutive steps. Our selection method was successfully used to develop a recombinant antibody inhibiting the interaction of ARABIDOPSIS HISTIDINE PHOSPHOTRANSFER PROTEIN 3 with such of its upstream interaction partners as the receiver domain of CYTOKININ INDEPENDENT HISTIDINE KINASE 1. The specific down-regulation of the cytokinin signaling pathway in vivo demonstrates the validity of our approach. This selection method can serve as a prototype for developing unique recombinant antibodies able to interfere with virtually any biomolecule in the living cell.

  15. Electrophysiological study of intravenous pinaverium bromide in cardiology.

    Science.gov (United States)

    Guerot, C; Khemache, A; Sebbah, J; Noel, B

    1988-01-01

    Pinaverium bromide is a musculotropic spasmolytic agent which acts by inhibiting transmembrane calcium movements, an effect similar to that of verapamil. Because of this, an investigation was carried out to see if it had any electrophysiological effects in patients with various cardiac disorders. In an open study, 10 patients received 2 mg pinaverium bromide intravenously. In a double-blind study, 10 patients received 4 mg pinaverium bromide intravenously and 10 patients placebo. Patients included those with either normal or pathological basal conduction, such as bundle-branch block and 1st degree atrioventricular block. Measurements were made of electrophysiological parameters before and 10 minutes after injection. The results showed that neither of the two doses of pinaverium bromide had any effect on atrial excitability, sino-atrial conduction, node and trunk atrioventricular conduction or on intraventricular conduction. No significant difference was seen in comparison with placebo. Pinaverium bromide had no anti-arrhythmic properties in these studies. Local, cardiac and general clinical tolerability was good in all patients. PMID:3219882

  16. Simultaneous Assessment of Acidogenesis-Mitigation and Specific Bacterial Growth-Inhibition by Dentifrices.

    Directory of Open Access Journals (Sweden)

    Sarah Forbes

    Full Text Available Dentifrices can augment oral hygiene by inactivating bacteria and at sub-lethal concentrations may affect bacterial metabolism, potentially inhibiting acidogenesis, the main cause of caries. Reported herein is the development of a rapid method to simultaneously measure group-specific bactericidal and acidogenesis-mitigation effects of dentifrices on oral bacteria. Saliva was incubated aerobically and anaerobically in Tryptone Soya Broth, Wilkins-Chalgren Broth with mucin, or artificial saliva and was exposed to dentifrices containing triclosan/copolymer (TD; sodium fluoride (FD; stannous fluoride and zinc lactate (SFD1; or stannous fluoride, zinc lactate and stannous chloride (SFD2. Minimum inhibitory concentrations (MIC were determined turbidometrically whilst group-specific minimum bactericidal concentrations (MBC were assessed using growth media and conditions selective for total aerobes, total anaerobes, streptococci and Gram-negative anaerobes. Minimum acid neutralization concentration (MNC was defined as the lowest concentration of dentifrice at which acidification was inhibited. Differences between MIC and MNC were calculated and normalized with respect to MIC to derive the combined inhibitory and neutralizing capacity (CINC, a cumulative measure of acidogenesis-mitigation and growth inhibition. The overall rank order for growth inhibition potency (MIC under aerobic and anaerobic conditions was: TD> SFD2> SFD1> FD. Acidogenesis-mitigation (MNC was ordered; TD> FD> SFD2> SFD1. CINC was ordered TD> FD> SFD2> SFD1 aerobically and TD> FD> SFD1> SFD2 anaerobically. With respect to group-specific bactericidal activity, TD generally exhibited the greatest potency, particularly against total aerobes, total anaerobes and streptococci. This approach enables the rapid simultaneous evaluation of acidity mitigation, growth inhibition and specific antimicrobial activity by dentifrices.

  17. Atrazine acts as an endocrine disrupter by inhibiting cAMP-specific phosphodiesterase-4

    Energy Technology Data Exchange (ETDEWEB)

    Kucka, Marek [Section on Cellular Signaling, Program in Developmental Neuroscience, NICHD, NIH, Bethesda, MD (United States); Pogrmic-Majkic, Kristina; Fa, Svetlana [Laboratory for Ecotoxicology, Department of Biology and Ecology, University of Novi Sad, Faculty of Sciences, 21000 Novi Sad (Serbia); Stojilkovic, Stanko S. [Section on Cellular Signaling, Program in Developmental Neuroscience, NICHD, NIH, Bethesda, MD (United States); Kovacevic, Radmila, E-mail: radmila.kovacevic@dbe.uns.ac.rs [Laboratory for Ecotoxicology, Department of Biology and Ecology, University of Novi Sad, Faculty of Sciences, 21000 Novi Sad (Serbia)

    2012-11-15

    Atrazine, one of the most commonly used herbicides worldwide, acts as an endocrine disruptor, but the mechanism of its action has not been characterized. In this study, we show that atrazine rapidly increases cAMP levels in cultured rat pituitary and testicular Leydig cells in a concentration-dependent manner, but less effectively than 3-isobutyl-1-methylxanthine, a competitive non-specific inhibitor of phosphodiesterases (PDEs). In forskolin (an activator of adenylyl cyclase)- and probenecid (an inhibitor of cyclic nucleotide transporters)-treated cells, but not in 3-isobutyl-1-methylxanthine-treated cells, atrazine further increased cAMP levels, indicating that inhibition of PDEs accounts for accumulation of cAMP. In contrast to cAMP, atrazine did not alter cGMP levels, further indicating that it inhibits cAMP-specific PDEs. Atrazine-induced changes in cAMP levels were sufficient to stimulate prolactin release in pituitary cells and androgen production in Leydig cells, indicating that it acts as an endocrine disrupter both in cells that secrete by exocytosis of prestored hormones and in cells that secrete by de novo hormone synthesis. Rolipram abolished the stimulatory effect of atrazine on cAMP release in both cell types, suggesting that it acts as an inhibitor of PDE4s, isoforms whose mRNA transcripts dominate in pituitary and Leydig cells together with mRNA for PDE8A. In contrast, immortalized lacto-somatotrophs showed low expression of these mRNA transcripts and several fold higher cAMP levels compared to normal pituitary cells, and atrazine was unable to further increase cAMP levels. These results indicate that atrazine acts as a general endocrine disrupter by inhibiting cAMP-specific PDE4s. -- Highlights: ► Atrazine stimulates cAMP accumulation in pituitary and Leydig cells. ► Atrazine also stimulates PRL and androgens secretion. ► Stimulatory effects of atrazine were abolished in cells with IBMX-inhibited PDEs. ► Atrazine specificity toward cAMP-specific

  18. Cell-specific RNA aptamer against human CCR5 specifically targets HIV-1 susceptible cells and inhibits HIV-1 infectivity.

    Science.gov (United States)

    Zhou, Jiehua; Satheesan, Sangeetha; Li, Haitang; Weinberg, Marc S; Morris, Kevin V; Burnett, John C; Rossi, John J

    2015-03-19

    The C-C chemokine receptor type 5 (CCR5) is a receptor expressed by T cells and macrophages that serves as a coreceptor for macrophage-tropic HIV-1. Loss of CCR5 is associated with resistance to HIV-1. Here, we combine the live-cell-based SELEX with high-throughput sequencing technology to generate CCR5 RNA aptamers capable of specifically targeting HIV-1 susceptible cells (as small interfering RNA [siRNA] delivery agent) and inhibiting HIV-1 infectivity (as antiviral agent) via block of the CCR5 required for HIV-1 to enter cells. One of the best candidates, G-3, efficiently bound and was internalized into human CCR5-expressing cells. The G-3 specifically neutralized R5 virus infection in primary peripheral blood mononuclear cells, and in vivo generated human CD4(+) T cells with a nanomolar inhibitory concentration 50%. G-3 was also capable of transferring functional siRNAs to CCR5-expressing cells. Collectively, the cell-specific, internalizing, CCR5-targeted aptamers and aptamer-siRNA conjugates offer promise for overcoming some of the current challenges of drug resistance in HIV-1 by providing cell-type- or tissue-specific delivery of various therapeutic moieties.

  19. Actinomycin D specifically inhibits the interaction between transcription factor Sp1 and its binding site.

    Science.gov (United States)

    Czyz, M; Gniazdowski, M

    1998-01-01

    The mode of action of many anticancer drugs involves DNA interactions. We here examine the ability of actinomycin D to alter the specific binding of transcription factors Spl and NFkappaB to their DNA sequences. Employing an electrophoretic mobility shift assay, it is shown that actinomycin D inhibits complex formation between nuclear proteins present in the extracts from stimulated human umbilical vein endothelial cells and the Sp1-binding site. Actinomycin D is also able to induce disruption of preformed DNA-protein complexes, pointing to the importance of an equilibrium of three components: actinomycin D, protein and DNA for drug action. The effect of actinomycin D is sequence-specific, since no inhibition is observed for interaction of nuclear proteins with the NFkappaB binding site. The results support the view that DNA-binding drugs displaying high sequence-selectivity can exhibit distinct effects on the interaction between DNA and different DNA-binding proteins. PMID:9701497

  20. Action of pinaverium bromide, a calcium-antagonist, on gastrointestinal motility disorders.

    Science.gov (United States)

    Christen, M O

    1990-01-01

    1. The evidence reviewed here indicates that pinaverium bromide (Dicetel) relaxes gastrointestinal (GI) structures primarily by inhibiting Ca2+ influx through potential-dependent channels of surface membranes of smooth muscle cells. 2. The in vivo selectivity of pinaverium bromide for the GI tract appears to be due mainly to its pharmacokinetic properties. Because of its low absorption (typical for quaternary ammonium compounds) and marked hepatobiliary excretion, most of the orally-administered dose of pinaverium bromide remains in the GI tract. 3. Orally-administered pinaverium bromide does not elicit adverse cardiovascular side-effects at doses that effectively relieve GI spasm, pain, transit disturbances and other symptoms related to motility disorders. 4. Pinaverium bromide is the only Ca2(+)-antagonist with known therapeutic efficacy in the treatment of irritable bowel syndrome and certain other functional intestinal disorders. PMID:2177709

  1. Cationic oligonucleotides can mediate specific inhibition of gene expression in Xenopus oocytes.

    OpenAIRE

    Bailey, C P; Dagle, J M; Weeks, D L

    1998-01-01

    Base-specific hydrogen bonding between an oligonucleotide and the purines in the major groove of a DNA duplex provide an approach to selective inhibition of gene expression. Oligonucleotide-mediated triplex formation in vivo may be enhanced by a number of different chemical modifications. We have previously described an in vitro analysis of triplex formation using oligonucleotides containing internucleoside phosphate linkages modified with the cation N , N -diethyl-ethylenediamine (DEED). Whe...

  2. Specific inhibition of Escherichia coli ferrienterochelin uptake by a normal human serum immunoglobulin.

    OpenAIRE

    Moore, D G; Earhart, C F

    1981-01-01

    Normal human serum contains an enterochelin-specific antibody which presumably acts with transferrin to hinder iron assimilation by enterochelin-producing pathogens. This antibody can be isolated from serum by sodium sulfate fractionation or affinity chromatography by employing an enterochelin-derived ligand (2,3-dihydroxy-N-benzoyl-L-serine) attached to aminohexyl Sepharose 4B. In assays of iron uptake by whole cells, the antibody inhibited enterochelin-directed uptake but not that mediated ...

  3. Structural Basis for Specific Inhibition of tRNA Synthetase by an ATP Competitive Inhibitor

    OpenAIRE

    Fang, Pengfei; Han, Hongyan; Wang, Jing; Chen, Kaige; Chen, Xin; Guo, Min

    2015-01-01

    Pharmaceutical inhibitors of aminoacyl-tRNA synthetases demand high species and family specificity. The antimalarial ATP-mimetic cladosporin selectively inhibits P. falciparum LysRS (PfLysRS). How the binding to a universal ATP site achieves the specificity is unknown. Here we report 3 crystal structures of cladosporin with human LysRS, PfLysRS, and a Pf-like human LysRS mutant. In all 3 structures, cladosporin occupies the class defining ATP-binding pocket, replacing the adenosine portion of...

  4. Akt inhibition enhances expansion of potent tumor-specific lymphocytes with memory cell characteristics

    Science.gov (United States)

    Crompton, Joseph G.; Sukumar, Madhusudhanan; Roychoudhuri, Rahul; Clever, David; Gros, Alena; Eil, Robert; Tran, Eric; Hanada, Ken-ichi; Yu, Zhiya; Palmer, Douglas C.; Kerkar, Sid P.; Michalek, Ryan D.; Upham, Trevor; Leonardi, Anthony; Aquavella, Nicholas; Wang, Ena; Marincola, Francesco M.; Gattinoni, Luca; Muranski, Pawel; Sundrud, Mark S.; Klebanoff, Christopher A.; Rosenberg, Steven A.; Fearon, Douglas T.; Restifo, Nicholas P.

    2015-01-01

    Adoptive cell therapy (ACT) using autologous tumor-infiltrating lymphocytes (TIL) can result in complete regression of advanced cancer in some patients, but the efficacy of this potentially curative therapy might be limited by poor persistence of TIL after adoptive-transfer. Pharmacologic inhibition of the serine/threonine kinase Akt has recently been shown to promote immunologic memory in viral-specific murine models, but whether this approach may enhance features of memory (e.g. long-term persistence) in TIL which are characteristically exhausted and senescent is not established. Here we show that pharmacologic inhibition of Akt enables expansion of TIL with the transcriptional, metabolic and functional properties characteristic of memory T cells. Consequently, Akt inhibition results in enhanced persistence of TIL after adoptive transfer into an immunodeficient animal model and augments anti-tumor immunity of CD8 T cells in a mouse model of cell-based immunotherapy. Pharmacologic inhibition of Akt represents a novel immunometabolomic approach to enhance the persistence of anti-tumor T cells and improve the efficacy of cell-based immunotherapy for metastatic cancer. PMID:25432172

  5. Specific inhibition of the ABCG2 transporter could improve the efficacy of photodynamic therapy.

    Science.gov (United States)

    Bebes, Attila; Nagy, Tünde; Bata-Csörgo, Zsuzsanna; Kemény, Lajos; Dobozy, Attila; Széll, Márta

    2011-11-01

    Photodynamic therapy is based on the selective accumulation of a photosensitizer in tumors, followed by destruction of the target tissue by a light source. Protoporphyrin IX, a well-known photosensitizer, was recently reported as an endogenous substrate for the multidrug transporter ABCG2. We investigated the role of ABCG2 protein in the porphyrin extrusion ability of keratinocytes, with regard to the impact of the specific inhibition of ABCG2 by a non-toxic fumitremorgin C analog, Ko-134, on photodynamic therapy efficacy. We studied the level of porphyrin accumulation in response to delta-aminolevulinic acid pretreatment in proliferating and highly differentiated HaCaT keratinocytes. An in vitro model of photodynamic therapy on HaCaT cells was established with a therapeutically approved narrow-bandwidth red-light source. The porphyrin extrusion ability of HaCaT cells proved to correlate with their ABCG2 expression which was higher in proliferating cells than in differentiated cells. Moreover, the specific inhibition of ABCG2 by Ko-134 enhanced the sensitivity of keratinocytes to photodynamic therapy in vitro. These results suggest that ABCG2 may serve as a target molecule via which to improve the photodynamic therapy of skin lesions: its inhibition by the non-toxic Ko-134 is a promising therapeutic modality.

  6. GDE2 regulates subtype-specific motor neuron generation through inhibition of Notch signaling.

    Science.gov (United States)

    Sabharwal, Priyanka; Lee, Changhee; Park, Sungjin; Rao, Meenakshi; Sockanathan, Shanthini

    2011-09-22

    The specification of spinal interneuron and motor neuron identities initiates within progenitor cells, while motor neuron subtype diversification is regulated by hierarchical transcriptional programs implemented postmitotically. Here we find that mice lacking GDE2, a six-transmembrane protein that triggers motor neuron generation, exhibit selective losses of distinct motor neuron subtypes, specifically in defined subsets of limb-innervating motor pools that correlate with the loss of force-generating alpha motor neurons. Mechanistically, GDE2 is expressed by postmitotic motor neurons but utilizes extracellular glycerophosphodiester phosphodiesterase activity to induce motor neuron generation by inhibiting Notch signaling in neighboring motor neuron progenitors. Thus, neuronal GDE2 controls motor neuron subtype diversity through a non-cell-autonomous feedback mechanism that directly regulates progenitor cell differentiation, implying that subtype specification initiates within motor neuron progenitor populations prior to their differentiation into postmitotic motor neurons.

  7. Specific Inhibition of β-Secretase Processing of the Alzheimer Disease Amyloid Precursor Protein

    Directory of Open Access Journals (Sweden)

    Saoussen Ben Halima

    2016-03-01

    Full Text Available Development of disease-modifying therapeutics is urgently needed for treating Alzheimer disease (AD. AD is characterized by toxic β-amyloid (Aβ peptides produced by β- and γ-secretase-mediated cleavage of the amyloid precursor protein (APP. β-secretase inhibitors reduce Aβ levels, but mechanism-based side effects arise because they also inhibit β-cleavage of non-amyloid substrates like Neuregulin. We report that β-secretase has a higher affinity for Neuregulin than it does for APP. Kinetic studies demonstrate that the affinities and catalytic efficiencies of β-secretase are higher toward non-amyloid substrates than toward APP. We show that non-amyloid substrates are processed by β-secretase in an endocytosis-independent manner. Exploiting this compartmentalization of substrates, we specifically target the endosomal β-secretase by an endosomally targeted β-secretase inhibitor, which blocked cleavage of APP but not non-amyloid substrates in many cell systems, including induced pluripotent stem cell (iPSC-derived neurons. β-secretase inhibitors can be designed to specifically inhibit the Alzheimer process, enhancing their potential as AD therapeutics without undesired side effects.

  8. Evaluation of cytotoxicity of aqueous extract of Graviola leaves on squamous cell carcinoma cell-25 cell lines by 3-(4,5-dimethylthiazol-2-Yl -2,5-diphenyltetrazolium bromide assay and determination of percentage of cell inhibition at G2M phase of cell cycle by flow cytometry: An in vitro study

    Directory of Open Access Journals (Sweden)

    Visveswaraiah Paranjyothi Magadi

    2015-01-01

    Full Text Available Introduction: Malignancies constitute a wide variety of disorders having high mortality and morbidity rates. Current protocols for management include surgical intervention, chemotherapy, and radiation which possess numerous adverse effects. Many phytochemicals are available with anticancer properties similar to anticancer drugs. Major benefit of these compounds is apparent lack of toxicity to normal tissues. Graviola (botanical name: Annona Muricata contain bioactive compound “annonaceous acetogenins” known for anticancer activity on cancer cell lines. Aims: To determine cytotoxicity of Graviola and percentage cell inhibition at G2M phase of cell cycle. Settings and Design: The cytotoxicity of aqueous extract of Graviola leaves on squamous cell carcinoma (SCC-25 cell lines at various concentrations evaluated using 3-(4,5-dimethylthiazol-2-Yl-2,5-diphenyltetrazolium bromide (MTT assay. The percentage of SCC-25 cell inhibition at G2M phase of cell cycle determined using flow cytometry. Methods: Graviola Leaves, American Type Culture Collection SCC-25 cell lines were procured from Skanda Laboratories, Bengaluru. The cytotoxicity of aqueous extract of Graviola on SCC-25 cells at various concentrations evaluated using MTT assay. The percentage of SCC-25 cell inhibition at G2M phase of cell cycle determined using flow cytometry. Statistical Analysis: Statistical analysis was done using one-way ANOVA. Results: MTT assay showed statistically significant (P < 0.001 dose-dependent inhibition of SCC-25 cell lines by Graviola with IC50 value of 12.42 μg/ml. Flow cytometry revealed that Graviola at 25 and 50 g/ml arrested 53.39% and 52.09% cells in G2M phase of cell cycle respectively, which was statistically significant. Conclusion: Graviola showed significant cytotoxic activity and percentage of cell inhibition at G2M phase cell cycle against SCC-25 cell lines.

  9. Conversion of Alcohols to Bromides by Trimethylsilane and lithium Bromide in Acetone

    Institute of Scientific and Technical Information of China (English)

    Wei Feng; Zhang Xiao-xia; Zhang Qing; Wang Ji-yu; Chen Dai-mo

    2004-01-01

    Conversion of alcohols to alkyl bromides is one of the most frequently used functional group transformation reactions. Phosphorus tribromide is one of the most popular classical reagents.Triphenylphosphine has been used in combination with bromine,carbon tetrabromide,N-halo imides and other bromide compounds as a mild reagents for the preparation of alkyl bromides.More reacently, halotrimethylsilanes were found to be useful for halogenation of alcohols. George A.Olah successfully converted alcohols to bromides with chlorotrimethylsilane/lithium bromide in acetonitrile. But in our research, we found that we got no bromides but methylation products when we planed to convered our substances to bromides according to Gerge's method. We did some experiments, and we found that when the substituent group in the 2-N was donor group,we got the methylation products,but when it was acceptor group,the bromide could be got.(Scheme 1).Then we did some experiments with several other solvents, we found excitedly that when the solvent was acetone ,the bromides could be got even the substituent group was donor.(Scheme 2).When we changed the substances to normal alcohols ,such as ethyl alcohol,benzyl alcohol,isopropyl alcohol and 3,4-dimethoxy benzyl alcohol,we also got the bromides.In conclusion, we found a simple method to convert alcohols to bromides with trimethylsilane/li thium bromide in acetone,which was better than Geroge's method.

  10. IL-35 inhibits HBV antigen-specific IFN-γ-producing CTLs in vitro.

    Science.gov (United States)

    Li, Xuefen; Tian, Li; Dong, Yuejiao; Zhu, Qiaoyun; Wang, Yiyin; Han, Wenzheng; Liu, Xia; Ni, Qin; Chen, Yu; Li, Lanjuan

    2015-09-01

    Interleukin (IL)-35 is an inhibitory cytokine consisting of IL-12A and Epstein-Barr virus-induced gene 3 (Ebi3) and is required by regulatory T-cells (Tregs) for maximal activity. During chronic hepatitis B virus (HBV) infection, Tregs have immunosuppressive effects on HBV-specific T helper (Th) cells, yet little is known about the complex regulation of Tregs and their contribution to the inadequate immune system response to the virus. In the present study, we investigated whether IL-35 is involved in HBV-related cellular immune responses. Cluster of differentiation (CD)4(+) T-cells from peripheral blood were derived from healthy volunteers, resolved HBV individuals and chronic active hepatitis B patients and stimulated with CD3/28-conjugated beads. We analysed mRNA and protein levels of IL-35 and assessed the inhibitory effect of IL-35 on HBV core antigen-specific cytotoxic T lymphocytes (CTLs), dendritic cells (DCs) and effector T-cells (Teffs). Correlation analyses between liver inflammation and HBV DNA load were conducted. Results show that chronic HBV patients harbour significantly higher levels of Ebi3 mRNA and protein in CD4(+) T-cells compared with healthy volunteers and resolved HBV individuals. IL-35 suppressed the proliferation of HBV antigen-specific CTLs and interferon (IFN)-γ production in vitro. Ex vivo, IL-35 decreased the proliferation of CD4(+)CD45RA(+) naïve T-cells, especially in CD4(+)CD25(-)CD45RA(+) naïve Teffs. IL-35 inhibited the expansion of CD11c(+) DCs. Our data indicate that IL-35 is highly expressed in chronic HBV CD4(+) T-cells and plays an important role in the inhibition of the cellular immune response in chronic HBV.

  11. Reversed phase-high performance liquid chromatographic method to measure migration of semivolatile compound, vanillin, in ipratropium bromide inhalation solution

    OpenAIRE

    Conkins, Dennis; Economou, Julia E; Boersma, James A; Dedhiya, Mehendra G; Hansen, Gordon

    1999-01-01

    Ipratropium bromide, a bronchodilator, is used as an inhalation solution. Commercial ipratropium bromide solution products are packaged in low-density polyethylene (LDPE) vials, through which semivolatile compounds are reported to migrate. In this article, a specific reversed phase-high performance liquid chromatographic method to assay vanillin, a semivolatile compound, in ipratropium bromide solution is described. The method was validated for a concentration range for vanillin from 30 ng/mL...

  12. AtOPR3 specifically inhibits primary root growth in Arabidopsis under phosphate deficiency.

    Science.gov (United States)

    Zheng, Hongyan; Pan, Xiaoying; Deng, Yuxia; Wu, Huamao; Liu, Pei; Li, Xuexian

    2016-01-01

    The primary root plays essential roles in root development, nutrient absorption, and root architectural establishment. Primary root growth is generally suppressed by phosphate (P) deficiency in A. thaliana; however, the underlying molecular mechanisms are largely elusive to date. We found that AtOPR3 specifically inhibited primary root growth under P deficiency via suppressing root tip growth at the transcriptional level, revealing an important novel function of AtOPR3 in regulating primary root response to the nutrient stress. Importantly, AtOPR3 functioned to down-regulate primary root growth under P limitation mostly by its own, rather than depending on the Jasmonic acid signaling pathway. Further, AtOPR3 interacted with ethylene and gibberellin signaling pathways to regulate primary root growth upon P deficiency. In addition, the AtOPR3's function in inhibiting primary root growth upon P limitation was also partially dependent on auxin polar transport. Together, our studies provide new insights into how AtOPR3, together with hormone signaling interactions, modulates primary root growth in coping with the environmental stress in Arabidopsis.

  13. Inhibitory effect of pinaverium bromide on gastrointestinal contractile activity in conscious dogs.

    Science.gov (United States)

    Itoh, Z; Takahashi, I

    1981-01-01

    The inhibitory effect of 4-(6-bromoveratryl)-4-(2-[2-(6,6-dimethyl-2-norpinyl)-ethoxy]-ethyl)-morpholinium hydroxide (pinaverium bromide), a quaternary ammonium derivative, on the contractile activity of the gastrointestinal tract from the stomach to the colon was investigated in six conscious dogs. Gastrointestinal motor activity was monitored by means of chronically implanted force transducers. Pinaverium bromide was continuously administered i.v. for 30 min in doses of 10 and 20 mg/kg/h during both the digestive and interdigestive states. It was found that pinaverium bromide strongly inhibited gastrointestinal contractile activity during both the digestive and interdigestive states; contractions in the stomach were most strongly inhibited; however, those in the small and large bowels were also significantly inhibited. No significant side effects in the circulatory and respiratory systems and the gastrointestinal tract such as nausea, vomiting or diarrhea were observed during and after the infusion of this agent. PMID:7197953

  14. Specific inhibition of secreted NRG1 types I-II by heparin enhances Schwann Cell myelination.

    Science.gov (United States)

    Eshed-Eisenbach, Yael; Gordon, Aaron; Sukhanov, Natalya; Peles, Elior

    2016-07-01

    Primary cultures of mixed neuron and Schwann cells prepared from dorsal root ganglia (DRG) are extensively used as a model to study myelination. These dissociated DRG cultures have the particular advantage of bypassing the difficulty in purifying mouse Schwann cells, which is often required when using mutant mice. However, the drawback of this experimental system is that it yields low amounts of myelin. Here we report a simple and efficient method to enhance myelination in vitro. We show that the addition of heparin or low molecular weight heparin to mixed DRG cultures markedly increases Schwann cells myelination. The myelin promoting activity of heparin results from specific inhibition of the soluble immunoglobulin (Ig)-containing isoforms of neuregulin 1 (i.e., NRG1 types I and II) that negatively regulates myelination. Heparin supplement provides a robust and reproducible method to increase myelination in a simple and commonly used culture system. GLIA 2016;64:1227-1234. PMID:27143444

  15. Potent and specific inhibition of SARS-CoV antigen expression by RNA interference

    Institute of Scientific and Technical Information of China (English)

    TAO Peng; ZHANG Jun; TANG Ni; ZHANG Bing-qiang; HE Tong-chuan; HUANG Ai-long

    2005-01-01

    Background Severe acute respiratory syndrome (SARS) is an infectious disease caused by SARS-CoV. There are no effective antiviral drugs for SARS although the epidemic of SARS was controlled. The aim of this study was to develop an RNAi (RNA interference) approach that specifically targeted the N gene sequence of severe acute respiratory syndrome associated coronavirus (SARS-CoV) by synthesizing short hairpin RNA (shRNA) in vivo, and to assess the inhibitory effect of this shRNA on SARS-CoV N antigen expression. Methods The eukaryotic expression plasmid pEGFP-C1-N, containing SARS-CoV N gene, was co-transfected into 293 cells with either the RNAi plasmid pshRNA-N or unrelated control plasmid pshRNA-HBV-C4. At 24, 48 and 72 hours post transfection, the green fluorescence was observed through a fluorescence microscope. The RNA levels of SARS-CoV N were determined by reverse transcription polymerase chain reaction (RT-PCR). The expression of Green Fluorescent Protein (GFP) and protein N were detected using Western blot.Results The vector, pshRNA-N expressing shRNA which targeted the N gene of SARS-CoV, was successfully constructed. The introduction of RNAi plasmid efficiently and specifically inhibited the synthesis of protein N. RT-PCR showed that RNAs of N gene were clearly reduced when the pEGFP-C1-N was cotransfected with pshRNA-N, whereas the control vector did not exhibit inhibitory effect on N gene transcription.Conclusions Our results demonstrate that RNAi mediated silencing of SARS-CoV gene could effectively inhibit expression of SARS-CoV antigen, hence RNAi based strategy should be further explored as a more efficacious antiviral therapy of SARS-CoV infection.

  16. NFκB-inducing kinase inhibits NFκB activity specifically in neurons of the CNS.

    Science.gov (United States)

    Mao, Xianrong; Phanavanh, Bounleut; Hamdan, Hamdan; Moerman-Herzog, Andréa M; Barger, Steven W

    2016-04-01

    The control of NFκB in CNS neurons appears to differ from that in other cell types. Studies have reported induction of NFκB in neuronal cultures and immunostaining in vivo, but others have consistently detected little or no transcriptional activation by NFκB in brain neurons. To test if neurons lack some component of the signal transduction system for NFκB activation, we transfected cortical neurons with several members of this signaling system along with a luciferase-based NFκB-reporter plasmid; RelA was cotransfected in some conditions. No component of the NFκB pathway was permissive for endogenous NFκB activity, and none stimulated the activity of exogenous RelA. Surprisingly, however, the latter was inhibited by cotransfection of NFκB-inducing kinase (NIK). Fluorescence imaging of RelA indicated that co-expression of NIK sequestered RelA in the cytoplasm, similar to the effect of IκBα. NIK-knockout mice showed elevated expression of an NFκB-reporter construct in neurons in vivo. Cortical neurons cultured from NIK-knockout mice showed elevated expression of an NFκB-reporter transgene. Consistent with data from other cell types, a C-terminal fragment of NIK suppressed RelA activity in astrocytes as well as neurons. Therefore, the inhibitory ability of the NIK C-terminus was unbiased with regard to cell type. However, inhibition of NFκB by full-length NIK is a novel outcome that appears to be specific to CNS neurons. This has implications for unique aspects of transcription in the CNS, perhaps relevant to aspects of development, neuroplasticity, and neuroinflammation. Full-length NIK was found to inhibit (down arrow) transcriptional activation of NFκB in neurons, while it elevated (up arrow) activity in astrocytes. Deletion constructs corresponding to the N-terminus or C-terminus also inhibited NFκB in neurons, while only the C-terminus did so in astrocytes. One possible explanation is that the inhibition in neurons occurs via two different

  17. Non-specific chemical inhibition of the Fanconi anemia pathway sensitizes cancer cells to cisplatin

    Directory of Open Access Journals (Sweden)

    Jacquemont Céline

    2012-04-01

    Full Text Available Abstract Background Platinum compounds such as cisplatin and carboplatin are DNA crosslinking agents widely used for cancer chemotherapy. However, the effectiveness of platinum compounds is often tempered by the acquisition of cellular drug resistance. Until now, no pharmacological approach has successfully overcome cisplatin resistance in cancer treatment. Since the Fanconi anemia (FA pathway is a DNA damage response pathway required for cellular resistance to DNA interstrand crosslinking agents, identification of small molecules that inhibit the FA pathway may reveal classes of chemicals that sensitize cancer cells to cisplatin. Results Through a cell-based screening assay of over 16,000 chemicals, we identified 26 small molecules that inhibit ionizing radiation and cisplatin-induced FANCD2 foci formation, a marker of FA pathway activity, in multiple human cell lines. Most of these small molecules also compromised ionizing radiation-induced RAD51 foci formation and homologous recombination repair, indicating that they are not selective toward the regulation of FANCD2. These compounds include known inhibitors of the proteasome, cathepsin B, lysosome, CHK1, HSP90, CDK and PKC, and several uncharacterized chemicals including a novel proteasome inhibitor (Chembridge compound 5929407. Isobologram analyses demonstrated that half of the identified molecules sensitized ovarian cancer cells to cisplatin. Among them, 9 demonstrated increased efficiency toward FA pathway-proficient, cisplatin-resistant ovarian cancer cells. Six small molecules, including bortezomib (proteasome inhibitor, CA-074-Me (cathepsin B inhibitor and 17-AAG (HSP90 inhibitor, synergized with cisplatin specifically in FA-proficient ovarian cancer cells (2008 + FANCF, but not in FA-deficient isogenic cells (2008. In addition, geldanamycin (HSP90 inhibitor and two CHK1 inhibitors (UCN-01 and SB218078 exhibited a significantly stronger synergism with cisplatin in FA

  18. Natamycin Inhibits Vacuole Fusion at the Priming Phase via a Specific Interaction with Ergosterol▿

    Science.gov (United States)

    te Welscher, Yvonne Maria; Jones, Lynden; van Leeuwen, Martin Richard; Dijksterhuis, Jan; de Kruijff, Ben; Eitzen, Gary; Breukink, Eefjan

    2010-01-01

    The antifungal antibiotic natamycin belongs to the family of polyene antibiotics. Its antifungal activity arises via a specific interaction with ergosterol in the plasma membrane (te Welscher et al., J. Biol. Chem. 283:6393-6401, 2008). However, this activity does not involve disruption of the membrane barrier function, a well-known property of other members of the polyene antibiotic family, such as filipin and nystatin. Here we tested the effect of natamycin on vacuole membrane fusion, which is known to be ergosterol dependent. Natamycin blocked the fusion of isolated vacuoles without compromising the barrier function of the vacuolar membrane. Sublethal doses of natamycin perturbed the cellular vacuole morphology, causing the formation of many more small vacuolar structures in yeast cells. Using vacuoles isolated from yeast strains deficient in the ergosterol biosynthesis pathway, we showed that the inhibitory activity of natamycin was dependent on the presence of specific chemical features in the structure of ergosterol that allow the binding of natamycin. We found that natamycin inhibited the priming stage of vacuole fusion. Similar results were obtained with nystatin. These results suggest a novel mode of action of natamycin and perhaps all polyene antibiotics, which involves the impairment of membrane fusion via perturbation of ergosterol-dependent priming reactions that precede membrane fusion, and they may point to an effect of natamycin on ergosterol-dependent protein function in general. PMID:20385867

  19. Natamycin inhibits vacuole fusion at the priming phase via a specific interaction with ergosterol.

    Science.gov (United States)

    te Welscher, Yvonne Maria; Jones, Lynden; van Leeuwen, Martin Richard; Dijksterhuis, Jan; de Kruijff, Ben; Eitzen, Gary; Breukink, Eefjan

    2010-06-01

    The antifungal antibiotic natamycin belongs to the family of polyene antibiotics. Its antifungal activity arises via a specific interaction with ergosterol in the plasma membrane (te Welscher et al., J. Biol. Chem. 283:6393-6401, 2008). However, this activity does not involve disruption of the membrane barrier function, a well-known property of other members of the polyene antibiotic family, such as filipin and nystatin. Here we tested the effect of natamycin on vacuole membrane fusion, which is known to be ergosterol dependent. Natamycin blocked the fusion of isolated vacuoles without compromising the barrier function of the vacuolar membrane. Sublethal doses of natamycin perturbed the cellular vacuole morphology, causing the formation of many more small vacuolar structures in yeast cells. Using vacuoles isolated from yeast strains deficient in the ergosterol biosynthesis pathway, we showed that the inhibitory activity of natamycin was dependent on the presence of specific chemical features in the structure of ergosterol that allow the binding of natamycin. We found that natamycin inhibited the priming stage of vacuole fusion. Similar results were obtained with nystatin. These results suggest a novel mode of action of natamycin and perhaps all polyene antibiotics, which involves the impairment of membrane fusion via perturbation of ergosterol-dependent priming reactions that precede membrane fusion, and they may point to an effect of natamycin on ergosterol-dependent protein function in general. PMID:20385867

  20. [Manometric effects of pinaverium bromide in irritable bowel syndrome].

    Science.gov (United States)

    Soifer, L; Varela, E; Olmos, J

    1992-01-01

    The effects of pinaverium bromide on colonic motility were investigated in a controlled, controlled, cross-over study in 32 patients with irritable bowel syndrome. Constipation was clearly predominant in one group of 16 patients, and diarrhea in the other group of 16. Manometric measurements were taken of the colonic motor response generated by distention of a balloon inserted to the rectosigmoid junction. Measurements were taken before and one hour after ingestion of two tablets containing placebo or two tablets each containing 50 mg of pinaverium bromide. Following intake of placebo the motility index increased from the basal value in patients with constipation, and resistance to distention decreased in the diarrhea group. These changes were attributable to repetition of the mechanical stimulus within a relatively brief time lapse, or more probably to the ingestion of liquid which accompanied intake of tablets. Compared with placebo, pinaverium bromide induced inhibition of both effects. From the therapeutic point of view, the decrease in motility index seen in patients with irritable bowel syndrome and constipation is particularly interesting. PMID:1295286

  1. Growth-arrest-specific protein 2 inhibits cell division in Xenopus embryos.

    Directory of Open Access Journals (Sweden)

    Tong Zhang

    Full Text Available BACKGROUND: Growth-arrest-specific 2 gene was originally identified in murine fibroblasts under growth arrest conditions. Furthermore, serum stimulation of quiescent, non-dividing cells leads to the down-regulation of gas2 and results in re-entry into the cell cycle. Cytoskeleton rearrangements are critical for cell cycle progression and cell division and the Gas2 protein has been shown to co-localize with actin and microtubules in interphase mammalian cells. Despite these findings, direct evidence supporting a role for Gas2 in the mechanism of cell division has not been reported. METHODOLOGY AND PRINCIPAL FINDINGS: To determine whether the Gas2 protein plays a role in cell division, we over-expressed the full-length Gas2 protein and Gas2 truncations containing either the actin-binding CH domain or the tubulin-binding Gas2 domain in Xenopus laevis embryos. We found that both the full-length Gas2 protein and the Gas2 domain, but not the CH domain, inhibited cell division and resulted in multinucleated cells. The observation that Gas2 domain alone can arrest cell division suggests that Gas2 function is mediated by microtubule binding. Gas2 co-localized with microtubules at the cell cortex of Gas2-injected Xenopus embryos using cryo-confocal microscopy and co-sedimented with microtubules in cytoskeleton co-sedimentation assays. To investigate the mechanism of Gas2-induced cell division arrest, we showed, using a wound-induced contractile array assay, that Gas2 stabilized microtubules. Finally, electron microscopy studies demonstrated that Gas2 bundled microtubules into higher-order structures. CONCLUSION AND SIGNIFICANCE: Our experiments show that Gas2 inhibits cell division in Xenopus embryos. We propose that Gas2 function is mediated by binding and bundling microtubules, leading to cell division arrest.

  2. The effect of conditioned inhibition on the specific Pavlovian-instrumental transfer effect.

    Science.gov (United States)

    Alarcón, Daniel; Bonardi, Charlotte

    2016-01-01

    Four experiments examined the effect of Pavlovian conditioned inhibition on specific Pavlovian-instrumental transfer (PIT) in human participants. The task comprised an instrumental phase in which 2 responses (R1, R2) were each paired with 1 of 2 outcomes (O1, O2: R1→O1, R2→O2), and a Pavlovian phase, in which 2 conditioned stimuli (CSs), CS1 and CS2 each signaled 1 of the 2 outcomes (CS1→O1, CS2→O2). In Experiments 1-2 a conditioned inhibitor, X, predicted the omission of 1 of the outcomes (e.g., CS1→O1, CS1X→nothing). In a subsequent test, performance of R1 and R2 was examined in the presence of CS1 and CS2. A specific PIT effect was observed: R1 was performed more than R2 during CS1, and R2 more than R1 during CS2. This PIT effect was significantly reduced by the presence of the inhibitor X in Experiment 1, in which the Pavlovian phase followed the instrumental phase, and in Experiment 2 in which it preceded it. No such effect was observed when X was presented in the absence of any expectation of the outcomes during the PIT test (Experiment 3a), or when X was trained as a signal for an alternative outcome (Experiment 3b). These results are consistent with the suggestion that the specific PIT effect occurs through a stimulus-outcome-response (S-O-R) mechanism, according to which the CS evokes a representation of the outcome which in turn elicits the response (e.g., CS1→O1→R1). The conditioned inhibitor suppresses performance of the response by suppressing activation of the outcome representation.

  3. In vivo transcription of a progesterone-responsive gene is specifically inhibited by a triplex-forming oligonucleotide.

    OpenAIRE

    Ing, N H; Beekman, J M; Kessler, D J; Murphy, M.; Jayaraman, K; Zendegui, J G; Hogan, M E; O'Malley, B W; Tsai, M J

    1993-01-01

    Oligonucleotides provide novel reagents for inhibition of gene expression because of their high affinity binding to specific nucleotide sequences. We describe a 38 base, single-stranded DNA that forms a triple helix or 'triplex' on progesterone response elements of a target gene. This triplex-forming oligonucleotide binds with a Kd = 100 nM at 37 degrees C and physiological pH, and blocks binding of progesterone receptors to the target. Furthermore, it completely inhibited progesterone recept...

  4. Lysine-specific histone demethylase 1 inhibition promotes reprogramming by facilitating the expression of exogenous transcriptional factors and metabolic switch.

    Science.gov (United States)

    Sun, Hao; Liang, Lining; Li, Yuan; Feng, Chengqian; Li, Lingyu; Zhang, Yixin; He, Songwei; Pei, Duanqing; Guo, Yunqian; Zheng, Hui

    2016-01-01

    Lysine-specific histone demethylase 1 (LSD1) regulates histone methylation and influences the epigenetic state of cells during the generation of induced pluripotent stem cells (iPSCs). Here we reported that LSD1 inhibition via shRNA or specific inhibitor, tranylcypromine, promoted reprogramming at early stage via two mechanisms. At early stage of reprogramming, LSD1 inhibition increased the retrovirus-mediated exogenous expression of Oct4, Klf4, and Sox2 by blocking related H3K4 demethylation. Since LSD1 inhibition still promoted reprogramming even when iPSCs were induced with small-molecule compounds in a virus-free system, additional mechanisms should be involved. When RNA-seq was used for analysis, it was found that LSD1 inhibition reversed some gene expression changes induced by OKS, which subsequently promoted reprogramming. For example, by partially rescuing the decreased expression of Hif1α, LSD1 inhibition reversed the up-regulation of genes in oxidative phosphorylation pathway and the down-regulation of genes in glycolysis pathway. Such effects facilitated the metabolic switch from oxidative phosphorylation to glycolysis and subsequently promoted iPSCs induction. In addition, LSD1 inhibition also promoted the conversion from pre-iPSCs to iPSCs by facilitating the similar metabolic switch. Therefore, LSD1 inhibition promotes reprogramming by facilitating the expression of exogenous transcriptional factors and metabolic switch. PMID:27481483

  5. Antidepressant drugs specifically inhibiting noradrenaline reuptake enhance recognition memory in rats.

    Science.gov (United States)

    Feltmann, Kristin; Konradsson-Geuken, Åsa; De Bundel, Dimitri; Lindskog, Maria; Schilström, Björn

    2015-12-01

    Patients suffering from major depression often experience memory deficits even after the remission of mood symptoms, and many antidepressant drugs do not affect, or impair, memory in animals and humans. However, some antidepressant drugs, after a single dose, enhance cognition in humans (Harmer et al., 2009). To compare different classes of antidepressant drugs for their potential as memory enhancers, we used a version of the novel object recognition task in which rats spontaneously forget objects 24 hr after their presentation. Antidepressant drugs were injected systemically 30 min before or directly after the training phase (Session 1 [S1]). Post-S1 injections were used to test for specific memory-consolidation effects. The noradrenaline reuptake inhibitors reboxetine and atomoxetine, as well as the serotonin noradrenaline reuptake inhibitor duloxetine, injected prior to S1 significantly enhanced recognition memory. In contrast, the serotonin reuptake inhibitors citalopram and paroxetine and the cyclic antidepressant drugs desipramine and mianserin did not enhance recognition memory. Post-S1 injection of either reboxetine or citalopram significantly enhanced recognition memory, indicating an effect on memory consolidation. The fact that citalopram had an effect only when injected after S1 suggests that it may counteract its own consolidation-enhancing effect by interfering with memory acquisition. However, pretreatment with citalopram did not attenuate reboxetine's memory-enhancing effect. The D1/5-receptor antagonist SCH23390 blunted reboxetine's memory-enhancing effect, indicating a role of dopaminergic transmission in reboxetine-induced recognition memory enhancement. Our results suggest that antidepressant drugs specifically inhibiting noradrenaline reuptake enhance cognition and may be beneficial in the treatment of cognitive symptoms of depression. PMID:26501179

  6. Specificity of prenatal cocaine on inhibition of locus coeruleus neurite outgrowth.

    Science.gov (United States)

    Dey, S; Mactutus, C F; Booze, R M; Snow, D M

    2006-01-01

    Prenatal cocaine exposure induces alterations in attentional function that presumably involve locus coeruleus noradrenergic neurons and their projections. Previous reports indicate that embryonic rat locus coeruleus neurons exposed to cocaine, both in vitro and in vivo, showed in decreased cell survival and inhibition of neurite outgrowth, and that the effects were most deleterious during early gestation. The present study performed in vitro addressed the specificity of the inhibitory effects of cocaine by comparing locus coeruleus neurite formation and extension to that of dopaminergic substantia nigra neurons following exposure to a physiologically-relevant dose of cocaine (500 ng/ml, two times a day, for four days) during peak neuritogenesis. Following cocaine treatment, immunocytochemistry (anti-norepinephrine antibody to locus coeruleus; anti-tyrosine hydroxylase antibody to substantia nigra) and image analysis were performed to measure a variety of neurite outgrowth parameters. For locus coeruleus neurons, cocaine treatment decreased the 1) number of cells initiating neurites [Pcocaine for any of the parameters examined. More importantly, a significant interaction between cocaine treatment and brain region was observed [Pcocaine exposure. These data support our hypothesis that cocaine targets the noradrenergic system by negatively regulating locus coeruleus neuronal outgrowth, which likely affects pathfinding, synaptic connectivity, and ultimately attentional behavior in cocaine-exposed offspring. PMID:16483722

  7. Specific amino acids inhibit food intake via the area postrema or vagal afferents.

    Science.gov (United States)

    Jordi, Josua; Herzog, Brigitte; Camargo, Simone M R; Boyle, Christina N; Lutz, Thomas A; Verrey, François

    2013-11-15

    To maintain nutrient homeostasis the central nervous system integrates signals that promote or inhibit eating. The supply of vital amino acids is tuned by adjusting food intake according to its dietary protein content. We hypothesized that this effect is based on the sensing of individual amino acids as a signal to control food intake. Here, we show that food intake was most potently reduced by oral L-arginine (Arg), L-lysine (Lys) and L-glutamic acid (Glu) compared to all other 17 proteogenic amino acids in rats. These three amino acids induced neuronal activity in the area postrema and the nucleus of the solitary tract. Surgical lesion of the area postrema abolished the anorectic response to Arg and Glu, whereas vagal afferent lesion prevented the response to Lys. These three amino acids also provoked gastric distension by differentially altering gastric secretion and/or emptying. Importantly, these peripheral mechanical vagal stimuli were dissociated from the amino acids' effect on food intake. Thus, Arg, Lys and Glu had a selective impact on food processing and intake suggesting them as direct sensory input to assess dietary protein content and quality in vivo. Overall, this study reveals novel amino acid-specific mechanisms for the control of food intake and of gastrointestinal function.

  8. Investigation of drug interactions with pinaverium bromide.

    Science.gov (United States)

    Devred, C; Godeau, P; Guerot, C; Librez, P; Mougeot, G; Orsetti, A; Segrestaa, J M

    1986-01-01

    A series of studies was carried out at 6 centres to investigate possible drug interaction between the spasmolytic, pinaverium bromide, and cardiac glycosides, anticoagulants and hypoglycaemic agents given to patients as part of the long-term treatment of their condition. The results of clinical and laboratory investigations did not show any evidence of pinaverium bromide interfering with the action or activity of any of the drugs studied. PMID:3084176

  9. Betulinic acid selectively increases protein degradation and enhances prostate cancer-specific apoptosis: possible role for inhibition of deubiquitinase activity.

    Directory of Open Access Journals (Sweden)

    Teresita Reiner

    Full Text Available Inhibition of the ubiquitin-proteasome system (UPS of protein degradation is a valid anti-cancer strategy and has led to the approval of bortezomib for the treatment of multiple myeloma. However, the alternative approach of enhancing the degradation of oncoproteins that are frequently overexpressed in cancers is less developed. Betulinic acid (BA is a plant-derived small molecule that can increase apoptosis specifically in cancer but not in normal cells, making it an attractive anti-cancer agent. Our results in prostate cancer suggested that BA inhibited multiple deubiquitinases (DUBs, which resulted in the accumulation of poly-ubiquitinated proteins, decreased levels of oncoproteins, and increased apoptotic cell death. In normal fibroblasts, however, BA did not inhibit DUB activity nor increased total poly-ubiquitinated proteins, which was associated with a lack of effect on cell death. In the TRAMP transgenic mouse model of prostate cancer, treatment with BA (10 mg/kg inhibited primary tumors, increased apoptosis, decreased angiogenesis and proliferation, and lowered androgen receptor and cyclin D1 protein. BA treatment also inhibited DUB activity and increased ubiquitinated proteins in TRAMP prostate cancer but had no effect on apoptosis or ubiquitination in normal mouse tissues. Overall, our data suggests that BA-mediated inhibition of DUBs and induction of apoptotic cell death specifically in prostate cancer but not in normal cells and tissues may provide an effective non-toxic and clinically selective agent for chemotherapy.

  10. Uptake of ozone to mixed sodium bromide/ citric acid solutions

    Science.gov (United States)

    Lee, Ming-Tao; Steimle, Emilie; Bartels-Rausch, Thorsten; Kato, Shunsuke; Lampimäki, Markus; Brown, Matthew; van Bokhoven, Jeroen; Nolting, Frithjof; Kleibert, Armin; Türler, Andreas; Ammann, Markus

    2013-04-01

    Sea-salt solution - air interfaces play an important role in the chemistry of the marine boundary layer. The reaction of ozone (O3) with bromide is of interest in the context of formation of photolabile halogens (Br2, BrCl) in the marine boundary layer. Recent experiments have suggested that the bromide oxidation rate is related to the surface concentration of bromide [1] and inversely related to the gas phase concentration of O3, an indication for a precursor mediated reaction at the surface [2]. So far, the effect of organics (such as those occurring at the ocean surface or in marine aerosols) on the reaction of O3 with bromide aerosols has not been studied yet. In our study we investigate the uptake kinetics of O3 to a mixed solution of sodium bromide (NaBr) and citric acid (CA), which represents highly oxidized organic compounds present in the environment, with a well-established coated wall flow tube technique, which leads to exposure of the film to O3 allowing the heterogeneous reactions to take place and the loss of O3 being measured. The results indicate that the uptake of O3 to the films with the higher bromide concentrations (0.34M and 4M) is independent of the gas phase concentration and roughly consistent with uptake limited by reaction in the bulk. For the lower bromide concentration (84mM), however, we observe a trend of the uptake coefficient to decrease with increasing O3 concentration, indicating an increasing importance of a surface reaction. In an attempt to constrain the kinetic data, we employed X-ray photoelectron spectroscopy (XPS) to get insight into the surface composition of the aqueous solution - air interface. Previous XPS studies have shown that halide ion concentrations are enhanced at the aqueous solution air interface [3-4], which likely promotes the surface reactions of bromide or iodide with O3. A first XPS study of ternary solutions of KI with butanol indicated the importance of specific interactions of the cation with the alcohol

  11. Tribenuron-Methyl Induces Male Sterility through Anther-Specific Inhibition of Acetolactate Synthase Leading to Autophagic Cell Death.

    Science.gov (United States)

    Zhao, Lun; Jing, Xue; Chen, Li; Liu, Yingjun; Su, Yanan; Liu, Tingting; Gao, Changbin; Yi, Bin; Wen, Jing; Ma, Chaozhi; Tu, Jinxing; Zou, Jitao; Fu, Tingdong; Shen, Jinxiong

    2015-12-01

    Tribenuron-methyl (TM) is a powerful sulfonylurea herbicide that inhibits branched-chain amino acid (BCAA) biosynthesis by targeting the catalytic subunit (CSR1) of acetolactate synthase (ALS). Selective induction of male sterility by foliar spraying of TM at low doses has been widely used for hybrid seed production in rapeseed (Brassica napus); however, the underlying mechanism remains unknown. Here, we report greater TM accumulation and subsequent stronger ALS inhibition and BCAA starvation in anthers than in leaves and stems after TM application. Constitutive or anther-specific expression of csr1-1D (a CSR1 mutant) eliminated anther-selective ALS inhibition and reversed the TM-induced male sterile phenotype in both rapeseed and Arabidopsis. The results of TM daub-stem experiments, combined with the observations of little TM accumulation in anthers and reversion of TM-induced male sterility by targeted expression of the TM metabolism gene Bel in either the mesophyll or phloem, suggested that foliar-sprayed TM was polar-transported to anthers mainly through the mesophyll and phloem. Microscopy and immunoblotting revealed that autophagy, a bulk degradation process induced during cell death, was elevated in TM-induced male sterile anthers and by anther-specific knockdown of ALS. Moreover, TM-induced pollen abortion was significantly inhibited by the autophagy inhibitor 3-MA. These data suggested that TM was polar-transported to anthers, resulting in BCAA starvation via anther-specific ALS inhibition and, ultimately, autophagic cell death in anthers. PMID:26362932

  12. BDNF deficiency and young-adult methamphetamine induce sex-specific effects on prepulse inhibition regulation

    Directory of Open Access Journals (Sweden)

    Elizabeth E Manning

    2013-06-01

    Full Text Available Brain-derived neurotrophic factor (BDNF has been implicated in the pathophysiology of schizophrenia, yet its role in the development of specific symptoms is unclear. Methamphetamine (METH users have an increased risk of psychosis and schizophrenia, and METH-treated animals have been used extensively as a model to study the positive symptoms of schizophrenia. We investigated whether METH treatment in BDNF heterozygous mutant mice (HET has cumulative effects on sensorimotor gating, including the disruptive effects of psychotropic drugs. BDNF HETs and WT littermates were treated during young-adulthood with METH and, following a two-week break, prepulse inhibition (PPI was examined. At baseline, BDNF HETs showed reduced PPI compared to WT mice irrespective of METH pre-treatment. An acute challenge with amphetamine (AMPH disrupted PPI but male BDNF HETs were more sensitive to this effect, irrespective of METH pre-treatment. In contrast, female mice treated with METH were less sensitive to the disruptive effects of AMPH, and there were no effects of BDNF genotype. Similar changes were not observed in the response to an acute apomorphine or MK-801 challenge. These results show that genetically-induced reduction of BDNF caused changes in a behavioural endophenotype relevant to the positive symptoms of schizophrenia. However, major sex differences were observed in the effects of a psychotropic drug challenge on this behaviour. These findings suggest sex differences in the effects of BDNF depletion and METH treatment on the monoamine signaling pathways that regulate PPI. Given that these same pathways are thought to contribute to the expression of positive symptoms in schizophrenia, this work suggests that there may be significant sex differences in the pathophysiology underlying these symptoms. Elucidating these sex differences may be important for our understanding of the neurobiology of schizophrenia and developing better treatments strategies for the

  13. In vitro induction of tumor-specific immunity. VI: analysis of specificity of immune response by cellular competitive inhibition: limitations and advantages of the technique.

    Science.gov (United States)

    Chism, S E; Burton, R C; Grail, D L; Bell, P M; Warner, N L

    1977-01-01

    The cellular competitive inhibition 51Cr-release assay makes two distinct contributions to the in vitro study of cell-mediated immunity. It allows target cells which are not amenable to isotopic labelling to be investigated for their antigenic specificity, and it provides a means, complementary to the direct cytotoxicity assay, of estimating qualitative and quantitative differences in antigen expression on intact normal and neoplastic cells. Various parameters of a micro-51Cr-release inhibition assay have been studied, and it was found that the assay conditions markedly influenced both the sensitivity and specificity. It is concluded that optimal assay conditions for specificity include: 1) moderate levels of lysis on the linear part of the CL/T titration curve, 2) avoidance of prolonged assay times, and 3) low ratios of blocker to target cells. When tumor cells with large cell volumes are used as competitive inhibitor (blocker) cells, non-specific blocking will occur; limits have been defined for this particular micro-inhibition assay which, in general, exclude these effects.

  14. Epitope specificity and isotype of monoclonal anti-D antibodies dictate their ability to inhibit phagocytosis of opsonized platelets.

    Science.gov (United States)

    Kjaersgaard, Mimi; Aslam, Rukhsana; Kim, Michael; Speck, Edwin R; Freedman, John; Stewart, Donald I H; Wiersma, Erik J; Semple, John W

    2007-08-15

    Rh immune globulin (WinRho SDF; Cangene, Mississauga, ON, Canada) is an effective treatment for autoimmune thrombocytopenic purpura; however, maintaining a sustained supply for its use in autoimmune thrombocytopenic purpura and its primary indication, hemolytic disease of the newborn, makes the development of alternative reagents desirable. We compared Rh immune globulin and 6 human monoclonal anti-D antibodies (MoAnti-D) with differing isotypes and specificities for their ability to opsonize erythrocytes and inhibit platelet phagocytosis in an in vitro assay. Results demonstrated that opsonization of erythrocytes with Rh immune globulin significantly (P < .001) reduced phagocytosis of fluorescently labeled opsonized platelets in an Fc-dependent manner. Of the MoAnti-D that shared specificity but differed in isotype, only IgG3 antibodies could significantly (P < .001) inhibit platelet phagocytosis. In contrast, 2 MoAnti-D shared isotypes and differed in specificity; however, only one could significantly (P < .001) inhibit platelet phagocytosis. The results suggest that MoAnti-D epitope specificity and isotypes are critical requirements for optimal inhibition of opsonized platelet phagocytosis. PMID:17456719

  15. ADAMTS1 inhibits lymphangiogenesis by attenuating phosphorylation of the lymphatic endothelial cell-specific VEGF receptor

    Energy Technology Data Exchange (ETDEWEB)

    Inagaki, Junko; Takahashi, Katsuyuki; Ogawa, Hiroko; Asano, Keiichi; Faruk Hatipoglu, Omer; Zeynel Cilek, Mehmet; Obika, Masanari; Ohtsuki, Takashi [Department of Molecular Biology and Biochemistry, Okayama University Graduate School of Medicine, Dentistry and Pharmaceutical Sciences, Okayama (Japan); Hofmann, Matthias [Department of Dermatology, Venereology and Allergology, Goethe University, Frankfurt (Germany); Kusachi, Shozo [Department of Medical Technology, Okayama University Graduate School of Health Sciences, Okayama (Japan); Ninomiya, Yoshifumi [Department of Molecular Biology and Biochemistry, Okayama University Graduate School of Medicine, Dentistry and Pharmaceutical Sciences, Okayama (Japan); Hirohata, Satoshi, E-mail: hirohas@cc.okayama-u.ac.jp [Department of Molecular Biology and Biochemistry, Okayama University Graduate School of Medicine, Dentistry and Pharmaceutical Sciences, Okayama (Japan); International Center, Okayama University, Okayama (Japan)

    2014-05-01

    Angiogenesis and lymphangiogenesis play roles in malignant tumor progression, dissemination, and metastasis. ADAMTS1, a member of the matrix metalloproteinase family, is known to inhibit angiogenesis. Recombinant ADAMTS1 was shown to strongly inhibit angiogenesis. We investigated whether ADAMTS1 inhibited lymphangiogenesis in the present study. We examined cell proliferation and cell migration in normal human dermal lymphatic microvascular endothelial cells (HMVEC-dLy) transduced with or without adenoviral human ADAMTS1 gene therapy. We then examined the VEGFC/VEGFR3 signal transduction pathway in ADAMTS1-transduced HMVEC-dLy. Cell proliferation and tube formation in Matrigel were significantly lower with transduced ADAMTS1 than with control (non-transduced HMVEC-dLy). The phosphorylation of VEGFR3 was also attenuated by ADAMTS1 gene therapy in HMVEC-dLy. Immunoprecipitation assays revealed that ADAMTS1 formed a complex with VEGFC. Our results demonstrated that ADAMTS1 inhibited lymphangiogenesis in vitro. The data highlight the new function of ADAMTS1 in the regulation of lymphangiogenesis and the therapeutic potential of ADAMTS1 in cancer therapy. - Highlights: • ADAMTS1 significantly inhibited tube formation and cell proliferation in HMVEC-dLy. • Reduced lymph endothelial cell migration in ADAMTS1 transduced co-culture systems. • VEGFC-stimulated phosphorylation of VEGFR3 is attenuated by ADAMTS1. • Reduced phosphorylation of Akt and ERK1/2 in ADAMTS1 treated HMVEC-dLy. • ADAMTS1 binds directly to VEGFC.

  16. Lumican Inhibits SNAIL-Induced Melanoma Cell Migration Specifically by Blocking MMP-14 Activity

    Science.gov (United States)

    Stasiak, Marta; Boncela, Joanna; Perreau, Corinne; Karamanou, Konstantina; Chatron-Colliet, Aurore; Proult, Isabelle; Przygodzka, Patrycja; Chakravarti, Shukti; Maquart, François-Xavier; Kowalska, M. Anna; Wegrowski, Yanusz; Brézillon, Stéphane

    2016-01-01

    Lumican, a small leucine rich proteoglycan, inhibits MMP-14 activity and melanoma cell migration in vitro and in vivo. Snail triggers epithelial-mesenchymal transitions endowing epithelial cells with migratory and invasive properties during tumor progression. The aim of this work was to investigate lumican effects on MMP-14 activity and migration of Snail overexpressing B16F1 (Snail-B16F1) melanoma cells and HT-29 colon adenocarcinoma cells. Lumican inhibits the Snail induced MMP-14 activity in B16F1 but not in HT-29 cells. In Snail-B16F1 cells, lumican inhibits migration, growth, and melanoma primary tumor development. A lumican-based strategy targeting Snail-induced MMP-14 activity might be useful for melanoma treatment. PMID:26930497

  17. Nox2 B-loop Peptide, Nox2ds, Specifically Inhibits Nox2 Oxidase

    OpenAIRE

    Csányi, Gábor; Cifuentes-Pagano, Eugenia; Ghouleh, Imad Al; Ranayhossaini, Daniel J.; Egaña, Loreto; Lopes, Lucia R.; Jackson, Heather M.; Kelley, Eric E.; Pagano, Patrick J.

    2011-01-01

    In recent years, reactive oxygen species (ROS) derived from the vascular isoforms of NADPH oxidase, Nox1, Nox2 and Nox4, have been implicated in many cardiovascular pathologies. As a result, the selective inhibition of these isoforms is an area of intense current investigation. In the present study, we postulated that Nox2ds, a peptidic inhibitor that mimics a sequence in the cytosolic B loop of Nox2, would inhibit ROS production by Nox2-, but not by Nox1- and Nox4-oxidase systems. To test ou...

  18. Exogenous quinones inhibit photosynthetic electron transfer in Chloroflexus aurantiacus by specific quenching of the excited bacteriochlorophyll c antenna

    DEFF Research Database (Denmark)

    Frigaard, N-U; Tokita, S; Matsuura, K

    1999-01-01

    , but not when BChl a was excited. The quenching of BChl c fluorescence induced by these quinones correlated with the inhibition of flash-induced cytochrome c oxidation. We concluded that the quinones inhibited electron transfer in the reaction center by specifically quenching the excitation energy in the BChl c......-hydroxy-1,4-naphthoquinone, or 4 microM 2-acetyl-3-methyl-1,4-naphthoquinone. Between 25 and 100 times higher quinone concentrations were needed to quench BChl a fluorescence to a similar extent. These quinones also efficiently inhibited flash-induced cytochrome c oxidation when BChl c was excited......In the photosynthetic green filamentous bacterium Chloroflexus aurantiacus, excitation energy is transferred from a large bacteriochlorophyll (BChl) c antenna via smaller BChl a antennas to the reaction center. The effects of substituted 1,4-naphthoquinones on BChl c and BChl a fluorescence...

  19. Glycyrrhizic acid prevents astrocyte death by neuromyelitis optica-specific IgG via inhibition of C1q binding.

    Science.gov (United States)

    Kim, Ji-Sun; Cheon, Soyoung; Kim, Seung Woo; Kim, Boram; Kim, Heejaung; Park, Ki Duk; Kim, Sung-Min

    2016-09-16

    Neuromyelitis optica (NMO) is an inflammatory demyelinating disease of the central nervous system and is mediated by complement-dependent cytotoxicity (CDC) of NMO-specific immunoglobulin G (IgG) antibodies (NMO-IgG). Glycyrrhizic acid (GA) has numerous pharmacological effects including inhibition of the complement pathway. We aimed to study the influence of GA on NMO-IgG-induced CDC. NMO-IgG samples from 7 patients with NMO, together with human complement, induced CDC in an aquaporin 4 M23-overexpressing glial cell line, an in vitro NMO model. GA attenuated NMO-IgG-induced CDC in a dose-dependent manner. The mechanism of the GA-related CDC inhibition was sequentially dissected and found to involve inhibition of C1q binding to NMO-IgG. Consequently, GA attenuates NMO-IgG-induced CDC and may be a promising novel therapeutic agent against NMO. PMID:27462020

  20. Sequence-specific inhibition of duck hepatitis B virus reverse transcription by peptide nucleic acids (PNA)

    DEFF Research Database (Denmark)

    Robaczewska, Magdalena; Narayan, Ramamurthy; Seigneres, Beatrice;

    2005-01-01

    BACKGROUND/AIMS: Peptide nucleic acids (PNAs) appear as promising new antisense agents, that have not yet been examined as hepatitis B virus (HBV) inhibitors. Our aim was to study the ability of PNAs targeting the duck HBV (DHBV) encapsidation signal epsilon to inhibit reverse transcription (RT...

  1. Retrieval-induced forgetting without competition: testing the retrieval specificity assumption of the inhibition theory

    NARCIS (Netherlands)

    J.G.W. Raaijmakers; E. Jakab

    2011-01-01

    According to the inhibition theory of forgetting (Anderson, Journal of Memory and Language 49:415-445, 2003; Anderson, Bjork, & Bjork, Psychonomic Bulletin & Review 7:522-530, 2000), retrieval practice on a subset of target items leads to forgetting for the other, nontarget items, due to the fact th

  2. Chondrocyte-Specific Inhibition of β-Catenin Signaling Leads to Dysplasia of the Caudal Vertebrae in Mice

    OpenAIRE

    Shu, Bing; Li, Tian-Fang; Li, Xiao-Feng; Tang, De-Zhi; Zhang, Yejia; Shi, Qi; Wang, Yong-Jun; Chen, Di

    2013-01-01

    Study Design. To inhibit β-catenin specifically signaling in chondrocytes Col2-ICAT transgenic mice were generated. Anomalies in caudal vertebrae were detected during embryonic and postnatal stages of Col2-ICAT transgenic mice. Objective. To determine the role of canonical β-catenin signaling in caudal vertebral development. Summary of Background Data. β-catenin signaling plays a critical role in skeletal development. Col2-ICAT transgenic mice were generated to selectively block β-catenin sig...

  3. Subpicomolar diphenyleneiodonium inhibits microglial NADPH oxidase with high specificity and shows great potential as a therapeutic agent for neurodegenerative diseases

    OpenAIRE

    Wang, Qingshan; Chu, Chun-Hsien; Oyarzabal, Esteban; Jiang, Lulu; Chen, Shih-Heng; Wilson, Belinda; Qian, Li; Hong, Jau-Shyong

    2014-01-01

    Activation of microglial NADPH oxidase (NOX2) plays a critical role in mediating neuroinflammation, which is closely linked with the pathogenesis of a variety of neurodegenerative diseases, including Parkinson’s disease (PD). The inhibition of NOX2-generated superoxide has become an effective strategy for developing disease-modifying therapies for PD. However, the lack of specific and potent NOX2 inhibitors has hampered the progress of this approach. Diphenyleneiodonium (DPI) is a widely used...

  4. End product inhibition of hepatic 25-hydroxyvitamin D production in the rat: specificity and kinetics

    Energy Technology Data Exchange (ETDEWEB)

    Milne, M.L.; Baran, D.T.

    1985-11-01

    The role of vitamin D metabolites in the regulation of hepatic 25-hydroxyvitamin D production was investigated by examining the effects of 25-hydroxyvitamin D, 1,25-dihydroxyvitamin D, and 24,25-dihydroxyvitamin D on the synthesis of (25-/sup 3/H)hydroxyvitamin D by rachitic rat liver homogenates. Production of (25-/sup 3/H)hydroxyvitamin D was inhibited by 25-hydroxyvitamin D and 1,25-dihydroxyvitamin D, but not by 24,25-dihydroxyvitamin D. 25-Hydroxyvitamin D increased the Km of the vitamin D-25-hydroxylase enzyme(s), while 1,25-dihydroxyvitamin D decreased the Vmax with a Ki of 88.7 ng/ml. Inhibition of hepatic 25-hydroxyvitamin D production by 25-hydroxyvitamin D and 1,25-dihydroxyvitamin D may be another control mechanism to regulate circulating vitamin D levels.

  5. End product inhibition of hepatic 25-hydroxyvitamin D production in the rat: specificity and kinetics

    International Nuclear Information System (INIS)

    The role of vitamin D metabolites in the regulation of hepatic 25-hydroxyvitamin D production was investigated by examining the effects of 25-hydroxyvitamin D, 1,25-dihydroxyvitamin D, and 24,25-dihydroxyvitamin D on the synthesis of [25-3H]hydroxyvitamin D by rachitic rat liver homogenates. Production of [25-3H]hydroxyvitamin D was inhibited by 25-hydroxyvitamin D and 1,25-dihydroxyvitamin D, but not by 24,25-dihydroxyvitamin D. 25-Hydroxyvitamin D increased the Km of the vitamin D-25-hydroxylase enzyme(s), while 1,25-dihydroxyvitamin D decreased the Vmax with a Ki of 88.7 ng/ml. Inhibition of hepatic 25-hydroxyvitamin D production by 25-hydroxyvitamin D and 1,25-dihydroxyvitamin D may be another control mechanism to regulate circulating vitamin D levels

  6. The activity-dependent transcription factor NPAS4 regulates domain-specific inhibition

    OpenAIRE

    Bloodgood, Brenda L.; Sharma, Nikhil; Browne, Heidi Adlman; Trepman, Alissa Z.; Greenberg, Michael E.

    2013-01-01

    A heterogeneous population of inhibitory neurons controls the flow of information through a neural circuit1–3. Inhibitory synapses that form on pyramidal neuron dendrites modulate the summation of excitatory synaptic potentials4–6 and prevent the generation of dendritic calcium spikes7,8. Precisely timed somatic inhibition limits both the number of action potentials and the time window during which firing can occur8,9. The activity-dependent transcription factor NPAS4 regulates inhibitory syn...

  7. Specific inhibition of long-lasting, L-type calcium channels by synthetic parathyroid hormone

    International Nuclear Information System (INIS)

    The effect of an active synthetic N-terminal fragment of bovine parathyroid hormone (bPTH), bPTH-(1-34), on Ca2+ channels was studied in mouse neuroblastoma cells (N1E-115). With the whole-cell variation of the patch-clamp technique, T (transient) and L (long-lasting) types of Ca2+ currents were identified. Pharmacological characterization showed that the L current was amplified by the Ca2+ channel stimulator BAY K-8644, but the T current was unaffected. The administration of bPTH-(1-34) produced dose-related inhibition of the L current, which could be reversed by BAY K-8644. The peptide had no effect on the T current. In addition, use of the fluorescent indicator fura-2 showed that bPTH-(1-34) inhibited the KCl-stimulated increase in intracellular free Ca2+ in neuroblastoma cells with L channels but not in cells with T channels. An inactivated (oxidized) preparation of bPTH-(1-34) failed to affect the L current. High-affinity binding of labeled PTH analog to these neuroblastoma cells was also demonstrated. In addition, bPTH-(1-34) inhibited the L current in cultured vascular smooth muscle cells from rat tail artery. These data indicate that, in some tissues PTH can act as an endogenous blocker of Ca2+ entry

  8. Electrical polarization of lead bromide crystals. I

    NARCIS (Netherlands)

    Schoonman, A.; Macke, A.J.H.

    1972-01-01

    An attempt was made to measure electronic conductivity in lead bromide in equilibrium with lead, since experimental data on the cell −Pb/PbBr2/C+ in the literature are not consistent with existing theories. Combination of our results with published data for bromine-induced hole conduction in lead br

  9. A comparison of the action of otilonium bromide and pinaverium bromide: study conducted under clinical control.

    Science.gov (United States)

    Defrance, P; Casini, A

    1991-11-01

    We studied 40 patients with irritable bowel syndrome (IBS) which received in a simple-blind fashion otilonium and pinaverium bromide (15 days each drug). During each 15-day period we evaluated: number of pain episodes, intensity of pain, number of bowel movements, side effects. Otilonium bromide, (OB), compared with pinaverium bromide was able to significantly (p less than 0.05) reduce the number of pain attacks, whereas no significant differences were found between the 2 groups as regards the other parameters. The occurrence of side effects was similar in the two treatment courses. We can conclude that the two types of treatment were similarly useful in IBS, although OB seems more effective than pinaverium bromide. PMID:1756286

  10. Recombinant norovirus-specific scFv inhibit virus-like particle binding to cellular ligands

    Directory of Open Access Journals (Sweden)

    Hardy Michele E

    2008-01-01

    Full Text Available Abstract Background Noroviruses cause epidemic outbreaks of gastrointestinal illness in all age-groups. The rapid onset and ease of person-to-person transmission suggest that inhibitors of the initial steps of virus binding to susceptible cells have value in limiting spread and outbreak persistence. We previously generated a monoclonal antibody (mAb 54.6 that blocks binding of recombinant norovirus-like particles (VLP to Caco-2 intestinal cells and inhibits VLP-mediated hemagglutination. In this study, we engineered the antigen binding domains of mAb 54.6 into a single chain variable fragment (scFv and tested whether these scFv could function as cell binding inhibitors, similar to the parent mAb. Results The scFv54.6 construct was engineered to encode the light (VL and heavy (VH variable domains of mAb 54.6 separated by a flexible peptide linker, and this recombinant protein was expressed in Pichia pastoris. Purified scFv54.6 recognized native VLPs by immunoblot, inhibited VLP-mediated hemagglutination, and blocked VLP binding to H carbohydrate antigen expressed on the surface of a CHO cell line stably transfected to express α 1,2-fucosyltransferase. Conclusion scFv54.6 retained the functional properties of the parent mAb with respect to inhibiting norovirus particle interactions with cells. With further engineering into a form deliverable to the gut mucosa, norovirus neutralizing antibodies represent a prophylactic strategy that would be valuable in outbreak settings.

  11. The in vitro and in vivo profile of aclidinium bromide in comparison with glycopyrronium bromide.

    Science.gov (United States)

    Gavaldà, Amadeu; Ramos, Israel; Carcasona, Carla; Calama, Elena; Otal, Raquel; Montero, José Luis; Sentellas, Sonia; Aparici, Monica; Vilella, Dolors; Alberti, Joan; Beleta, Jorge; Miralpeix, Montserrat

    2014-08-01

    This study characterised the in vitro and in vivo profiles of two novel long-acting muscarinic antagonists, aclidinium bromide and glycopyrronium bromide, using tiotropium bromide and ipratropium bromide as comparators. All four antagonists had high affinity for the five muscarinic receptor sub-types (M1-M5); aclidinium had comparable affinity to tiotropium but higher affinity than glycopyrronium and ipratropium for all receptors. Glycopyrronium dissociated faster from recombinant M3 receptors than aclidinium and tiotropium but more slowly than ipratropium; all four compounds dissociated more rapidly from M2 receptors than from M3 receptors. In vitro, aclidinium, glycopyrronium and tiotropium had a long duration of action at native M3 receptors (>8 h versus 42 min for ipratropium). In vivo, all compounds were equi-potent at reversing acetylcholine-induced bronchoconstriction. Aclidinium, glycopyrronium and ipratropium had a faster onset of bronchodilator action than tiotropium. Aclidinium had a longer duration of action than glycopyronnium (time to 50% recovery of effect [t½ offset] = 29 h and 13 h, respectively); these compare with a t½ offset of 64 h and 8 h for tiotropium and ipratropium, respectively. Aclidinium was less potent than glycopyrronium and tiotropium at inhibiting salivation in conscious rats (dose required to produce half-maximal effect [ED50] = 38, 0.74 and 0.88 μg/kg, respectively) and was more rapidly hydrolysed in rat, guinea pig and human plasma compared with glycopyrronium or tiotropium. These results indicate that while aclidinium and glycopyrronium are both potent antagonists at muscarinic receptors with similar kinetic selectivity for M3 receptors versus M2, aclidinium has a longer dissociation half-life at M3 receptors and a longer duration of bronchodilator action in vivo than glycopyrronium. The rapid plasma hydrolysis of aclidinium, coupled to its kinetic selectivity, may confer a reduced propensity for systemic

  12. Aspirin inhibits colon cancer cell and tumor growth and downregulates specificity protein (Sp transcription factors.

    Directory of Open Access Journals (Sweden)

    Satya Pathi

    Full Text Available Acetylsalicylic acid (aspirin is highly effective for treating colon cancer patients postdiagnosis; however, the mechanisms of action of aspirin in colon cancer are not well defined. Aspirin and its major metabolite sodium salicylate induced apoptosis and decreased colon cancer cell growth and the sodium salt of aspirin also inhibited tumor growth in an athymic nude mouse xenograft model. Colon cancer cell growth inhibition was accompanied by downregulation of Sp1, Sp3 and Sp4 proteins and decreased expression of Sp-regulated gene products including bcl-2, survivin, VEGF, VEGFR1, cyclin D1, c-MET and p65 (NFκB. Moreover, we also showed by RNA interference that β-catenin, an important target of aspirin in some studies, is an Sp-regulated gene. Aspirin induced nuclear caspase-dependent cleavage of Sp1, Sp3 and Sp4 proteins and this response was related to sequestration of zinc ions since addition of zinc sulfate blocked aspirin-mediated apoptosis and repression of Sp proteins. The results demonstrate an important underlying mechanism of action of aspirin as an anticancer agent and, based on the rapid metabolism of aspirin to salicylate in humans and the high salicylate/aspirin ratios in serum, it is likely that the anticancer activity of aspirin is also due to the salicylate metabolite.

  13. Specific Btk inhibition suppresses B cell- and myeloid cell-mediated arthritis

    Energy Technology Data Exchange (ETDEWEB)

    Di Paolo, Julie A.; Huang, Tao; Balazs, Mercedesz; Barbosa, James; Barck, Kai H.; Bravo, Brandon J.; Carano, Richard A.D.; Darrow, James; Davies, Douglas R.; DeForge, Laura E.; Diehl, Lauri; Ferrando, Ronald; Gallion, Steven L.; Giannetti, Anthony M.; Gribling, Peter; Hurez, Vincent; Hymowitz, Sarah G.; Jones, Randall; Kropf, Jeffrey E.; Lee, Wyne P.; Maciejewski, Patricia M.; Mitchell, Scott A.; Rong, Hong; Staker, Bart L.; Whitney, J. Andrew; Yeh, Sherry; Young, Wendy B.; Yu, Christine; Zhang, Juan; Reif, Karin; Currie, Kevin S. (CGI); (Emerald); (Genentech)

    2011-09-20

    Bruton's tyrosine kinase (Btk) is a therapeutic target for rheumatoid arthritis, but the cellular and molecular mechanisms by which Btk mediates inflammation are poorly understood. Here we describe the discovery of CGI1746, a small-molecule Btk inhibitor chemotype with a new binding mode that stabilizes an inactive nonphosphorylated enzyme conformation. CGI1746 has exquisite selectivity for Btk and inhibits both auto- and transphosphorylation steps necessary for enzyme activation. Using CGI1746, we demonstrate that Btk regulates inflammatory arthritis by two distinct mechanisms. CGI1746 blocks B cell receptor-dependent B cell proliferation and in prophylactic regimens reduces autoantibody levels in collagen-induced arthritis. In macrophages, Btk inhibition abolishes Fc{gamma}RIII-induced TNF{alpha}, IL-1{beta} and IL-6 production. Accordingly, in myeloid- and Fc{gamma}R-dependent autoantibody-induced arthritis, CGI1746 decreases cytokine levels within joints and ameliorates disease. These results provide new understanding of the function of Btk in both B cell- or myeloid cell-driven disease processes and provide a compelling rationale for targeting Btk in rheumatoid arthritis.

  14. Specific Btk inhibition suppresses B cell- and myeloid cell-mediated arthritis

    Energy Technology Data Exchange (ETDEWEB)

    Di Paolo, Julie A; Huang, Tao; Balazs, Mercedesz; Barbosa, James; Barck, Kai H; Bravo, Brandon J; Carano, Richard A.D.; Darrow, James; Davies, Douglas R; DeForge, Laura E; Diehl, Lauri; Ferrando, Ronald; Gallion, Steven L; Giannetti, Anthony M; Gribling, Peter; Hurez, Vincent; Hymowitz, Sarah G; Jones, Randall; Kropf, Jeffrey E; Lee, Wyne P; Maciejewski, Patricia M; Mitchell, Scott A; Rong, Hong; Staker, Bart L; Whitney, J Andrew; Yeh, Sherry; Young, Wendy B; Yu, Christine; Zhang, Juan; Reif, Karin; Currie, Kevin S [CGI; (Emerald); (Genentech)

    2011-08-29

    Bruton's tyrosine kinase (Btk) is a therapeutic target for rheumatoid arthritis, but the cellular and molecular mechanisms by which Btk mediates inflammation are poorly understood. Here we describe the discovery of CGI1746, a small-molecule Btk inhibitor chemotype with a new binding mode that stabilizes an inactive nonphosphorylated enzyme conformation. CGI1746 has exquisite selectivity for Btk and inhibits both auto- and transphosphorylation steps necessary for enzyme activation. Using CGI1746, we demonstrate that Btk regulates inflammatory arthritis by two distinct mechanisms. CGI1746 blocks B cell receptor–dependent B cell proliferation and in prophylactic regimens reduces autoantibody levels in collagen-induced arthritis. In macrophages, Btk inhibition abolishes FcγRIII-induced TNFα, IL-1β and IL-6 production. Accordingly, in myeloid- and FcγR-dependent autoantibody-induced arthritis, CGI1746 decreases cytokine levels within joints and ameliorates disease. These results provide new understanding of the function of Btk in both B cell– or myeloid cell–driven disease processes and provide a compelling rationale for targeting Btk in rheumatoid arthritis.

  15. Characterization of a monoclonal antibody that specifically inhibits triosephosphate isomerase activity of Taenia solium.

    Science.gov (United States)

    Víctor, Sanabria-Ayala; Yolanda, Medina-Flores; Araceli, Zavala-Carballo; Lucía, Jiménez; Abraham, Landa

    2013-08-01

    In the present study, we obtained and characterized partially a monoclonal antibody (4H11D10B11 mAb) against triosephosphate isomerase from Taenia solium (TTPI). This antibody recognized the enzyme by both ELISA and western blot and was able to inhibit its enzymatic activity in 74%. Moreover, the antigen-binding fragments (Fabs), products of digestion of the monoclonal antibody with papain, retained almost the same inhibitory effect. We determined the binding site by ELISA; synthetic peptides containing sequences from different non-conserved regions of the TTPI were confronted to the 4H11D10B11 mAb. The epitope recognized by the monoclonal antibody was located on peptide TTPI-56 (ATPAQAQEVHKVVRDWIRKHVDAGIADKARI), and an analysis of mimotopes, obtained with the 4H11D10B11 mAb, suggests that the epitope spans the sequence WIRKHVDAGIAD, residues 193-204 of the enzyme. This epitope is located within helix 6, next to loop 6, an essential active loop during catalysis. The antibody did not recognize triosephosphate isomerase from man and pig, definitive and intermediary hosts of T. solium, respectively. Furthermore, it did not bind to the catalytic site, since kinetic analysis demonstrated that inhibition had a non-competitive profile.

  16. Phagocytic superoxide specifically damages an extracytoplasmic target to inhibit or kill Salmonella.

    Directory of Open Access Journals (Sweden)

    Maureen Craig

    Full Text Available BACKGROUND: The phagocytic oxidative burst is a primary effector of innate immunity that protects against bacterial infection. However, the mechanism by which reactive oxygen species (ROS kill or inhibit bacteria is not known. It is often assumed that DNA is a primary target of oxidative damage, consistent with known effects of endogenously produced ROS in the bacterial cytoplasm. But most studies fail to distinguish between effects of host derived ROS versus damage caused by endogenous bacterial sources. We took advantage of both the ability of Salmonella enterica serovar Typhimurium to survive in macrophages and the genetic tractability of the system to test the hypothesis that phagocytic superoxide damages cytoplasmic targets including DNA. METHODOLOGY/PRINCIPAL FINDINGS: SodCI is a periplasmic Cu-Zn superoxide dismutase (SOD that contributes to the survival of Salmonella Typhimurium in macrophages. Through competitive virulence assays, we asked if sodCI has a genetic interaction with various cytoplasmic systems. We found that SodCI acts independently of cytoplasmic SODs, SodA and SodB. In addition, SodCI acts independently of the base excision repair system and RuvAB, involved in DNA repair. Although sodCI did show genetic interaction with recA, this was apparently independent of recombination and is presumably due to the pleiotropic effects of a recA mutation. CONCLUSIONS/SIGNIFICANCE: Taken together, these results suggest that bacterial inhibition by phagocytic superoxide is primarily the result of damage to an extracytoplasmic target.

  17. Triptolide inhibits the proliferation of prostate cancer cells and down-regulates SUMO-specific protease 1 expression.

    Directory of Open Access Journals (Sweden)

    Weiwei Huang

    Full Text Available Recently, traditional Chinese medicine and medicinal herbs have attracted more attentions worldwide for its anti-tumor efficacy. Celastrol and Triptolide, two active components extracted from the Chinese herb Tripterygium wilfordii Hook F (known as Lei Gong Teng or Thunder of God Vine, have shown anti-tumor effects. Celastrol was identified as a natural 26 s proteasome inhibitor which promotes cell apoptosis and inhibits tumor growth. The effect and mechanism of Triptolide on prostate cancer (PCa is not well studied. Here we demonstrated that Triptolide, more potent than Celastrol, inhibited cell growth and induced cell death in LNCaP and PC-3 cell lines. Triptolide also significantly inhibited the xenografted PC-3 tumor growth in nude mice. Moreover, Triptolide induced PCa cell apoptosis through caspases activation and PARP cleavage. Unbalance between SUMOylation and deSUMOylation was reported to play an important role in PCa progression. SUMO-specific protease 1 (SENP1 was thought to be a potential marker and therapeutical target of PCa. Importantly, we observed that Triptolide down-regulated SENP1 expression in both mRNA and protein levels in dose-dependent and time-dependent manners, resulting in an enhanced cellular SUMOylation in PCa cells. Meanwhile, Triptolide decreased AR and c-Jun expression at similar manners, and suppressed AR and c-Jun transcription activity. Furthermore, knockdown or ectopic SENP1, c-Jun and AR expression in PCa cells inhibited the Triptolide anti-PCa effects. Taken together, our data suggest that Triptolide is a natural compound with potential therapeutic value for PCa. Its anti-tumor activity may be attributed to mechanisms involving down-regulation of SENP1 that restores SUMOylation and deSUMOyaltion balance and negative regulation of AR and c-Jun expression that inhibits the AR and c-Jun mediated transcription in PCa.

  18. Inhibition of ACh release at an Aplysia synapse by neurotoxic phospholipases A2: specific receptors and mechanisms of action.

    Science.gov (United States)

    Fossier, P; Lambeau, G; Lazdunski, M; Baux, G

    1995-01-01

    1. Monochain (OS2) and multichain (taipoxin) neurotoxic phospholipases A2 (PLA2), purified from taipan snake venom, both inhibited ACh release at a concentration of 20 nM (90% inhibition in 2 h) at an identified synapse from buccal ganglion of Aplysia californica. 2. The Na+ current was unchanged upon application of either OS2 or taipoxin. Conversely, presynaptic K+ currents (IA and IK) were increased by taipoxin but not by OS2. In addition, OS2 induced a significant decrease of the presynaptic Ca2+ current (30%) while taipoxin increased this latter current by 20-30%. 3. Bee venom PLA2, another monochain neurotoxic PLA2, also inhibited ACh release while non-toxic enzymatically active PLA2s like OS1 (also purified from taipan snake venom) or porcine pancreatic PLA2 elicited a much weaker inhibition of ACh release, suggesting a specific action of neurotoxic PLA2s versus non-toxic PLA2s on ACh release. 4. Using iodinated OS2, specific high affinity binding sites with molecular masses of 140 and 18 kDa have been identified on Aplysia ganglia. The maximal binding capacities were 55 and 300-400 fmol (mg protein)-1 for membrane preparations from whole and buccal ganglia, respectively. These binding sites are of high affinity for neurotoxic PLA2s (Kd values, 100-800 pM) and of very low affinity for non-toxic PLA2s (Kd values in the micromolar range), thus indicating that these binding sites are presumably involved in the blockade of ACh release by neurotoxic PLA2s. Images Figure 8 Figure 9 PMID:8583413

  19. Human prostate tumor antigen-specific CD8+ regulatory T cells are inhibited by CTLA-4 or IL-35 blockade.

    Science.gov (United States)

    Olson, Brian M; Jankowska-Gan, Ewa; Becker, Jordan T; Vignali, Dario A A; Burlingham, William J; McNeel, Douglas G

    2012-12-15

    Regulatory T cells play important roles in cancer development and progression by limiting the generation of innate and adaptive anti-tumor immunity. We hypothesized that in addition to natural CD4(+)CD25(+) regulatory T cells (Tregs) and myeloid-derived suppressor cells, tumor Ag-specific Tregs interfere with the detection of anti-tumor immunity after immunotherapy. Using samples from prostate cancer patients immunized with a DNA vaccine encoding prostatic acid phosphatase (PAP) and a trans-vivo delayed-type hypersensitivity (tvDTH) assay, we found that the detection of PAP-specific effector responses after immunization was prevented by the activity of PAP-specific regulatory cells. These regulatory cells were CD8(+)CTLA-4(+), and their suppression was relieved by blockade of CTLA-4, but not IL-10 or TGF-β. Moreover, Ag-specific CD8(+) Tregs were detected prior to immunization in the absence of PAP-specific effector responses. These PAP-specific CD8(+)CTLA-4(+) suppressor T cells expressed IL-35, which was decreased after blockade of CTLA-4, and inhibition of either CTLA-4 or IL-35 reversed PAP-specific suppression of tvDTH response. PAP-specific CD8(+)CTLA-4(+) T cells also suppressed T cell proliferation in an IL-35-dependent, contact-independent fashion. Taken together, these findings suggest a novel population of CD8(+)CTLA-4(+) IL-35-secreting tumor Ag-specific Tregs arise spontaneously in some prostate cancer patients, persist during immunization, and can prevent the detection of Ag-specific effector responses by an IL-35-dependent mechanism.

  20. Methyl bromide residues in fumigated cocoa beans

    International Nuclear Information System (INIS)

    The 14C activity in unroasted [14C]-methyl bromide fumigated cocoa beans was used to study the fate and persistence of CH3Br in the stored beans. About 70% of the residues occurred in the shells. Unchanged CH3Br could not be detected, all the sorbed CH3Br having reacted with bean constituents apparently to form 14C-methylated derivatives and inorganic bromide. No 14C activity was found in the lipid fraction. Roasting decreased the bound (non-volatile) residues, with corresponding changes in the activities and amounts of free sugars, free and protein amino acids. Roasted nibs and shells showed a two-fold increase in the volatile fraction of the 14C residue. This fraction may be related to the volatile aroma compounds formed by Maillard-type reactions. (author)

  1. Receptor-like protein-tyrosine phosphatase alpha specifically inhibits insulin-increased prolactin gene expression

    DEFF Research Database (Denmark)

    Jacob, K K; Sap, J; Stanley, F M

    1998-01-01

    A physiologically relevant response to insulin, stimulation of prolactin promoter activity in GH4 pituitary cells, was used as an assay to study the specificity of protein-tyrosine phosphatase function. Receptor-like protein-tyrosine phosphatase alpha (RPTPalpha) blocks the effect of insulin to i...

  2. Toward understanding the structural basis of cyclin-dependentkinase 6 specific inhibition

    Energy Technology Data Exchange (ETDEWEB)

    Lu, Heshu; Schulze-Gahmen, Ursula

    2006-01-12

    CDKs are key players in cell cycle control, and genetic alterations of CDKs and their regulators have been linked to a variety of cancers. Hence, CDKs are obvious targets for therapeutic intervention in various proliferative diseases, including cancer. To date, drug design efforts have mostly focused on CDK2 because methods for crystallization of its inhibitor complexes have been well established. CDK4 and CDK6, however, may be at least as important enzymes for cell cycle regulation and could provide alternative treatment options. We describe here two complex structures of human CDK6 with a very specific kinase inhibitor, PD0332991, which is based on a pyrido[2,3-d]pyrimidin-7-one scaffold, and with the less specific aminopurvalanol inhibitor. Analysis of the structures suggests that relatively small conformational differences between CDK2 and CDK6 in the hinge region are contributing to responsible for the inhibitor specificity by inducing changes in the inhibitor orientation that lead to sterical clashes in CDK2 but not CDK6. These complex structures provide valuable insights for the future development of CDK specific inhibitors.

  3. [Research advances in methyl bromide in the ocean].

    Science.gov (United States)

    Du, Hui-na; Xie, Wen-xia; Cui, Yu-qian; Chen, Jian-lei; Ye, Si-yuan

    2014-12-01

    Methyl bromide is an important atmospheric trace gas, which plays significant roles in the global warming and atmospheric chemistry. The ocean plays important and complex roles in the global biogeochemical cycles of methyl bromide, not only the source of atmospheric methyl bromide, but also the sink. Therefore, developing the chemical research of the soluble methyl bromide in the ocean, will not only have a certain guiding significance to the atmospheric ozone layer protection, but also provide a theoretical basis for estimating methyl bromide's contribution to the global environmental change on global scale. This paper reviewed the research advances on methyl bromide in the ocean, from the aspects of the biogeochemical cycle of methyl bromide in the ocean, the analysis and determination method, the concentration distribution, the sea-to-air flux and its sources and sinks in the atmosphere. Some deficiencies in the current studies were put forward, and the directions of the future studies were prospected. PMID:25876424

  4. Response-dependent dynamics of cell-specific inhibition in cortical networks in vivo

    OpenAIRE

    El-Boustani, Sami; Sur, Mriganka

    2014-01-01

    In the visual cortex, inhibitory neurons alter the computations performed by target cells via combination of two fundamental operations, division and subtraction. The origins of these operations have been variously ascribed to differences in neuron classes, synapse location or receptor conductances. Here, by utilizing specific visual stimuli and single optogenetic probe pulses, we show that the function of ​parvalbumin-expressing and ​somatostatin-expressing neurons in mice in vivo is governe...

  5. Specific immunotherapy in combination with Clostridium butyricum inhibits allergic inflammation in the mouse intestine.

    Science.gov (United States)

    Shi, Yanhong; Xu, Ling-Zhi; Peng, Kangsheng; Wu, Wei; Wu, Ruijin; Liu, Zhi-Qiang; Yang, Gui; Geng, Xiao-Rui; Liu, Jun; Liu, Zhi-Gang; Liu, Zhanju; Yang, Ping-Chang

    2015-12-02

    The current therapy on allergic inflammation is unsatisfactory. Probiotics improve the immunity in the body. This study aims to test a hypothesis that administration with Clostridium butyricum (C. butyricum) enforces the effect of specific immunotherapy (SIT) on intestinal allergic inflammation. In this study, an ovalbumin (OVA) specific allergic inflammation mouse model was created. The mice were treated with SIT or/and C. butyricum. The results showed that the intestinal allergic inflammation was only moderately alleviated by SIT, which was significantly enforced by a combination with C. butyricum; treating with C. butyricum alone did not show much inhibitory efficacy. The increase in the frequency of the interleukin (IL)-10-producing OVA-specific B cell (OVAsBC) was observed in mice in parallel to the inhibitory effect on the intestinal allergic inflammation. The in vitro treatment of the OVAsBCs with OVA increased the histone deacetylase-1 (HDAC1) phosphorylation, modulated the transcription of the Bcl6 gene, and triggered the OVAsBCs to differentiate to the IgE-producing plasma cells. Exposure to both OVA and butyrate sodium in the culture increased the expression of IL-10 in OVAsBCs. In conclusion, administration with C. butyricum enforces the inhibitory effect of SIT on allergic inflammation in the mouse intestine.

  6. Chemical inhibition of autophagy: Examining its potential to increase the specific productivity of recombinant CHO cell lines.

    Science.gov (United States)

    Baek, Eric; Kim, Che Lin; Kim, Mi Gyeom; Lee, Jae Seong; Lee, Gyun Min

    2016-09-01

    Chinese hamster ovary (CHO) cells activate and undergo apoptosis and autophagy for various environmental stresses. Unlike apoptosis, studies on increasing the production of therapeutic proteins in CHO cells by targeting the autophagy pathway are limited. In order to identify the effects of chemical autophagy inhibitors on the specific productivity (qp ), nine chemical inhibitors that had been reported to target three different phases of autophagy (metformin, dorsomorphin, resveratrol, and SP600125 against initiation and nucleation; 3-MA, wortmannin, and LY294002 against elongation, and chloroquine and bafilomycin A1 against autophagosome fusion) were used to treat three recombinant CHO (rCHO) cell lines: the Fc-fusion protein-producing DG44 (DG44-Fc) and DUKX-B11 (DUKX-Fc) and antibody-producing DG44 (DG44-Ab) cell lines. Among the nine chemical inhibitors tested, 3-MA, dorsomorphin, and SP600125 significantly increased the qp of DG44-Fc and DUKX-Fc. In contrast, for DG44-Ab, only 3-MA significantly increased the qp . The autophagy-inhibiting activity of the nine chemical inhibitors on the rCHO cell lines was evaluated through Western blot analysis and flow cytometry. Unexpectedly, some chemical inhibitors did not exhibit any apparent inhibition activity on autophagy. The chemical inhibitors that enhanced the qp , 3-MA, dorsomorphin, and SP600125, exhibited instead an increased autophagic flux. Taken all together, the chemical inhibition of autophagy was not effective in increasing the qp in rCHO cell lines and the positive effect of 3-MA, dorsomorphin, and SP600125 on the qp was not due to the inhibition of autophagy. Biotechnol. Bioeng. 2016;113: 1953-1961. © 2016 Wiley Periodicals, Inc.

  7. Curcumin inhibits srebp-2 expression in activated hepatic stellate cells in vitro by reducing the activity of specificity protein-1.

    Science.gov (United States)

    Kang, Qiaohua; Chen, Anping

    2009-12-01

    Elevated levels of cholesterol/low-density lipoprotein (LDL) are a risk factor for the development of nonalcoholic steatohepatitis and its associated hepatic fibrosis. However, underlying mechanisms remain elusive. We previously reported that curcumin induced gene expression of peroxisome proliferator-activated receptor (PPAR)-gamma and stimulated its activity, leading to the inhibition of the activation of hepatic stellate cells (HSCs), the major effector cells during hepatic fibrogenesis. We recently showed that curcumin suppressed gene expression of LDL receptor in activated HSCs in vitro by repressing gene expression of the transcription factor sterol regulatory element binding protein-2 (SREBP-2), leading to the reduction in the level of intracellular cholesterol in HSCs and to the attenuation of the stimulatory effects of LDL on HSCs activation. The current study aimed at exploring molecular mechanisms by which curcumin inhibits srebp-2 expression in HSCs. Promoter deletion assays, mutagenesis assays, and EMSAs localize a specificity protein-1 (SP-1) binding GC-box in the srebp-2 promoter, which is responsible for enhancing the promoter activity and responding to curcumin in HSCs. Curcumin suppresses gene expression of SP-1 and reduces its trans-activation activity, which are mediated by the activation of PPARgamma. The inhibitory effect of curcumin on SP-1 binding to the GC-box is confirmed by chromatin immuno-precipitation. In summary, our results demonstrate that curcumin inhibits srebp-2 expression in cultured HSCs by activating PPARgamma and reducing the SP-1 activity, leading to the repression of ldlr expression. These results provide novel insights into molecular mechanisms by which curcumin inhibits LDL-induced HSC activation.

  8. Chemical inhibition of autophagy: Examining its potential to increase the specific productivity of recombinant CHO cell lines.

    Science.gov (United States)

    Baek, Eric; Kim, Che Lin; Kim, Mi Gyeom; Lee, Jae Seong; Lee, Gyun Min

    2016-09-01

    Chinese hamster ovary (CHO) cells activate and undergo apoptosis and autophagy for various environmental stresses. Unlike apoptosis, studies on increasing the production of therapeutic proteins in CHO cells by targeting the autophagy pathway are limited. In order to identify the effects of chemical autophagy inhibitors on the specific productivity (qp ), nine chemical inhibitors that had been reported to target three different phases of autophagy (metformin, dorsomorphin, resveratrol, and SP600125 against initiation and nucleation; 3-MA, wortmannin, and LY294002 against elongation, and chloroquine and bafilomycin A1 against autophagosome fusion) were used to treat three recombinant CHO (rCHO) cell lines: the Fc-fusion protein-producing DG44 (DG44-Fc) and DUKX-B11 (DUKX-Fc) and antibody-producing DG44 (DG44-Ab) cell lines. Among the nine chemical inhibitors tested, 3-MA, dorsomorphin, and SP600125 significantly increased the qp of DG44-Fc and DUKX-Fc. In contrast, for DG44-Ab, only 3-MA significantly increased the qp . The autophagy-inhibiting activity of the nine chemical inhibitors on the rCHO cell lines was evaluated through Western blot analysis and flow cytometry. Unexpectedly, some chemical inhibitors did not exhibit any apparent inhibition activity on autophagy. The chemical inhibitors that enhanced the qp , 3-MA, dorsomorphin, and SP600125, exhibited instead an increased autophagic flux. Taken all together, the chemical inhibition of autophagy was not effective in increasing the qp in rCHO cell lines and the positive effect of 3-MA, dorsomorphin, and SP600125 on the qp was not due to the inhibition of autophagy. Biotechnol. Bioeng. 2016;113: 1953-1961. © 2016 Wiley Periodicals, Inc. PMID:26914152

  9. Histone Deacetylase Inhibition via RGFP966 Releases the Brakes on Sensory Cortical Plasticity and the Specificity of Memory Formation.

    Science.gov (United States)

    Bieszczad, Kasia M; Bechay, Kiro; Rusche, James R; Jacques, Vincent; Kudugunti, Shashi; Miao, Wenyan; Weinberger, Norman M; McGaugh, James L; Wood, Marcelo A

    2015-09-23

    Research over the past decade indicates a novel role for epigenetic mechanisms in memory formation. Of particular interest is chromatin modification by histone deacetylases (HDACs), which, in general, negatively regulate transcription. HDAC deletion or inhibition facilitates transcription during memory consolidation and enhances long-lasting forms of synaptic plasticity and long-term memory. A key open question remains: How does blocking HDAC activity lead to memory enhancements? To address this question, we tested whether a normal function of HDACs is to gate information processing during memory formation. We used a class I HDAC inhibitor, RGFP966 (C21H19FN4O), to test the role of HDAC inhibition for information processing in an auditory memory model of learning-induced cortical plasticity. HDAC inhibition may act beyond memory enhancement per se to instead regulate information in ways that lead to encoding more vivid sensory details into memory. Indeed, we found that RGFP966 controls memory induction for acoustic details of sound-to-reward learning. Rats treated with RGFP966 while learning to associate sound with reward had stronger memory and additional information encoded into memory for highly specific features of sounds associated with reward. Moreover, behavioral effects occurred with unusually specific plasticity in primary auditory cortex (A1). Class I HDAC inhibition appears to engage A1 plasticity that enables additional acoustic features to become encoded in memory. Thus, epigenetic mechanisms act to regulate sensory cortical plasticity, which offers an information processing mechanism for gating what and how much is encoded to produce exceptionally persistent and vivid memories. Significance statement: Here we provide evidence of an epigenetic mechanism for information processing. The study reveals that a class I HDAC inhibitor (Malvaez et al., 2013; Rumbaugh et al., 2015; RGFP966, chemical formula C21H19FN4O) alters the formation of auditory memory by

  10. Histone Deacetylase Inhibition via RGFP966 Releases the Brakes on Sensory Cortical Plasticity and the Specificity of Memory Formation.

    Science.gov (United States)

    Bieszczad, Kasia M; Bechay, Kiro; Rusche, James R; Jacques, Vincent; Kudugunti, Shashi; Miao, Wenyan; Weinberger, Norman M; McGaugh, James L; Wood, Marcelo A

    2015-09-23

    Research over the past decade indicates a novel role for epigenetic mechanisms in memory formation. Of particular interest is chromatin modification by histone deacetylases (HDACs), which, in general, negatively regulate transcription. HDAC deletion or inhibition facilitates transcription during memory consolidation and enhances long-lasting forms of synaptic plasticity and long-term memory. A key open question remains: How does blocking HDAC activity lead to memory enhancements? To address this question, we tested whether a normal function of HDACs is to gate information processing during memory formation. We used a class I HDAC inhibitor, RGFP966 (C21H19FN4O), to test the role of HDAC inhibition for information processing in an auditory memory model of learning-induced cortical plasticity. HDAC inhibition may act beyond memory enhancement per se to instead regulate information in ways that lead to encoding more vivid sensory details into memory. Indeed, we found that RGFP966 controls memory induction for acoustic details of sound-to-reward learning. Rats treated with RGFP966 while learning to associate sound with reward had stronger memory and additional information encoded into memory for highly specific features of sounds associated with reward. Moreover, behavioral effects occurred with unusually specific plasticity in primary auditory cortex (A1). Class I HDAC inhibition appears to engage A1 plasticity that enables additional acoustic features to become encoded in memory. Thus, epigenetic mechanisms act to regulate sensory cortical plasticity, which offers an information processing mechanism for gating what and how much is encoded to produce exceptionally persistent and vivid memories. Significance statement: Here we provide evidence of an epigenetic mechanism for information processing. The study reveals that a class I HDAC inhibitor (Malvaez et al., 2013; Rumbaugh et al., 2015; RGFP966, chemical formula C21H19FN4O) alters the formation of auditory memory by

  11. Mode of inhibition of HIV-1 Integrase by a C-terminal domain-specific monoclonal antibody*

    Directory of Open Access Journals (Sweden)

    Merkel George

    2006-06-01

    Full Text Available Abstract Background To further our understanding of the structure and function of HIV-1 integrase (IN we developed and characterized a library of monoclonal antibodies (mAbs directed against this protein. One of these antibodies, mAb33, which is specific for the C-terminal domain, was found to inhibit HIV-1 IN processing activity in vitro; a corresponding Fv fragment was able to inhibit HIV-1 integration in vivo. Our subsequent studies, using heteronuclear nuclear magnetic resonance spectroscopy, identified six solvent accessible residues on the surface of the C-terminal domain that were immobilized upon binding of the antibody, which were proposed to comprise the epitope. Here we test this hypothesis by measuring the affinity of mAb33 to HIV-1 proteins that contain Ala substitutions in each of these positions. To gain additional insight into the mode of inhibition we also measured the DNA binding capacity and enzymatic activities of the Ala substituted proteins. Results We found that Ala substitution of any one of five of the putative epitope residues, F223, R224, Y226, I267, and I268, caused a decrease in the affinity of the mAb33 for HIV-1 IN, confirming the prediction from NMR data. Although IN derivatives with Ala substitutions in or near the mAb33 epitope exhibited decreased enzymatic activity, none of the epitope substitutions compromised DNA binding to full length HIV-1 IN, as measured by surface plasmon resonance spectroscopy. Two of these derivatives, IN (I276A and IN (I267A/I268A, exhibited both increased DNA binding affinity and uncharacteristic dissociation kinetics; these proteins also exhibited non-specific nuclease activity. Results from these investigations are discussed in the context of current models for how the C-terminal domain interacts with substrate DNA. Conclusion It is unlikely that inhibition of HIV-1 IN activity by mAb33 is caused by direct interaction with residues that are essential for substrate binding. Rather

  12. Disruption of Specific RNA-RNA Interactions in a Double-Stranded RNA Virus Inhibits Genome Packaging and Virus Infectivity.

    Science.gov (United States)

    Fajardo, Teodoro; Sung, Po-Yu; Roy, Polly

    2015-12-01

    Bluetongue virus (BTV) causes hemorrhagic disease in economically important livestock. The BTV genome is organized into ten discrete double-stranded RNA molecules (S1-S10) which have been suggested to follow a sequential packaging pathway from smallest to largest segment during virus capsid assembly. To substantiate and extend these studies, we have investigated the RNA sorting and packaging mechanisms with a new experimental approach using inhibitory oligonucleotides. Putative packaging signals present in the 3'untranslated regions of BTV segments were targeted by a number of nuclease resistant oligoribonucleotides (ORNs) and their effects on virus replication in cell culture were assessed. ORNs complementary to the 3' UTR of BTV RNAs significantly inhibited virus replication without affecting protein synthesis. Same ORNs were found to inhibit complex formation when added to a novel RNA-RNA interaction assay which measured the formation of supramolecular complexes between and among different RNA segments. ORNs targeting the 3'UTR of BTV segment 10, the smallest RNA segment, were shown to be the most potent and deletions or substitution mutations of the targeted sequences diminished the RNA complexes and abolished the recovery of viable viruses using reverse genetics. Cell-free capsid assembly/RNA packaging assay also confirmed that the inhibitory ORNs could interfere with RNA packaging and further substitution mutations within the putative RNA packaging sequence have identified the recognition sequence concerned. Exchange of 3'UTR between segments have further demonstrated that RNA recognition was segment specific, most likely acting as part of the secondary structure of the entire genomic segment. Our data confirm that genome packaging in this segmented dsRNA virus occurs via the formation of supramolecular complexes formed by the interaction of specific sequences located in the 3' UTRs. Additionally, the inhibition of packaging in-trans with inhibitory ORNs

  13. Out with the Old and in with the New--Is Backward Inhibition a Domain-Specific Process?

    Directory of Open Access Journals (Sweden)

    Francesca Foti

    Full Text Available Effective task switching is supported by the inhibition of the just executed task, so that potential interference from previously executed tasks is adaptively counteracted. This inhibitory mechanism, named Backward Inhibition (BI, has been inferred from the finding that switching back to a recently executed task (A-B-A task sequence is harder than switching back to a less recently executed task (C-B-A task sequence. Despite the fact that BI effects do impact performance on everyday life activities, up to now it is still not clear whether the BI represents an amodal and material-independent process or whether it interacts with the task material. To address this issue, a group of individuals with Williams syndrome (WS characterized by specific difficulties in maintaining and processing visuo-spatial, but not verbal, information, and a mental age- and gender-matched group of typically developing (TD children were subjected to three task-switching experiments requiring verbal or visuo-spatial material to be processed. Results showed that individuals with WS exhibited a normal BI effect during verbal task-switching, but a clear deficit during visuo-spatial task-switching. Overall, our findings demonstrating that the BI is a material-specific process have important implications for theoretical models of cognitive control and its architecture.

  14. Specific Inhibition of Herpes Simplex Virus DNA Polymerase by Helical Peptides Corresponding to the Subunit Interface

    Science.gov (United States)

    Digard, Paul; Williams, Kevin P.; Hensley, Preston; Brooks, Ian S.; Dahl, Charles E.; Coen, Donald M.

    1995-02-01

    The herpes simplex virus DNA polymerase consists of two subunits-a catalytic subunit and an accessory subunit, UL42, that increases processivity. Mutations affecting the extreme C terminus of the catalytic subunit specifically disrupt subunit interactions and ablate virus replication, suggesting that new antiviral drugs could be rationally designed to interfere with polymerase heterodimerization. To aid design, we performed circular dichroism (CD) spectroscopy and analytical ultracentrifugation studies, which revealed that a 36-residue peptide corresponding to the C terminus of the catalytic subunit folds into a monomeric structure with partial α-helical character. CD studies of shorter peptides were consistent with a model where two separate regions of α-helix interact to form a hairpin-like structure. The 36-residue peptide and a shorter peptide corresponding to the C-terminal 18 residues blocked UL42-dependent long-chain DNA synthesis at concentrations that had no effect on synthesis by the catalytic subunit alone or by calf thymus DNA polymerase δ and its processivity factor. These peptides, therefore, represent a class of specific inhibitors of herpes simplex virus DNA polymerase that act by blocking accessory-subunit-dependent synthesis. These peptides or their structures may form the basis for the synthesis of clinically effective drugs.

  15. Species-specific inhibition of RIG-I ubiquitination and IFN induction by the influenza A virus NS1 protein.

    Directory of Open Access Journals (Sweden)

    Ricardo Rajsbaum

    Full Text Available Influenza A viruses can adapt to new host species, leading to the emergence of novel pathogenic strains. There is evidence that highly pathogenic viruses encode for non-structural 1 (NS1 proteins that are more efficient in suppressing the host immune response. The NS1 protein inhibits type-I interferon (IFN production partly by blocking the TRIM25 ubiquitin E3 ligase-mediated Lys63-linked ubiquitination of the viral RNA sensor RIG-I, required for its optimal downstream signaling. In order to understand possible mechanisms of viral adaptation and host tropism, we examined the ability of NS1 encoded by human (Cal04, avian (HK156, swine (SwTx98 and mouse-adapted (PR8 influenza viruses to interact with TRIM25 orthologues from mammalian and avian species. Using co-immunoprecipitation assays we show that human TRIM25 binds to all tested NS1 proteins, whereas the chicken TRIM25 ortholog binds preferentially to the NS1 from the avian virus. Strikingly, none of the NS1 proteins were able to bind mouse TRIM25. Since NS1 can inhibit IFN production in mouse, we tested the impact of TRIM25 and NS1 on RIG-I ubiquitination in mouse cells. While NS1 efficiently suppressed human TRIM25-dependent ubiquitination of RIG-I 2CARD, NS1 inhibited the ubiquitination of full-length mouse RIG-I in a mouse TRIM25-independent manner. Therefore, we tested if the ubiquitin E3 ligase Riplet, which has also been shown to ubiquitinate RIG-I, interacts with NS1. We found that NS1 binds mouse Riplet and inhibits its activity to induce IFN-β in murine cells. Furthermore, NS1 proteins of human but not swine or avian viruses were able to interact with human Riplet, thereby suppressing RIG-I ubiquitination. In conclusion, our results indicate that influenza NS1 protein targets TRIM25 and Riplet ubiquitin E3 ligases in a species-specific manner for the inhibition of RIG-I ubiquitination and antiviral IFN production.

  16. Detection of water contamination from hydraulic fracturing wastewater: a μPAD for bromide analysis in natural waters.

    Science.gov (United States)

    Loh, Leslie J; Bandara, Gayan C; Weber, Genevieve L; Remcho, Vincent T

    2015-08-21

    Due to the rapid expansion in hydraulic fracturing (fracking), there is a need for robust, portable and specific water analysis techniques. Early detection of contamination is crucial for the prevention of lasting environmental damage. Bromide can potentially function as an early indicator of water contamination by fracking waste, because there is a high concentration of bromide ions in fracking wastewaters. To facilitate this, a microfluidic paper-based analytical device (μPAD) has been developed and optimized for the quantitative colorimetric detection of bromide in water using a smartphone. A paper microfluidic platform offers the advantages of inexpensive fabrication, elimination of unstable wet reagents, portability and high adaptability for widespread distribution. These features make this assay an attractive option for a new field test for on-site determination of bromide. PMID:26161586

  17. Wnt isoform-specific interactions with coreceptor specify inhibition or potentiation of signaling by LRP6 antibodies.

    Science.gov (United States)

    Gong, Yan; Bourhis, Eric; Chiu, Cecilia; Stawicki, Scott; DeAlmeida, Venita I; Liu, Bob Y; Phamluong, Khanhky; Cao, Tim C; Carano, Richard A D; Ernst, James A; Solloway, Mark; Rubinfeld, Bonnee; Hannoush, Rami N; Wu, Yan; Polakis, Paul; Costa, Mike

    2010-01-01

    β-Catenin-dependent Wnt signaling is initiated as Wnt binds to both the receptor FZD and coreceptor LRP5/6, which then assembles a multimeric complex at the cytoplasmic membrane face to recruit and inactivate the kinase GSK3. The large number and sequence diversity of Wnt isoforms suggest the possibility of domain-specific ligand-coreceptor interactions, and distinct binding sites on LRP6 for Wnt3a and Wnt9b have recently been identified in vitro. Whether mechanistically different interactions between Wnts and coreceptors might mediate signaling remains to be determined. It is also not clear whether coreceptor homodimerization induced extracellularly can activate Wnt signaling, as is the case for receptor tyrosine kinases. We generated monoclonal antibodies against LRP6 with the unexpected ability to inhibit signaling by some Wnt isoforms and potentiate signaling by other isoforms. In cell culture, two antibodies characterized further show reciprocal activities on most Wnts, with one antibody antagonizing and the other potentiating. We demonstrate that these antibodies bind to different regions of LRP6 protein, and inhibition of signaling results from blocking Wnt binding. Antibody-mediated dimerization of LRP6 can potentiate signaling only when a Wnt isoform is also able to bind the complex, presumably recruiting FZD. Endogenous autocrine Wnt signaling in different tumor cell lines can be either antagonized or enhanced by the LRP6 antibodies, indicating expression of different Wnt isoforms. As anticipated from the roles of Wnt signaling in cancer and bone development, antibody activities can also be observed in mice for inhibition of tumor growth and in organ culture for enhancement of bone mineral density. Collectively, our results indicate that separate binding sites for different subsets of Wnt isoforms determine the inhibition or potentiation of signaling conferred by LRP6 antibodies. This complexity of coreceptor-ligand interactions may allow for

  18. Specific chalone inhibition of the regeneration of the JB-1 ascites tumour studied by flow microfluorometry.

    Science.gov (United States)

    Bichel, P; Barfod, N M

    1977-03-01

    The variation in the DNA distribution in the JB-1 and the Lla2 ascites tumour was investigated by means of flow microfluorometry (FMF) in the plateau stage and during the initiation of the regenerative growth induced by percutaneous aspiration. The study showed that a considerable influx of cells with G1DNA content into the S phase occurred in both tumours about 10 hr after aspiration. In the JB-1 tumour, these initial regenerative changes could be reversibly blocked by injections of cell-free plateau JB-1 ascitic fluid or an ultrafiltrate of this ascites. In contrast to these observations no delay in the regenerative changes was observed in the L1a2 tumour after treatment with JB-1 ascites or the ultrafiltrate. The study supports the assumption of a specific growth regulation of the JB-1 ascites tumour and emphasizes the suitability of FMF analyses in cell-kinetic studies in which short-term fluctuations take place in the distribution of cells with different DNA content.

  19. Intracellular cytoplasm-specific delivery of SH3 and SH2 domains of SLAP inhibits TcR-mediated signaling.

    Science.gov (United States)

    Kim, Jung-Ho; Moon, Jae-Seung; Yu, JiSang; Lee, Sang-Kyou

    2015-05-01

    Signaling events triggered by T cell receptor (TcR) stimulation are important targets for the development of common therapeutics for various autoimmune diseases. SLAP is a negative regulator of TcR-mediated signaling cascade via targeting TcR zeta chain for degradation through recruiting the ubiquitin ligase c-Cbl. In this study, we generated a transducible form of SH3 and SH2 domains of SLAP (ctSLAPΔC) which can be specifically targeted to the cytoplasm of a cell. ctSLAPΔC inhibited tyrosine phosphorylation of signaling mediators such as ZAP-70 and LAT involved in T cell activation, and effectively suppressed transcriptional activity of NFAT and NFκB upon TcR stimulation. The transduced ctSLAPΔC in T cells blocked the secretion of T cell-specific cytokines such as IL-2, IFNγ, IL-17A, and IL-4 and induced the expression of CD69 and CD25 on effector T cells without influencing the cell viability. Inhibition of TcR-mediated signaling via SLAP blocked the differentiation of naïve T cells into Th1, Th2 or Treg cells with different sensitivity, suggesting that qualitative and quantitative intensity of TcR-mediated signaling in the context of polarizing cytokines environment may be a critical factor to determine the differentiation fate of naïve T cells. These results suggest that cytoplasm-specific transduction of the SH3 and SH2 domains of SLAP has a therapeutic potential of being an immunosuppressive reagent for the treatment of various autoimmune diseases.

  20. FE65 binds Teashirt, inhibiting expression of the primate-specific caspase-4.

    Directory of Open Access Journals (Sweden)

    Yuji Kajiwara

    Full Text Available The Alzheimer disease (AD amyloid protein precursor (APP can bind the FE65 adaptor protein and this complex can regulate gene expression. We carried out yeast two-hybrid studies with a PTB domain of FE65, focusing on those genes that might be involved in nuclear signaling, and identified and validated Teashirt proteins as FE65 interacting proteins in neurons. Using reporter systems, we observed that FE65 could simultaneously recruit SET, a component of the inhibitor of acetyl transferase, and Teashirt, which in turn recruited histone deacetylases, to produce a powerful gene-silencing complex. We screened stable cell lines with a macroarray focusing on AD-related genes and identified CASP4, encoding caspase-4, as a target of this silencing complex. Chromatin immunoprecipitation showed a direct interaction of FE65 and Teashirt3 with the promoter region of CASP4. Expression studies in postmortem samples demonstrated decreasing expression of Teashirt and increasing expression of caspase-4 with progressive cognitive decline. Importantly, there were significant increases in caspase-4 expression associated with even the earliest neuritic plaque changes in AD. We evaluated a case-control cohort and observed evidence for a genetic association between the Teashirt genes TSHZ1 and TSHZ3 and AD, with the TSHZ3 SNP genotype correlating with expression of Teashirt3. The results were consistent with a model in which reduced expression of Teashirt3, mediated by genetic or other causes, increases caspase-4 expression, leading to progression of AD. Thus the cell biological, gene expression and genetic data support a role for Teashirt/caspase-4 in AD biology. As caspase-4 shows evidence of being a primate-specific gene, current models of AD and other neurodegenerative conditions may be incomplete because of the absence of this gene in the murine genome.

  1. BRAF and MEK inhibition variably affect GD2-specific chimeric antigen receptor (CAR) T-cell function in vitro.

    Science.gov (United States)

    Gargett, Tessa; Fraser, Cara K; Dotti, Gianpietro; Yvon, Eric S; Brown, Michael P

    2015-01-01

    Cancer immunotherapy has long been used in the treatment of metastatic melanoma, and an anti-CTLA-4 monoclonal antibody treatment has recently been approved by the US Food and Drug Administration. Targeted therapies such as small molecule kinase inhibitors targeting deregulated mitogen-activated protein kinase (MAPK) signaling have markedly improved melanoma control in up to 50% of metastatic disease patients and have likewise been recently approved. Combination therapies for melanoma have been proposed as a way to exploit the high-level but short-term responses associated with kinase inhibitor therapies and the low-level but longer-term responses associated with immunotherapy. Cancer immunotherapy now includes adoptive transfer of autologous tumor-specific chimeric antigen receptor (CAR) T cells and this mode of therapy is a candidate for combination with small molecule drugs. This paper describes CART cells that target GD2-expressing melanoma cells and investigates the effects of approved MAPK pathway-targeted therapies for melanoma [vemurafenib (Vem), dabrafenib (Dab), and trametinib (Tram)] on the viability, activation, proliferation, and cytotoxic T lymphocyte activity of these CAR T cells, as well as on normal peripheral blood mononuclear cells. We report that, although all these drugs lead to inhibition of stimulated T cells at high concentrations in vitro, only Vem inhibited T cells at concentrations equivalent to reported plasma concentrations in treated patients. Although the combination of Dab and Tram also resulted in inhibition of T-cell effector functions at some therapeutic concentrations, Dab itself had little adverse effect on CAR T-cell function. These findings may have implications for novel therapeutic combinations of adoptive CAR T-cell immunotherapy and MAPK pathway inhibitors.

  2. Role of serotonin transporter inhibition in the regulation of tryptophan hydroxylase in brainstem raphe nuclei: time course and regional specificity.

    Science.gov (United States)

    MacGillivray, L; Lagrou, L M; Reynolds, K B; Rosebush, P I; Mazurek, M F

    2010-12-01

    Drugs that selectively inhibit the serotonin transporter (SERT) are widely prescribed for treatment of depression and a range of anxiety disorders. We studied the time course of changes in tryptophan hydroxylase (TPH) in four raphe nuclei after initiation of two different SERT inhibitors, citalopram and fluoxetine. In the first experiment, groups of Sprague-Dawley rats received daily meals of rice pudding either alone (n=9) or mixed with citalopram 5 mg/kg/day (n=27). Rats were sacrificed after 24 h, 7 days or 28 days of treatment. Sections of dorsal raphe nucleus (DRN), median raphe nucleus (MRN), raphe magnus nucleus (RMN) and caudal linear nucleus (CLN) were processed for TPH immunohistochemistry. Citalopram induced a significant reduction in DRN TPH-positive cell counts at 24 h (41%), 7 days (38%) and 28 days (52%). Similar reductions in TPH-positive cell counts were also observed at each timepoint in the MRN and in the RMN. In the MRN, citalopram resulted in significant reductions at 24 h (26%), 7 days (16%) and 28 days (23%). In the RMN, citalopram induced significant reductions of TPH-positive cell counts at 24 h (45%), 7 days (34%) and 28 days (43%). By contrast, no significant differences between control and treatment groups were observed in the CLN at any of the time points that we studied. To investigate whether these changes would occur with other SERT inhibitors, we conducted a second experiment, this time with a 28-day course of fluoxetine. As was observed with citalopram, fluoxetine induced significant reductions of TPH cell counts in the DRN (39%), MRN (38%) and RMN (41%), with no significant differences in the CLN. These results indicate that SERT inhibition can alter the regulation of TPH, the rate limiting enzyme for serotonin biosynthesis. This persistent and regionally specific downregulation of serotonin biosynthesis may account for some of the clinical withdrawal symptoms associated with drugs that inhibit SERT.

  3. Pregnancy-specific glycoproteins bind integrin αIIbβ3 and inhibit the platelet-fibrinogen interaction.

    Directory of Open Access Journals (Sweden)

    Daniel K Shanley

    Full Text Available Pregnancy-specific glycoproteins (PSGs are immunoglobulin superfamily members encoded by multigene families in rodents and primates. In human pregnancy, PSGs are secreted by the syncytiotrophoblast, a fetal tissue, and reach a concentration of up to 400 ug/ml in the maternal bloodstream at term. Human and mouse PSGs induce release of anti-inflammatory cytokines such as IL-10 and TGFβ1 from monocytes, macrophages, and other cell types, suggesting an immunoregulatory function. RGD tri-peptide motifs in the majority of human PSGs suggest that they may function like snake venom disintegrins, which bind integrins and inhibit interactions with ligands. We noted that human PSG1 has a KGD, rather than an RGD motif. The presence of a KGD in barbourin, a platelet integrin αIIbβ3 antagonist found in snake venom, suggested that PSG1 may be a selective αIIbβ3 ligand. Here we show that human PSG1 binds αIIbβ3 and inhibits the platelet - fibrinogen interaction. Unexpectedly, however, the KGD is not critical as multiple PSG1 domains independently bind and inhibit αIIbβ3 function. Human PSG9 and mouse Psg23 are also inhibitory suggesting conservation of this function across primate and rodent PSG families. Our results suggest that in species with haemochorial placentation, in which maternal blood is in direct contact with fetal trophoblast, the high expression level of PSGs reflects a requirement to antagonise abundant (3 mg/ml fibrinogen in the maternal circulation, which may be necessary to prevent platelet aggregation and thrombosis in the prothrombotic maternal environment of pregnancy.

  4. Europium-doped barium bromide iodide

    Energy Technology Data Exchange (ETDEWEB)

    Gundiah, Gautam; Hanrahan, Stephen M.; Hollander, Fredrick J.; Bourret-Courchesne, Edith D.

    2009-10-21

    Single crystals of Ba0.96Eu0.04BrI (barium europium bromide iodide) were grown by the Bridgman technique. The title compound adopts the ordered PbCl2 structure [Braekken (1932). Z. Kristallogr. 83, 222-282]. All atoms occupy the fourfold special positions (4c, site symmetry m) of the space group Pnma with a statistical distribution of Ba and Eu. They lie on the mirror planes, perpendicular to the b axis at y = +-0.25. Each cation is coordinated by nine anions in a tricapped trigonal prismatic arrangement.

  5. Herb–drug interaction prediction based on the high specific inhibition of andrographolide derivatives towards UDP-glucuronosyltransferase (UGT) 2B7

    Energy Technology Data Exchange (ETDEWEB)

    Ma, Hai-Ying, E-mail: cmu4h-mhy@126.com [The Fourth Affiliated Hospital of China Medical University, Shenyang 110032 (China); Sun, Dong-Xue [School of Traditional Chinese Medicine, Shenyang Pharmaceutical University, No. 103, Wenhua Road, Shenyang 110016 (China); Cao, Yun-Feng [The First Affiliated Hospital of Liaoning Medical University, Jinzhou 121001 (China); Joint Center for Translational Medicine, Dalian Institute of Chemical Physics, Chinese Academy of Sciences, Zhongshan Road, Dalian 116023 (China); Ai, Chun-Zhi [Joint Center for Translational Medicine, Dalian Institute of Chemical Physics, Chinese Academy of Sciences, Zhongshan Road, Dalian 116023 (China); Qu, Yan-Qing [Thyroid Surgery, Yantaishan Hospital, Yantai, Shandong (China); Hu, Cui-Min [Joint Center for Translational Medicine, Dalian Institute of Chemical Physics, Chinese Academy of Sciences, Zhongshan Road, Dalian 116023 (China); Department of Microbiology and Immunology, Georgetown University Medical Center, Washington, DC 20057 (United States); Jiang, Changtao [Laboratory of Metabolism, Center for Cancer Research, National Cancer Institute, Bethesda, MD 20892 (United States); Dong, Pei-Pei [Academy of Integrative Medicine, Dalian Medical University, Dalian 116044 (China); Sun, Xiao-Yu; Hong, Mo [Joint Center for Translational Medicine, Dalian Institute of Chemical Physics, Chinese Academy of Sciences, Zhongshan Road, Dalian 116023 (China); Tanaka, Naoki; Gonzalez, Frank J. [Laboratory of Metabolism, Center for Cancer Research, National Cancer Institute, Bethesda, MD 20892 (United States); and others

    2014-05-15

    Herb–drug interaction strongly limits the clinical application of herbs and drugs, and the inhibition of herbal components towards important drug-metabolizing enzymes (DMEs) has been regarded as one of the most important reasons. The present study aims to investigate the inhibition potential of andrographolide derivatives towards one of the most important phase II DMEs UDP-glucuronosyltransferases (UGTs). Recombinant UGT isoforms (except UGT1A4)-catalyzed 4-methylumbelliferone (4-MU) glucuronidation reaction and UGT1A4-catalyzed trifluoperazine (TFP) glucuronidation were employed to firstly screen the andrographolide derivatives' inhibition potential. High specific inhibition of andrographolide derivatives towards UGT2B7 was observed. The inhibition type and parameters (K{sub i}) were determined for the compounds exhibiting strong inhibition capability towards UGT2B7, and human liver microsome (HLMs)-catalyzed zidovudine (AZT) glucuronidation probe reaction was used to furtherly confirm the inhibition behavior. In combination of inhibition parameters (K{sub i}) and in vivo concentration of andrographolide and dehydroandrographolide, the potential in vivo inhibition magnitude was predicted. Additionally, both the in vitro inhibition data and computational modeling results provide important information for the modification of andrographolide derivatives as selective inhibitors of UGT2B7. Taken together, data obtained from the present study indicated the potential herb–drug interaction between Andrographis paniculata and the drugs mainly undergoing UGT2B7-catalyzed metabolic elimination, and the andrographolide derivatives as potential candidates for the selective inhibitors of UGT2B7. - Highlights: • Specific inhibition of andrographolide derivatives towards UGT2B7. • Herb-drug interaction related withAndrographis paniculata. • Guidance for design of UGT2B7 specific inhibitors.

  6. Herb–drug interaction prediction based on the high specific inhibition of andrographolide derivatives towards UDP-glucuronosyltransferase (UGT) 2B7

    International Nuclear Information System (INIS)

    Herb–drug interaction strongly limits the clinical application of herbs and drugs, and the inhibition of herbal components towards important drug-metabolizing enzymes (DMEs) has been regarded as one of the most important reasons. The present study aims to investigate the inhibition potential of andrographolide derivatives towards one of the most important phase II DMEs UDP-glucuronosyltransferases (UGTs). Recombinant UGT isoforms (except UGT1A4)-catalyzed 4-methylumbelliferone (4-MU) glucuronidation reaction and UGT1A4-catalyzed trifluoperazine (TFP) glucuronidation were employed to firstly screen the andrographolide derivatives' inhibition potential. High specific inhibition of andrographolide derivatives towards UGT2B7 was observed. The inhibition type and parameters (Ki) were determined for the compounds exhibiting strong inhibition capability towards UGT2B7, and human liver microsome (HLMs)-catalyzed zidovudine (AZT) glucuronidation probe reaction was used to furtherly confirm the inhibition behavior. In combination of inhibition parameters (Ki) and in vivo concentration of andrographolide and dehydroandrographolide, the potential in vivo inhibition magnitude was predicted. Additionally, both the in vitro inhibition data and computational modeling results provide important information for the modification of andrographolide derivatives as selective inhibitors of UGT2B7. Taken together, data obtained from the present study indicated the potential herb–drug interaction between Andrographis paniculata and the drugs mainly undergoing UGT2B7-catalyzed metabolic elimination, and the andrographolide derivatives as potential candidates for the selective inhibitors of UGT2B7. - Highlights: • Specific inhibition of andrographolide derivatives towards UGT2B7. • Herb-drug interaction related withAndrographis paniculata. • Guidance for design of UGT2B7 specific inhibitors

  7. Rh2E2, a novel metabolic suppressor, specifically inhibits energy-based metabolism of tumor cells.

    Science.gov (United States)

    Wong, Vincent Kam Wai; Dong, Hang; Liang, Xu; Bai, Li-Ping; Jiang, Zhi-Hong; Guo, Yue; Kong, Ah Ng Tony; Wang, Rui; Kam, Richard Kin Ting; Law, Betty Yuen Kwan; Hsiao, Wendy Wen Luen; Chan, Ka Man; Wang, Jingrong; Chan, Rick Wai Kit; Guo, Jianru; Zhang, Wei; Yen, Feng Gen; Zhou, Hua; Leung, Elaine Lai Han; Yu, Zhiling; Liu, Liang

    2016-03-01

    Energy metabolism in cancer cells is often increased to meet their higher proliferative rate and biosynthesis demands. Suppressing cancer cell metabolism using agents like metformin has become an attractive strategy for treating cancer patients. We showed that a novel ginsenoside derivative, Rh2E2, is as effective as aspirin in preventing the development of AOM/DSS-induced colorectal cancer and suppresses tumor growth and metastasis in a LLC-1 xenograft. A sub-chronic and acute toxicity LD50 test of Rh2E2 showed no harmful reactions at the maximum oral dosage of 5000 mg/kg body weight in mice. Proteomic profiling revealed that Rh2E2 specifically inhibited ATP production in cancer cells via down-regulation of metabolic enzymes involving glycolysis, fatty acid β-oxidation and the tricarboxylic acid cycle, leading to specific cytotoxicity and S-phase cell cycle arrest in cancer cells. Those findings suggest that Rh2E2 possesses a novel and safe anti-metabolic agent for cancer patients by specific reduction of energy-based metabolism in cancer cells. PMID:26799418

  8. Kinetics of Chlorination of Benzophenone-3 in the Presence of Bromide and Ammonia.

    Science.gov (United States)

    Abdallah, Pamela; Deborde, Marie; Dossier Berne, Florence; Karpel Vel Leitner, Nathalie

    2015-12-15

    The aim of this study was to assess the impact of chlorination on the degradation of one of the most commonly used UV filters (benzophenone-3 (BP-3)) and the effects of bromide and ammonia on the kinetics of BP-3 elimination. Bromide and ammonia are rapidly converted to bromine and chloramines during chlorination. At first, the rate constants of chlorine, bromine and monochloramine with BP-3 were determined at various pH levels. BP-3 was found to react rapidly with chlorine and bromine, with values of apparent second order rate constants equal to 1.25(±0.14) × 10(3) M(-1)·s(-1) and 4.04(±0.54) × 10(6) M(-1)·s(-1) at pH 8.5 for kChlorine/BP-3 and kBromine/BP-3, respectively, whereas low monochloramine reactivity was observed (kNH2Cl/BP-3 = 0.112 M(-1)·s(-1)). To assess the impact of the inorganic content of water on BP-3 degradation, chlorination experiments with different added concentrations of bromide and/or ammonia were conducted. Under these conditions, BP-3 degradation was found to be enhanced in the presence of bromide due to the formation of bromine, whereas it was inhibited in the presence of ammonia. However, the results obtained were pH dependent. Finally, a kinetic model considering 18 reactions was developed using Copasi to estimate BP-3 degradation during chlorination in the presence of bromide and ammonia.

  9. Autophagy and endosomal trafficking inhibition by Vibrio cholerae MARTX toxin phosphatidylinositol-3-phosphate-specific phospholipase A1 activity.

    Science.gov (United States)

    Agarwal, Shivani; Kim, Hyunjin; Chan, Robin B; Agarwal, Shivangi; Williamson, Rebecca; Cho, Wonhwa; Paolo, Gilbert Di; Paolo, Gilbert D; Satchell, Karla J F

    2015-10-26

    Vibrio cholerae, responsible for acute gastroenteritis secretes a large multifunctional-autoprocessing repeat-in-toxin (MARTX) toxin linked to evasion of host immune system, facilitating colonization of small intestine. Unlike other effector domains of the multifunctional toxin that target cytoskeleton, the function of alpha-beta hydrolase (ABH) remained elusive. This study demonstrates that ABH is an esterase/lipase with catalytic Ser-His-Asp triad. ABH binds with high affinity to phosphatidylinositol-3-phosphate (PtdIns3P) and cleaves the fatty acid in PtdIns3P at the sn1 position in vitro making it the first PtdIns3P-specific phospholipase A1 (PLA1). Expression of ABH in vivo reduces intracellular PtdIns3P levels and its PtdIns3P-specific PLA1 activity blocks endosomal and autophagic pathways. In accordance with recent studies acknowledging the potential of extracellular pathogens to evade or exploit autophagy to prevent their clearance and facilitate survival, this is the first report highlighting the role of ABH in inhibiting autophagy and endosomal trafficking induced by extracellular V. cholerae.

  10. Expression of aquaporin-1 in rat pleural mesothelial cells and its specific inhibition by RNA interference in vitro

    Institute of Scientific and Technical Information of China (English)

    ZHANG Wei; XIE Can-mao; LI Zhi-ping

    2007-01-01

    Background The discovery of water channel aquaporins(AQPs)has greatly expanded the understanding of the regulation of the water permeability of biological membranes.Aquaporin-1(AQP1)may be involved in fluid transport in numerous pathological conditions.The objective of the present study was to examine whether AQP1 is present in cultured rat pleural mesothelial cells(PMCs)and to investigate the specific inhibitory effect of RNA interference(RNAi) on AQP1 expression in PMCs,which may provide a new method for the further studies on the relation between expression of AQP1 in PMCs and pleural fluid removal in vivo.Methods PMCs were isolated and cultured from rat pleura.The expression of AQP1 in PMCs was confirmed by immunocytochemical staining and reverse transcriptase-polymerase chain reaction(RT-PCR).Two eukaryotic expression plasmid vectors of short hairpin RNA(shRNA)specific for the AQP1 gene of rat sapien were designed and constructed.The recombinant plasmid vectors were transfected into cultured rat PMCs by cation liposomes.Flow cytometry was used to screen the most effective shRNA at 48 hours after transfection.The expressions of AQP1 mRNA and protein were detected by RT-PCR and Western blotting method at 48 hours after transfection.Results RT-PCR and immunostaining revealed that AQP1 mRNA and protein were present in cultured rat PMCs.Two effective eukaryotic expression plasmid vectors of shRNA specific for the AQP1 gene were constructed successfully.The levels of the expression of AQP1 were inhibited by 83.45%,90.93%,respectively,at mRNA level and 41.24%,67.60%,respectively at protein level by two recombinant plasmids at 48 hours after transfection.The expression of AQP1 in PMCs transfected with plasmid was significantly lower than that of the cells transfected with the control plasmid HK and that of the untransfected cells(P<0.01).There was no significant difference in AQP1 expression between the control group and the group transfected with AQP1 nonspecific sh

  11. Antisense Phosphorodiamidate Morpholino Oligomer Length and Target Position Effects on Gene-Specific Inhibition in Escherichia coli

    OpenAIRE

    Deere, Jesse; Iversen, Pat; Geller, Bruce L.

    2005-01-01

    Phosphorodiamidate morpholino oligomers (PMOs) are synthetic DNA analogs that inhibit gene expression in a sequence-dependent manner. PMOs of various lengths (7 to 20 bases) were tested for inhibition of luciferase expression in Escherichia coli. Shorter PMOs generally inhibited luciferase greater than longer PMOs. Conversely, in bacterial cell-free protein synthesis reactions, longer PMOs inhibited equally or more than shorter PMOs. Overlapping, isometric (10-base) PMOs complementary to the ...

  12. Squalamine, a novel cationic steroid, specifically inhibits the brush-border Na+/H+ exchanger isoform NHE3.

    Science.gov (United States)

    Akhter, S; Nath, S K; Tse, C M; Williams, J; Zasloff, M; Donowitz, M

    1999-01-01

    Squalamine, an endogenous molecule found in the liver and other tissues of Squalus acanthias, has antibiotic properties and causes changes in endothelial cell shape. The latter suggested that its potential targets might include transport proteins that control cell volume or cell shape. The effect of purified squalamine was examined on cloned Na+/H+ exchanger isoforms NHE1, NHE2, and NHE3 stably transfected in PS120 fibroblasts. Squalamine (1-h pretreatment) decreased the maximal velocity of rabbit NHE3 in a concentration-dependent manner (13, 47, and 57% inhibition with 3, 5, and 7 micrograms/ml, respectively) and also increased K'[H+]i. Squalamine did not affect rabbit NHE1 or NHE2 function. The inhibitory effect of squalamine was 1) time dependent, with no effect of immediate addition and maximum effect with 1 h of exposure, and 2) fully reversible. Squalamine pretreatment of the ileum for 60 min inhibited brush-border membrane vesicle Na+/H+ activity by 51%. Further investigation into the mechanism of squalamine's effects showed that squalamine required the COOH-terminal 76 amino acids of NHE3. Squalamine had no cytotoxic effect at the concentrations studied, as indicated by monitoring lactate dehydrogenase release. These results indicate that squalamine 1) is a specific inhibitor of the brush-border NHE isoform NHE3 and not NHE1 or NHE2, 2) acts in a nontoxic and fully reversible manner, and 3) has a delayed effect, indicating that it may influence brush-border Na+/H+ exchanger function indirectly, through an intracellular signaling pathway or by acting as an intracellular modulator. PMID:9886929

  13. Identification of Plasmodium falciparum RhopH3 protein peptides that specifically bind to erythrocytes and inhibit merozoite invasion

    Science.gov (United States)

    Pinzón, Carlos Giovanni; Curtidor, Hernando; Reyes, Claudia; Méndez, David; Patarroyo, Manuel Elkin

    2008-01-01

    The identification of sequences involved in binding to erythrocytes is an important step for understanding the molecular basis of merozoite–erythrocyte interactions that take place during invasion of the Plasmodium falciparum malaria parasite into host cells. Several molecules located in the apical organelles (micronemes, rhoptry, dense granules) of the invasive-stage parasite are essential for erythrocyte recognition, invasion, and establishment of the nascent parasitophorous vacuole. Particularly, it has been demonstrated that rhoptry proteins play an important role in binding to erythrocyte surface receptors, among which is the PfRhopH3 protein, which triggers important immune responses in patients from endemic regions. It has also been reported that anti-RhopH3 antibodies inhibit in vitro invasion of erythrocytes, further supporting its direct involvement in erythrocyte invasion processes. In this study, PfRhopH3 consecutive peptides were synthesized and tested in erythrocyte binding assays for identifying those regions mediating binding to erythrocytes. Fourteen PfRhopH3 peptides presenting high specific binding activity were found, whose bindings were saturable and presented nanomolar dissociation constants. These high-activity binding peptides (HABPs) were characterized by having α-helical structural elements, as determined by circular dichroism, and having receptors of a possible sialic acid-dependent and/or glycoprotein-dependent nature, as evidenced in enzyme-treated erythrocyte binding assays and further corroborated by cross-linking assay results. Furthermore, these HABPs inhibited merozoite in vitro invasion of normal erythrocytes at 200 μM by up to 60% and 90%, suggesting that some RhopH3 protein regions are involved in the P. falciparum erythrocyte invasion. PMID:18593818

  14. Artificial light at night causes diapause inhibition and sex-specific life history changes in a moth.

    Science.gov (United States)

    van Geffen, Koert G; van Grunsven, Roy H A; van Ruijven, Jasper; Berendse, Frank; Veenendaal, Elmar M

    2014-06-01

    Rapidly increasing levels of light pollution subject nocturnal organisms to major alterations of their habitat, the ecological consequences of which are largely unknown. Moths are well-known to be attracted to light at night, but effects of light on other aspects of moth ecology, such as larval development and life-history, remain unknown. Such effects may have important consequences for fitness and thus for moth population sizes. To study the effects of artificial night lighting on development and life-history of moths, we experimentally subjected Mamestra brassicae (Noctuidae) caterpillars to low intensity green, white, red or no artificial light at night and determined their growth rate, maximum caterpillar mass, age at pupation, pupal mass and pupation duration. We found sex-specific effects of artificial light on caterpillar life-history, with male caterpillars subjected to green and white light reaching a lower maximum mass, pupating earlier and obtaining a lower pupal mass than male caterpillars under red light or in darkness. These effects can have major implications for fitness, but were absent in female caterpillars. Moreover, by the time that the first adult moth from the dark control treatment emerged from its pupa (after 110 days), about 85% of the moths that were under green light and 83% of the moths that were under white light had already emerged. These differences in pupation duration occurred in both sexes and were highly significant, and likely result from diapause inhibition by artificial night lighting. We conclude that low levels of nocturnal illumination can disrupt life-histories in moths and inhibit the initiation of pupal diapause. This may result in reduced fitness and increased mortality. The application of red light, instead of white or green light, might be an appropriate measure to mitigate negative artificial light effects on moth life history. PMID:25360250

  15. Specific inhibition of T-cell adhesion to extracellular matrix and proinflammatory cytokine secretion by human recombinant galectin-1.

    Science.gov (United States)

    Rabinovich, G A; Ariel, A; Hershkoviz, R; Hirabayashi, J; Kasai, K I; Lider, O

    1999-05-01

    The migration of immune cells through the extracellular matrix (ECM) towards inflammatory sites is co-ordinated by receptors recognizing ECM glycoproteins, chemokines and proinflammatory cytokines. In this context, galectins are secreted to the extracellular milieu, where they recognize poly-N-acetyllactosamine chains on major ECM glycoproteins, such as fibronectin and laminin. We investigated the possibility that galectin-1 could modulate the adhesion of human T cells to ECM and ECM components. T cells were purified from human blood, activated with interleukin-2 (IL-2), labelled, and incubated further with intact immobilized ECM and ECM glycoproteins in the presence of increasing concentrations of human recombinant galectin-1, or its more stable, related, C2-S molecule obtained by site-directed mutagenesis. The presence of galectin-1 was shown to inhibit T-cell adhesion to intact ECM, laminin and fibronectin, and to a lesser extent to collagen type IV, in a dose-dependent manner. This effect was specifically blocked by anti-galectin-1 antibody and was dependent on the lectin's carbohydrate-binding properties. The inhibition of T-cell adhesion by galectin-1 correlates with the ability of this molecule to block the re-organization of the activated cell's actin cytoskeleton. Furthermore, tumour necrosis factor-alpha (TNF-alpha) and interferon-gamma (IFN-gamma) production was markedly reduced when IL-2-activated T cells were incubated with galectin-1 or its mutant. This effect was prevented by beta-galactoside-related sugars. The present study reveals an alternative inhibitory mechanism for explaining the suppressive properties of the galectin-1 subfamily on inflammatory and autoimmune processes. PMID:10447720

  16. Dynamics of cetyltrimethylammonium bromide mediated reaction of phenylsulfinylacetic acid with Cr(VI: Treatment of pseudo-phase models

    Directory of Open Access Journals (Sweden)

    Subramaniam Perumal

    2015-01-01

    The influence of cetyltrimethylammonium bromide, CTon the oxidative decarboxylation of phenylsulfinylacetic acid, PSAA and several meta- and para-substituted PSAAs by Cr(VI was investigated in 95 % H2O-5 % CH3CN medium. The rate profile displayed a peculiar trend with an initial rate increase at low [CTAB] followed by sharp rate inhibition at higher [CTAB]. The initial rate acceleration can be explained by strong binding of SO42- on the positively charged micellar surface. The specific partitioning of PSAA in micellar phase by hydrophobic interaction and the oxidizing species, HCrO3+ in aqueous phase by electrostatic repulsion accounted the rate retardation at higher [CTAB]. The Hammett plot with different substituted PSAAs showed an excellent correlation affording negative ρ value which supports the proposed mechanism involving a sulfonium cation intermediate formation. The obtained ρ value in CTmedium is found to be slightly lower than that in aqueous medium. The quantitative analysis of rate data for the inhibition shown by CTwas performed using Menger-Portnoy and Piszkiewicz pseudo-phase models. The binding constant for PSAA with micelle was evaluated from Piszkiewicz cooperative model.

  17. 77 FR 20752 - Methyl Bromide; Proposed Pesticide Tolerance

    Science.gov (United States)

    2012-04-06

    ..., which means EPA will not know your identity or contact information unless you provide it in the body of... include your name and other contact information in the body of your comment and with any disk or CD-ROM... methyl bromide. And, although methyl bromide tends to be lipid soluble, the low octanol-water...

  18. Specifications

    International Nuclear Information System (INIS)

    As part of the Danish RERTR Program, three fuel elements with LEU U3O8-Al fuel and three fuel elements with LEU U3Si2-Al fuel were manufactured by NUKEM for irradiation testing in the DR-3 reactor at the Risoe National Laboratory in Denmark. The specifications for the elements with U3O8-Al fuel are presented here as an illustration only. Specifications for the elements with U3Si2-Al fuel were very similar. In this example, materials, material numbers, documents numbers, and drawing numbers specific to a single fabricator have been deleted. (author)

  19. Degradation of methyl bromide in anaerobic sediments

    Science.gov (United States)

    Oremland, R.S.; Miller, L.G.; Strohmaler, F.E.

    1994-01-01

    Methyl bromide (MeBr) was anaerobically degraded in saltmarsh sediments after reaction with sulfide. The product of this nucleophilic substitution reaction was methanethiol, which underwent further chemical and bacterial reactions to form dimethyl sulfide. These two gases appeared transiently during sediment incubations because they were metabolized by methanogenic and sulfate-reducing bacteria. A second, less significant reaction of MeBr was the exchange with chloride, forming methyl chloride, which was also susceptible to attack by sulfide. Incubation of 14C-labeled methyl iodide as an analogue of MeBr resulted in the formation of 14CH4 and 14CO2 and also indicated that sulfate-reducing bacteria as well as methanogens metabolized the methylated sulfur intermediates. These results suggest that exposed sediments with abundant free sulfide, such as coastal salt-marshes, may constitute a sink for atmospheric MeBr.

  20. Kinetic spectrophotometric determination of bromide in clidinium-c drug

    Institute of Scientific and Technical Information of China (English)

    Ali Sheibani; M. Reza Shishehbore; Zahra Tavakolian Ardakani

    2011-01-01

    A simple, rapid and sensitive method has been described for the determination of the trace amounts of bromide. The method is based on the catalytic effect of bromide ion on the oxidation of methylene blue by bromate in sulfuric acid media. The reaction is monitored spectrophotometrically by measuring the decrease in the absorbance of methylene blue at 665 nm. Bromide was determined in the range of 0.05-1.90 μg/mL with the detection limit of 0.03 μg/mL. The relative standard deviations of five replicate determinations of 0.20 and 10.0 μg/mL of bromide were 2.4% and 1.8%, respectively. The influence of potential interfering ions and substances was studied. The method is applied to the analysis of bromide in clidinium-c tablet as a real sample.

  1. NEW CLASS OF DRUGS: THERAPEUTIC RNAi INHIBITION OF PCSK9 AS A SPECIFIC LDL-C LOWERING THERAPY.

    Science.gov (United States)

    Strat, A L; Ghiciuc, Cristina Mihaela; Lupuşoru, Cătălina Elena; Mitu, F

    2016-01-01

    Hyperlipidemia is a well-known risk factor for coronary heart disease, the leading cause of death for both men and women. Current lipid-lowering treatment is not always efficient, therefore new pharmacological interventions that reduce LDL cholesterol (LDL-C) have been developed. This paper presents new class of specific LDL lipid-lowering drugs under investigation in phase II or III clinical trials. The inhibition of proprotein convertase subtilisin/kexin type 9 (PCSK9), a key enzyme in cholesterol homeostasis, improve the liver's ability to clear LDL from the plasma, reducing LDL-C levels. Currently, three monoclonal antibodies PCSK9 inhibitors (alirocumab, evolocumab and bococizumab) are evaluated in clinical outcome trials. ALN-PCSsc, the new first-in- class therapeutic RNA interference (RNAi) inhibitor of proprotein convertase subtilisin/kexin type 9 (PCSK9) is also the first-in-class investigational medicine that acts by turning off PCSK9 synthesis in the liver. The development leadership of ALN-PCSsc has now transferred from Alnylam Pharmaceuticals to The Medicines Company, who has initiated the ORION-1 Phase II study at the beginning of 2016. ALN-PCSsc has significant potential given its highly competitive profile as compared with monoclonal antibodies anti-PCSK9 MAbs, a recently approved class of LDL-C lowering drugs.

  2. Specific interaction between Mycobacterium tuberculosis lipoprotein-derived peptides and target cells inhibits mycobacterial entry in vitro

    Science.gov (United States)

    Ocampo, Marisol; Curtidor, Hernando; Vanegas, Magnolia; Patarroyo, Manuel Alfonso; Patarroyo, Manuel Elkin

    2014-01-01

    Summary Tuberculosis (TB) continues being one of the diseases having the greatest mortality rates around the world, 8.7 million cases having been reported in 2011. An efficient vaccine against TB having a great impact on public health is an urgent need. Usually, selecting antigens for vaccines has been based on proteins having immunogenic properties for patients suffering TB and having had promising results in mice and non-human primates. Our approach has been based on a functional approach involving the pathogen–host interaction in the search for antigens to be included in designing an efficient, minimal, subunit-based anti-tuberculosis vaccine. This means that Mycobacterium tuberculosis has mainly been involved in studies and that lipoproteins represent an important kind of protein on the cell envelope which can also contribute towards this pathogen's virulence. This study has assessed the expression of four lipoproteins from M. tuberculosis H37Rv, i.e. Rv1411c (LprG), Rv1911c (LppC), Rv2270 (LppN) and Rv3763 (LpqH), and the possible biological activity of peptides derived from these. Five peptides were found for these proteins which had high specific binding to both alveolar A549 epithelial cells and U937 monocyte-derived macrophages which were able to significantly inhibit mycobacterial entry to these cells in vitro. PMID:25041568

  3. PKA and CDK5 can phosphorylate specific serines on the intracellular domain of podoplanin (PDPN) to inhibit cell motility.

    Science.gov (United States)

    Krishnan, Harini; Retzbach, Edward P; Ramirez, Maria I; Liu, Tong; Li, Hong; Miller, W Todd; Goldberg, Gary S

    2015-07-01

    Podoplanin (PDPN) is a transmembrane glycoprotein that promotes tumor cell migration, invasion, and cancer metastasis. In fact, PDPN expression is induced in many types of cancer. Thus, PDPN has emerged as a functionally relevant cancer biomarker and chemotherapeutic target. PDPN contains 2 intracellular serine residues that are conserved between species ranging from mouse to humans. Recent studies indicate that protein kinase A (PKA) can phosphorylate PDPN in order to inhibit cell migration. However, the number and identification of specific residues phosphorylated by PKA have not been defined. In addition, roles of other kinases that may phosphorylate PDPN to control cell migration have not been investigated. We report here that cyclin dependent kinase 5 (CDK5) can phosphorylate PDPN in addition to PKA. Moreover, results from this study indicate that PKA and CDK5 cooperate to phosphorylate PDPN on both intracellular serine residues to decrease cell motility. These results provide new insight into PDPN phosphorylation dynamics and the role of PDPN in cell motility. Understanding novel mechanisms of PDPN intracellular signaling could assist with designing novel targeted chemotherapeutic agents and procedures. PMID:25959509

  4. Effects of oral pinaverium bromide on colonic response to food in irritable bowel syndrome patients.

    Science.gov (United States)

    Bouchoucha, M; Faye, A; Devroede, G; Arsac, M

    2000-08-01

    We have recently developed a simple method to investigate the colonic response to food (CRF). This study describes the modifications of CRF induced by treatment with oral pinaverium bromide in irritable bowel syndrome (IBS) patients. Thirty healthy subjects and 43 patients suffering from IBS were studied. Colonic transit time (CTT) was measured in fasting conditions and after eating a standard test meal. Colonic response to food was quantified by calculating the variation in number of markers in each zone of interest of the large bowel between the X-ray films of the abdomen taken before and after eating. CRF is characterized by caudal propulsion of colonic contents in the two groups. In controls, there is emptying of the caecum-ascending colon region and filling of the rectosigmoid. In IBS patients, only the left transverse colon and the splenic flexure empty. Pinaverium bromide exerts no effect in controls but reverses the CRF of the right colon in IBS patients by inhibiting right colon emptying. These results suggest that the inhibitory action of pinaverium bromide on CRF may support the clinical efficacy of this calcium channel blocker in the treatment of IBS. PMID:10989977

  5. Inhibition of X-ray and doxorubicin-induced apoptosis by butyrolactone I, a CDK-specific inhibitor, in human tumor cells

    Energy Technology Data Exchange (ETDEWEB)

    Lu Yanjun [Shanghai Celstar Bio-Pharmaceutical Co. Ltd. (China). Cancer Research Center; Takebe, Hiraku; Yagi, Takashi

    2000-12-01

    Cell-cycle progression is coordinately regulated by cyclin-dependent kinases (CDKs). The inhibition of CDKs by p21 {sup wafl/Cipl/Sdil} prevents the apoptosis of cells treated with DNA-damaging agents. In this study, we found that butyrolactone I, a specific inhibitor of CDC2 family kinases, blocks the X-ray- or doxorubicin-induced apoptosis of DLD1 (p21 +/+) human colorectal carcinoma cells in a dose-dependent manner. We also found that butyrolactone I inhibits the CDK2 activity and enhances cell survival after an X-ray irradiation or doxorubicin treatment in both DLD1 (p21 -/-) and DLD1 (p21 +/+) cells. These findings suggest that butyrolactone I prevents apoptosis by the direct inhibition of CDK and also, possibly, by CDK-inhibition through p53-independent p21-induction. Our findings indicate that CDK activity is required for DNA-damaging agent-induced apoptosis. (author)

  6. Inhibition of X-ray and doxorubicin-induced apoptosis by butyrolactone I, a CDK-specific inhibitor, in human tumor cells

    International Nuclear Information System (INIS)

    Cell-cycle progression is coordinately regulated by cyclin-dependent kinases (CDKs). The inhibition of CDKs by p21 wafl/Cipl/Sdil prevents the apoptosis of cells treated with DNA-damaging agents. In this study, we found that butyrolactone I, a specific inhibitor of CDC2 family kinases, blocks the X-ray- or doxorubicin-induced apoptosis of DLD1 (p21 +/+) human colorectal carcinoma cells in a dose-dependent manner. We also found that butyrolactone I inhibits the CDK2 activity and enhances cell survival after an X-ray irradiation or doxorubicin treatment in both DLD1 (p21 -/-) and DLD1 (p21 +/+) cells. These findings suggest that butyrolactone I prevents apoptosis by the direct inhibition of CDK and also, possibly, by CDK-inhibition through p53-independent p21-induction. Our findings indicate that CDK activity is required for DNA-damaging agent-induced apoptosis. (author)

  7. Specific Inhibition of the VEGFR-3 Tyrosine Kinase by SAR131675 Reduces Peripheral and Tumor Associated Immunosuppressive Myeloid Cells

    Directory of Open Access Journals (Sweden)

    Nicolas Espagnolle

    2014-02-01

    Full Text Available Myeloid derived suppressor cells (MDSCs and tumor-associated macrophages (TAMs represent prominent components in cancer progression. We previously showed that inhibition of the VEGFR-3 pathway by SAR131675 leads to reduction of TAM infiltration and tumor growth. Here, we found that treatment with SAR131675 prevents the accumulation of immunosuppressive blood and splenic MDSCs which express VEGFR-3, in 4T1 tumor bearing mice. Moreover we showed that soluble factors secreted by tumor cells promote MDSCs proliferation and differentiation into M2 polarized F4/80+ macrophages. In addition, cell sorting and transcriptomic analysis of tumor infiltrating myeloid cells revealed the presence of a heterogeneous population that could be divided into 3 subpopulations: (i immature cells with a MDSC phenotype (GR1+/CD11b+/F4/80−; (ii “immuno-incompetent” macrophages (F4/80high/CD86neg/MHCIILow strongly expressing M2 markers such as Legumain, CD206 and Mgl1/2 and (iii “immuno-competent”-M1 like macrophages (F4/80Low/CD86+/MHCIIHigh. SAR131675 treatment reduced MDSCs in lymphoid organs as well as F4/80High populations in tumors. Interestingly, in the tumor SAR131675 was able to increase the immunocompetent M1 like population (F4/80low. Altogether these results demonstrate that the specific VEGFR-3 inhibitor SAR131675 exerts its anti tumoral activity by acting on different players that orchestrate immunosuppression and cancer progression in a tumoral context: MDSCs in peripheral lymphoid organs and TAMs infiltrating the tumor.

  8. Specific Inhibition of the VEGFR-3 Tyrosine Kinase by SAR131675 Reduces Peripheral and Tumor Associated Immunosuppressive Myeloid Cells

    Energy Technology Data Exchange (ETDEWEB)

    Espagnolle, Nicolas [UMR5273 INSERM U1031/CNRS/EFS StromaLab, Toulouse 31432 (France); Barron, Pauline; Mandron, Marie; Blanc, Isabelle; Bonnin, Jacques [Sanofi Recherche et Développement, Early to Candidate DPU, Toulouse 31036 (France); Agnel, Magali; Kerbelec, Erwan [Molecular Biology Unit, Biologics Department, Sanofi, Vitry-sur-Seine 94400 (France); Herault, Jean Pascal; Savi, Pierre; Bono, Françoise; Alam, Antoine, E-mail: antoine.alam@sanofi.com [Sanofi Recherche et Développement, Early to Candidate DPU, Toulouse 31036 (France)

    2014-02-28

    Myeloid derived suppressor cells (MDSCs) and tumor-associated macrophages (TAMs) represent prominent components in cancer progression. We previously showed that inhibition of the VEGFR-3 pathway by SAR131675 leads to reduction of TAM infiltration and tumor growth. Here, we found that treatment with SAR131675 prevents the accumulation of immunosuppressive blood and splenic MDSCs which express VEGFR-3, in 4T1 tumor bearing mice. Moreover we showed that soluble factors secreted by tumor cells promote MDSCs proliferation and differentiation into M2 polarized F4/80+ macrophages. In addition, cell sorting and transcriptomic analysis of tumor infiltrating myeloid cells revealed the presence of a heterogeneous population that could be divided into 3 subpopulations: (i) immature cells with a MDSC phenotype (GR1+/CD11b+/F4/80{sup −}); (ii) “immuno-incompetent” macrophages (F4/80{sup high}/CD86{sup neg}/MHCII{sup Low}) strongly expressing M2 markers such as Legumain, CD206 and Mgl1/2 and (iii) “immuno-competent”-M1 like macrophages (F4/80{sup Low}/CD86{sup +}/MHCII{sup High}). SAR131675 treatment reduced MDSCs in lymphoid organs as well as F4/80{sup High} populations in tumors. Interestingly, in the tumor SAR131675 was able to increase the immunocompetent M1 like population (F4/80{sup low}). Altogether these results demonstrate that the specific VEGFR-3 inhibitor SAR131675 exerts its anti tumoral activity by acting on different players that orchestrate immunosuppression and cancer progression in a tumoral context: MDSCs in peripheral lymphoid organs and TAMs infiltrating the tumor.

  9. Chloride, bromide and iodide scintillators with europium

    Energy Technology Data Exchange (ETDEWEB)

    Zhuravleva, Mariya; Yang, Kan

    2016-09-27

    A halide scintillator material is disclosed where the halide may comprise chloride, bromide or iodide. The material is single-crystalline and has a composition of the general formula ABX.sub.3 where A is an alkali, B is an alkali earth and X is a halide which general composition was investigated. In particular, crystals of the formula ACa.sub.1-yEu.sub.yI.sub.3 where A=K, Rb and Cs were formed as well as crystals of the formula CsA.sub.1-yEu.sub.yX.sub.3 (where A=Ca, Sr, Ba, or a combination thereof and X=Cl, Br or I or a combination thereof) with divalent Europium doping where 0.ltoreq.y.ltoreq.1, and more particularly Eu doping has been studied at one to ten mol %. The disclosed scintillator materials are suitable for making scintillation detectors used in applications such as medical imaging and homeland security.

  10. Rapid Consumption of Low Concentrations of Methyl Bromide by Soil Bacteria

    OpenAIRE

    Hines, Mark E.; Crill, Patrick M; Varner, Ruth K.; Talbot, Robert W; Shorter, Joanne H.; Kolb, Charles E.; Harriss, Robert C.

    1998-01-01

    A dynamic dilution system for producing low mixing ratios of methyl bromide (MeBr) and a sensitive analytical technique were used to study the uptake of MeBr by various soils. MeBr was removed within minutes from vials incubated with soils and ∼10 parts per billion by volume of MeBr. Killed controls did not consume MeBr, and a mixture of the broad-spectrum antibiotics chloramphenicol and tetracycline inhibited MeBr uptake by 98%, indicating that all of the uptake of MeBr was biological and by...

  11. Low concentrations of nitrate and ammonium stimulate nodulation and N-2 fixation while inhibiting specific nodulation (nodule DW g(-1) root dry weight) and specific N-2 fixation (N-2 fixed g(-1) root dry weight) in soybean

    NARCIS (Netherlands)

    Gan, YB; Stulen, [No Value; van Keulen, H; Kuiper, PJC

    2004-01-01

    Nitrate N is a major inhibitor of the soybean/Bradyrhizobium symbiosis in legumes and although this inhibition has been studied for many years, as yet no consensus has been reached on the specific and quantitative interactions between nitrate and ammonium supply and N-2 fixation. The effect of nitra

  12. Low concentrations of nitrate and ammonium stimulate nodulation and N2 fixation while inhibiting specific nodulation (nodule DW g-1 root dry weight) and specific N2 fixation (N2 fixed g-1 root dry weight) in soybean

    NARCIS (Netherlands)

    Gan, Y.; Stulen, I.; Keulen, van H.; Kuiper, P.J.C.

    2004-01-01

    Nitrate N is a major inhibitor of the soybean/Bradyrhizobium symbiosis in legumes and although this inhibition has been studied for many years, as yet no consensus has been reached on the specific and quantitative interactions between nitrate and ammonium supply and N2 fixation. The effect of nitrat

  13. A new convenient access to highly functionalized ()-2-arylvinyl bromides

    Indian Academy of Sciences (India)

    Yubo Jiang; Chunxiang Kuang

    2009-11-01

    Highly functionalized ()-2-arylvinyl bromides were prepared in high yields through a new convenient access by acylation of ()-4-(2-bromovinyl)phenol with fatty and aromatic acids at room temperature using dicyclohexyl carbodiimide (DCC) and dimethylaminopyridine (DMAP).

  14. Bromide space, total body water, and sick cell syndrome

    Energy Technology Data Exchange (ETDEWEB)

    Schober, O.; Hundeshagen, H.; Lehr, L.

    1982-01-01

    Displacements of the bromide space (Br-82-C, as a marker for the extracellular fluid compartment) are caused by an enhanced anatomical space and/or increased permeability of cells to bromide. The ratio Br-82-C: total body water (TBW) was evaluated to be 0.83 +- 0.17 in critically ill patients (n = 38) compared with the normal value of 0.46 +- 0.04 (n = 10). Because of normal TBW in critically ill patients (TBW = 505 +- 68 ml/kg), an increased bromide penetration into cells seems to be responsible for the enlarged ratio Br-82-C: TBW. Taking into consideration measurements in patients with malabsorption (Br-82-C: TBW = 0.56 +- 0.13; n = 13) and carcinoma of the rectum and colon (Br-82-C: TBW = 0.66 +- 0.24; n = 18) we think that the bromide space is a good measurement of the effective extracellular water.

  15. Effects of ipratropium bromide and fenoterol aerosols in pulmonary emphysema.

    OpenAIRE

    Hughes, J A; Tobin, M. J.; Bellamy, D; Hutchison, D. C.

    1982-01-01

    In patients with radiological evidence of pulmonary emphysema the bronchodilator drugs fenoterol and ipratropium bromide produced a considerable increase in vital capacity and reduction in residual volume. The response to fenoterol was virtually complete 15 minutes after administration, but after ipratropium bromide vital capacity was still increasing at 60 minutes. The change in vital capacity was slightly greater with a combination of the two drugs than with either used alone. Changes in FE...

  16. Quantum Chemistry Study on Dissociation of Oxalyl Bromide

    Institute of Scientific and Technical Information of China (English)

    2005-01-01

    The multi-bond dissociation dynamics of oxalyl bromide ((BrCO)2) has been investigated by DFT and CIS calculations. Upon the results, conclusion could be drawn that dissociation of C-Br bond of oxalyl bromide at the ground state (S0) is of barrierless. After the absorption of a photon, (BrCO)2 is excited to the first excited state and one of its C-Br bonds is broken to yield dissociate.

  17. Effect of pinaverium bromide on jejunal motility and colonic transit time in healthy humans.

    Science.gov (United States)

    Bouchoucha, M; Salles, J P; Fallet, M; Frileux, P; Cugnenc, P H; Barbier, J P

    1992-01-01

    Pinaverium bromide is a specific calcium channel blocker used in the treatment of irritable bowel syndrome (IBS) for its spasmolytic activity. The aim of the present study was to evaluate the effect of orally administered pinaverium bromide on jejunal motility and total and segmental colonic transit time in control subjects. Gastrointestinal studies were performed in 10 healthy volunteers (30 +/- 3 years), before and after a treatment phase of 14 days (150 mg/d). Jejunal motility was measured by prolonged manometry (14 h) and colonic transit time by a multiple ingestion, single marker technique. No significant modification of phase III of the migrating motor complexes was demonstrated. On the contrary, a significant (p < 0.01) but weak decrease of the frequency of contraction was found. Unlike previous studies, no decrease of total or segmental colonic transit time was demonstrated. PMID:1421047

  18. Bacterial oxidation of methyl bromide in fumigated agricultural soils

    Science.gov (United States)

    Miller, L.G.; Connell, T.L.; Guidetti, J.R.; Oremland, R.S.

    1997-01-01

    The oxidation of [14C]methyl bromide ([14C]MeBr) to 14CO2 was measured in field experiments with soils collected from two strawberry plots fumigated with mixtures of MeBr and chloropicrin (CCI3NO2). Although these fumigants are considered potent biocides, we found that the highest rates of MeBr oxidation occurred 1 to 2 days after injection when the fields were tarped, rather than before or several days after injection. No oxidation of MeBr occurred in heat-killed soils, indicating that microbes were the causative agents of the oxidation. Degradation of MeBr by chemical and/or biological processes accounted for 20 to 50% of the loss of MeBr during fumigation, with evasion to the atmosphere inferred to comprise the remainder. In laboratory incubations, complete removal of [14C]MeBr occurred within a few days, with 47 to 67% of the added MeBr oxidized to 14CO2 and the remainder of counts associated with the solid phase. Chloropicrin inhibited the oxidation of MeBr, implying that use of this substance constrains the extent of microbial degradation of MeBr during fumigation. Oxidation was by direct bacterial attack of MeBr and not of methanol, a product of the chemical hydrolysis of MeBr. Neither nitrifying nor methane-oxidizing bacteria were sufficiently active in these soils to account for the observed oxidation of MeBr, nor could the microbial degradation of MeBr be linked to cooxidation with exogenously supplied electron donors. However, repeated addition of MeBr to live soils resulted in higher rates of its removal, suggesting that soil bacteria used MeBr as an electron donor for growth. To support this interpretation, we isolated a gram-negative, aerobic bacterium from these soils which grew with MeBr as a sole source of carbon and energy.

  19. The killing of African trypanosomes by ethidium bromide.

    Directory of Open Access Journals (Sweden)

    Arnab Roy Chowdhury

    Full Text Available Introduced in the 1950s, ethidium bromide (EB is still used as an anti-trypanosomal drug for African cattle although its mechanism of killing has been unclear and controversial. EB has long been known to cause loss of the mitochondrial genome, named kinetoplast DNA (kDNA, a giant network of interlocked minicircles and maxicircles. However, the existence of viable parasites lacking kDNA (dyskinetoplastic led many to think that kDNA loss could not be the mechanism of killing. When recent studies indicated that kDNA is indeed essential in bloodstream trypanosomes and that dyskinetoplastic cells survive only if they have a compensating mutation in the nuclear genome, we investigated the effect of EB on kDNA and its replication. We here report some remarkable effects of EB. Using EM and other techniques, we found that binding of EB to network minicircles is low, probably because of their association with proteins that prevent helix unwinding. In contrast, covalently-closed minicircles that had been released from the network for replication bind EB extensively, causing them, after isolation, to become highly supertwisted and to develop regions of left-handed Z-DNA (without EB, these circles are fully relaxed. In vivo, EB causes helix distortion of free minicircles, preventing replication initiation and resulting in kDNA loss and cell death. Unexpectedly, EB also kills dyskinetoplastic trypanosomes, lacking kDNA, by inhibiting nuclear replication. Since the effect on kDNA occurs at a >10-fold lower EB concentration than that on nuclear DNA, we conclude that minicircle replication initiation is likely EB's most vulnerable target, but the effect on nuclear replication may also contribute to cell killing.

  20. Bioreactors for removing methyl bromide following contained fumigations

    Science.gov (United States)

    Miller, L.G.; Baesman, S.M.; Oremland, R.S.

    2003-01-01

    Use of methyl bromide (MeBr) as a quarantine, commodity, or structural fumigant is under scrutiny because its release to the atmosphere contributes to the depletion of stratospheric ozone. A closed-system bioreactor consisting of 0.5 L of a growing culture of a previously described bacterium, strain IMB-1, removed MeBr (> 110 ??mol L-1) from recirculating air. Strain IMB-1 grew slowly to high cell densities in the bioreactor using MeBr as its sole carbon and energy source. Bacterial oxidation of MeBr produced CO2 and hydrobromic acid (HBr), which required continuous neutralization with NaOH for the system to operate effectively. Strain IMB-1 was capable of sustained oxidation of large amounts of MeBr (170 mmol in 46 d). In an open-system bioreactor (10-L fermenter), strain IMB-1 oxidized a continuous supply of MeBr (220 ??mol L-1 in air). Growth was continuous, and 0.5 mol of MeBr was removed from the air supply in 14 d. The specific rate of MeBr oxidation was 7 ?? 10-16 mol cell-1 h-1. Bioreactors such as these can therefore be used to remove large quantities of contaminant MeBr, which opens the possibility of biodegradation as a practical means for its disposal.

  1. Assessment of Ethidium bromide and Ethidium monoazide bromide removal from aqueous matrices by adsorption on cupric oxide nanoparticles.

    Science.gov (United States)

    Fakhri, Ali

    2014-06-01

    The present study was undertaken to develop an effective adsorbent and to study the adsorption of Ethidium bromide and Ethidium monoazide bromide from aqueous solution using the CuO nanoparticles. The characteristics of CuO nanoparticles were determined and found to have a surface area 89.59m(2)/g. Operational parameters such as pH, contact time and adsorbent concentration, initial concentration and temperature were also studied. The amount of removal increases with the increase in pH from one to seven and reaches the maximum when the pH is nine. Adsorption data fitted well with the Langmuir, Freundlich and Florry-Huggins models. The results show that the best fit was achieved with the Langmuir isotherm equation with maximum adsorption capacities of 0.868 and 0.662mg/g for Ethidium bromide and Ethidium monoazide bromide, respectively. The adsorption process was found to follow pseudo-second-order kinetics. The calculated thermodynamic parameters, namely ΔG, ΔH and ΔS showed that adsorption of Ethidium bromide and Ethidium monoazide bromide was spontaneous and endothermic under examined conditions. PMID:24630576

  2. Specific oligopeptides in fermented soybean extract inhibit NF-κB-dependent iNOS and cytokine induction by toll-like receptor ligands.

    Science.gov (United States)

    Lee, Woo Hyung; Wu, Hong Min; Lee, Chan Gyu; Sung, Dae Il; Song, Hye Jung; Matsui, Toshiro; Kim, Han Bok; Kim, Sang Geon

    2014-11-01

    The ethanol extract of fermented soybean from Glycine max (chungkookjang, CHU) has been claimed to have chemopreventive and cytoprotective effects. In the present study, we examined the inhibitory effect of CHU on inducible nitric oxide synthase (iNOS) and cytokine induction by toll-like receptor (TLR) ligands treatment and attempted to identify the responsible active components. Nitric oxide (NO) content and iNOS levels in the media or RAW264.7 cells were measured using the Griess reagent and real-time polymerase chain reaction assays. CHU treatment inhibited NO production and iNOS induction elicited by lipopolysaccharide (LPS, TLR4L) in a concentration-dependent manner. Tumor necrosis factor-α and interleukin-6 productions were also diminished. Peptidoglycans (TLR2/6L) and CpG-oligodeoxynucleotides (TLR9L) from CHU inhibited iNOS induction, but not poly I:C (TLR3L) or loxoribine (TLF7L). The anti-inflammatory effect resulted from the inhibition of nuclear factor-kappa B (NF-κB) through the inhibition of inhibitory-κB degradation. Of the representative components in CHU, specific oligopeptides (AFPG and GVAWWMY) had the ability to inhibit iNOS induction by LPS, whereas others failed to do so. Daidzein, an isoflavone used for comparative purposes, was active at a relatively higher concentration. In an animal model, oral administration of CHU to rats significantly diminished carrageenan-induced paw edema and iNOS induction. Our results demonstrate that CHU has anti-inflammatory effects against TLR ligands by inhibiting NF-κB activation, which may result from specific oligopeptide components in CHU. Since CHU is orally effective, dietary applications of CHU and/or the identified oligopeptides may be of use in the prevention of inflammatory diseases. PMID:25184943

  3. Specific inhibition of histone deacetylase 8 reduces gene expression and production of proinflammatory cytokines in vitro and in vivo

    NARCIS (Netherlands)

    Li, S.; Fossati, G.; Marchetti, C.; Modena, D.; Pozzi, P.; Reznikov, L.L.; Moras, M.L.; Azam, T.; Abbate, A.; Mascagni, P.; Dinarello, C.A.

    2015-01-01

    ITF2357 (generic givinostat) is an orally active, hydroxamic-containing histone deacetylase (HDAC) inhibitor with broad anti-inflammatory properties, which has been used to treat children with systemic juvenile idiopathic arthritis. ITF2357 inhibits both Class I and II HDACs and reduces caspase-1 ac

  4. Potentiation of thrombin generation in hemophilia A plasma by coagulation factor VIII and characterization of antibody-specific inhibition.

    Directory of Open Access Journals (Sweden)

    Bhavya S Doshi

    Full Text Available Development of inhibitory antibodies to coagulation factor VIII (fVIII is the primary obstacle to the treatment of hemophilia A in the developed world. This adverse reaction occurs in 20-30% of persons with severe hemophilia A treated with fVIII-replacement products and is characterized by the development of a humoral and neutralizing immune response to fVIII. Patients with inhibitory anti-fVIII antibodies are treated with bypassing agents including recombinant factor VIIa (rfVIIa. However, some patients display poor hemostatic response to bypass therapy and improved treatment options are needed. Recently, we demonstrated that fVIII inhibitors display widely variable kinetics of inhibition that correlate with their respective target epitopes. Thus, it was hypothesized that for antibodies that display slow rates of inhibition, supplementation of rfVIIa with fVIII would result in improved thrombin generation and be predictive of clinical responses to this novel treatment regimen. In order to test this hypothesis, 10 murine monoclonal antibodies (MAbs with non-overlapping epitopes spanning fVIII, differential inhibition titers, and inhibition kinetics were studied using a thrombin generation assay. Of the 3 MAbs with high inhibitory titers, only the one with fast and complete (classically defined as "type I" kinetics displayed significant inhibition of thrombin generation with no improvement upon supplementation of rfVIIa with fVIII. The other two MAbs that displayed incomplete (classically defined as "type II" inhibition did not suppress the potentiation of thrombin generation by fVIII. All antibodies that did not completely inhibit fVIII activity demonstrated potentiation of thrombin generation by the addition of fVIII as compared to rfVIIa alone. In conclusion, fVIII alone or in combination with rfVIIa corrects the thrombin generation defect produced by the majority of anti-fVIII MAbs better than single agent rfVIIa. Therefore, combined f

  5. Antigen-specific inhibition of CD8+ T cell response by immature myeloid cells in cancer is mediated by reactive oxygen species.

    Science.gov (United States)

    Kusmartsev, Sergei; Nefedova, Yulia; Yoder, Daniel; Gabrilovich, Dmitry I

    2004-01-15

    Tumor growth is associated with the accumulation of immature myeloid cells (ImC), which in mice are characterized by the expression of Gr-1 and CD11b markers. These cells suppress Ag-specific CD8+ T cells via direct cell-cell contact. However, the mechanism of immunosuppressive activity of tumor-derived ImC remains unclear. In this study we analyzed the function of ImC isolated from tumor-free control and tumor-bearing mice. Only ImC isolated from tumor-bearing mice, not those from their control counterparts, were able to inhibit the Ag-specific response of CD8+ T cells. ImC obtained from tumor-bearing mice had significantly higher levels of reactive oxygen species (ROS) than ImC isolated from tumor-free animals. Accumulation of H2O2, but not superoxide or NO, was a major contributor to this increased pool of ROS. It appears that arginase activity played an important role in H2O2 accumulation in these cells. Inhibition of ROS in ImC completely abrogated the inhibitory effect of these cells on T cells, indicating that ImC generated in tumor-bearing hosts suppress the CD8+ T cell response via production of ROS. Interaction of ImC with Ag-specific T cells in the presence of specific Ags resulted in a significant increase in ROS production compared with control Ags. That increase was independent of IFN-gamma production by T cells, but was mediated by integrins CD11b, CD18, and CD29. Blocking of these integrins with specific Abs abrogated ROS production and ImC-mediated suppression of CD8+ T cell responses. This study demonstrates a new mechanism of Ag-specific T cell inhibition mediated by ROS produced by ImCs in cancer.

  6. Histone Deacetylase Inhibition via RGFP966 Releases the Brakes on Sensory Cortical Plasticity and the Specificity of Memory Formation

    OpenAIRE

    Bieszczad, KM; Bechay, K; Rusche, JR; Jacques, V.; Kudugunti, S; Miao, W.; Weinberger, NM; McGaugh, JL; Wood, MA

    2015-01-01

    © 2015 the authors. Research over the past decade indicates a novel role for epigenetic mechanisms in memory formation. Of particular interest is chromatin modification by histone deacetylases (HDACs), which, in general, negatively regulate transcription. HDAC deletion or inhibition facilitates transcription during memory consolidation and enhances long-lasting forms of synaptic plasticity and long-term memory. A key open question remains: How does blocking HDAC activity lead to memory enhanc...

  7. Inhibition of replication of fresh HIV type 1 patient isolates by a polypurine tract-specific self-complementary oligodeoxynucleotide

    OpenAIRE

    Jendis, J; Strack, B; Volkmann, S; Böni, J; Mölling, K.

    1996-01-01

    A previously described self-complementary oligodeoxynucleotide termed triplex-forming oligodeoxynucleotide (TFO A), 54 bases in length, designed against the polypurine tract of HIV-1 RNA, inhibited viral replication at a 1 to 3 microM concentration in acutely infected cells, whereas antisense and scrambled sequence oligodeoxynucleotides were ineffective. Three HIV-1 viral isolates from patients of clinical categories A1, B, and C3 were transmitted to peripheral blood mononuclear cells and tes...

  8. Specificity of attention and cognitive inhibition processes in relapsing-remitting multiple sclerosis patients with consideration of their mood level

    Directory of Open Access Journals (Sweden)

    Tyburski, Ernest

    2014-04-01

    Full Text Available The results of contemporary neuropsychological analyses lay foundation for a broad discussion of the nature and causes of cognitive deficits in MS patients. Aim: The aim of this study was to determine the level of alternating attention and dominant reaction inhibition in relapsing-remitting multiple sclerosis patients, with consideration of their mood level, age and disease duration. Method: Experimental group consisted of 43 adults (30 women and 13 men diagnosed with relapsing-remitting multiple sclerosis, with Extended Disability Status Scale (EDSS results ranging between 2.5-6.5. Control group comprised 38 healthy adults (26 women and 12 men selected according to sex, age and education. The following tasks were used in the study: the Trail Making Test A and B (TMT, Stroop Colour-Word Test (SCWT, and Beck Depression Inventory (BDI. Results: Experimental group was characterized by significantly worse performance in TMT (p0.05 and SCWT (p>0.05 in the experimental group between subjects with depressed and neutral mood. Disease duration proved significantly related to the level of dominant reaction inhibition (p<0.001. Conclusions: Cognitive impairments within areas of concentration, attention shifting and dominant reaction inhibition were all revealed in the experimental group.

  9. Specific inhibition of formation of transcription complexes by a calicheamicin oligosaccharide: a paradigm for the development of transcriptional antagonists.

    OpenAIRE

    Ho, S N; Boyer, S H; Schreiber, S L; Danishefsky, S J; Crabtree, G R

    1994-01-01

    Sequence-specific DNA ligands that antagonize DNA-protein interactions represent a potentially powerful means of modulating gene expression. Calicheamicin gamma 1I, a member of the DNA-cleaving enediyne class of anticancer antibiotics, binds to specific DNA sequences through an aryltetrasaccharide domain. To take advantage of this unique sequence-specific recognition capability, the methyl glycoside of the aryltetrasaccharide of calicheamicin gamma 1I (CLM-MG) was used to investigate the abil...

  10. Protective effect of testosterone on cognitive deficits induced by ethidium bromide in experimental model of multiple sclerosis

    Directory of Open Access Journals (Sweden)

    Sallahadin Feizollah

    2015-11-01

    Full Text Available Background: Multiple Sclerosis (MS is a neurodegenerative disease of the central nervous system (CNS. The hippocampus is a vital center for learning and memory; it is extremely vulnerable to neurodegenerative diseases. The male hormones could be neuroprotective for the CNS. The current study is an attempt to investigate the effect of testosterone on learning and spatial memory following the demyelination of CA1 area by the injection of ethidium bromide in the rats' hippocampus. Methods: This experimental study has been conducted on healthy rats in the faculty of science of the Urmia University from September 2013 to February 2015. For demyelination in all previously gonadectomized healthy rats, 3µl ethidium bromide was injected into the CA1 area of rats by stereotaxic surgery. In addition, the treatment groups received 1µl testosterone (6µg/µl during a 20-day timeframe on a daily basis after demyelination by the ethidium bromide. The control groups had no drug injection. The process of the learning and spatial memory of the rats were closely monitored by the radial Maze. The demyelination and remyelination in the hippocampus were checked by the myelin-specific coloring (Luxol fast blue and Cresyl violet. Results: The histological results suggest that the testosterone is capable of minimizing the destructive impacts of ethidium bromide in the treatment group as well as enhancing the remyelination process. In the group treated by testosterone, the percentage of the pyknotic cells 20 days after demyelination induction, represented a significant reduction compared to that of ethidium bromide group (P=0.008. The behavioral studies analyses show that the amount of the food finding time in those groups received ethidium bromide was significantly longer than those of the control groups (P=0.001. Furthermore, the application of the testosterone in the treatment groups reduced the extent of demyelination while the memory impairment induced by the

  11. Involvement of a CCK-dependent capsaicin-sensitive afferent pathway in the inhibitory effect of pinaverium bromide on the colonic motor response to eating in rats.

    Science.gov (United States)

    Fioramonti, J; Christen, M O; Dupre, I; Bueno, L

    1997-01-01

    The effects of pinaverium bromide on the stimulation of colonic motility induced by meal and cholecystokinin (CCK) were investigated in rats chronically fitted with intraparietal electrodes on the proximal colon and previously treated or not by capsaicin. Pinaverium bromide inhibited in a dose-related manner (2-50 mg/kg, per os) the increase in colonic spike burst frequency induced by a 3 g meal or CCK-8 (2 micrograms/kg, i.v.). The CCK-A and CCK-B antagonists, devazepide and L 365260 (100 micrograms/kg, i.p.), respectively, inhibited the postprandial colonic motor response while only L 365260 reduced the CCK-induced stimulation. The effects of pinaverium bromide and CCK antagonists were not observed in capsaicin-treated animals. Moreover, CCK-8 (2 micrograms/kg, i.v.) did not stimulate colonic motility after capsaicin treatment. The inhibition of postprandial colonic motility by pinaverium bromide, given orally at therapeutic doses, involves a CCK-dependent pathway which requires the integrity of capsaicin-sensitive afferents. PMID:9243254

  12. IR, Raman and SERS spectra of propantheline bromide.

    Science.gov (United States)

    Baraldi, C; Freguglia, G; Tinti, A; Sparta, M; Alexandrova, A N; Gamberini, M C

    2013-02-15

    The two known propantheline bromide polymorphs (form I and form II) were studied and characterized by a multianalytical approach. In the present work, the identification of propantheline bromide polymorphic forms through vibrational IR spectroscopies are presented and for the first time Raman microscopy and hot stage Raman microscopy (HSRM) studies are reported. Finally, quantum mechanical calculations were performed. For assisting the assignment of the experimental picks, the two IR spectra of the most and least stable representatives of a set of 56 conformers are calculated and studied. DSC thermograms data, are also reported. The surface enhanced Raman scattering (SERS) spectrum was also recorded in a silver colloid; it could be inferred that propantheline bromide is adsorbed on silver colloid through the oxygen atom with the molecular plane perpendicular to the metal surface.

  13. Inhibition of Insulin Degradation by Hepatoma Cells after Microinjection of Monoclonal Antibodies to a Specific Cytosolic Protease

    Science.gov (United States)

    Shii, Kozui; Roth, Richard A.

    1986-06-01

    Four monoclonal antibodies were identified by their ability to bind to 125I-labeled insulin covalently linked to a cytosolic insulin-degrading enzyme from human erythrocytes. All four antibodies were also found to remove more than 90% of the insulin-degrading activity from erythrocyte extracts. These antibodies were shown to be directed to different sites on the enzyme by mapping studies and by their various properties. Two antibodies recognized the insulin-degrading enzyme from rat liver; one inhibited the erythrocyte enzyme directly; and two recognized the enzyme after gel electrophoresis and transfer to nitrocellulose filters. By this latter procedure and immunoprecipitation from metabolically labeled cells, the enzyme from a variety of tissues was shown to be composed of a single polypeptide chain of apparent Mr 110,000. Finally, these monoclonal antibodies were microinjected into the cytoplasm of a human hepatoma cell line to assess the contribution of this enzyme to insulin degradation in the intact cell. In five separate experiments, preloading of cells with these monoclonal antibodies resulted in an inhibition of insulin degradation of 18-54% (average 39%) and increased the amount of 125I-labeled insulin associated with the cells. In contrast, microinjection of control antibody or an extraneous monoclonal antibody had no effect on insulin degradation or on the amount of insulin associated with the cells. Moreover, the monoclonal antibodies to the insulin-degrading enzyme caused no significant inhibition of degradation of another molecule, low density lipoprotein. Thus, these results support a role for this enzyme in insulin degradation in the intact cell.

  14. Inhibition of Ubiquitin-specific Peptidase 8 Suppresses Adrenocorticotropic Hormone Production and Tumorous Corticotroph Cell Growth in AtT20 Cells

    Science.gov (United States)

    Jian, Fang-Fang; Li, Yun-Feng; Chen, Yu-Fan; Jiang, Hong; Chen, Xiao; Zheng, Li-Li; Zhao, Yao; Wang, Wei-Qing; Ning, Guang; Bian, Liu-Guan; Sun, Qing-Fang

    2016-01-01

    Background: Two recent whole-exome sequencing researches identifying somatic mutations in the ubiquitin-specific protease 8 (USP8) gene in pituitary corticotroph adenomas provide exciting advances in this field. These mutations drive increased epidermal growth factor receptor (EGFR) signaling and promote adrenocorticotropic hormone (ACTH) production. This study was to investigate whether the inhibition of USP8 activity could be a strategy for the treatment of Cushing's disease (CD). Methods: The anticancer effect of USP8 inhibitor was determined by testing cell viability, colony formation, apoptosis, and ACTH secretion. The immunoblotting and quantitative reverse transcription polymerase chain reaction were conducted to explore the signaling pathway by USP8 inhibition. Results: Inhibition of USP8-induced degradation of receptor tyrosine kinases including EGFR, EGFR-2 (ERBB2), and Met leading to a suppression of AtT20 cell growth and ACTH secretion. Moreover, treatment with USP8 inhibitor markedly induced AtT20 cells apoptosis. Conclusions: Inhibition of USP8 activity could be an effective strategy for CD. It might provide a novel pharmacological approach for the treatment of CD. PMID:27569239

  15. Non-Specific Inhibition of Ischemia- and Acidosis-Induced Intracellular Calcium Elevations and Membrane Currents by α-Phenyl-N-tert-butylnitrone, Butylated Hydroxytoluene and Trolox

    Directory of Open Access Journals (Sweden)

    Christopher Katnik

    2014-02-01

    Full Text Available Ischemia, and subsequent acidosis, induces neuronal death following brain injury. Oxidative stress is believed to be a key component of this neuronal degeneration. Acute chemical ischemia (azide in the absence of external glucose and acidosis (external media buffered to pH 6.0 produce increases in intracellular calcium concentration ([Ca2+]i and inward membrane currents in cultured rat cortical neurons. Two α-tocopherol analogues, trolox and butylated hydroxytoluene (BHT, and the spin trapping molecule α-Phenyl-N-tert-butylnitrone (PBN were used to determine the role of free radicals in these responses. PBN and BHT inhibited the initial transient increases in [Ca2+]i, produced by ischemia, acidosis and acidic ischemia and increased steady state levels in response to acidosis and the acidic ischemia. BHT and PBN also potentiated the rate at which [Ca2+]i increased after the initial transients during acidic ischemia. Trolox inhibited peak and sustained increases in [Ca2+]i during ischemia. BHT inhibited ischemia induced initial inward currents and trolox inhibited initial inward currents activated by acidosis and acidic ischemia. Given the inconsistent results obtained using these antioxidants, it is unlikely their effects were due to elimination of free radicals. Instead, it appears these compounds have non-specific effects on the ion channels and exchangers responsible for these responses.

  16. Suppression of Cytokine Signalling by SOCS3: Characterisation of the mode of inhibition and the basis of its specificity

    OpenAIRE

    Babon, Jeffrey J.; Kershaw, Nadia J.; Murphy, James M.; Varghese, Leila N; Laktyushin, Artem; Young, Samuel N.; Lucet, Isabelle S; Raymond S Norton; Nicola, Nicos A.

    2012-01-01

    Janus kinases (JAKs) are key effectors in controlling immune responses and maintaining hematopoiesis. SOCS3 (Suppressor of Cytokine Signaling-3) is a major regulator of JAK signaling and here we investigate the molecular basis of its mechanism of action. We found that SOCS3 bound and directly inhibited the catalytic domains of JAK1, JAK2 and TYK2, but not JAK3 via an evolutionarily conserved motif unique to JAKs. Mutation of this motif led to the formation of an active kinase that could not b...

  17. Glycosylation with Disarmed Glycosyl Bromides Promoted by Iodonium Ions

    DEFF Research Database (Denmark)

    Lanz, Gyrithe; Madsen, Robert

    2016-01-01

    Iodonium ions have been developed for activating glycosyl bromides in the coupling to glycosyl acceptors. The iodonium ions are generated from N-iodosuccinimide and a protic acid such as camphorsulfonic acid or triflic acid, where the latter gives the most reactive promoter system. The couplings...... occur with the release of iodine monobromide, and the best results are obtained with benzoylated glycosyl donors and acceptors. In this way, disarmed glycosyl bromides can serve as glycosyl donors without the use of heavy-metal salts....

  18. Investigation of possible interaction between pinaverium bromide and digoxin.

    Science.gov (United States)

    Weitzel, O; Seidel, G; Engelbert, S; Berksoy, M; Eberhardt, G; Bode, R

    1983-01-01

    A single-blind study was carried out in 25 patients, who were receiving maintenance therapy for congestive heart failure with digoxin, to investigate the effect on steady-state plasma digoxin levels of concomitant administration of the spasmolytic, pinaverium bromide (50 mg 3-times daily). Patients received pinaverium bromide for 12 days followed by placebo for a further 7 days. Assessment of the results in 21 patients showed no evidence of any statistically significant variations in plasma digoxin levels during either treatment period or in the clinical observations which might indicate drug interaction. PMID:6653138

  19. Silica nanoparticles separation from water: aggregation by cetyltrimethylammonium bromide (CTAB).

    Science.gov (United States)

    Liu, Y; Tourbin, M; Lachaize, S; Guiraud, P

    2013-07-01

    Nanoparticles will inevitably be found in industrial and domestic wastes in the near future and as a consequence soon in water resources. Due to their ultra-small size, nanoparticles may not only have new hazards for environment and human health, but also cause low separation efficiency by classical water treatments processes. Thus, it would be an important challenge to develop a specific treatment with suitable additives for recovery of nanoparticles from waters. For this propose, this paper presents aggregation of silica nanoparticles (Klebosol 30R50 (75nm) and 30R25 (30nm)) by cationic surfactant cetyltrimethylammonium bromide (CTAB). Different mechanisms such as charge neutralization, "depletion flocculation" or "volume-restriction", and "hydrophobic effect" between hydrocarbon tails of CTAB have been proposed to explicate aggregation results. One important finding is that for different volume concentrations between 0.05% and 0.51% of 30R50 suspensions, the same critical coagulation concentration was observed at CTAB=0.1mM, suggesting the optimized quantity of CTAB during the separation process for nanoparticles of about 75nm. Furthermore, very small quantities of CTAB (0.01mM) can make 30R25 nanosilica aggregated due to the "hydrophobic effect". It is then possible to minimize the sludge and allow the separation process as "greener" as possible by studying this case. It has also shown that aggregation mechanisms can be different for very small particles so that a special attention has to be paid to the treatment of nanoparticles contained in water and wastewaters.

  20. Neuroantigen-specific autoregulatory CD8+ T cells inhibit autoimmune demyelination through modulation of dendritic cell function.

    Directory of Open Access Journals (Sweden)

    Venkatesh P Kashi

    Full Text Available Experimental autoimmune encephalomyelitis (EAE is a well-established murine model of multiple sclerosis, an immune-mediated demyelinating disorder of the central nervous system (CNS. We have previously shown that CNS-specific CD8+ T cells (CNS-CD8+ ameliorate EAE, at least in part through modulation of CNS-specific CD4+ T cell responses. In this study, we show that CNS-CD8+ also modulate the function of CD11c+ dendritic cells (DC, but not other APCs such as CD11b+ monocytes or B220+ B cells. DC from mice receiving either myelin oligodendrocyte glycoprotein-specific CD8+ (MOG-CD8+ or proteolipid protein-specific CD8+ (PLP-CD8+ T cells were rendered inefficient in priming T cell responses from naïve CD4+ T cells (OT-II or supporting recall responses from CNS-specific CD4+ T cells. CNS-CD8+ did not alter DC subset distribution or MHC class II and CD86 expression, suggesting that DC maturation was not affected. However, the cytokine profile of DC from CNS-CD8+ recipients showed lower IL-12 and higher IL-10 production. These functions were not modulated in the absence of immunization with CD8-cognate antigen, suggesting an antigen-specific mechanism likely requiring CNS-CD8-DC interaction. Interestingly, blockade of IL-10 in vitro rescued CD4+ proliferation and in vivo expression of IL-10 was necessary for the suppression of EAE by MOG-CD8+. These studies demonstrate a complex interplay between CNS-specific CD8+ T cells, DC and pathogenic CD4+ T cells, with important implications for therapeutic interventions in this disease.

  1. The p16-specific reactivation and inhibition of cell migration through demethylation of CpG islands by engineered transcription factors.

    Science.gov (United States)

    Zhang, Baozhen; Xiang, Shengyan; Zhong, Qiming; Yin, Yanru; Gu, Liankun; Deng, Dajun

    2012-10-01

    Methylation of CpG islands inactivates transcription of tumor suppressor genes including p16 (CDKN2A). Inhibitors of DNA methylation and histone deacylation are recognized as useful cancer therapeutic chemicals through reactivation of the expression of methylated genes. However, these inhibitors are not target gene-specific, so that they lead to serious side effects as regular cytotoxic chemotherapy agents. To explore the feasibility of methylated gene-specific reactivation by artificial transcription factors, we engineered a set of Sp1-like seven-finger zinc-finger proteins (7ZFPs) targeted to a 21-bp sequence of the p16 promoter and found that these 7ZFPs could bind specifically to the target p16 promoter probe. Then the p16-specific artificial transcription factors (p16ATFs) were made from these 7ZFPs and the transcription activator VP64. Results showed that transient transfection of some p16ATFs selectively up-regulated the endogenous p16 expression in the p16-active 293T cells. Moreover, the transient transfection of the representative p16ATF-6I specifically reactivated p16 expression in the p16-methylated H1299 and AGS cells pretreated with a nontoxic amount of 5'-aza-deoxycytidine (20 and 80 nM, respectively). In addition, stable transfection of the p16ATF induced demethylation of p16 CpG island and trimethylation of histone H3K4, and inhibited recruitment of DNA methyltransferase 1 and trimethylation of H3K9 and H3K27 in the p16 promoter in H1299 cells without 5'-aza-deoxycytidine pretreatment. Notably, inhibition of cell migration and invasion was observed in these p16-reactivated cells induced by transient and stable p16ATF transfection. These results demonstrate that p16ATF not only specifically reactivates p16 expression through demethylation of CpG islands, but also restores methylated p16 function. PMID:22738793

  2. GENE THERAPY USING RETROVIRAL VECTOR OF bcr-abl SPECIFIC MULTI-UNIT RIBOZYMES COULD INHIBIT CML CELL GROWTH AND INDUCE APOPTOSIS

    Institute of Scientific and Technical Information of China (English)

    冯琦; 孙凯; 赵永同; 张涛; 尚振川; 王莎; 王玮; 赵宁; 颜真; 韩苇; 张英起; 孙秉中

    2003-01-01

    Objective: To investigate the in vitro cleavage ability and effects on apoptosis and cell growth of the bcr-abl fusion gene specific multi-unit ribozymes. Methods: Three fusion point specific ribozymes were designed and the multi-unit ribozymes' in vitro transcription vector and retroviral vector were constructed. The in vitro cleavage ability was tested. The retroviral vector was transfected into K562 cell and the effects on proliferation, apoptosis, cell cycle and cell structure were observed. Results: Multi-unit ribozymes had in vitro cleavage efficiency of 70.8%, which was more efficient than single-unit and double-unit ribozymes. Transfection of the retroviral vector of the ribozyme into K562 cells, induced inhibition of cell growth and apoptosis. The incorporation rate of DNA in ribozymes transfected K562 cells was greatly decreased along with time passed, with an inhibition rate of more than 50% after 96 h of transfection. Under FCM, 18.4% of the cells underwent apoptosis 72 h after transfection and more cells were blocked in G phase, with the ratio in S phase greatly decreased (41.9%). Under electron microscope, compaction of nuclear chromatin and apoptosis bodies were observed.Conclusion: Multi-unit ribozymes specific to bcr-abl fusion gene can be used to treat CML and to purge bone marrow for self-grafting.

  3. Reactive films for mitigating methyl bromide emissions from fumigated soil

    Science.gov (United States)

    Emissions of methyl bromide (MeBr) from agricultural fumigation can lead to depletion of the stratospheric ozone layer, and so its use is being phased out. However, as MeBr is still widely used under Critical Use Exemptions, strategies are still required to control such emissions. In this work, nove...

  4. Depleting methyl bromide residues in soil by reaction with bases

    Science.gov (United States)

    Despite generally being considered the most effective soil fumigant, methyl bromide (MeBr) use is being phased out because its emissions from soil can lead to stratospheric ozone depletion. However, a large amount is still currently used due to Critical Use Exemptions. As strategies for reducing the...

  5. Preozonation of bromide-bearing source water in south China

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    The effectiveness of preozonation was evaluated on treating a bromide-bearing dam source water in south China through batch-scale experiments. Preozonation at ozone doses of 0.5-1.0 mg/L (at ozone consumption base) enhanced total organic carbon(TOC) removal through coagulation, and resulted in an almost linear reduction of ultraviolet absorbance at 254 nm (UV254). The removals of TOC (after coagulation) and UV254 at the ozone dose of 1.0 mg/L were 36% and 70%, respectively. Preozonation at an ozone dose between 0.5 and 1.0 mg/L resulted in the removal of disinfection byproducts formation potential (DBFP) including trihalomethane formation potential (THMFP) and haloacetic acid formation potential (HAAFP) for about 50%. The removals of THMFP and HAAFP decreased with the further increase of ozone dose. Ozonation of bromide-bearing water (bromide concentration,34 μg/L) produced a bromate concentration under the detection limit(2 μg/L) at ozone doses < 1.5 mg/L. However, bromate >10 μg/L could be produced when the bromide concentration was increased to 96 μg/L.

  6. 7 CFR 305.6 - Methyl bromide fumigation treatment schedules.

    Science.gov (United States)

    2010-01-01

    ... to air temperature within the chamber. Fruit taken from a cooling room may have to be prewarmed... pure, type “Q” (for quarantine use only) methyl bromide per 1,000 cubic feet of chamber space. Dosage.... Water temperature in the volatilizer must never fall below 65.6 °C (150 °F) at any time during...

  7. Residues resulting from fumigation of food commodities with methyl bromide

    International Nuclear Information System (INIS)

    An investigation was undertaken to determine the nature and significance of residues remaining in methyl bromide-fumigated commodities using radiotracer techniques (14C-methyl bromide). Experiments with corn showed that the germ part of the kernel contained nearly half of the total 14C-residue remaining in the seed. Also preliminary tests with granny smith apples revealed that considerable residue may remain in seeds of treated apples with less in skin and the least in the fleshy pulp. In fumigated corn, fractionation revealed that radioactive residues were distributed throughout albumins, globulins, Zein 1, Zein 2 and glutelin with a large part in the aqueous extract (amino acids). Further investigation emphasized the characterization of volatile substances resulting from alkali treatment. It was found that methyl bromide readily methylated methionine and this constitutes a major site of methylation. A component of the volatile fraction was dimethyl sulfoxide, probably a product of oxidation of dimethyl sulphide. Work is in progress to determine whether methyl bromide will methylate purine and pyrimidine components. (author)

  8. Methyl bromide phase out could affect future reforestation efforts

    Science.gov (United States)

    Methyl bromide has long been an integral component in producing healthy tree seedlings in forest nurseries of California, Idaho, Montana, Oregon and Washington. The fumigant was supposed to be completely phased out of use in the United States of America by 2005, but many forest nurseries continue to...

  9. Transforming growth factor-beta inhibits human antigen-specific CD4(+) T cell proliferation without modulating the cytokine response

    NARCIS (Netherlands)

    Tiemessen, MM; Kunzmann, S; Schmidt-Weber, CB; Garssen, J; Bruijnzeel-Koomen, CAFM; Knol, EF; Van Hoffen, E

    2003-01-01

    Transforming growth factor (TGF)-beta has been demonstrated to play a key role in the regulation of the immune response, mainly by its suppressive function towards cells of the immune system. In humans, the effect of TGF-beta on antigen-specific established memory T cells has not been investigated y

  10. Mannose-containing oligosaccharides of non-specific human secretory immunoglobulin A mediate inhibition of Vibrio cholerae biofilm formation.

    Directory of Open Access Journals (Sweden)

    Ashlesh K Murthy

    Full Text Available The role of antigen-specific secretory IgA (SIgA has been studied extensively, whereas there is a limited body of evidence regarding the contribution of non-specific SIgA to innate immune defenses against invading pathogens. In this study, we evaluated the effects of non-specific SIgA against infection with Vibrio cholerae O139 strain MO10 and biofilm formation. Seven day old infant mice deficient in IgA (IgA(-/- mice displayed significantly greater intestinal MO10 burden at 24 hr post-challenge when compared to IgA(+/+ pups. Importantly, cross-fostering of IgA(-/- pups with IgA(+/+ nursing dams reversed the greater susceptibility to MO10 infection, suggesting a role for non-specific SIgA in protection against the infection. Since biofilm formation is associated with virulence of MO10, we further examined the role of human non-specific SIgA on this virulence phenotype of the pathogen. Human non-specific SIgA, in a dose-dependent fashion, significantly reduced the biofilm formation by MO10 without affecting the viability of the bacterium. Such an inhibitory effect was not induced by human serum IgA, IgG, or IgM, suggesting a role for the oligosaccharide-rich secretory component (SC of SIgA. This was supported by the demonstration that SIgA treated with endoglycosidase H, to cleave the high-mannose containing terminal chitobiose residues, did not induce a reduction in biofilm formation by MO10. Furthermore, the addition of free mannose per se, across a wide dose range, induced significant reduction in MO10 biofilm formation. Collectively, these results suggest that mannose containing oligosaccharides within human non-specific secretory IgA can alter important virulence phenotypes of Vibrio cholerae such as biofilm formation, without affecting viability of the microorganism. Such effects may contribute significantly to innate immune defenses against invading pathogens in vivo in the gastrointestinal tract.

  11. Plasmodium falciparum 19-kilodalton merozoite surface protein 1 (MSP1)-specific antibodies that interfere with parasite growth in vitro can inhibit MSP1 processing, merozoite invasion, and intracellular parasite development.

    Science.gov (United States)

    Moss, David K; Remarque, Edmond J; Faber, Bart W; Cavanagh, David R; Arnot, David E; Thomas, Alan W; Holder, Anthony A

    2012-03-01

    Merozoite surface protein 1 (MSP1) is a target for malaria vaccine development. Antibodies to the 19-kDa carboxy-terminal region referred to as MSP1(19) inhibit erythrocyte invasion and parasite growth, with some MSP1-specific antibodies shown to inhibit the proteolytic processing of MSP1 that occurs at invasion. We investigated a series of antibodies purified from rabbits immunized with MSP1(19) and AMA1 recombinant proteins for their ability to inhibit parasite growth, initially looking at MSP1 processing. Although significant inhibition of processing was mediated by several of the antibody samples, there was no clear relationship with overall growth inhibition by the same antibodies. However, no antibody samples inhibited processing but not invasion, suggesting that inhibition of MSP1 processing contributes to but is not the only mechanism of antibody-mediated inhibition of invasion and growth. Examining other mechanisms by which MSP1-specific antibodies inhibit parasite growth, we show that MSP1(19)-specific antibodies are taken up into invaded erythrocytes, where they persist for significant periods and result in delayed intracellular parasite development. This delay may result from antibody interference with coalescence of MSP1(19)-containing vesicles with the food vacuole. Antibodies raised against a modified recombinant MSP1(19) sequence were more efficient at delaying intracellular growth than those to the wild-type protein. We propose that antibodies specific for MSP1(19) can mediate inhibition of parasite growth by at least three mechanisms: inhibition of MSP1 processing, direct inhibition of invasion, and inhibition of parasite development following invasion. The balance between mechanisms may be modulated by modifying the immunogen used to induce the antibodies.

  12. Een ionchromatografische methode voor de simultane bepaling van nitriet, bromide en sulfiet in water

    NARCIS (Netherlands)

    Beld WA van den; Cleven RFMJ; LAC

    1996-01-01

    Betreft resultaten van een onderzoek naar het ontwikkelen van een geautomatiseerde ionchromatografische methode voor de bepaling van nitriet, bromide en sulfiet. Het onderzoek heeft geresulteerd in een betrouwbare, selectieve en gevoelige methode voor de simultane bepaling van nitriet, bromide e

  13. The inhibition of anti-DNA binding to DNA by nucleic acid binding polymers.

    Directory of Open Access Journals (Sweden)

    Nancy A Stearns

    Full Text Available Antibodies to DNA (anti-DNA are the serological hallmark of systemic lupus erythematosus (SLE and can mediate disease pathogenesis by the formation of immune complexes. Since blocking immune complex formation can attenuate disease manifestations, the effects of nucleic acid binding polymers (NABPs on anti-DNA binding in vitro were investigated. The compounds tested included polyamidoamine dendrimer, 1,4-diaminobutane core, generation 3.0 (PAMAM-G3, hexadimethrine bromide, and a β-cylodextrin-containing polycation. As shown with plasma from patients with SLE, NABPs can inhibit anti-DNA antibody binding in ELISA assays. The inhibition was specific since the NABPs did not affect binding to tetanus toxoid or the Sm protein, another lupus autoantigen. Furthermore, the polymers could displace antibody from preformed complexes. Together, these results indicate that NABPs can inhibit the formation of immune complexes and may represent a new approach to treatment.

  14. Morphology-Specific Inhibition of β-Amyloid Aggregates by 17β-Hydroxysteroid Dehydrogenase Type 10.

    Science.gov (United States)

    Aitken, Laura; Quinn, Steven D; Perez-Gonzalez, Cibran; Samuel, Ifor D W; Penedo, J Carlos; Gunn-Moore, Frank J

    2016-06-01

    A major hallmark of Alzheimer's disease (AD) is the formation of toxic aggregates of the β-amyloid peptide (Aβ). Given that Aβ peptides are known to localise within mitochondria and interact with 17β-HSD10, a mitochondrial protein expressed at high levels in AD brains, we investigated the inhibitory potential of 17β-HSD10 against Aβ aggregation under a range of physiological conditions. Fluorescence self-quenching (FSQ) of Aβ(1-42) labelled with HiLyte Fluor 555 was used to evaluate the inhibitory effect under conditions established to grow distinct Aβ morphologies. 17β-HSD10 preferentially inhibits the formation of globular and fibrillar-like structures but has no effect on the growth of amorphous plaque-like aggregates at endosomal pH 6. This work provides insights into the dependence of the Aβ-17β-HSD10 interaction with the morphology of Aβ aggregates and how this impacts enzymatic function. PMID:26991863

  15. Structure-guided design of aminopyrimidine amides as potent, selective inhibitors of lymphocyte specific kinase: synthesis, structure-activity relationships, and inhibition of in vivo T cell activation.

    Science.gov (United States)

    DiMauro, Erin F; Newcomb, John; Nunes, Joseph J; Bemis, Jean E; Boucher, Christina; Chai, Lilly; Chaffee, Stuart C; Deak, Holly L; Epstein, Linda F; Faust, Ted; Gallant, Paul; Gore, Anu; Gu, Yan; Henkle, Brad; Hsieh, Faye; Huang, Xin; Kim, Joseph L; Lee, Josie H; Martin, Matthew W; McGowan, David C; Metz, Daniela; Mohn, Deanna; Morgenstern, Kurt A; Oliveira-dos-Santos, Antonio; Patel, Vinod F; Powers, David; Rose, Paul E; Schneider, Stephen; Tomlinson, Susan A; Tudor, Yan-Yan; Turci, Susan M; Welcher, Andrew A; Zhao, Huilin; Zhu, Li; Zhu, Xiaotian

    2008-03-27

    The lymphocyte-specific kinase (Lck), a member of the Src family of cytoplasmic tyrosine kinases, is expressed in T cells and natural killer (NK) cells. Genetic evidence, including knockout mice and human mutations, demonstrates that Lck kinase activity is critical for normal T cell development, activation, and signaling. Selective inhibition of Lck is expected to offer a new therapy for the treatment of T-cell-mediated autoimmune and inflammatory disease. With the aid of X-ray structure-based analysis, aminopyrimidine amides 2 and 3 were designed from aminoquinazolines 1, which had previously been demonstrated to exhibit potent inhibition of Lck and T cell proliferation. In this report, we describe the synthesis and structure-activity relationships of a series of novel aminopyrimidine amides 3 possessing improved cellular potency and selectivity profiles relative to their aminoquinazoline predecessors 1. Orally bioavailable compound 13b inhibited the anti-CD3-induced production of interleukin-2 (IL-2) in mice in a dose-dependent manner (ED 50 = 9.4 mg/kg). PMID:18321037

  16. EZH2-specific microRNA-98 inhibits human ovarian cancer stem cell proliferation via regulating the pRb-E2F pathway.

    Science.gov (United States)

    Liu, Te; Hou, Lengchen; Huang, Yongyi

    2014-07-01

    The Polycomb group protein, enhancer of zeste homolog 2 (EZH2), plays an important role in transcriptional regulation through chromatin remodeling and interactions with other transcription factors to control cell proliferation and embryonic development. Previous study has shown that EZH2 is important for cell cycle regulation and is highly expressed in human ovarian cancer. Loss of EZH2 inhibits growth of ovarian cancer as well as other human carcinomas. In this study, an expression plasmid of EZH2-targeted microRNA-98 was constructed and transfected into human ovarian cancer stem cells (OCSCs). Seventy-two hours after transfection, cell growth was inhibited and arrested at the G0/G1 transition. p21(CIPI/WAF1) was up-regulated, while the CDK2/cyclin E complex and c-Myc were down-regulated. Most importantly, expression levels of E2F1, retinoblastoma protein (pRb), and histone deacetylase 1 (HDAC1) in the pRb-E2F signaling pathway had changed. Furthermore, microRNA-98 suppressed the growth of OCSCs xenograft tumors. Our findings suggest that EZH2-specific microRNA-98 can effectively inhibit cell proliferation in vitro and regulate the pRb-E2F pathway in human OCSCs.

  17. Inhibition of listeriolysin O and phosphatidylcholine-specific production in Listeria monocytogenes by subinhibitory concentrations of plant essential oils.

    Science.gov (United States)

    Smith-Palmer, A; Stewartt, J; Fyfe, L

    2002-07-01

    Successful infection by Listeria monocytogenes is dependent upon a range of bacterial extracellular proteins including a cytolysin termed listeriolysin O and phosphatidylcholine-specific phospholipase C. Five plant essential oils--bay, clove, cinnamon, nutmeg and thyme--significantly reduced the production of listeriolysin O by L. monocytogenes. The greatest change was observed after culture with oil of thyme, which reduced haemolysis to 52.1 haemolytic units (HU)/ml compared with 99.8 HU/ml observed with the control. Oil of clove was the only oil that also significantly reduced phosphatidylcholine-specific phospholipase C activity. These changes were observed despite the oils causing no change to the final bacterial concentration or total extracellular protein concentration. PMID:12132773

  18. The IgG-specific endoglycosidase EndoS inhibits both cellular and complement-mediated autoimmune hemolysis

    OpenAIRE

    Allhorn, Maria; Briceño, Juana G.; Baudino, Lucie; Lood, Christian; Olsson, Martin L.; Izui, Shozo; Collin, Mattias

    2010-01-01

    EndoS from Streptococcus pyogenes is an immunomodulating enzyme that specifically hydrolyzes glycans from human immunoglobulin G and thereby affects antibody effector functions. Autoimmune hemolytic anemia is caused by antibody-mediated red blood cell (RBC) destruction and often resists treatment with corticosteroids that also cause frequent adverse effects. We show here that anti-RhD (anti-D) and rabbit anti–human-RBC antibodies (anti-RBC) mediated destruction of RBC, ie, phagocytosis, compl...

  19. Dissociable identity- and modality-specific neural representations as revealed by cross-modal nonspatial inhibition of return.

    Science.gov (United States)

    Chi, Yukai; Yue, Zhenzhu; Liu, Yupin; Mo, Lei; Chen, Qi

    2014-08-01

    There are ongoing debates on whether object concepts are coded as supramodal identity-based or modality-specific representations in the human brain. In this fMRI study, we adopted a cross-modal "prime-neutral cue-target" semantic priming paradigm, in which the prime-target relationship was manipulated along both the identity and the modality dimensions. The prime and the target could refer to either the same or different semantic identities, and could be delivered via either the same or different sensory modalities. By calculating the main effects and interactions of this 2 (identity cue validity: "Identity_Cued" vs. "Identity_Uncued") × 2 (modality cue validity: "Modality_Cued" vs. "Modality_Uncued") factorial design, we aimed at dissociating three neural networks involved in creating novel identity-specific representations independent of sensory modality, in creating modality-specific representations independent of semantic identity, and in evaluating changes of an object along both the identity and the modality dimensions, respectively. Our results suggested that bilateral lateral occipital cortex was involved in creating a new supramodal semantic representation irrespective of the input modality, left dorsal premotor cortex, and left intraparietal sulcus were involved in creating a new modality-specific representation irrespective of its semantic identity, and bilateral superior temporal sulcus was involved in creating a representation when the identity and modality properties were both cued or both uncued. In addition, right inferior frontal gyrus showed enhanced neural activity only when both the identity and the modality of the target were new, indicating its functional role in novelty detection.

  20. Alkanediyl-α, ω-bis (dimethyl cetylammonium bromide gemini surfactants as novel corrosion inhibitors for mild steel in formic acid

    Directory of Open Access Journals (Sweden)

    Mohammad Mobin

    2012-12-01

    Full Text Available Gemini surfactants, butanediyl 1,4-bis(dimethyl cetylammonium bromide, pentanediyl 1,5 - bis (dimethyl cetylammonium bromide and hexanediyl 1,6 - bis (dimethyl cetylammonium bromide from Alkanediyl-α, ω-bis (dimethyl cetylammonium bromide series were synthesized in laboratory and were characterized by using Nuclear Magnetic Resonance (NMR spectroscopy. The surfactants were tested as corrosion inhibitors for mild steel in 20% formic acid. The influence of surfactants on mild steel corrosion inhibition was investigated by measuring the corrosion rate of mild steel in their absence and presence by weight loss measurements, solvent analysis of iron ions into the test solution and potentiodynamic polarization measurements. The surface morphology of the corroded steel samples in presence and absence of surfactants was evaluated by using Scanning Electron Microscopy (SEM. The synthesized gemini surfactants performed as excellent corrosion inhibitor, the inhibition efficiency (IE being in the range of 76.66-97.41%. The IE of surfactants is slightly affected by the spacer length. The IE increased with increase in surfactant concentration and temperature. The adsorption of gemini surfactants on the steel surface was found to obey Langmuir adsorption isotherm. The results of the potentiodynamic polarization studies are consistent with the results of weight loss studies.

  1. KN-93, a specific inhibitor of CaMK Ⅱ inhibits human hepatic stellate cell proliferation in vitro

    Institute of Scientific and Technical Information of China (English)

    Ping An; Jun-Yong Zhu; Yan Yang; Peng Lv; Yi-Hao Tian; Ming-Kai Chen; He-Sheng Luo

    2007-01-01

    AIM: To investigate the effects of KN-93, a CaMKⅡ selective inhibitor on cell proliferation and the expression of p53 or p21 protein in human hepatic stellate ceils.METHODS: Human hepatic stellate cells (LX-2) were incubated with various concentrations (0-50 μmol/L) of KN-93 or its inactive derivative, KN-92. Cell proliferation was measured by CCK-8 assay, and the expression of two cell cycle regulators, p53 and p21, was determined by SDS-PAGE and Western blotting.RESULTS: KN-93 (5-50 μmol/L) decreased the proliferation of human hepatic stellate cells in a dosedependent manner from 81.76% (81.76% + 2.58% vs 96.63% + 2.69%, P < 0.05) to 27.15% (27.15% + 2.86% vs 96.59% + 2.44%, P < 0.01) after 24 h treatment.Incubation of 10 μmol/L KN-93 induced the cell growth reduction in a time-dependent manner from 78.27% at 8 h to 11.48% at 48 h. However, KN-92, an inactive derivative of KN-93, did not inhibit cell proliferation effectively. Moreover, analysis of cell cycle regulator expression revealed that KN-93 rather than KN-92 reduced the expression of p53 and p21.CONCLUSION: KN-93 has potent inhibitory effect on proliferation of LX-2 cells by modulating the expression of two special cell cycle regulators, p53 and p21.

  2. Residue-specific annotation of disorder-to-order transition and cathepsin inhibition of a propeptide-like crammer from D. melanogaster.

    Directory of Open Access Journals (Sweden)

    Tien-Sheng Tseng

    Full Text Available Drosophila melanogaster crammer is a novel cathepsin inhibitor involved in long-term memory formation. A molten globule-to-ordered structure transition is required for cathepsin inhibition. This study reports the use of alanine scanning to probe the critical residues in the two hydrophobic cores and the salt bridges of crammer in the context of disorder-to-order transition and cathepsin inhibition. Alanine substitution of the aromatic residues W9, Y12, F16, Y20, Y32, and W53 within the hydrophobic cores, and charged residues E8, R28, R29, and E67 in the salt bridges considerably decrease the ability of crammer to inhibit Drosophila cathepsin B (CTSB. Far-UV circular dichroism (CD, intrinsic fluorescence, and nuclear magnetic resonance (NMR spectroscopies show that removing most of the aromatic and charged side-chains substantially reduces thermostability, alters pH-dependent helix formation, and disrupts the molten globule-to-ordered structure transition. Molecular modeling indicates that W53 in the hydrophobic Core 2 is essential for the interaction between crammer and the prosegment binding loop (PBL of CTSB; the salt bridge between R28 and E67 is critical for the appropriate alignment of the α-helix 4 toward the CTSB active cleft. The results of this study show detailed residue-specific dissection of folding transition and functional contributions of the hydrophobic cores and salt bridges in crammer, which have hitherto not been characterized for cathepsin inhibition by propeptide-like cysteine protease inhibitors. Because of the involvements of cathepsin inhibitors in neurodegenerative diseases, these structural insights can serve as a template for further development of therapeutic inhibitors against human cathepsins.

  3. Association of defects in lead chloride and lead bromide: Ionic conductivity and dielectric loss measurements

    NARCIS (Netherlands)

    Brom, W.E. van den; Schoonman, J.; Wit, J.H.W. de

    1972-01-01

    The ionic conductivity data of pure and doped lead bromide without associated defects are used in order to explain the anomalous conductivity behaviour of copper (I) bromide and lead oxide-doped lead-bromide crystals. In these crystals precipitated dopant and associated defects are present. The asso

  4. 40 CFR 180.519 - Bromide ion and residual bromine; tolerances for residues.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Bromide ion and residual bromine... Tolerances § 180.519 Bromide ion and residual bromine; tolerances for residues. (a) General. The food additives, bromide ion and residual bromine, may be present in water, potable in accordance with...

  5. Discrimination of differentially inhibited cysteine proteases by activity-based profiling using cystatin variants with tailored specificities.

    Science.gov (United States)

    Sainsbury, Frank; Rhéaume, Ann-Julie; Goulet, Marie-Claire; Vorster, Juan; Michaud, Dominique

    2012-12-01

    Recent research has shown the possibility of tailoring the inhibitory specificity of plant cystatins toward cysteine (Cys) proteases by single mutations at positively selected amino acid sites. Here we devised a cystatin activity-based profiling approach to assess the impact of such mutations at the proteome scale using single variants of tomato cystatin SlCYS8 and digestive Cys proteases of the herbivorous insect, Colorado potato beetle, as a model. Biotinylated forms of SlCYS8 and SlCYS8 variants were used to capture susceptible Cys proteases in insect midgut protein extracts by biotin immobilization on avidin-embedded beads. A quantitative LC-MS/MS analysis of the captured proteins was performed to compare the inhibitory profile of different SlCYS8 variants. The approach confirmed the relevance of phylogenetic inferences categorizing the insect digestive Cys proteases into six functionally distinct families. It also revealed significant variation in protease family profiles captured with N-terminal variants of SlCYS8, in line with in silico structural models for Cys protease-SlCYS8 interactions suggesting a functional role for the N-terminal region. Our data confirm overall the usefulness of cystatin activity-based protease profiling for the monitoring of Cys protease-inhibitor interactions in complex biological systems. They also illustrate the potential of biotinylated cystatins to identify recombinant cystatin candidates for the inactivation of specific Cys protease targets.

  6. A comparison of the effect of intranasal desmopressin and intramuscular hyoscine N-butyl bromide combination with intramuscular hyoscine N-butyl bromide alone in acute renal colic

    OpenAIRE

    Abdol-Reza Kheirollahi; Mohammad Tehrani; Mohammad Bashashati

    2010-01-01

    Background: Patients with acute renal colic usually require immediate diagnosis and treatment. In this clinical trial analgesic effect of hyoscine N-butyl bromide and desmopressin combination in comparison with hyoscine N-butyl bromide alone in patients with acute renal colic induced by urinary stones was assessed. Methods: The study included 114 patients randomly allocated in two groups (A and B). Patients in group A received 20 mg intramuscular hyoscine N-butyl bromide at admission tim...

  7. Growth Inhibition and Apoptosis Inducing Mechanisms of Curcumin on Human Ovarian Cancer Cell Line A2780

    Institute of Scientific and Technical Information of China (English)

    ZHENG Li-duan; TONG Qiang-song; WU Cui-huan

    2006-01-01

    Objective: To explore the growth inhibition effects and apoptosis inducing mechanisms of curcumin on human ovarian cancer cell line A2780. Methods: After treatment with 10-50 μmol/L curcumin for 6-24 h, the growth activity of A2780 cancer cells were studied by [ 4, 5-dimethylthiazol-2-yl]-2, 5-diphenyItetrazolium bromide (MTT) colorimetry. Cellular apoptosis was inspected by flow cytometery and acridine orange-ethidium bromide fluorescent staining methods. The fragmentation of cellular chromosome DNA was detected by DNA ladder, the ultrastructural change was observed under a transmission electron microscope,and the protein levels of nuclear factor-kappa B (NF-κB, P65) and cysteinyl aspartate specific protease-3 (Caspase-3) in ovarian cancer cells were measured by immunohistochemistry. Results: After treatment with various concentrations of curcumin, the growth inhibition rates of cancer cells reached 62.05%- 89.24%,with sub-G1 peaks appearing on histogram. Part of the cancer cells showed characteristic morphological changes of apoptosis under fluorescence and electron microscopes, and the rate of apoptosis was 21.5 % -33.5%. The protein expression of NF-κB was decreased, while that of Caspase-3 was increased in a timedependent manner. Conclusion: Curcumin could significantly inhibit the growth of human ovarian cancer cells;inducing apoptosis through up-regulating Caspase-3 and down-regulating gene expression of NF-κB is probably one of its molecular mechanisms.

  8. Chlorination of bromide-containing waters: Enhanced bromate formation in the presence ofsynthetic metal oxides and deposits formed indrinking water distribution systems

    KAUST Repository

    Liu, Chao

    2013-09-01

    Bromate formation from the reaction between chlorine and bromide in homogeneous solution is a slow process. The present study investigated metal oxides enhanced bromate formation during chlorination of bromide-containing waters. Selected metal oxides enhanced the decay of hypobromous acid (HOBr), a requisite intermediate during the oxidation of bromide to bromate, via (i) disproportionation to bromate in the presence of nickel oxide (NiO) and cupric oxide (CuO), (ii) oxidation of a metal to a higher valence state in the presence of cuprous oxide (Cu2O) and (iii) oxygen formation by NiO and CuO. Goethite (α-FeOOH) did not enhance either of these pathways. Non-charged species of metal oxides seem to be responsible for the catalytic disproportionation which shows its highest rate in the pH range near the pKa of HOBr. Due to the ability to catalyze HOBr disproportionation, bromate was formed during chlorination of bromide-containing waters in the presence of CuO and NiO, whereas no bromate was detected in the presence of Cu2O and α-FeOOH for analogous conditions. The inhibition ability of coexisting anions on bromate formation at pH 8.6 follows the sequence of phosphate>>sulfate>bicarbonate/carbonate. A black deposit in a water pipe harvested from a drinking water distribution system exerted significant residual oxidant decay and bromate formation during chlorination of bromide-containing waters. Energy dispersive spectroscopy (EDS) analyses showed that the black deposit contained copper (14%, atomic percentage) and nickel (1.8%, atomic percentage). Cupric oxide was further confirmed by X-ray diffraction (XRD). These results indicate that bromate formation may be of concern during chlorination of bromide-containing waters in distribution systems containing CuO and/or NiO. © 2013 Elsevier Ltd.

  9. The splicing factor SRSF1 modulates pattern formation by inhibiting transcription of tissue specific genes during embryogenesis.

    Science.gov (United States)

    Lee, Soo-Ho; Lee, Hyun-Kyung; Kim, Chowon; Kim, Yoo-Kyung; Ismail, Tayaba; Jeong, Youngeun; Park, Kyeongyeon; Park, Jeen-Woo; Kwon, Oh-Shin; Kang, Beom Sik; Lee, Dong-Seok; Park, Mae-Ja; Park, Do-Sim; Lee, Hyun-Shik

    2016-09-01

    Alternative splicing is a major mechanism regulating pattern of gene expression through the production of multiple mRNAs from a single gene transcript. Any misregulation can cause various human diseases and also have severe effects on embryogenesis. SRSF1 is one of the critical factors regulating alternative splicing at many stages of vertebrate development and any disturbance in SRSF1 leads to serious consequences. In current study, we investigated the effects of loss of the SRSF1 gene using antisense morpholino oligonucleotides (MO) in Xenopus embryogenesis. It is evident from the results of RT-PCR and whole-mount in situ hybridization that SRSF1 is a maternal gene having strong expression in head, eyes and central nervous system. Moreover, SRSF1 morphants exhibited malformed phenotypes, including miscoiled guts, heart and cartilage formation, edema in the head and heart, and small eyes. Especially, in SRSF1 morphants, bone cartilage formation was reduced in the brain and Nkx-2.5 expression was dramatically reduced in the heart of SRSF1 morphants. In addition, a dramatic reduction in functional chordin RNA in SRSF1 morphants was observed suggesting that chordin is one of the targets of SRSF1. Thus, we concluded that SRSF1 is an essential factor for pattern formation including heart, cartilage and germ layers through the regulation of specific genes. PMID:27396620

  10. The Effects of Inhibiting Hedgehog Signaling Pathways by Using Specific Antagonist Cyclopamine on the Chondrogenic Differentiation of Mesenchymal Stem Cells

    Directory of Open Access Journals (Sweden)

    Zheng-Rong Chen

    2013-03-01

    Full Text Available This study aimed to investigate the effects of cyclopamine, a specific inhibitor of Hedgehog signaling pathways, on the chondrogenic differentiation of mesenchymal stem cells (MSCs. During culture, the experimental groups were treated with cyclopamine and their cell proliferation status was assessed using the MTT test. The extra-bone cellular matrix (ECM and Collagen II (Col II was detected by toluidine blue staining and immunohistochemistry of cells. The concentrations of Col II and aggrecan in the culture solution and cytosol were detected using ELISA on the 7th, 14th, and 21st days of cyclopamine induction. Gene and protein expression of Col II and aggrecan were analyzed on the 14th day of cyclopamine induction using real-time PCR and western blot analyses. No significant differences in proliferation of mesenchymal stem cells were found between the control group and the group treated with cyclopamine. Compared to the blank control group, the ECM level was low and the protein and mRNA concentrations of Collagen II (Col II and aggrecan in the culture solution and cytosol, respectively, were significantly reduced in the experimental group. The Smo acted as a key point in the regulations of Hedgehog signaling pathway on the chondrogenic differentiation of rabbit MSCs.

  11. Prostate Specific Antigen Promoter-Driven Adenovirus-Mediated Expression of Both ODC and AdoMetDC Antisenses Inhibit Prostate Cancer Growth

    Institute of Scientific and Technical Information of China (English)

    Wei Li; Hui Xiong; Yi-lin Hong; Chun-hua Zhang; Chang-chun Liu

    2010-01-01

    Objective:To generate recombinant adenovirus that could simultaneously express ornithine decarboxylase(ODC)and S-adenosylmethionine decarboxylase(AdoMetDC)antisenses specifically in prostate cancer cells,and evaluate its inhibitory effect on prostate cancer in vivo.Methods:Fragments of ODC and AdoMetDC genes were generated by PCR,cloned into the pPGL-PSES,and then recombined with pAdEasy-1 vectors in AdEasy-1 cells.Ad-PSES-ODC-AdoMetDCas virus was produced in HEK293 cells.Following transfection with Ad-PSES-ODC-AdoMetDCas,the levels of ODC or AdoMetDC were determined by RT-PCR and western blot assays.The effect of Ad-PSES-ODC-AdoMetDCas treatment on tumor formation and growth was evaluated in xenograft models of prostate cancers in vivo.Results:The plasmid pAdEasy-PSES-ODC-AdoMetDCas was successfully constructed and the recombinant Ad-PSES-ODC-AdoMetDCas adenovirus was produced.Transfection with Ad-PSES-ODC-AdoMetDCas adenovirus significantly inhibited the expression of ODC and AdoMetDC genes specifically in prostate DU145cells,but not H1299,HT29 and HepG2 cancer cells,and disrupted the ability of DU145 cells to form solid prostate cancer in vivo.Intratumoral treatment with Ad-PSES-ODC-AdoMetDCas adenovirus significantly inhibited the growth of engrafted prostate tumors in vivo.Conclusion:The recombinant Ad-PSES-ODC-AdoMetDCas adenovirus specifically reduces the expression of both ODC and AdoMetDC genes in prostate cells and may be used for treatment of prostate cancers at the clinic.

  12. Aluminium Electroplating on Steel from a Fused Bromide Electrolyte

    Energy Technology Data Exchange (ETDEWEB)

    Prabhat Tripathy; Laura Wurth; Eric Dufek; Toni Y. Gutknecht; Natalie Gese; Paula Hahn; Steven Frank; Guy Fredrickson; J Stephen Herring

    2014-08-01

    A quaternary bromide bath (LiBr-KBr-CsBr-AlBr3) was used to electro-coat aluminium on steel substrates. The electrolyte was prepared by the addition of AlBr3 into the eutectic LiBr-KBr-CsBr melt. A smooth, thick, adherent and shiny aluminium coating could be obtained with 80 wt.% AlBr3 in the ternary melt. The SEM photographs of the coated surfaces suggest the formation of thick and dense coatings with good aluminium coverage. Both salt immersion and open circuit potential measurement suggest that the coatings did display good corrosion-resistance behavior. Annealing of the coated surfaces, prior to corrosion tests, suggested the robustness of the metallic aluminium coating in preventing the corrosion of the steel surfaces. Studies also indicated that the quaternary bromide plating bath can potentially provide a better aluminium coating on both ferrous and non-ferrous metals, including complex surfaces/geometries.

  13. [2,6-Bis(dimethylaminomethylphenyl]selenium bromide monohydrate

    Directory of Open Access Journals (Sweden)

    Richard A. Varga

    2010-04-01

    Full Text Available In the title hydrated molecular salt, C12H19N2Se+·Br−·H2O, the two independent bromide anions lie on a twofold rotation axis. Strong intramolecular N→Se interactions [2.185 (3 and 2.181 (3 Å] are established by both N atoms of the organic group in the cation, in trans positions to each other, with an N—Se—N angle of 161.6 (1°, resulting in a T-shaped (C,N,N′Se core. In the crystal, dimeric associations are formed by Br...Se [3.662 (2 Å] and Br...H interactions [2.56 (6 and 2.63 (7 Å] involving two bromide anions, two cations and two water molecules.

  14. Preparation of ethyl magnesium bromide for regiospecific analysis of triacylglycerols.

    Science.gov (United States)

    Ando, Yasuhiro; Tomita, Yuki; Haba, Yusuke

    2008-01-01

    This paper presents a procedure for preparation of a Grignard reagent, ethyl magnesium bromide, used for partial deacylation of triacylglycerols (TAG) in their regiospecific analysis. Magnesium turnings were reacted with ethereal solution of bromoethane in a screw-capped test tube to synthesize 2 mL of 1 M ethyl magnesium bromide. Continuously stirred with a vortex mixer, the reaction smoothly proceeded at room temperature. Regiospecific analysis of 1,3-distearoyl-2-oleoylglycerol using this product showed that fatty acid compositions of the sn-1(3) and sn-2 positions were contaminated by less than 2 mol% of fatty acids migrated from isomeric positions. The analyses of lard and cod liver/mackerel oil TAG showed typical distribution patterns of 16:0, 22:5n-3 and 22:6n-3 in pig and fish depot TAG. These results confirmed the view that the freshly prepared reagent is usable for regiospecific analysis of TAG.

  15. High-speed Laser Micromachining with Copper Bromide Laser

    CERN Document Server

    Balchev, I I; Minkovski, N I; Sabotinov, N V; Balchev, Ivaylo I.; Kostadinov, Ivan K.; Minkovski, Nikolai I.; Sabotinov, Nikola V.

    2006-01-01

    The application of the copper bromide (CuBr) laser as an attractive tool in the micro-machining of different materials has been demonstrated. High-quality drilling by trepanning and precision cutting was established on several materials with a negligible heat-affected zone (HAZ). That good performance was a result of the combination of high power visible radiation, short pulses, and close to the diffraction-limited laser beam quality with high-speed galvo scanner beam steering.

  16. Criticality in aqueous solutions of 3-methylpyridine and sodium bromide.

    Science.gov (United States)

    Kostko, A F; Anisimov, M A; Sengers, J V

    2004-08-01

    We address a controversial issue regarding the nature of critical behavior in ternary electrolyte solutions of water, 3-methylpyridine, and sodium bromide. Earlier light-scattering studies showed an anomalous critical behavior in this system that was attributed to the formation of a microheterogeneous phase associated with ion-molecule clustering [M.A. Anisimov, J. Jacob, A. Kumar, V.A. Agayan, and J. V. Sengers, Phys. Rev. Lett. 85, 2336 (2000)

  17. Comparison of Heat and Bromide as Ground Water Tracers Near Streams

    Science.gov (United States)

    Constantz, J.; Cox, M.H.; Su, G.W.

    2003-01-01

    Heat and bromide were compared as tracers for examining stream/ground water exchanges along the middle reaches of the Santa Clara River, California, during a 10-hour surface water sodium bromide injection test. Three cross sections that comprise six shallow (sodium bromide injection test. Vertical, one-dimensional simulations of bromide concentrations in the sediments yielded a good match to the observed bromide concentrations, without adjustment of any model parameters except solute dispersivities. This indicates that, for the spatial and temporal scales examined on the Santa Clara River, the use of heat and bromide as tracers provide comparable information with respect to apparent hydraulic conductivities and fluxes for sediments near streams. In other settings, caution should be used due to differences in the nature of conservative (bromide) versus nonconservative (heat) tracers, particularly when preferential flowpaths are present.

  18. Use of 82Br and 131I radionuclides in studies of goitrogenic effects of exogenous bromide

    International Nuclear Information System (INIS)

    The interference of excessive bromide intake with iodine metabolism in the rat was studied using 82Br and 131I radionuclides. Mainly lactating rat dams and their pups were used, in addition to adult male rats, in the present studies. Particularly, the influence of high bromide intake in lactating rat dams on the transfer of iodine and bromide to suckling young through breast milk was evaluated. The induction of hypothyroid status in the pups by high bromide intake in the mothers was proved unambiguously. Excessive bromide in lactating rat dams caused a marked decrease in plasma levels of thyroid hormones both, in the mothers and in their sucklings. The effects of an enhanced bromide intake on the thyroid function in relation to iodine status in the animals were also followed. Marked goitrogenic and thyrotoxic effects of excessive bromide in adult rats were significantly enhanced under the conditions of simultaneous iodine deficiency in the experimental animals. (author)

  19. 4-Hydroxy-1,2,6-trimethylpyridinium bromide monohydrate

    Directory of Open Access Journals (Sweden)

    T. Seethalakshmi

    2013-06-01

    Full Text Available The title salt, C8H12NO+·Br−·H2O, is isomorphous with the chloride analogue [Seethalakshmi et al. (2013. Acta Cryst. E69, o835–o836]. In the solid state, the cations, anions and water molecules are interlinked by a network of O—H...O, O—H...Br and C—H...Br interactions. The water molecule makes two O—H...Br hydrogen bonds, generating [010] zigzag chains of alternating water molecules and bromide anions. The cation is involved in two intermolecular C—H...Cl interactions in the chloride salt, whereas three intermolecular C—H...Br interactions are observed in the title bromide salt. This additional intermolecular C—H...Br interaction links the adjacent water and bromide zigzag chains via cationic molecules. In addition, weak π–π stacking interactions are observed between pyridinium rings [centroid–centroid distance = 3.5664 (13 Å].

  20. Structural, vibrational and theoretical studies of L-histidine bromide

    Science.gov (United States)

    Ahmed, A. Ben; Feki, H.; Abid, Y.; Boughzala, H.; Mlayah, A.

    2008-10-01

    This paper presents the results of our calculations of the geometric parameters, vibrational spectra and hyperpolarizability of a non linear optical material, L-histidine bromide. Due to the lack of sufficiently precise information on the geometric structure available in literature, theoretical calculations were preceded by re-determination of the crystal X-ray structure. Single crystals of L-histidine bromide have been grown by slow evaporation of an aqueous solution at room temperature. The compound crystallizes in the non-Centro symmetric space group P2 12 12 1 of the orthorhombic system. Raman spectra have been recorded in the range [200-3500 cm -1]. All observed vibrational bands have been discussed and assigned to normal mode or to combinations and overtones on the basis of our calculations. The optimized geometric bond lengths and bond angles obtained by using HF and DFT (B3LYP and BLYP) show good agreement with the experimental data. Comparison between the measured and the calculated vibrational frequencies indicate that B3LYP is superior to the scaled HF approach for molecular vibrational problems. To investigate microscopic second order non linear optical properties of L-histidine bromide, the electric dipole μ, the polarizability α and the hyperpolarizability β were computed using DFT//B3LYP/6-31G(d) method. According to our calculations, the title compound exhibits non-zero β value revealing microscopic second order NLO behaviour.

  1. Oral teratogenicity studies of methyl bromide in rats and rabbits.

    Science.gov (United States)

    Kaneda, M; Hojo, H; Teramoto, S; Maita, K

    1998-05-01

    Teratogenicity studies of methyl bromide, a widely used fumigant, were conducted in rats and rabbits. Methyl bromide was dissolved in corn oil and administered orally to groups of 24 copulated female Crj:CD (SD) rats at dose levels of 0 (corn oil), 3, 10 or 30 mg/kg/day on days 6-15 of gestation and to groups of 18 artificially inseminated female Kbl:JW rabbits at 0, 1, 3 or 10 mg/kg/day on days 6-18 of gestation. Maternal rats and rabbits were euthanized on respective days 20 and 27 of gestation. Foetuses were examined for survival, growth and teratological alterations. Maternal toxicity was evident in the high-dose groups for both species. In these groups, maternal body weight gains and food consumption were significantly decreased during the dosing and post-dosing periods. Necropsy of maternal rats also revealed erosive lesions in the stomach and the surrounding organs. However, no treatment-related adverse effects were found in foetuses of the treated groups for both rat and rabbit studies. These results led to the conclusion that methyl bromide was not foetotoxic or teratogenic to rat and rabbit foetuses up to dose levels of 30 and 10 mg/kg/day, respectively, at which maternal toxicity was evident for both species.

  2. Preservatives and neutralizing substances in milk: analytical sensitivity of official specific and nonspecific tests, microbial inhibition effect, and residue persistence in milk

    Directory of Open Access Journals (Sweden)

    Livia Cavaletti Corrêa da Silva

    2015-09-01

    Full Text Available Milk fraud has been a recurring problem in Brazil; thus, it is important to know the effect of most frequently used preservatives and neutralizing substances as well as the detection capability of official tests. The objective of this study was to evaluate the analytical sensitivity of legislation-described tests and nonspecific microbial inhibition tests, and to investigate the effect of such substances on microbial growth inhibition and the persistence of detectable residues after 24/48h of refrigeration. Batches of raw milk, free from any contaminant, were divided into aliquots and mixed with different concentrations of formaldehyde, hydrogen peroxide, sodium hypochlorite, chlorine, chlorinated alkaline detergent, or sodium hydroxide. The analytical sensitivity of the official tests was 0.005%, 0.003%, and 0.013% for formaldehyde, hydrogen peroxide, and hypochlorite, respectively. Chlorine and chlorinated alkaline detergent were not detected by regulatory tests. In the tests for neutralizing substances, sodium hydroxide could not be detected when acidity was accurately neutralized. The yogurt culture test gave results similar to those obtained by official tests for the detection of specific substances. Concentrations of 0.05% of formaldehyde, 0.003% of hydrogen peroxide and 0.013% of sodium hypochlorite significantly reduced (P

  3. RAG-mediated DNA double-strand breaks activate a cell type-specific checkpoint to inhibit pre-B cell receptor signals.

    Science.gov (United States)

    Bednarski, Jeffrey J; Pandey, Ruchi; Schulte, Emily; White, Lynn S; Chen, Bo-Ruei; Sandoval, Gabriel J; Kohyama, Masako; Haldar, Malay; Nickless, Andrew; Trott, Amanda; Cheng, Genhong; Murphy, Kenneth M; Bassing, Craig H; Payton, Jacqueline E; Sleckman, Barry P

    2016-02-01

    DNA double-strand breaks (DSBs) activate a canonical DNA damage response, including highly conserved cell cycle checkpoint pathways that prevent cells with DSBs from progressing through the cell cycle. In developing B cells, pre-B cell receptor (pre-BCR) signals initiate immunoglobulin light (Igl) chain gene assembly, leading to RAG-mediated DNA DSBs. The pre-BCR also promotes cell cycle entry, which could cause aberrant DSB repair and genome instability in pre-B cells. Here, we show that RAG DSBs inhibit pre-BCR signals through the ATM- and NF-κB2-dependent induction of SPIC, a hematopoietic-specific transcriptional repressor. SPIC inhibits expression of the SYK tyrosine kinase and BLNK adaptor, resulting in suppression of pre-BCR signaling. This regulatory circuit prevents the pre-BCR from inducing additional Igl chain gene rearrangements and driving pre-B cells with RAG DSBs into cycle. We propose that pre-B cells toggle between pre-BCR signals and a RAG DSB-dependent checkpoint to maintain genome stability while iteratively assembling Igl chain genes. PMID:26834154

  4. Inhibition of the striatal specific phosphodiesterase PDE10A ameliorates striatal and cortical pathology in R6/2 mouse model of Huntington's disease.

    Directory of Open Access Journals (Sweden)

    Carmela Giampà

    Full Text Available BACKGROUND: Huntington's disease is a devastating neurodegenerative condition for which there is no therapy to slow disease progression. The particular vulnerability of striatal medium spiny neurons to Huntington's pathology is hypothesized to result from transcriptional dysregulation within the cAMP and CREB signaling cascades in these neurons. To test this hypothesis, and a potential therapeutic approach, we investigated whether inhibition of the striatal-specific cyclic nucleotide phosphodiesterase PDE10A would alleviate neurological deficits and brain pathology in a highly utilized model system, the R6/2 mouse. METHODOLOGY/PRINCIPAL FINDINGS: R6/2 mice were treated with the highly selective PDE10A inhibitor TP-10 from 4 weeks of age until euthanasia. TP-10 treatment significantly reduced and delayed the development of the hind paw clasping response during tail suspension, deficits in rotarod performance, and decrease in locomotor activity in an open field. Treatment prolonged time to loss of righting reflex. These effects of PDE10A inhibition on neurological function were reflected in a significant amelioration in brain pathology, including reduction in striatal and cortical cell loss, the formation of striatal neuronal intranuclear inclusions, and the degree of microglial activation that occurs in response to the mutant huntingtin-induced brain damage. Striatal and cortical levels of phosphorylated CREB and BDNF were significantly elevated. CONCLUSIONS/SIGNIFICANCE: Our findings provide experimental support for targeting the cAMP and CREB signaling pathways and more broadly transcriptional dysregulation as a therapeutic approach to Huntington's disease. It is noteworthy that PDE10A inhibition in the R6/2 mice reduces striatal pathology, consistent with the localization of the enzyme in medium spiny neurons, and also cortical pathology and the formation of neuronal nuclear inclusions. These latter findings suggest that striatal pathology may

  5. Betulinic acid inhibits colon cancer cell and tumor growth and induces proteasome-dependent and -independent downregulation of specificity proteins (Sp transcription factors

    Directory of Open Access Journals (Sweden)

    Pathi Satya

    2011-08-01

    Full Text Available Abstract Background Betulinic acid (BA inhibits growth of several cancer cell lines and tumors and the effects of BA have been attributed to its mitochondriotoxicity and inhibition of multiple pro-oncogenic factors. Previous studies show that BA induces proteasome-dependent degradation of specificity protein (Sp transcription factors Sp1, Sp3 and Sp4 in prostate cancer cells and this study focused on the mechanism of action of BA in colon cancer cells. Methods The effects of BA on colon cancer cell proliferation and apoptosis and tumor growth in vivo were determined using standardized assays. The effects of BA on Sp proteins and Sp-regulated gene products were analyzed by western blots, and real time PCR was used to determine microRNA-27a (miR-27a and ZBTB10 mRNA expression. Results BA inhibited growth and induced apoptosis in RKO and SW480 colon cancer cells and inhibited tumor growth in athymic nude mice bearing RKO cells as xenograft. BA also decreased expression of Sp1, Sp3 and Sp4 transcription factors which are overexpressed in colon cancer cells and decreased levels of several Sp-regulated genes including survivin, vascular endothelial growth factor, p65 sub-unit of NFκB, epidermal growth factor receptor, cyclin D1, and pituitary tumor transforming gene-1. The mechanism of action of BA was dependent on cell context, since BA induced proteasome-dependent and proteasome-independent downregulation of Sp1, Sp3 and Sp4 in SW480 and RKO cells, respectively. In RKO cells, the mechanism of BA-induced repression of Sp1, Sp3 and Sp4 was due to induction of reactive oxygen species (ROS, ROS-mediated repression of microRNA-27a, and induction of the Sp repressor gene ZBTB10. Conclusions These results suggest that the anticancer activity of BA in colon cancer cells is due, in part, to downregulation of Sp1, Sp3 and Sp4 transcription factors; however, the mechanism of this response is cell context-dependent.

  6. In vitro effects of buyang huanwu decoction and its ingredients on inhibiting the specific binding of 3H-platelet activating factor to its receptor in rabbits

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    radioligand binding assay. The inhibitory rate of the specific binding was used as an assessing index. The inhibitory action of and on 3H-PAF to PAFR binding was analyzed and compared in vitro. The inhibitory action of each ingredient in the prescription BHD·on 3H-PAF to PAFR binding was investigated and compared in vitro by direct analysis and analysis of variance of orthogonal test.MAIN OUTCOME MEASURES: Effect of 8 prescriptions for L8 (27) orthogonal test table on the specific binding inhibition rate of 3H-PAF and PAFR.RESULTS: According to results of variance analysis of orthogonal test, the inhibitory action of each ingredient in the prescription BHD on 3H-PAF to PAFR binding from the highest to the lowest was in turn Honghua, Shenghuangqi, Taoren, Dilong, Dangguiwei, Chuanxiong, Chishao. Honghua, Shenghuangqi,Taoren, Dilong, Danguiwei were major influence factors to 3H-PAF to PAFR in rabbits (F =187.829,144.446,59.521,5.018,4.265, P < 0.05- 0.01), but Chuanxiong and Chishao had not obviously inhibitory effect. The specific binding inhibition rate of prescriptions (except Shenghuangqi ) was obviously higher than that of one of prescriptions (Shenghuangqi included).CONCLUSION: The results of orthogonal test show that Honghua, Shenghuangqi, Taoren, Dilong,Dangguiwei are major influencing factors to inhibit binding of 3H-PAF to PAFR in rabbits, among which,Honghua is the strongest in ingredients of prescription BHD. The results also reveal that Shenghuangqi is able to weaken the inhibitory effect and to prevent the strong inhibitory effect of blood-activating drugs in BHD.

  7. Prostate Specific Antigen Promoter-Driven Adenovirus-Mediated Expression of Both ODC and AdoMetDC Antisenses Inhibit Prostate Cancer Growth

    Institute of Scientific and Technical Information of China (English)

    Wei Li; Hui Xiong; Yi-lin Hong; Chun-hua Zhang; Chang-chun Liu

    2011-01-01

    Objective: To generate recombinant adenovirus that could simultaneously express ornithine decarboxylase (ODC) and S-adenosylmethionine decarboxylase(AdoMetDC) antisenses specifically in prostate cancer cells,and evaluate its inhibitory effect on prostate cancer in vivo.Methods: Fragments of ODC and AdoMetDC genes were generated by PCR,cloned into the pPGL-PSES,and then recombined with pAdEasy-1 vectors in AdEasy-1 cells.Ad-PSES-ODC-AdoMetDCas virus was produced in HEK293 cells.Following transfection with Ad-PSES-ODC-AdoMetDCas,the levels of ODC or AdoMetDC were determined by RT-PCR and western blot assays.The effect of Ad-PSES-ODC-AdoMetDCas treatment on tumor formation and growth was evaluated in xenograft models of prostate cancers in vivo.Results: The plasmid pAdEasy-PSES-ODC-AdoMetDCas was successfully constructed and the recombinant Ad-PSES-ODC-AdoMetDCas adenovirus was produced.Transfection with Ad-PSES-ODC-AdoMetDCasadenovirus significantly inhibited the expression of ODC and AdoMetDC genes specifically in prostate DU145 cells,but not H1299,HT29 and HepG2 cancer cells,and disrupted the ability of DU145 cells to form solid prostate cancer in vivo.Intratumoral treatment with Ad-PSES-ODC-AdoMetDCas adenovirus significantly inhibited the growth of engrafted prostate tumors in vivo.both ODC and AdoMetDC genes in prostate cells and may be used for treatment of prostate cancers at the clinic.

  8. Solid miscibility of common-anion lithium and sodium halides. Experimental determination of the region of demixing in lithium bromide + sodium bromide

    NARCIS (Netherlands)

    Oonk, H.A.J.; Wijk, H.J. van; Doornhof, D.

    1984-01-01

    The region of demixing of solid lithium bromide + sodium bromide mixtures has been measured by X-ray diffraction. The critical temperature of mixing corresponding to a thermodynamic fit of the experimental data is 513 K. Estimates are given of the regions of demixing in solid lithium chloride + sodi

  9. Characterization of the cloned full-length and a truncated human target of rapamycin: Activity, specificity, and enzyme inhibition as studied by a high capacity assay

    International Nuclear Information System (INIS)

    The mammalian target of rapamycin (mTOR/TOR) is implicated in cancer and other human disorders and thus an important target for therapeutic intervention. To study human TOR in vitro, we have produced in large scale both the full-length TOR (289 kDa) and a truncated TOR (132 kDa) from HEK293 cells. Both enzymes demonstrated a robust and specific catalytic activity towards the physiological substrate proteins, p70 S6 ribosomal protein kinase 1 (p70S6K1) and eIF4E binding protein 1 (4EBP1), as measured by phosphor-specific antibodies in Western blotting. We developed a high capacity dissociation-enhanced lanthanide fluorescence immunoassay (DELFIA) for analysis of kinetic parameters. The Michaelis constant (K m) values of TOR for ATP and the His6-S6K substrate were shown to be 50 and 0.8 μM, respectively. Dose-response and inhibition mechanisms of several known inhibitors, the rapamycin-FKBP12 complex, wortmannin and LY294002, were also studied in DELFIA. Our data indicate that TOR exhibits kinetic features of those shared by traditional serine/threonine kinases and demonstrate the feasibility for TOR enzyme screen in searching for new inhibitors

  10. Cardiac-specific overexpression of catalase prevents diabetes-induced pathological changes by inhibiting NF-κB signaling activation in the heart.

    Science.gov (United States)

    Cong, Weitao; Ruan, Dandan; Xuan, Yuanhu; Niu, Chao; Tao, Youli; Wang, Yang; Zhan, Kungao; Cai, Lu; Jin, Litai; Tan, Yi

    2015-12-01

    Catalase is an antioxidant enzyme that specifically catabolizes hydrogen peroxide (H2O2). Overexpression of catalase via a heart-specific promoter (CAT-TG) was reported to reduce diabetes-induced accumulation of reactive oxygen species (ROS) and further prevent diabetes-induced pathological abnormalities, including cardiac structural derangement and left ventricular abnormity in mice. However, the mechanism by which catalase overexpression protects heart function remains unclear. This study found that activation of a ROS-dependent NF-κB signaling pathway was downregulated in hearts of diabetic mice overexpressing catalase. In addition, catalase overexpression inhibited the significant increase in nitration levels of key enzymes involved in energy metabolism, including α-oxoglutarate dehydrogenase E1 component (α-KGD) and ATP synthase α and β subunits (ATP-α and ATP-β). To assess the effects of the NF-κB pathway activation on heart function, Bay11-7082, an inhibitor of the NF-κB signaling pathway, was injected into diabetic mice, protecting mice against the development of cardiac damage and increased nitrative modifications of key enzymes involved in energy metabolism. In conclusion, these findings demonstrated that catalase protects mouse hearts against diabetic cardiomyopathy, partially by suppressing NF-κB-dependent inflammatory responses and associated protein nitration.

  11. Dynamic and Static Simulations of Fluvoxamine-Perpetrated Drug-Drug Interactions Using Multiple Cytochrome P450 Inhibition Modeling, and Determination of Perpetrator-Specific CYP Isoform Inhibition Constants and Fractional CYP Isoform Contributions to Victim Clearance.

    Science.gov (United States)

    Iga, Katsumi

    2016-03-01

    Fluvoxamine-perpetrated drug-drug interactions (DDIs) of victims metabolized by multiple cytochrome P450 isoforms (CYP1A2, CYP2C19, and CYP3A4) were simulated using 2 compartment-based tube modeling, assuming a multiple inhibition-constant (Ki) model, as well as a previously reported single Ki model. Good fittings were obtained for all DDIs using consistent perpetrator-specific CYP isoform Kis and fractional CYP isoform contributions to victim clearance in concordance with literature information. Through these simulations, the following rules to predict DDI were derived. Overall enzymatic inhibitory activity calculated from static DDI data determines entirely dynamic DDIs. DDI-relevant time-dependent hepatic blood unbound perpetrator levels can be approximated to mean hepatic blood unbound perpetrator levels in any victim DDIs when a perpetrator is supplied consistently. Static and dynamic multiple CYP model-based simulations agree with one another. Fluvoxamine-perpetrated DDIs can be bridged to other perpetrator DDIs. The derived rules will allow simpler prediction of DDIs from in vivo DDI databases. Tens or hundreds of Ki gaps between in vitro and in vivo data could be reduced to within severalfold using the liver-microsome contamination model, thus suggesting that microsomes qualified with contamination would greatly improve prediction of DDIs from in vitro data. PMID:26886336

  12. Deoxyhypusine hydroxylase from Plasmodium vivax, the neglected human malaria parasite: molecular cloning, expression and specific inhibition by the 5-LOX inhibitor zileuton.

    Directory of Open Access Journals (Sweden)

    Veronika Anyigoh Atemnkeng

    Full Text Available Primaquine, an 8-aminoquinoline, is the only drug which cures the dormant hypnozoites of persistent liver stages from P. vivax. Increasing resistance needs the discovery of alternative pathways as drug targets to develop novel drug entities. Deoxyhypusine hydroxylase (DOHH completes hypusine biosynthesis in eukaryotic initiation factor (eIF-5A which is the only cellular protein known to contain the unusual amino acid hypusine. Modified EIF-5A is important for proliferation of the malaria parasite. Here, we present the first successful cloning and expression of DOHH from P. vivax causing tertiary malaria. The nucleic acid sequence of 1041 bp encodes an open reading frame of 346 amino acids. Histidine tagged expression of P. vivax DOHH detected a protein of 39.01 kDa in E. coli. The DOHH protein from P. vivax shares significant amino acid identity to the simian orthologues from P. knowlesi and P. yoelii strain H. In contrast to P. falciparum only four E-Z-type HEAT-like repeats are present in P. vivax DOHH with different homology to phycocyanin lyase subunits from cyanobacteria and in proteins participating in energy metabolism of Archaea and Halobacteria. However, phycocyanin lyase activity is absent in P. vivax DOHH. The dohh gene is present as a single copy gene and transcribed throughout the whole erythrocytic cycle. Specific inhibition of recombinant P. vivax DOHH is possible by complexing the ferrous iron with zileuton, an inhibitor of mammalian 5-lipoxygenase (5-LOX. Ferrous iron in the active site of 5-LOX is coordinated by three conserved histidines and the carboxylate of isoleucine(673. Zileuton inhibited the P. vivax DOHH protein with an IC50 of 12,5 nmol determined by a relative quantification by GC/MS. By contrast, the human orthologue is only less affected with an IC50 of 90 nmol suggesting a selective iron-complexing strategy for the parasitic enzyme.

  13. Highly specific inhibition of leukaemia virus membrane fusion by interaction of peptide antagonists with a conserved region of the coiled coil of envelope

    Directory of Open Access Journals (Sweden)

    van Aalten Daan MF

    2008-08-01

    Full Text Available Abstract Background Human T-cell leukaemia virus (HTLV-1 and bovine leukaemia virus (BLV entry into cells is mediated by envelope glycoprotein catalyzed membrane fusion and is achieved by folding of the transmembrane glycoprotein (TM from a rod-like pre-hairpin intermediate to a trimer-of-hairpins. For HTLV-1 and for several virus groups this process is sensitive to inhibition by peptides that mimic the C-terminal α-helical region of the trimer-of-hairpins. Results We now show that amino acids that are conserved between BLV and HTLV-1 TM tend to map to the hydrophobic groove of the central triple-stranded coiled coil and to the leash and C-terminal α-helical region (LHR of the trimer-of-hairpins. Remarkably, despite this conservation, BLV envelope was profoundly resistant to inhibition by HTLV-1-derived LHR-mimetics. Conversely, a BLV LHR-mimetic peptide antagonized BLV envelope-mediated membrane fusion but failed to inhibit HTLV-1-induced fusion. Notably, conserved leucine residues are critical to the inhibitory activity of the BLV LHR-based peptides. Homology modeling indicated that hydrophobic residues in the BLV LHR likely make direct contact with a pocket at the membrane-proximal end of the core coiled-coil and disruption of these interactions severely impaired the activity of the BLV inhibitor. Finally, the structural predictions assisted the design of a more potent antagonist of BLV membrane fusion. Conclusion A conserved region of the HTLV-1 and BLV coiled coil is a target for peptide inhibitors of envelope-mediated membrane fusion and HTLV-1 entry. Nevertheless, the LHR-based inhibitors are highly specific to the virus from which the peptide was derived. We provide a model structure for the BLV LHR and coiled coil, which will facilitate comparative analysis of leukaemia virus TM function and may provide information of value in the development of improved, therapeutically relevant, antagonists of HTLV-1 entry into cells.

  14. Degradation of methyl bromide by methanotrophic bacteria in cell suspensions and soils

    Science.gov (United States)

    Oremland, R.S.; Miller, L.G.; Culbertson, C.W.; Connell, T.L.; Jahnke, L.

    1994-01-01

    Cell suspensions of Methylococcus capsulatus mineralized methyl bromide (MeBr), as evidenced by its removal from the gas phase, the quantitative recovery of Br- in the spent medium, and the production of 14CO2 from [14C]MeBr. Methyl fluoride (MeF) inhibited oxidation of methane as well as that of [14C]MeBr. The rate of MeBr consumption by cells varied inversely with the supply of methane, which suggested a competitive relationship between these two substrates. However, MeBr did not support growth of the methanotroph. In soils exposed to high levels (10,000 ppm) of MeBr, methane oxidation was completely inhibited. At this concentration, MeBr removal rates were equivalent in killed and live controls, which indicated a chemical rather than biological removal reaction. At lower concentrations (1,000 ppm) of MeBr, methanotrophs were active and MeBr consumption rates were 10-fold higher in live controls than in killed controls. Soils exposed to trace levels (10 ppm) of MeBr demonstrated complete consumption within 5 h of incubation, while controls inhibited with MeF or incubated without O2 had 50% lower removal rates. Aerobic soils oxidized [14C]MeBr to 14CO2, and MeF inhibited oxidation by 72%. Field experiments demonstrated slightly lower MeBr removal rates in chambers containing MeF than in chambers lacking MeF. Collectively, these results show that soil methanotrophic bacteria, as well as other microbes, can degrade MeBr present in the environment.

  15. Interaction between gaseous ozone and crystalline potassium bromide

    Science.gov (United States)

    Levanov, A. V.; Maksimov, I. B.; Isaikina, O. Ya.; Antipenko, E. E.; Lunin, V. V.

    2016-07-01

    The formation of nonvolatile products of the oxidation of a bromide ion during the interaction between gaseous ozone and powdered crystalline KBr is studied. It is found that potassium bromate KBrO3 is the main product of the reaction. The influence of major experimental factors (the duration of ozonation, the concentration of ozone, the humidity of the initial gas, and the temperature) on the rate of formation of bromate is studied. The effective constants of the formation of bromate during the interaction between O3 and Br- in a heterogeneous gas-solid body system and in a homogeneous aqueous solution are compared.

  16. Suicide by intravenous injection of rocuronium-bromide: Case report

    Directory of Open Access Journals (Sweden)

    Nikolić Slobodan

    2005-01-01

    Full Text Available Suicides by intravenous injection of an overdose of medicaments are uncommon. In this paper, we present the case of a suicide by rocuronium-bromide injection in combination with an oral overdose of metoprolol. Unfortunately, in Belgrade, there is no toxicological laboratory capable of detecting rocuronium. The interpretation of autopsy and toxicological data in this case was made difficult due to the extreme putrefaction of the body of the deceased. So, by forensic investigation, the case was solved indirectly, through circumstantial evidence: an empty ampoule of rocuronium found near the body, as well as a plastic syringe and cloth-bandage found in the left hand of the deceased.

  17. Methyl bromide: Ocean sources, ocean sinks, and climate sensitivity

    OpenAIRE

    A. D. Anbar; Yung, Y. L.; Chavez, F.P.

    1996-01-01

    The oceans play an important role in the geochemical cycle of methyl bromide (CH_3Br), the major carrier of O_3-destroying bromine to the stratosphere. The quantity of CH_3Br produced annually in seawater is comparable to the amount entering the atmosphere each year from natural and anthropogenic sources. The production mechanism is unknown but may be biological. Most of this CH_3Br is consumed in situ by hydrolysis or reaction with chloride. The size of the fraction which escapes to the atmo...

  18. Enzyme activities in agricultural soils fumigated with methyl bromide alternatives

    OpenAIRE

    Klose, Susanne; Ajwa, H A

    2004-01-01

    Pre-plant fumigation of agricultural soils with a combination of methyl bromide (MeBr) and chloropicrin (CP) to control nematodes, soil-borne pathogens and weeds has been a common practice in strawberry (Fragaria X ananassa Duchesne) production since the 1960s. MeBr will be phased out by 2005, but little is known about the impacts of alternative fumigants on soil microbial processes. We investigated the response of microbial biomass and enzyme activities in soils fumigated over two years with...

  19. Automated determination of bromide in waters by ion chromatography with an amperometric detector

    Science.gov (United States)

    Pyen, G.S.; Erdmann, D.E.

    1983-01-01

    An automated ion chromatograph, including a program controller, an automatic sampler, an integrator, and an amperometric detector, was used to develop a procedure for the determination of bromide in rain water and many ground waters. Approximately 10 min is required to obtain a chromatogram. The detection limit for bromide is 0.01 mg l-1 and the relative standard deivation is <5% for bromide concentrations between 0.05 and 0.5 mg l-1. Chloride interferes if the chloride-to-bromide ratio is greater than 1 000:1 for a range of 0.01-0.1 mg l-1 bromide; similarly, chloride interferes in the 0.1-1.0 mg l-1 range if the ratio is greater than 5 000:1. In the latter case, a maximum of 2 000 mg l-1 of chloride can be tolerated. Recoveries of known concentrations of bromide added to several samples, ranged from 97 to 110%. ?? 1983.

  20. Stathmin-specific siRNA expression plasmid inhibits the expression of stathmin%Stathmin特异性siRNA表达质粒抑制stathmin的表达

    Institute of Scientific and Technical Information of China (English)

    向秋; 王建红; 熊伟明; 田晶; 蒋伟; 肖胜军; 何晓松; 雷迅

    2012-01-01

    目的:构建微管解聚蛋白stathmin基因的特异性siRNA质粒表达栽体,以便研究stathmin在鼻咽癌中的生物学作用.方法:合成stathmin特异性DNA片段,退火形成的双链DNA片段克隆于质粒表达载体pGenesil-1.3;载体经扩增后,进行酶切和测序鉴定;采用QIAGEN公司脂质体(effectene transfection reagent)将鉴定后的重组质粒转入鼻咽癌CNE2细胞:RT-PCR与Western blot检测stathmin基因表达.结果:酶切和测序分析表明,插入siRNA质粒表达栽体中的DNA片段,其碱基序列和插入方向正确.表达分析证实特异性siRNA质粒表达载体能有效抑制鼻咽癌CNE2细胞中stathmin的表达.结论:构建的siRNA质粒表达栽体对stathmin的表达有很好的抑制作用.%Objective Construct microtubule depolymerizing protein stathmin specific siRNA expression plasmid vector and study the biological function of stathmin in nasopharyngeal carcinoma. Methods Synthesize stathmin specific DNA fragments and anneal them to form double-strand DNA fragment. Subclone the DNA fragment into plasmid expression vector pGenesil-1.3. After the vector was amplified , it was identified by enzyme digestion and sequencing.Then, the identified recombinant plasmid vector was transferred into nasopharyngeal carcinoma CNE2 cell line by effectene transfection reagent of QIAGEN Company. Expression of stathmin was analyzed by RT-PCR and western blot. Results Enzyme digestion and sequencing data showed that siRNA expression plasmid vectors had been inserted stathmin-specific DNA fragment with right direction. Expression analysis confirmed that stathmin specific siRNA expression plasmid vector could effectively inhibit stathmin expression in nasopharyngeal CNE2 cells. Conclusion Recombinant stathmin specific siRNA expression plasmid vector can silence stathmin.

  1. Transient neuromyopathy after bromide intoxication in a dog with idiopathic epilepsy

    Directory of Open Access Journals (Sweden)

    Steinmetz Sonja

    2012-12-01

    Full Text Available Abstract A seven-year old Australian Shepherd, suffering from idiopathic epilepsy under treatment with phenobarbitone and potassium bromide, was presented with generalised lower motor neuron signs. Electrophysiology and muscle-nerve biopsies revealed a neuromyopathy. The serum bromide concentration was increased more than two-fold above the upper reference value. Clinical signs disappeared after applying diuretics and reducing the potassium bromide dose rate. This is the first case report describing electrophysiological and histopathological findings associated with bromide induced lower motor neuron dysfunction in a dog.

  2. Bromoform formation in ozonated groundwater containing bromide and humic substances

    Energy Technology Data Exchange (ETDEWEB)

    Cooper, W.J.; Amy, G.L.; Moore, C.A.; Zika, R.G.

    1986-01-01

    The effect of bromide ion, organic carbon concentration (natural aquatic humic substances), pH, and solar irradiation on the formation of bromoform in ozonated groundwater has been studied. The studies were conducted on four unique samples of groundwater taken from different regions of the Biscayne Aquifer in southern Florida. All other conditions being equal, increases in bromide ion concentrations resulted in increases in CHBr/sub 3/ formation. In three of the four samples, CHBr/sub 3/ formation decreased as the pH level increased from 5 to 9. The fourth sample exhibited an opposite trend whereby the CHBr/sub 3/ concentration increased with increasing pH. Bromoform concentration increased with increased O/sub 3/ concentration over an ozone dosage range of 3.4 to 6.7 mg/L. Ozonated samples placed in sunlight immediately after ozone addition showed a decrease in the formation of CHBr/sub 3/ presumably due to the photodecomposition of HOBr/OBr.

  3. Bromoform formation in ozonated groundwater containing bromide and humic substances

    Energy Technology Data Exchange (ETDEWEB)

    Copper, W.J. (Florida International Univ., Miami (United States)); Amy, G.L. (Univ. of Arizona, Tucson (United States)); Moore, C.A.; Zika, R.G. (Univ. of Miami, FL (United States))

    The effect of bromide ion, organic carbon concentration (natural aquatic humic substances), pH, and solar irradiation on the formation of bromoform in ozonated groundwater has been studied. The studies were conducted on four unique samples of groundwater taken from different regions of the Biscayne Aquifer in southern Florida. All other conditions being equal, increases in bromide ion concentrations resulted in increases in CHBr{sub 3} formation. In three of the four samples, CHBr{sub 3} formation decreased as the pH level increased from 5 to 9. The fourth sample exhibited an opposite trend whereby the CHBr{sub 3} concentration increased with increasing pH. Bromoform concentration increased with increased O{sub 3} concentration over an ozone dosage range of 3.4 to 6.7 mg/L. Ozonated samples placed in sunlight immediately after ozone addition showed a decrease in the formation of CHBr{sub 3}, presumably due to the photodecomposition of HOBr/OBr.

  4. Synthesis and Characterization of Mercuric Bromide-Phenothiazine Complexes

    Directory of Open Access Journals (Sweden)

    Vidisha A. Alwani

    2014-12-01

    Full Text Available N-alkylphenothiazines (NAPTZs are biologically active heterocyclic compounds that find extensive applications in the field of medicine. In the pharmaceutical industry, they are used as psychotherapeutic, antiemetic, and antihistaminic drugs. In this study, complexation reactions of mercuric bromide with NAPTZs as principal ligands have been investigated in MeOH medium. Five mercuric bromide complexes of the NAPTZ ligands namely, chlorpromazine hydrochloride (CP.HCl, promethazine hydrochloride (PM.HCl, ethopropazine hydrochloride (EP.HCl, trifluoperazine dihydrochloride (TF.2HCl and thioridazine hydrochloride (TR.HCl have been synthesized. These complexes were subjected to elemental analysis, solubility, molar conductance and magnetic susceptibility, U.V-Vis, I.R, and NMR spectroscopy. The molecular formulations of the complexes have been found to be: [HgBr2(CP2].4H2O; [HgBr2(PM2].2H2O; [HgBr2(EP2]; [HgBr2(TF2].2H2O and [HgBr2(TR2]. Tentative molecular structures have been proposed and presented.

  5. Modeling water/lithium bromide absorption chillers in ASPEN Plus

    International Nuclear Information System (INIS)

    Highlights: → Single- and double-effect water/lithium bromide absorption chiller designs are numerically modeled using ASPEN. → The modeling procedure is described and the results are compared to published modeling data to access prediction accuracy. → Predictions for the single- and double-effect designs are within 3% and 5%, respectively of published data for all cycle parameters of interest. → The absorption cycle models presented allow investigation of using absorption chillers for waste heat utilization in the oil and gas industry. -- Abstract: Absorption chillers are a viable option for providing waste heat-powered cooling or refrigeration in oil and gas processing plants, thereby improving energy efficiency. In this paper, single- and double-effect water/lithium bromide absorption chiller designs are numerically modeled using ASPEN. The modeling procedure is described and the results are compared to published modeling data to access prediction accuracy. Predictions for the single- and double-effect designs are within 3% and 5%, respectively of published data for all cycle parameters of interest. The absorption cycle models presented not only allow investigation into the benefits of using absorption chillers for waste heat utilization in the oil and gas industry, but are also generically applicable to a wide range of other applications.

  6. Development of copper bromide laser master oscillator power amplifier system

    Indian Academy of Sciences (India)

    G N Tiwari; R K Mishra; R Khare; S V Nakhe

    2014-02-01

    Development of master oscillator power amplifier (MOPA) system of copper bromide laser (CBL) operating at 110 W average power is reported. The spectral distribution of power at green (510.6 nm) and yellow (578.2 nm) components in the output of a copper bromide laser is studied as a function of operating parameters. The electrical input power was varied from 2.6 to 4.3 kW, the pulse repetition frequency (PRF) was changed from 16 to 19 kHz, and the pressure of the buffer gas (neon) was kept fixed at 20 mbar. When the electrical input power was increased to 4.3 kW from 2.6 kW, the tube-wall temperature also increased to 488°C from 426°C but the ratio of the green to yellow power decreased to 1.53 from 3.73. The ratio of green to yellow power decreased to 1.53 from 1.63 when the PRF of the laser was increased to 19 kHz from 16 kHz. These observations are explained in terms of electron temperature, energy levels of transitions, and voltage and current waveforms across the laser head.

  7. Inhibition of the Myotoxicity Induced by Bothrops jararacussu Venom and Isolated Phospholipases A2 by Specific Camelid Single-Domain Antibody Fragments.

    Directory of Open Access Journals (Sweden)

    Nidiane D R Prado

    Full Text Available Antivenoms, produced using animal hyperimmune plasma, remains the standard therapy for snakebites. Although effective against systemic damages, conventional antivenoms have limited efficacy against local tissue damage. Additionally, the hypersensitivity reactions, often elicited by antivenoms, the high costs for animal maintenance, the difficulty of producing homogeneous lots, and the instability of biological products instigate the search for innovative products for antivenom therapy. In this study, camelid antibody fragments (VHH with specificity to Bothropstoxin I and II (BthTX-I and BthTX-II, two myotoxic phospholipases from Bothrops jararacussu venom, were selected from an immune VHH phage display library. After biopanning, 28 and 6 clones recognized BthTX-I and BthTX-II by ELISA, respectively. Complementarity determining regions (CDRs and immunoglobulin frameworks (FRs of 13 VHH-deduced amino acid sequences were identified, as well as the camelid hallmark amino acid substitutions in FR2. Three VHH clones (KF498607, KF498608, and KC329718 were capable of recognizing BthTX-I by Western blot and showed affinity constants in the nanomolar range against both toxins. VHHs inhibited the BthTX-II phospholipase A2 activity, and when tested for cross-reactivity, presented specificity to the Bothrops genus in ELISA. Furthermore, two clones (KC329718 and KF498607 neutralized the myotoxic effects induced by B. jararacussu venom, BthTX-I, BthTX-II, and by a myotoxin from Bothrops brazili venom (MTX-I in mice. Molecular docking revealed that VHH CDRs are expected to bind the C-terminal of both toxins, essential for myotoxic activity, and to epitopes in the BthTX-II enzymatic cleft. Identified VHHs could be a biotechnological tool to improve the treatment for snake envenomation, an important and neglected world public health problem.

  8. Inhibition of the Myotoxicity Induced by Bothrops jararacussu Venom and Isolated Phospholipases A2 by Specific Camelid Single-Domain Antibody Fragments

    Science.gov (United States)

    Prado, Nidiane D. R.; Pereira, Soraya S.; da Silva, Michele P.; Morais, Michelle S. S.; Kayano, Anderson M.; Moreira-Dill, Leandro S.; Luiz, Marcos B.; Zanchi, Fernando B.; Fuly, André L.; E. F. Huacca, Maribel; Fernandes, Cleberson F.; Calderon, Leonardo A.; Zuliani, Juliana P.; Soares, Andreimar M.; Stabeli, Rodrigo G.; F. C. Fernandes, Carla

    2016-01-01

    Antivenoms, produced using animal hyperimmune plasma, remains the standard therapy for snakebites. Although effective against systemic damages, conventional antivenoms have limited efficacy against local tissue damage. Additionally, the hypersensitivity reactions, often elicited by antivenoms, the high costs for animal maintenance, the difficulty of producing homogeneous lots, and the instability of biological products instigate the search for innovative products for antivenom therapy. In this study, camelid antibody fragments (VHH) with specificity to Bothropstoxin I and II (BthTX-I and BthTX-II), two myotoxic phospholipases from Bothrops jararacussu venom, were selected from an immune VHH phage display library. After biopanning, 28 and 6 clones recognized BthTX-I and BthTX-II by ELISA, respectively. Complementarity determining regions (CDRs) and immunoglobulin frameworks (FRs) of 13 VHH-deduced amino acid sequences were identified, as well as the camelid hallmark amino acid substitutions in FR2. Three VHH clones (KF498607, KF498608, and KC329718) were capable of recognizing BthTX-I by Western blot and showed affinity constants in the nanomolar range against both toxins. VHHs inhibited the BthTX-II phospholipase A2 activity, and when tested for cross-reactivity, presented specificity to the Bothrops genus in ELISA. Furthermore, two clones (KC329718 and KF498607) neutralized the myotoxic effects induced by B. jararacussu venom, BthTX-I, BthTX-II, and by a myotoxin from Bothrops brazili venom (MTX-I) in mice. Molecular docking revealed that VHH CDRs are expected to bind the C-terminal of both toxins, essential for myotoxic activity, and to epitopes in the BthTX-II enzymatic cleft. Identified VHHs could be a biotechnological tool to improve the treatment for snake envenomation, an important and neglected world public health problem. PMID:27028872

  9. Inhibition of the Myotoxicity Induced by Bothrops jararacussu Venom and Isolated Phospholipases A2 by Specific Camelid Single-Domain Antibody Fragments.

    Science.gov (United States)

    Prado, Nidiane D R; Pereira, Soraya S; da Silva, Michele P; Morais, Michelle S S; Kayano, Anderson M; Moreira-Dill, Leandro S; Luiz, Marcos B; Zanchi, Fernando B; Fuly, André L; Huacca, Maribel E F; Fernandes, Cleberson F; Calderon, Leonardo A; Zuliani, Juliana P; Pereira da Silva, Luiz H; Soares, Andreimar M; Stabeli, Rodrigo G; Fernandes, Carla F C

    2016-01-01

    Antivenoms, produced using animal hyperimmune plasma, remains the standard therapy for snakebites. Although effective against systemic damages, conventional antivenoms have limited efficacy against local tissue damage. Additionally, the hypersensitivity reactions, often elicited by antivenoms, the high costs for animal maintenance, the difficulty of producing homogeneous lots, and the instability of biological products instigate the search for innovative products for antivenom therapy. In this study, camelid antibody fragments (VHH) with specificity to Bothropstoxin I and II (BthTX-I and BthTX-II), two myotoxic phospholipases from Bothrops jararacussu venom, were selected from an immune VHH phage display library. After biopanning, 28 and 6 clones recognized BthTX-I and BthTX-II by ELISA, respectively. Complementarity determining regions (CDRs) and immunoglobulin frameworks (FRs) of 13 VHH-deduced amino acid sequences were identified, as well as the camelid hallmark amino acid substitutions in FR2. Three VHH clones (KF498607, KF498608, and KC329718) were capable of recognizing BthTX-I by Western blot and showed affinity constants in the nanomolar range against both toxins. VHHs inhibited the BthTX-II phospholipase A2 activity, and when tested for cross-reactivity, presented specificity to the Bothrops genus in ELISA. Furthermore, two clones (KC329718 and KF498607) neutralized the myotoxic effects induced by B. jararacussu venom, BthTX-I, BthTX-II, and by a myotoxin from Bothrops brazili venom (MTX-I) in mice. Molecular docking revealed that VHH CDRs are expected to bind the C-terminal of both toxins, essential for myotoxic activity, and to epitopes in the BthTX-II enzymatic cleft. Identified VHHs could be a biotechnological tool to improve the treatment for snake envenomation, an important and neglected world public health problem. PMID:27028872

  10. Suppression of Ubiquitin-Specific Peptidase 17 (USP17) Inhibits Tumorigenesis and Invasion in Non-Small Cell Lung Cancer Cells.

    Science.gov (United States)

    Zhang, Shengchao; Yuan, Jun; Zheng, Ruheng

    2016-01-01

    Recently, deubiquitinating enzymes (DUBs) are emerging as new regulators in cancer progression. However, understanding of the involvement of DUBs in non-small cell lung cancer (NSCLC) is just beginning. In this study, we investigated the expression and biological function of ubiquitin-specific peptidase 17 (USP17) in NSCLC progression in vitro and in vivo. We found that the expression of USP17 was higher than in a normal control. We further efficiently depleted USP17 expression in two different NSCLC cells, A549 and H1299. The anchorage-independent growth ability of these cells, estimated by soft agar colony formation assay, was significantly reduced after USP17 knockdown. Moreover, Matrigel-Transwell analysis showed that suppression of USP17 decreased cell migration and invasion capacity. Molecular mechanism studies found that USP17 silencing downregulated the expression of matrix metalloproteases (MMP3 and MMP9) in NSCLC cells. Furthermore, animal model results showed that USP17 suppression inhibited NSCLC tumorigenesis and growth. Altogether, this study illustrates the important functions of USP17 in NSCLC and suggests that USP17 might be an attractive target for NSCLC therapy. PMID:27656837

  11. Interstitial Perfusion Culture with Specific Soluble Factors Inhibits Type I Collagen Production from Human Osteoarthritic Chondrocytes in Clinical-Grade Collagen Sponges

    Science.gov (United States)

    Talò, Giuseppe; Lovati, Arianna B.; Pasdeloup, Marielle; Riboldi, Stefania A.; Moretti, Matteo; Mallein-Gerin, Frédéric

    2016-01-01

    Articular cartilage has poor healing ability and cartilage injuries often evolve to osteoarthritis. Cell-based strategies aiming to engineer cartilaginous tissue through the combination of biocompatible scaffolds and articular chondrocytes represent an alternative to standard surgical techniques. In this context, perfusion bioreactors have been introduced to enhance cellular access to oxygen and nutrients, hence overcoming the limitations of static culture and improving matrix deposition. Here, we combined an optimized cocktail of soluble factors, the BIT (BMP-2, Insulin, Thyroxin), and clinical-grade collagen sponges with a bidirectional perfusion bioreactor, namely the oscillating perfusion bioreactor (OPB), to engineer in vitro articular cartilage by human articular chondrocytes (HACs) obtained from osteoarthritic patients. After amplification, HACs were seeded and cultivated in collagen sponges either in static or dynamic conditions. Chondrocyte phenotype and the nature of the matrix synthesized by HACs were assessed using western blotting and immunohistochemistry analyses. Finally, the stability of the cartilaginous tissue produced by HACs was evaluated in vivo by subcutaneous implantation in nude mice. Our results showed that perfusion improved the distribution and quality of cartilaginous matrix deposited within the sponges, compared to static conditions. Specifically, dynamic culture in the OPB, in combination with the BIT cocktail, resulted in the homogeneous production of extracellular matrix rich in type II collagen. Remarkably, the production of type I collagen, a marker of fibrous tissues, was also inhibited, indicating that the association of the OPB with the BIT cocktail limits fibrocartilage formation, favoring the reconstruction of hyaline cartilage. PMID:27584727

  12. Vapour pressures, densities, and viscosities of the (water + lithium bromide + potassium acetate) system and (water + lithium bromide + sodium lactate) system

    Energy Technology Data Exchange (ETDEWEB)

    Lucas, Antonio de [Department of Chemical Engineering, University of Castilla - La Mancha, Avda. de Camilo Jose Cela s/n, 13004 Ciudad Real (Spain); Donate, Marina [Department of Chemical Engineering, University of Castilla - La Mancha, Avda. de Camilo Jose Cela s/n, 13004 Ciudad Real (Spain); Rodriguez, Juan F. [Department of Chemical Engineering, University of Castilla - La Mancha, Avda. de Camilo Jose Cela s/n, 13004 Ciudad Real (Spain)]. E-mail: juan.rromero@uclm.es

    2006-02-15

    Measurements of thermophysical properties (vapour pressure, density, and viscosity) of the (water + lithium bromide + potassium acetate) system LiBr:CH{sub 3}COOK = 2:1 by mass ratio and the (water + lithium bromide + sodium lactate) system LiBr:CH{sub 3}CH(OH)COONa = 2:1 by mass ratio were measured. The system, a possible new working fluid for absorption heat pump, consists of absorbent (LiBr + CH{sub 3}COOK) or (LiBr + CH{sub 3}CH(OH)COONa) and refrigerant H{sub 2}O. The vapour pressures were measured in the ranges of temperature and absorbent concentration from T = (293.15 to 333.15) K and from mass fraction 0.20 to 0.50, densities and viscosities were measured from T = (293.15 to 323.15) K and from mass fraction 0.20 to 0.40. The experimental data were correlated with an Antoine-type equation. Densities and viscosities were measured in the same range of temperature and absorbent concentration as that of the vapour pressure. Regression equations for densities and viscosities were obtained with a minimum mean square error criterion.

  13. An innovative experimental design reveals the spatial correlation between landuse, irrigation properties, and bromide leaching

    Science.gov (United States)

    Schwen, A.; Yang, Y.; Walton, J.; Wendroth, O.

    2012-04-01

    Understanding the relationship between leaching of pesticides and soil hydraulic properties under different land use conditions is critical to our understanding of the flow of water and solutes in soils and efforts to model these flow characteristics. One problem inherent in the measurement of solute leaching in field experiments is the considerable high natural spatial variability of flow-controlling soil properties. Thus, analyzing treatment effects based on the mean and the variance of observations can become obsolete if there is a huge inherent variance in the set of measurements. Moreover, no spatial range of influence can be derived from the observations. To overcome this limitation, the spatial covariance and cross-variance between measurements was used as decision and quality criteria in the present study. This study aims to demonstrate that focussing on the spatial covariance of observations and considering their spatial process can provide a measure of spatial representativity or scale-specific variance. We introduce a novel experimental scheme, where the treatments are arranged in a scale-dependent manner. In a field trial in Lexington, Kentucky, bromide leaching under two contrasting land use systems (no-till agricultural crops vs. pasture) was compared. After surface application of tracer solution (KBr), the experimental field was irrigated using different time-delays (1, 4 and 24 hours) as well as two different irrigation amounts and two different intensities. At the end, the KBr-concentration in the soil profile was determined using auger samplings. The data was correlated with the applied boundary conditions by spatial statistical methods such as semivariograms, cross-semivariograms and spectral analysis. Our results show distinct differences in the leaching behaviour between the two analyzed land uses with an deeper infiltration in the no-till agricultural field. This can be partly related to a higher initial soil water content in this treatment

  14. Voltage-independent inhibition of Cav2.2 channels is delimited to a specific region of the membrane potential in rat SCG neurons

    Institute of Scientific and Technical Information of China (English)

    Oscar Vivas; Isabel Arenas; David E.García

    2012-01-01

    Neurotransmitters and hormones regulate Cav2.2 channels through a voltage-independent pathway which is not well understood.It has been suggested that this voltageindependent inhibition is constant at all membrane voltages.However,changes in the percent of voltageindependent inhibition of Cav2.2 have not been tested within a physiological voltage range.Here,we used a double-pulse protocol to isolate the voltage-independent inhibition of Cav2.2 channels induced by noradrenaline in rat superior cervical ganglion neurons.To assess changes in the percent of the voltage-independent inhibition,the activation voltage of the channels was tested between -40 and +40 mV.We found that the percent of voltage-independent inhibition induced by noradrenaline changed with the activation voltage used.In addition,voltage-independent inhibition induced by oxo-M,a muscarinic agonist,exhibited thesame dependence on activation voltage,which supports that this pattern is not exclusive for adrenergic activation.Our results suggested that voltage-independent inhibition of Cav2.2 channels depends on the activation voltage of the channel in a physiological voltage range.This may have relevant implications in the understanding of the mechanism involved in voltage-independent inhibition.

  15. An investigation of inhibition effect of metronidazole before and after using advanced oxidation process (UV254/H2O2 on specific methanogenic activity of anaerobic biomass

    Directory of Open Access Journals (Sweden)

    S. A. Mirzaee

    2014-07-01

    Conclusion: Different concentrations of metronidazole had an inhibition effect on anaerobic digestions and therefore the efficient pretreatment method is needed to reduce this inhibition effect. The UV254/H2O2 process is an effective method for degradation and conversion of metronidazole to more biodegradable compounds for anaerobic bacteria consumption and, in turn, to increase biogasproduction in anaerobic digestions.

  16. Improving the ex vivo stability of drug ester compounds in rat and dog serum: inhibition of the specific esterases and implications on their identity.

    Science.gov (United States)

    Koitka, Matthias; Höchel, Joachim; Gieschen, Hille; Borchert, Hans-Hubert

    2010-02-01

    In drug development, it has been noticed that some drug compounds, especially esters, are unstable in serum samples ex vivo. This can lead to a substantial underestimation of the actual drug concentration. The rat and the dog, representing a rodent and non-rodent species, respectively, are widely used in preclinical studies. We studied the degradation of three structurally different drug esters in rat and dog serum. Moreover, the efficiency of selected enzyme inhibitors to prevent these degradations was investigated. Furthermore, we found indications of the identity of the drug-specific esterases by means of their inhibitor sensitivity as well as by protein purification and identification. The studied drugs were sagopilone, drospirenone, and methylprednisolone aceponate (MPA) all of which are used in (pre-)clinical drug development. The sagopilone-cleaving esterases in rat serum were inhibited by serine hydrolase inhibitors. We partly purified these esterases resulting in an activity yield of 5% and a purification factor of 472. Using matrix-assisted laser desorption ionization (MALDI)-time of flight (TOF)-mass spectrometry (MS), the rat carboxylesterase isoenzyme ES-1 was identified in these fractions, thus pointing to its involvement in sagopilone cleavage. Drospirenone cleavage in rat serum was effected by butyrylcholinesterase (BChE) and paraoxonase 1 (PON1) as we deduced from the high efficacy of certain serine hydrolase and metallohydrolase inhibitors, respectively. Likewise, some inhibition characteristics implied that MPA was cleaved in rat serum by BChE and serine proteases. Partial purification of the MPA-specific esterases resulted in activity yields of 1-2%, exhibiting up to 10,000-fold purification. In dog serum, we found that sagopilone was not degraded which was in contrast to MPA and drospirenone. MPA degradation was mainly prevented by serine hydrolase inhibitors. We used a three-step purification to isolate the esterases cleaving MPA. This

  17. Boron-doped diamond anodic oxidation of ethidium bromide: Process optimization by response surface methodology

    International Nuclear Information System (INIS)

    Highlights: ► Boron-doped diamond was used to degrade ethidium bromide. ► The process was optimized by a central composite rotatable design coupled with response surface methodology. ► Applied current is proved to be the most significant variable. ► A possible reaction sequence involving all the detected byproducts was proposed. - Abstract: The degradation of ethidium bromide (EtBr), a DNA intercalating pollutant, had been studied by anodic oxidation on boron-doped diamond (BDD) electrode under galvanostatic conditions. A central composite rotatable design coupled with response surface methodology was implemented to optimize the various operating parameters involved, among initial pH, flow rate, applied current and supporting electrolyte concentration, on the treatment efficiency; the latter was assessed in terms of color removal, COD removal, specific energy consumption and general current efficiency. Of the four parameters involved, applied current had a considerable effect on all the response factors. Optimum EtBr degradation was achieved by applying a current of 0.90 A, 9.0 mM Na2SO4, flow rate of 400 ml min−1 and pH 6.2 at 60 min of electrolysis, being reduced color by 80.2% and COD by 29.7%, with an energy consumption of 398.32 kW h (kg COD)−1 and a general current efficiency of 10.1%. Under these optimized conditions, EtBr decays followed pseudo first-order kinetics. Moreover, HPLC analysis of the BDD-treated solution allowed the detection of a number of reaction intermediates, and a possible reaction sequence involving all the detected byproducts was proposed for the electrochemical oxidation of EtBr on BDD anode.

  18. 76 FR 7200 - Methyl Bromide; Notice of Receipt of Requests To Voluntarily Amend Registrations To Terminate...

    Science.gov (United States)

    2011-02-09

    ... Professional Products to voluntarily amend methyl bromide product registration 8536-12 to terminate or delete... identity or contact information unless you provide it in the body of your comment. If you send an e- mail... Cardinal Professional Products, and Trical, Inc.) to delete certain uses of methyl bromide...

  19. SYNTHESIS AND CATALYTIC PROPERTIES OF HYDROPHOBICALLY MODIFIED POLY(ALKYLMETHYLDIALLYLAMMONIUM BROMIDES)

    NARCIS (Netherlands)

    YANG, YJ; ENGBERTS, JBFN

    1991-01-01

    A series of hydrophobically modified homo- and copolymers of the poly(alkylmethyldiallylammonium bromide) type has been prepared by free-radical cyclo(co)polymerization of alkylmethyldiallylammonium bromide monomers in aqueous solution. Depending on the length of the alkyl side chain (varied between

  20. Destruction of methyl bromide sorbed to activated carbon by thiosulfate and electrolysis

    Science.gov (United States)

    Methyl bromide is widely used as a fumigant for post-harvest and quarantine uses at port facilities due to the low treatment times required, but it is vented to the atmosphere after its use. Due to the potential contributions of methyl bromide to stratospheric ozone depletion, technologies for the c...

  1. Determination of micro-amount bromide in uranium trioxide by spectrophotometric method

    International Nuclear Information System (INIS)

    The content of bromide in the production of uranium trioxide is one of the most important control factors, so determining it accurately seems important. When uranium trioxide is dissolved in nitric acid, in the presence of AgNO3 solution, micro-amount bromide can be co- precipitated with AgCl. Bromide can be separated by centrifugation from a large amount of UO22+ and other anions. In the existing of KOH and H2O2, AgCl can be changed into free bromide. By adding ammonium molybdate as catalyst, bromide and excessive KBrO3 can react and produce Br2. In the medium of tert-butanol-ethanol, Br2 can react with basic fuchsine and produce a purple compound which is stable, the bromide content is determined by spectrophotometric method. The results show that it is a highly sensitive method with low detection limit. Its apparent molar absorption coefficient κ' is 1.7 x 104 L/(mol·cm). Its detection limit is 9 μg/L and determination limit is 0.13 mg/L. The linear relationship is in the range of 0.2-1.6 mg/L with a correlation coefficient of 0.997. The relative standard deviation is less than 10% after it is determed six times at the same time. For bromide content of 4.00 and 8.00 μg, the bromide recovery obtained are between 94% and 103%. (authors)

  2. Solvent effects in the reaction between piperazine and benzyl bromide

    Indian Academy of Sciences (India)

    S Ranga Reddy; P Manikyamba

    2007-11-01

    The reaction between piperazine and benzyl bromide was studied conductometrically and the second order rate constants were computed. These rate constants determined in 12 different protic and aprotic solvents indicate that the rate of the reaction is influenced by electrophilicity (), hydrogen bond donor ability () and dipolarity/polarizability (*) of the solvent. The LSER derived from the statistical analysis indicates that the transition state is more solvated than the reactants due to hydrogen bond donation and polarizability of the solvent while the reactant is more solvated than the transition state due to electrophilicity of the solvent. Study of the reaction in methanol, dimethyl formamide mixtures suggests that the rate is maximum when dipolar interactions between the two solvents are maximum.

  3. Mechanism of the Deaquation of Aquopentaaminocobalt(Ⅲ) Bromide

    Institute of Scientific and Technical Information of China (English)

    MA,Li-Dun(马礼敦); CHENG,Guang-Hui(程广辉); WU,Hong-Xiang(吴宏翔); LIN,Han-Yi(林涵毅); SHEN,Xiao-Liang(沈孝良); SHI,Guo-Shun(施国顺)

    2002-01-01

    There are two theories, SN1 and SN2, for the mechanism of the deaquation of aquopentaamincobalt(Ⅲ) bromide (AAC-B).Both of the theories are supported by some experimental and calculated data. But there are not any experiments to determine directly the structure of the intermediates at different reaction time. In this paper the structures of the intermediates at different reaction time in deaquation-anation of AACB were de-termined by extended X-ray absorption fine structure (EXAFS)and the reaction process wes studied by the combination of Xray powder diffraction and EXAFS. It was demonstrated that the deaquation-anation of AACB obeys the SN2 theory.

  4. Design and Fabrication of Externally heated Copper Bromide Laser

    Directory of Open Access Journals (Sweden)

    J.P. Dudeja

    1993-04-01

    Full Text Available An externally-heated, longitudinally-discharged, low-repetition-rate copper bromide laser, was designed and fabricated. The green-coloured wavelength at 5106 A from this laser can be used for underwater ranging and detection of submerged objects. Several new changes in the design of discharge tube, heating technique, buffer-gas-flow sub-system and electrical circuit have been conceived and incorporated advantageously in our system. Various parameters, for example, the type of buffer gas and its flow rate, mixture of gases, temperature of the discharge tube, delay between dissociation and excitation pulses, dissociation and excitation energies, and various resonator configurations are being optimised to get the maximum output power/energy from the laser system.

  5. Xanthine Biosensor Based on Didodecyldimethylammonium Bromide Modified Pyrolytic Graphite Electrode

    Institute of Scientific and Technical Information of China (English)

    TANG,Ji-Lin(唐纪琳); HAN,Xiao-Jun(韩晓军); HUANG,Wei-Min(黄卫民); WANG,Er-Kang(汪尔康)

    2002-01-01

    The vesicle of didodecyldimethylammonium bromide (DDAB)which contained tetrathiafulvalene (TTF) was mixed with xanthine oxidase, and the mixture was cast on the pyrolytic graphite electrode. The lipid films were used to supply a biological environment resembling biomembrane on the surface of the electrode. TTF was used as a mediator because of its high electron-transfer efficiency. A novel xanthine biosensor based on cast DDAB film was developed. The effects of pH and operating potential were explored for optimum analytical performance by using the amperometric method. The response time of the biosensor was less than 10 s. The detection limit of the biosensor was 3.2 × 10-7 mol/L and the liner range was from 4 × 10-7 mol/L to 2.4 × 10-6 mol/L.

  6. Irradiation as an alternative to methyl bromide: the Australian situation

    International Nuclear Information System (INIS)

    International agreement to phase out the fumigant Methyl bromide (MeBr) will have serious implications for pest and disease control in Australia, particularly grain pest control, quarantine usage on fresh horticultural produce and control of soil pathogens or nematodes. Irradiation is a practical alternative but is not currently approved for use in Australia. Other options are available but none of the viable methods except irradiation have the short application time needed for treatment of grams found to be infested during loading at export. This usage is vital, as Australian grain is exported at very high standards of freedom from insects, assured by Government regulatory requirements. Irradiation is contrasted against other alternatives including heat and cold, especially for fresh horticultural produce. (author)

  7. Mechanism of the Deaquation of Aquopentaaminocobalt(Ⅲ)Bromide

    Institute of Scientific and Technical Information of China (English)

    MA,Li-Dun; CHENG,Guang-Hui; 等

    2002-01-01

    There are two theories,SN1 and SN2, for the mechanism of the deaquation of aquopentaamincobalt(Ⅲ) bromide(AAC-B). Both of the theories are supported by some experimental and calculated data. But there are not any experiments to determine directly the structure of the intermediates at dififferent reaction time.In this paper the structures of the intermediates at different reaction time in deaquation-anation of AACB were determined by extended X-ray absorption fine structure (EXAFS) and the reaction process was studied by the combination of X-ray powder diffraction and EXAFS.It was demonstrated that the deaquation-anation of AACB obeys the SN2 theory.

  8. Thimet oligopeptidase specificity: evidence of preferential cleavage near the C-terminus and product inhibition from kinetic analysis of peptide hydrolysis.

    Science.gov (United States)

    Knight, C G; Dando, P M; Barrett, A J

    1995-01-01

    The substrate-size specificity of human thimet oligopeptidase (EC 3.4.24.15) was investigated with oligomers of glycyl-prolyl-leucine (GPL)n where n = 2, 3, 4 and 5. These peptides were cleaved only at Leu-Gly bonds to give GPL as the single final product. Hydrolysis was most rapid with (GPL)3 and slowest with (GPL)5. The more water-soluble oligomers of Gly-Hyp-Leu showed the same trend. (Gly-Hyp-Leu)6 was not hydrolysed, consistent with the previous finding that substrates larger than 17 amino acids are not cleaved by thimet oligopeptidase. The cleavage of (GPL)3 to GPL fitted a sequential first-order model. First-order kinetics were unexpected as the initial substrate concentration was greater than Km. The anomaly was also seen during the cleavage of bradykinin and neurotensin, and in these cases first-order behaviour was due to potent competitive inhibition by the C-terminal product. The sequential mechanism for (GPL)3 breakdown by thimet oligopeptidase does not discriminate between initial cleavages towards the N- or C-terminus. As isoleucine is an unfavourable residue in P1, substrates were made in which selected leucine residues were replaced by isoleucine. GPL--GPI--GPL (where--represents the bond between the tripeptide units) was resistant to hydrolysis and GPI--GPL--GPL was cleaved only at the -Leu-Gly- bond. Experiments with isoleucine-containing analogues of (Gly-Hyp-Leu)4 showed that thimet oligopeptidase preferred to cleave these peptides near the C-terminus. PMID:7755557

  9. Effect of pinaverium bromide on stress-induced colonic smooth muscle contractility disorder in rats

    Institute of Scientific and Technical Information of China (English)

    Yun Dai; Jian-Xiang Liu; Jun-Xia Li; Yun-Feng Xu

    2003-01-01

    AIM: To investigate the effect of pinaverium bromide, a Ltype calcium channel blocker with selectivity for the gastrointestinal tract on contractile activity of colonic circular smooth muscle in normal or cold-restraint stressed rats and its possible mechanism.METHODS: Cold-restraint stress was conducted on rats to increase fecal pellets output. Each isolated colonic circular muscle strip was suspended in a tissue chamber containing warm oxygenated Tyrode-Ringer solution. The contractile response to ACh or KCl was measured isometrically on inkwriting recorder. Incubated muscle in different concentrations of pinaverium and the effects of pinaverium were investigated on ACh or KCl-induced contraction. Colon smooth muscle cells were cultured from rats and [Ca2+]i was measured in cell suspension using the Ca2+ fluorescent dye fura-2/AlMl.RESULTS: During stress, rats fecal pellet output increased 61% (P<0.01). Stimulated with ACh or KCl, the muscle contractility was higher in stress than that in control. Pinaverium inhibited the increment of [Ca2+]i and the muscle contraction in response to ACh or KCl in a dose dependent manner. A significant inhibition of pinaverium to ACh or KCl induced [Ca2+]i increment was observed at 10-6 mol/L. The IC50 values for inhibition of ACh induced contraction for the stress and control group were 1.66×10-6 mol/L and 0.91×10-6mol/L, respectively. The ICs0 values for inhibition of KCl induced contraction for the stress and control group were 8.13×10-7 mol/L and 3.80×10-7 mol/L, respectively.CONCLUSION: Increase in [Ca2+]i of smooth muscle cells is directly related to the generation of contraction force in colon. L-type Ca2+ channels represent the main route of Ca2+ entry.Pinaverium inhibits the calcium influx through L-type channels;decreases the contractile response to many kinds of agonists and regulates the stress-induced colon hypermotility.

  10. Preservatives and neutralizing substances in milk: analytical sensitivity of official specific and nonspecific tests, microbial inhibition effect, and residue persistence in milk

    OpenAIRE

    Livia Cavaletti Corrêa da Silva; Ronaldo Tamanini; Juliana Ramos Pereira; Edson Antônio Rios; José Carlos Ribeiro Junior; Vanerli Beloti

    2015-01-01

    Milk fraud has been a recurring problem in Brazil; thus, it is important to know the effect of most frequently used preservatives and neutralizing substances as well as the detection capability of official tests. The objective of this study was to evaluate the analytical sensitivity of legislation-described tests and nonspecific microbial inhibition tests, and to investigate the effect of such substances on microbial growth inhibition and the persistence of detectable residues after 24/48h of...

  11. The effect of ethidium bromide and chloramphenicol on mitochondrial biogenesis in primary human fibroblasts

    Energy Technology Data Exchange (ETDEWEB)

    Kao, Li-Pin; Ovchinnikov, Dmitry; Wolvetang, Ernst, E-mail: e.wolvetang@uq.edu.au

    2012-05-15

    The expression of mitochondrial components is controlled by an intricate interplay between nuclear transcription factors and retrograde signaling from mitochondria. The role of mitochondrial DNA (mtDNA) and mtDNA-encoded proteins in mitochondrial biogenesis is, however, poorly understood and thus far has mainly been studied in transformed cell lines. We treated primary human fibroblasts with ethidium bromide (EtBr) or chloramphenicol for six weeks to inhibit mtDNA replication or mitochondrial protein synthesis, respectively, and investigated how the cells recovered from these insults two weeks after removal of the drugs. Although cellular growth and mitochondrial gene expression were severely impaired after both inhibitor treatments we observed marked differences in mitochondrial structure, membrane potential, glycolysis, gene expression, and redox status between fibroblasts treated with EtBr and chloramphenicol. Following removal of the drugs we further detected clear differences in expression of both mtDNA-encoded genes and nuclear transcription factors that control mitochondrial biogenesis, suggesting that the cells possess different compensatory mechanisms to recover from drug-induced mitochondrial dysfunction. Our data reveal new aspects of the interplay between mitochondrial retrograde signaling and the expression of nuclear regulators of mitochondrial biogenesis, a process with direct relevance to mitochondrial diseases and chloramphenicol toxicity in humans. -- Highlights: ► Cells respond to certain environmental toxins by increasing mitochondrial biogenesis. ► We investigated the effect of Chloramphenicol and EtBr in primary human fibroblasts. ► Inhibiting mitochondrial protein synthesis or DNA replication elicit different effects. ► We provide novel insights into the cellular responses toxins and antibiotics.

  12. Initial test results from the RedFlow 5 kW, 10 kWh zinc-bromide module, phase 1.

    Energy Technology Data Exchange (ETDEWEB)

    Ferreira, Summer Rhodes; Rose, David Martin

    2012-02-01

    In this paper the performance results of the RedFlow zinc-bromide module (ZBM) Gen 2.0 are reported for Phase 1 of testing, which includes initial characterization of the module. This included physical measurement, efficiency as a function of charge and discharge rates, efficiency as a function of maximum charge capacity, duration of maximum power supplied, and limited cycling with skipped strip cycles. The goal of this first phase of testing was to verify manufacturer specifications of the zinc-bromide flow battery. Initial characterization tests have shown that the ZBM meets the manufacturer's specifications. Further testing, including testing as a function of temperature and life cycle testing, will be carried out during Phase 2 of the testing, and these results will be issued in the final report, after Phase 2 testing has concluded.

  13. Novel action of apolipoprotein E (ApoE: ApoE isoform specifically inhibits lipid-particle-mediated cholesterol release from neurons

    Directory of Open Access Journals (Sweden)

    Fujita Shinobu C

    2007-05-01

    Full Text Available Abstract Background Since the majority of apolipoprotein E (apoE existing in the cerebrospinal fluid is associated with high-density lipoprotein (HDL, one should focus on the role of the apoE-HDL complex rather than on that of free apoE in cholesterol metabolism in the central nervous system. However, the apoE-isoform-specific effect of apoE-HDL on cholesterol transport remains unclarified. Results Here we show that apoE3-HDL induced a marked cholesterol release from neurons, while apoE4-HDL induced little. To elucidate the mechanism underlying this phenomenon, we used a complex of lipid emulsion (EM with recombinant apoE3 or apoE4 (apoE-EM at various apoE concentrations. When a small number of apoE molecules were associated with EM, apoE3- and apoE4-EM, induced a marked cholesterol release to a level similar to that induced by EM alone. However, when apoE at given concentrations was incubated with EM, apoE3-EM induced a marked cholesterol release, while apoE4-EM induced little. Under these conditions, a greater number of apoE4 molecules were associated with EM than apoE3 molecules. When an increasing number of apoE molecules were associated with EM, both apoE3-EM and apoE4-EM induced little cholesterol release. Preincubation with β-mercaptoethanol increased the number of apoE3 molecules associated with EM similar to that of apoE4 molecules, indicating that the presence (apoE3 or absence (apoE4 of intermolecular disulfide bond formation is responsible for the association of a greater number of apoE4 molecules to EM than apoE3 molecules. Conclusion These results suggest that although apoE and a lipid particle are lipid acceptors, when apoE and a lipid particle form a complex, apoE on the particle surface inhibits the lipid particle-mediated cholesterol release from cells in an apoE-concentration-dependent manner.

  14. Corrosion inhibition performance of a ionic liquid surfactant Br

    OpenAIRE

    Jing LIU; Dishun ZHAO; LIU, RAN; Wang, Ming; Peibing REN

    2016-01-01

    In order to study the novel green organic mercury-substituting inhibitors, the ionic liquid surfactant 1-methyl-3-dodecyl imidazole bromide ( Br) is synthesized with N-methyl imidazole and 1-bromodecane as raw materials. The corrosion inhibition of Br for zinc in zinc-manganese batteries is investigated using electrochemical methods and weight loss methods. The results show that corrosion inhibition efficiency increases with the increase of the concentration of Br, and when the concentration ...

  15. Bromine and bromide content in soils: Analytical approach from total reflection X-ray fluorescence spectrometry.

    Science.gov (United States)

    Gallardo, Helena; Queralt, Ignasi; Tapias, Josefina; Candela, Lucila; Margui, Eva

    2016-08-01

    Monitoring total bromine and bromide concentrations in soils is significant in many environmental studies. Thus fast analytical methodologies that entail simple sample preparation and low-cost analyses are desired. In the present work, the possibilities and drawbacks of low-power total reflection X-ray fluorescence spectrometry (TXRF) for the determination of total bromine and bromide contents in soils were evaluated. The direct analysis of a solid suspension using 20 mg of fine ground soil (soils (Br content range in soils = 5-40 mg kg(-1)). Information about bromide determination in soils is also possible by analyzing the Br content in water soil extracts. In this case, the TXRF analysis can be directly performed by depositing 10 μL of the internal standardized soil extract sample on a quartz glass reflector in a measuring time of 1500 s. The bromide limit of detection by this approach was 10 μg L(-1). Good agreement was obtained between the TXRF results for the total bromine and bromide determinations in soils and those obtained by other popular analytical techniques, e.g. energy dispersive X-ray fluorescence spectrometry (total bromine) and ionic chromatography (bromide). As a study case, the TXRF method was applied to study bromine accumulation in two agricultural soils fumigated with a methyl bromide pesticide and irrigated with regenerated waste water. PMID:27179429

  16. FTIR Metabolomic Fingerprint Reveals Different Modes of Action Exerted by Structural Variants of N-Alkyltropinium Bromide Surfactants on Escherichia coli and Listeria innocua Cells

    Science.gov (United States)

    Corte, Laura; Tiecco, Matteo; Roscini, Luca; De Vincenzi, Sergio; Colabella, Claudia; Germani, Raimondo; Tascini, Carlo; Cardinali, Gianluigi

    2015-01-01

    Surfactants are extremely important agents to clean and sanitize various environments. Their biocidal activity is a key factor determined by the interactions between amphiphile structure and the target microbial cells. The object of this study was to analyze the interactions between four structural variants of N-alkyltropinium bromide surfactants with the Gram negative Escherichia coli and the Gram positive Listeria innocua bacteria. Microbiological and conductometric methods with a previously described FTIR bioassay were used to assess the metabolomic damage exerted by these compounds. All surfactants tested showed more biocidal activity in L. innocua than in E. coli. N-tetradecyltropinium bromide was the most effective compound against both species, while all the other variants had a reduced efficacy as biocides, mainly against E. coli cells. In general, the most prominent metabolomic response was observed for the constituents of the cell envelope in the fatty acids (W1) and amides (W2) regions and at the wavenumbers referred to peptidoglycan (W2 and W3 regions). This response was particularly strong and negative in L. innocua, when cells were challenged by N-tetradecyltropinium bromide, and by the variant with a smaller head and a 12C tail (N-dodecylquinuclidinium bromide). Tail length was critical for microbial inhibition especially when acting against E. coli, maybe due the complex nature of Gram negative cell envelope. Statistical analysis allowed us to correlate the induced mortality with the metabolomic cell response, highlighting two different modes of action. In general, gaining insights in the interactions between fine structural properties of surfactants and the microbial diversity can allow tailoring these compounds for the various operative conditions. PMID:25588017

  17. Absorber performance of a water/lithium-bromide absorption chiller

    Energy Technology Data Exchange (ETDEWEB)

    Xie Guozhen [Beijing University of Civil Engineering and Architecture, Beijing 100044 (China)], E-mail: xieguozhen@bucea.edu.cn; Sheng Guogang [Beijing University of Civil Engineering and Architecture, Beijing 100044 (China); Bansal, Pradeep Kumar [Department of Mechanical Engineering, The University of Auckland, Private Bag 92019 (New Zealand); Li, Guang [Beijing University of Civil Engineering and Architecture, Beijing 100044 (China)

    2008-09-15

    An absorber is one of the most important components of a lithium-bromide absorption chiller (LBAC) as its absorbing characteristics directly influence the performance of the whole chiller. It has been indicated that the absorbing efficiency and cooling capacity could be improved by increasing the solution concentration. In this paper, based on the mechanism of falling film absorption on horizontal tubes, the theoretical models of falling film absorption on horizontal tubes have been established. A series of programs used for computing the theoretical mathematical models, including simulation of LBAC cycle and falling film absorption, have been programmed. The models have been validated reasonably by the experimental data. The results show that the cooling capacity of the LBAC varies in parabola shape of curve with the solution concentration from 52.5% to 58.5%, and that the best coefficient of performance (COP) occurs at concentration of 57%. The investigation proposes the absorbing process of sub-steady thermodynamic equilibrium for the duality solution under increase absorbing pressure.

  18. Absorber performance of a water/lithium-bromide absorption chiller

    Energy Technology Data Exchange (ETDEWEB)

    Xie, Guozhen; Sheng, Guogang; Li, Guang [Beijing University of Civil Engineering and Architecture, Beijing 100044 (China); Bansal, Pradeep Kumar [Department of Mechanical Engineering, The University of Auckland, Private Bag 92019 (New Zealand)

    2008-09-15

    An absorber is one of the most important components of a lithium-bromide absorption chiller (LBAC) as its absorbing characteristics directly influence the performance of the whole chiller. It has been indicated that the absorbing efficiency and cooling capacity could be improved by increasing the solution concentration. In this paper, based on the mechanism of falling film absorption on horizontal tubes, the theoretical models of falling film absorption on horizontal tubes have been established. A series of programs used for computing the theoretical mathematical models, including simulation of LBAC cycle and falling film absorption, have been programmed. The models have been validated reasonably by the experimental data. The results show that the cooling capacity of the LBAC varies in parabola shape of curve with the solution concentration from 52.5% to 58.5%, and that the best coefficient of performance (COP) occurs at concentration of 57%. The investigation proposes the absorbing process of sub-steady thermodynamic equilibrium for the duality solution under increase absorbing pressure. (author)

  19. Water-lithium bromide double-effect absorption cooling analysis

    Energy Technology Data Exchange (ETDEWEB)

    Vliet, G.C.; Lawson, M.B.; Lithgow, R.A.

    1980-12-01

    A numerical model was developed for the transient simulation of the double-effect, water-lithium bromide absorption cooling machine, and the use of the model to determine the effect of the various design and input variables on the absorption unit performance. The performance parameters considered were coefficient of performance and cooling capacity. The sensitivity analysis was performed by selecting a nominal condition and determining performance sensitivity for each variable with others held constant. The variables considered in the study include source hot water, cooling water, and chilled water temperatures; source hot water, cooling water, and chilled water flow rates; solution circulation rate; heat exchanger areas; pressure drop between evaporator and absorber; solution pump characteristics; and refrigerant flow control methods. The performance sensitivity study indicated in particular that the distribution of heat exchanger area among the various (seven) heat exchange components is a very-important design consideration. Moreover, it indicated that the method of flow control of the first effect refrigerant vapor through the second effect is a critical design feature when absorption units operate over a significant range of cooling capacity. The model was used to predict the performance of the Trane absorption unit with fairly good accuracy.

  20. Chloride, bromide and iodide scintillators with europium doping

    Science.gov (United States)

    Zhuravleva, Mariya; Yang, Kan

    2014-08-26

    A halide scintillator material is disclosed where the halide may comprise chloride, bromide or iodide. The material is single-crystalline and has a composition of the general formula ABX.sub.3 where A is an alkali, B is an alkali earth and X is a halide which general composition was investigated. In particular, crystals of the formula ACa.sub.1-yEu.sub.yI.sub.3 where A=K, Rb and Cs were formed as well as crystals of the formula CsA.sub.1-yEu.sub.yX.sub.3 (where A=Ca, Sr, Ba, or a combination thereof and X=Cl, Br or I or a combination thereof) with divalent Europium doping where 0.ltoreq.y.ltoreq.1, and more particularly Eu doping has been studied at one to ten mol %. The disclosed scintillator materials are suitable for making scintillation detectors used in applications such as medical imaging and homeland security.

  1. Organomontmorillonites Modified with 2-Methacryloyloxy Ethyl Alkyl Dimethyl Ammonium Bromide

    Institute of Scientific and Technical Information of China (English)

    WANG Jian-quan; WU Wen-hui

    2007-01-01

    Organomontmorillonites (organo-MMT) were synthesized by means of montmorillonites (MMT) modified with a series of 2-methacryloyloxy ethyl alkyl dimethyl ammonium bromide (MAAB) having different alkyl chain lengths as cationic surfactants through a cationic exchanging reaction, and were characterized by FTIR, TG, elemental analysis, and XRD. The microenvironment of the organic interlayer such as the orientation and arrangement of the alkyl chains of MAAB, as well as the properties of nanocomposite hydrogels, were also investigated. The amount of organic components absorbed on interlayer and the basal spacing of organo-MMT both increase with the increasing of alkyl length of MAAB. When carbon number of alkyl chain is in the region of 8 to 14, the alkyl chains between layers would adopt a disordered gauche conformation; while the carbon number is 16, an ordered all-trans conformation with a vertical orientation would be found together with the disordered gauche conformation according to the results of XRD and FTIR. Due to the difference of microenvironment of organic interlayer, the Young's moduli of the nanocomposite hydrogels increased as the alkyl chains of MAAB became longer.

  2. Accommodation coefficient of HOBr on deliquescent sodium bromide aerosol particles

    Directory of Open Access Journals (Sweden)

    M. Wachsmuth

    2002-01-01

    Full Text Available Uptake of HOBr on sea salt aerosol, sea salt brine or ice is believed to be a key process providing a source of photolabile bromine (Br2 and sustaining ozone depletion cycles in the Arctic troposphere. In the present study, uptake of HOBr on sodium bromide (NaBr aerosol particles was investigated at an extremely low HOBr concentration of 300 cm-3 using the short-lived radioactive isotopes 83-86Br. Under these conditions, at maximum one HOBr molecule was taken up per particle. The rate of uptake was clearly limited by the mass accommodation coefficient, which was calculated to be 0.6 ± 0.2. This value is a factor of 10 larger than estimates used in earlier models. The atmospheric implications are discussed using the box model "MOCCA'', showing that the increase of the accommodation coefficient of HOBr by a factor of 10 only slightly affects net ozone loss, but significantly increases chlorine release.

  3. Evaluation of Alkali Bromide Salts for Potential Pyrochemical Applications

    Energy Technology Data Exchange (ETDEWEB)

    Prabhat K. Tripathy; Steven D. Herrmann; Guy L. Fredrickson; Tedd E. Lister; Toni Y. Gutknecht

    2013-10-01

    Transient techniques were employed to study the electrochemical behavior, reduction mechanism and transport properties of REBr3 (RE - La, Nd and Gd) in pure LiBr, LiBr-KBr (eutectic) and LiBr-KBr-CsBr (eutectic) melts. Gd(III) showed a reversible single step soluble-insoluble exchange phenomenon in LiBr melt at 973K. Although La (III), Nd(III) and Gd(III) ions showed reversible behavior in eutectic LiBr-KBr melts, these ions showed a combination of temperature dependent reversible and pseudo-reversible behavior. While both La(III) and Gd(III) showed one step reduction, the reduction of Nd(III) was observed to be a two step process. La metal could be electrodeposited from the ternary electrolyte at a temperature of 673K. Various electrochemical measurements suggest that both binary and ternary bromide melts can potentially be used to electrodeposit high purity RE metals at comparatively lower operating temperatures.

  4. A comparison of the effect of intranasal desmopressin and intramuscular hyoscine N-butyl bromide combination with intramuscular hyoscine N-butyl bromide alone in acute renal colic

    Directory of Open Access Journals (Sweden)

    Abdol-Reza Kheirollahi

    2010-01-01

    Full Text Available Background: Patients with acute renal colic usually require immediate diagnosis and treatment. In this clinical trial analgesic effect of hyoscine N-butyl bromide and desmopressin combination in comparison with hyoscine N-butyl bromide alone in patients with acute renal colic induced by urinary stones was assessed. Methods: The study included 114 patients randomly allocated in two groups (A and B. Patients in group A received 20 mg intramuscular hyoscine N-butyl bromide at admission time and patients in group B received 20 μg of intranasal desmopressin in combination with 20 mg intramuscular hyoscine N-butyl bromide. A visual analogue scale (VAS; a 10-cm horizontal scale ranging from "zero or no pain" to "10 or unbearable pain" was hired to assess the patients′ pain severity at baseline, 30 and 60 minutes after the treatments. Results: On admission, the pain level was similar in both groups (group A: 8.95 ± 0.11 and group B: 8.95 ± 0.12. In group A, the mean of pain level showed a decrease after 30 minutes (group A: 7.26 ± 0.25 and group B: 5.95 ± 0.28 but further decreasing did not occur; however in group B, the pain consistently decreased and the mean after 60 minutes was significantly decreased (group A: 6.80 ± 0.31 and group B: 3.71 ± 0.31. No side effects were detected in this study. Conclusions: The combination of hyoscine N-butyl bromide and desmopressin is more effective than hyoscine N-butyl bromide alone in patients with renal colic. Further studies are recommended to validate these findings and compare the different doses of desmopressin.

  5. Plasmid DNA induces dodecyl triethyl ammonium bromide to aggregate into vesicle

    Institute of Scientific and Technical Information of China (English)

    Xiang Mei Ran; Xia Guo; Jia Tong Ding

    2012-01-01

    Single-chained cationic surfactant dodecyl triethyl ammonium bromide and plasmid DNA together can form vesicles once the concentration of plasmid DNA reaches a critical value (Ccvc).Bigger the size of plasmid DNA,higher the value of Ccvc.

  6. The non-specific inhibition of enzymes by environmental pollutants: a study of a model system towards the development of electrochemical biosensor arrays.

    Science.gov (United States)

    Young, S J; Hart, J P; Dowman, A A; Cowell, D C

    2001-12-01

    Previous research has shown that lactate dehydrogenase (LDH) was competitively inhibited by pentachlorophenol (PCP) and a modified assay produced a detection limit of 1 microM (270 microg l(-1)). This work used spectrophotometric rate-determination but in order to move towards biosensor development the selected detection method was electrochemical. The linkage of LDH to lactate oxidase (LOD) provided the electroactive species, hydrogen peroxide. This could be monitored using a screen-printed carbon electrode (SPCE) incorporating the mediator, cobalt phthalocyanine, at a potential of +300 mV (vs. Ag/AgCl). A linked LDH/LOD system was optimised with respect to inhibition by PCP. It was found that the SPCE support material, PVC, acted to reduce inhibition, possibly by combining with PCP. A cellulose acetate membrane removed this effect. Inhibition of the system was greatest at enzyme activities of 5 U ml(-1) LDH and 0.8 U ml(-1) LOD in reactions containing 246 microM pyruvate and 7.5 microM NADPH. PCP detection limits were an EC(10) of 800 nM (213 microg l(-1)) and a minimum inhibition detectable (MID) limit of 650 nM (173 microg l(-1)). The inclusion of a third enzyme, glucose dehydrogenase (GDH), provided cofactor recycling to enable low concentrations of NADPH to be incorporated within the assay. NADPH was reduced from 7.5 to 2 microM. PCP detection limits were obtained for an assay containing 5 U ml(-1) LDH, 0.8 U ml(-1) LOD and 0.1 U ml(-1) GDH with 246 microM pyruvate, 400 mM glucose and 2 microM NADPH. The EC(10) limit was 150 nM (39.9 microg l(-1)) and the MID was 100 nM (26.6 microg l(-1)). The design of the inhibition assays discussed has significance as a model for other enzymes and moves forward the possibility of an electrochemical biosensor array for pollution monitoring. PMID:11679267

  7. Corrosion Behavior of Austenitic and Duplex Stainless Steels in Lithium Bromide

    OpenAIRE

    Ayo Samuel AFOLABI; Alaneme, K.K.; Samson Oluwaseyi BADA

    2009-01-01

    The corrosion behavior of austenitic and duplex stainless steels in various concentrations of lithium, bromide solution was investigated by using the conventional weight loss measurement method. The results obtained show that corrosion of these steels occurred due to the aggressive bromide ion in the medium. Duplex stainless steel shows a greater resistance to corrosion than austenitic stainless steel in the medium. This was attributed to equal volume proportion of ferrite and austenite in th...

  8. A case report of QT prolongation with glycopyrronium bromide in a patient with chronic tamoxifen use

    OpenAIRE

    Chiu, Michael H.; Al-Majed, Nawaf S.; Stubbins, Ryan; Pollmann, Dylan; Sandhu, Roopinder K.

    2016-01-01

    Background Glycopyrronium bromide has recently been approved as a once daily maintenance inhalation therapy for moderate to severe chronic obstructive pulmonary disease (COPD). Efficacy and safety trial data have found rare cases of significant QT prolongation. To our knowledge, we describe the first case report of QT prolongation >600 ms with initiation of glycopyrronium bromide in a real world setting. Case presentation A 78-year-old female with moderate COPD recently started on glycopyrron...

  9. Influence of bromide on the performance of the amphipod Hyalella azteca in reconstituted waters

    Science.gov (United States)

    Ivey, Chris D.; Ingersoll, Christopher G.

    2016-01-01

    Poor performance of the amphipod Hyalella azteca has been observed in exposures using reconstituted waters. Previous studies have reported success in H. azteca water-only exposures with the addition of relatively high concentrations of bromide. The present study evaluated the influence of lower environmentally representative concentrations of bromide on the response ofH. azteca in 42-d water-only exposures. Improved performance of H. azteca was observed in reconstituted waters with >0.02 mg Br/L.

  10. The effect of pinaverium bromide (LA 1717) on the lower oesophageal sphincter.

    Science.gov (United States)

    Wöltje, M; Huchzermeyer, H

    1982-01-01

    An acute, double-blind study was carried out in 8 healthy male volunteers to investigate any effect of a new antispasmodic, pinaverium bromide, compared with placebo on the lower oesophageal sphincter. Manometric measurements showed no significant differences in resting pressures either after placebo or a therapeutic dose (200 mg) of pinaverium bromide, suggesting that the active drug does not cause any impairment of function of the lower oesophageal sphincter. PMID:7128186

  11. Tribromoisocyanuric acid/triphenylphosphine: a new system for conversion of alcohols into alkyl bromides

    Energy Technology Data Exchange (ETDEWEB)

    Andrade, Vitor S.C. de; Mattos, Marcio C.S. de, E-mail: mmattos@iq.ufrj.br [Universidade Federal do Rio de Janeiro (UFRJ), RJ (Brazil). Instituto de Quimica. Departamento de Quimica Organica

    2014-05-15

    An efficient and facile method has been developed for the conversion of alcohols into alkyl bromides under neutral conditions using tribromoisocyanuric acid and triphenylphosphine (molar ratio 1.0:0.7:2.0, alcohol/tribromoisocyanuric acid/triphenylphosphine) in dichloromethane at room temperature. This method can be applied for the conversion of primary, secondary, benzilic and allylic alcohols, and their corresponding bromides are obtained in 67-82 % yield. Tertiary alcohols do not react under these conditions. (author)

  12. Locomotor and sensorimotor performance deficit in rats following exposure to pyridostigmine bromide, DEET, and permethrin, alone and in combination.

    Science.gov (United States)

    Abou-Donia, M B; Goldstein, L B; Jones, K H; Abdel-Rahman, A A; Damodaran, T V; Dechkovskaia, A M; Bullman, S L; Amir, B E; Khan, W A

    2001-04-01

    Since their return from Persian Gulf War (PGW), many veterans have complained of symptoms including muscle and joint pain, ataxia, chronic fatigue, headache, and difficulty with concentration. The causes of the symptoms remain unknown. Because these veterans were exposed to a combination of chemicals including pyridostigmine bromide (PB), DEET, and permethrin, we investigated the effects of these agents, alone and in combination, on the sensorimotor behavior and central cholinergic system of rats. Male Sprague-Dawley rats (200-250 gm) were treated with DEET (40 mg/kg, dermal) or permethrin (0.13 mg/kg, dermal), alone and in combination with PB (1.3 mg/kg, oral, last 15 days only), for 45 days. Sensorimotor ability was assessed by a battery of behavioral tests that included beam-walk score, beam-walk time, incline plane performance, and forepaw grip on days 30 and 45 following the treatment. On day 45 the animals were sacrificed, and plasma and CNS cholinesterase, and brain choline acetyl transferase, muscarinic and nicotinic acetylcholine receptors were evaluated. Animals treated with PB, alone or in combination with DEET and permethrin, showed a significant deficit in beam-walk score as well as beam-walk time as compared with controls. Treatment with either DEET or permethrin, alone or in combination with each other, did not have a significant effect on beam-walk score. All chemicals, alone or in combination, resulted in a significant impairment in incline plane testing on days 30 and 45 following treatment. Treatment with PB, DEET, or permethrin alone did not have any inhibitory effect on plasma or brain cholinesterase activities, except that PB alone caused moderate inhibition in midbrain acetylcholinesterase (AChE) activity. Treatment with permethrin alone caused significant increase in cortical and cerebellar AChE activity. A combination of DEET and permethrin or PB and DEET led to significant decrease in AChE activity in brainstem and midbrain and brainstem

  13. Structural and Functional Analysis of a C3b-specific Antibody That Selectively Inhibits the Alternative Pathway of Complement*S⃞

    OpenAIRE

    Katschke, Kenneth J.; Stawicki, Scott; Yin, JianPing; Steffek, Micah; Xi, Hongkang; Sturgeon, Lizette; Hass, Philip E.; Loyet, Kelly M.; DeForge, Laura; Wu, Yan; van Lookeren Campagne, Menno; Wiesmann, Christian

    2009-01-01

    Amplification of the complement cascade through the alternative pathway can lead to excessive inflammation. Targeting C3b, a component central to the alternative pathway of complement, provides a powerful approach to inhibit complement-mediated immune responses and tissue injury. In the present study, phage display technology was employed to generate an antibody that selectively recognizes C3b but not the non-activated molecule C3. The crystal structure of C3b in compl...

  14. Electrochemical Recognition of Metalloproteins by Bromide-modified Silver Electrode - A New Method

    Directory of Open Access Journals (Sweden)

    Abbas Ali Rostami

    2007-07-01

    Full Text Available A bromide–modified silver electrode is reported, in the present study, to catalyzethe redox reactions of metalloproteins. This study describes that the bromide ions showvery good redox behavior with silver electrode. The cathodic and anodic peak potentialswere related to the concentration of bromide ions involved in making bromide-modifiedsilver electrode. The electrode reaction in the bromine solution was a diffusion-controlledprocess. Positive potential shift of the bromide ions was seen when different proteins wereadded to the solution using a silver electrode. New cathodic and anodic peaks wereobserved at different potential ranges for myoglobin, cytochrome c and catalase. A linearlyincreasing cathodic peak current of bromide ions was seen when the concentration ofsuperoxide dismutase was increased in the test solution. However, no change for albuminwas observed when its concentration was increased in the test solution. Present data provesour methodology as an easy-to-use analysis for comparing the redox potentials of differentmetalloproteins and differentiating the metallo- from non-metalloproteins. In this study, weintroduced an interesting method for bio-electrochemical analyses.

  15. Effect of ferric and bromide ions on the formation and speciation of disinfection byproducts during chlorination

    Institute of Scientific and Technical Information of China (English)

    Shaogang Liu; Zhiliang Zhu; Yanling Qiu; Jianfu Zhao

    2011-01-01

    The effects of ferric ion, pH, and bromide on the formation and distribution of disinfection byproducts (DBPs) during chlorination were studied. Two raw water samples from Huangpu River and Yangtze River, two typical drinking water sources of Shanghai, were used for the investigation. Compared with the samples from Huangpu River, the raw water samples from Yangtze River had lower content of total organic carbon (TOC) and ferric ions, but higher bromide concentrations. Under controlled chlorination conditions,four trihalomethanes (THMs), nine haloacetic acids (HAAs), total organic halogen (TOX) and its halogen species fractions, including total organic chlorine (TOC1) and total organic bromide (TOBr), were determined. The results showed that co-existent ferric and bromide ions significantly promoted the formation of total THMs and HAAs for both raw water samples. Higher concentration of bromide ions significantly changed the speciation of the formed THMs and HAAs. There was an obvious shift to brominated species,which might result in a more adverse influence on the safety of drinking water. The results also indicated that high levels of bromide ions in raw water samples produced higher percentages of unknown TOBr.

  16. Effect of ferric and bromide ions on the formation and speciation of disinfection byproducts during chlorination.

    Science.gov (United States)

    Liu, Shaogang; Zhu, Zhiliang; Qiu, Yanling; Zhao, Jianfu

    2011-01-01

    The effects of ferric ion, pH, and bromide on the formation and distribution of disinfection byproducts (DBPs) during chlorination were studied. Two raw water samples from Huangpu River and Yangtze River, two typical drinking water sources of Shanghai, were used for the investigation. Compared with the samples from Huangpu River, the raw water samples from Yangtze River had lower content of total organic carbon (TOC) and ferric ions, but higher bromide concentrations. Under controlled chlorination conditions, four trihalomethanes (THMs), nine haloacetic acids (HAAs), total organic halogen (TOX) and its halogen species fractions, including total organic chlorine (TOC1) and total organic bromide (TOBr), were determined. The results showed that co-existent ferric and bromide ions significantly promoted the formation of total THMs and HAAs for both raw water samples. Higher concentration of bromide ions significantly changed the speciation of the formed THMs and HAAs. There was an obvious shift to brominated species, which might result in a more adverse influence on the safety of drinking water. The results also indicated that high levels of bromide ions in raw water samples produced higher percentages of unknown TOBr.

  17. Design and characterization of N2-arylaminopurines which selectively inhibit replicative DNA synthesis and replication-specific DNA polymerases: guanine derivatives active on mammalian DNA polymerase alpha and bacterial DNA polymerase III.

    OpenAIRE

    Wright, G E; Baril, E F; Brown, V M; Brown, N C

    1982-01-01

    The 2-amino substituted derivatives of guanine, N2-(p-n-butylphenyl)guanine (BuPG) and N2-(3',4'-trimethylenephenyl) guanine (TMPG), were synthesized and found to selectively inhibit, respectively, HeLa cell DNA polymerase alpha (po1 alpha) and B. subtilis DNA polymerase III (po1 III). Both purines, like their corresponding uracil analogs, BuAu and TMAU (2,9), were specifically competitive with dGTP in their inhibitory action on their target polymerases. BuPG, the pol alpha-specific purine, w...

  18. Predicting bromide incorporation in a chlorinated indoor swimming pool.

    Science.gov (United States)

    Chowdhury, Shakhawat; Mazumder, Abu Jafar; Husain, Tahir

    2016-06-01

    The water in and air above swimming pools often contain high levels of disinfection byproducts (DBPs) due to chemical reactions between chlorine- or bromine-based disinfectants and organic/inorganic matter in the source water and released from swimmers. Exposure to these DBPs, though inevitable, can pose health threats to humans. In this study, DBPs in tap water (S1), and water from a chlorinated indoor swimming pool before (S2) and after swimming (S3) were measured. The brominated species constituted the majority of DBPs formed in S1, S2, and S3. Trihalomethanes (THMs) in S3 was 6.9 (range 2.9-11.1) and 1.4 (range 0.52-2.9) times those in S1 and S2, respectively; and the haloacetic acids (HAAs) in S3 was 4.2 (range 2.5-7.5) and 1.2 (range 0.6-2.6) times those in S1 and S2, respectively. The mean THMs in air above the swimming pool before (S2-A) and after swimming (S3-A) were 72.2 and 93.0 μg/m(3), respectively, and their ranges were 36.3-105.8 and 44.1-133.6 μg/m(3), respectively. The average percentages of bromide incorporation (BI) into THMs in S1, S2, and S3 were 3.0, 9.3, and 10.6 %, respectively; and the BI into HAAs in S1, S2, and S3 were 6.6, 12.0, and 12.2 %, respectively. Several models were trained for predicting the BI into THMs and HAAs. The results indicate that additional information is required to develop predictive models for BI in swimming pools.

  19. Eudragit RS PO nanoparticles for sustained release of pyridostigmine bromide

    International Nuclear Information System (INIS)

    Pyridostigmine bromide (PB) is an inhibitor of cholinesterase, which is used in the treatment of myasthenia gravis and administered for protection against exposure to toxic nerve agents. Tests were done to investigate prolonging the half-life of PB and improving its release behavior. PB was loaded in nanoparticles (NPs) of Eudragit RS PO (Eu-RS) prepared using the technique of quasi emulsion solvent diffusion. Variables of output power of the sonicator, bath temperature and mixing time, were chosen as the optimization factors to obtain the minimum sized NPs. In addition, emulsions were tested at different ratios of drug-to-polymer by dynamic light scattering to determine size and zeta potential of NPs. UV-spectroscopy was used to determine PB content of the NPs. Drug-loaded NPs were characterized by scanning electron microscopy, X-ray diffraction, and Fourier transform infrared spectra. Results determined that mixing time had a significant impact on the size of Eu-RS NPs, but power output of sonicator and bath temperature had no significant effect. The particle size obtained at the optimum condition (power output of 70 W, bath temperature of 33 °C, and mixing time of 7 min) was less than 200 nm (optimum sizes were 138.9 and 179.5 nm for Eu-RS and PB-loaded Eu-RS NPs, respectively). The optimum PB-loaded Eu-RS NPs at the PB to Eu-RS weight ratio of 1–4 and 20 % of loaded PB released from the nanocarriers within 100 h

  20. The developmental toxicity of 1-methyl-3-octylimidazolium bromide on Daphnia magna.

    Science.gov (United States)

    Luo, Yan-Rui; Li, Xiao-Yu; Chen, Xiao-Xiao; Zhang, Bang-Jun; Sun, Zhen-Jun; Wang, Jian-Ji

    2008-12-01

    The developmental toxicity of 1-methyl-3-octylimidazolium bromide ([C(8)mim]Br) on Daphnia magna was investigated. The 24 and 48 h LC(50) values for [C(8)mim]Br in D. magna were 1.99 and 0.95 mg/L, respectively. A series of multigenerational toxicity tests were then used to explore [C(8)mim]Br effects in D. magna. [C(8)mim]Br significantly inhibited the body lengths of the F0 and F1 1st generations. After 21 days of exposure, [C(8)mim]Br lowered the reproductive ability of the F0 and F1 1st generations. In F1 3rd generation, 21 days of [C(8)mim]Br exposure prolonged the time to bear the first egg and the time to the first brood compared with the control, but the number of first-brood offspring and the number of broods produced by these animals were reduced. After the recovery period all the reproductive parameters returned to normal in F1 1st generation except for the number of broods. The dead neonates increased with prolonged exposure and increasing concentrations, and the dead neonates of the F1 3rd generation went far beyond that of the F1 1st and F0 generations. The intrinsic rate of natural increase (r) values of the three D. magna generations significantly decreased after exposure to higher concentrations of [C(8)mim]Br compared with control groups. Collectively, these results suggest that [C(8)mim]Br exerts a toxic effect on the development of D. magna. This study also highlights the importance of systematically evaluating the potential effects of aquatic ecosystems of ionic liquids that may be released into bodies of water. PMID:18442076

  1. Binding of dyes to hydroxyapatite treated with cetylpyridinium chloride or cetrimonium bromide.

    Science.gov (United States)

    Jensen, J E

    1978-03-01

    The effect of cetylpyridinium chloride (CPC) and cetrimonium bromide (CTAB) on the adsorption of some acidic food dyes to hydroxyapatite was studied. The dyes investigated were brilliant blue (FD&C Blue No. 1), tartrazine (FD&C Yellow No. 5), sunset yellow (FD&C Yellow No. 6) and amaranth (FD&C Red No. 2). The apatite had adsorbed 9.2 mumol CPC per g dry weight. The adsorbed CPC was in equilibrium with a free concentration of 20 microgram/ml (58 micrometer). The adsorption of CPC and CTAB to the apatite was followed by an increased ability of the crystals to bind the dyes. The dyes were very firmly adsorbed and were not released during a series of washings. Untreated apatite showed only a minor affinity for the dyes. The adsorbed dyes were easily washed out. CPC and CTAB showed the smae specific ability to increase the binding capacity of the apatite. The results are discussed and related to the formation of stains on the teeth in persons using quaternary ammonium compounds for mouthrinsing. A mechanism explaining the production of stains is proposed.

  2. Spectroscopic study of tetradecyltrimethylammonium bromide Pt-C14TAB nanoparticles: Structure and Stability

    Energy Technology Data Exchange (ETDEWEB)

    Borodko, Y.; Jones, L.; Frei, H.; Somorjai, G.

    2009-01-09

    The vibrational spectra of platinum nanoparticles (12 nm) capped with tetradecyltrimethylammonium bromide, C{sub 14}TAB, were investigated by Fourier transform infrared (FTIR) spectroscopy. We have shown that the thermal decay of Pt-C{sub 14}TAB nanoparticles in N{sub 2}, H{sub 2} and O{sub 2} atmospheres leads to the release of hydrocarbon chain of surfactant and the formation of strongly bonded layer of ammonium cations on the platinum surface. The platinum atoms accessible to CO chemisorptions were not reducible by hydrogen in the temperature ranging from 30 C to 200 C. A FTIR spectrum of C{sub 14}TAB adsorbed on Pt nanoparticles dramatically perturbed as compared with pure C{sub 14}TAB. New intense and broad bands centered at 1450 cm{sup -1} and 760 cm{sup -1} are making their appearance in Pt-C{sub 14}TAB. It may be speculated, that new bands are result of coupling between conducting electrons of Pt and molecular vibrations of adsorbed C{sub 14}TAB and as a consequence specific vibrational modes of ammonium cation transformed into electron-vibrational modes.

  3. Renal cell carcinoma-infiltrating natural killer cells express differential repertoires of activating and inhibitory receptors and are inhibited by specific HLA class I allotypes.

    Science.gov (United States)

    Schleypen, Julia S; Von Geldern, Marion; Weiss, Elisabeth H; Kotzias, Nicole; Rohrmann, Karl; Schendel, Dolores J; Falk, Christine S; Pohla, Heike

    2003-10-10

    Among tumor-infiltrating lymphocytes (TILs) directly isolated from renal cell carcinomas (RCCs), we found substantial numbers of natural killer (NK) cells in most tumor tissues. They could be identified reliably in situ with an antibody directed against the activating receptor (AR) NKp46 that is exclusively expressed by all NK cells. NK-enriched TILs (NK-TILs) showed cytotoxicity against major histocompatibility complex (MHC) class I-negative cell lines. The ability to detect lysis of target cells was dependent on the percentage of NK cells within the TILs, and cytotoxicity was only observed after overnight activation with low-dose interleukin-2 (IL-2). Infiltrating NK cells were found to express various inhibitory receptors (IRs); among these the CD94/NKG2A receptor complex was overrepresented compared to the autologous peripheral blood mononuclear cell (PBMC) population. Other IRs were underrepresented, indicating that NK subpopulations vary in their tumor-infiltrating capacity. IRs expressed by NK-TILs are functional since receptor engagement with MHC class I ligands presented by human leukocyte antigen (HLA)-transfected target cell lines was able to inhibit NK-mediated cytotoxicity. NK-TILs were also able to lyse autologous or allogeneic tumor cell lines in vitro. This activity correlated with low HLA class I surface expression since lysis could be inhibited by interferon (IFN)-gamma-expressing RCC transductants that displayed a higher surface density of HLA class I molecules. Therefore, NK cells infiltrating tumor tissues have an inherent ability to recognize transformed cells, but they require cytokine activation and are sensitive to inhibition by IR ligands.

  4. High concentrations of L-ascorbic acid specifically inhibit the growth of human leukemic cells via downregulation of HIF-1α transcription.

    Directory of Open Access Journals (Sweden)

    Hiroshi Kawada

    Full Text Available We examined the antileukemic effects of high concentrations of L-ascorbic acid (high AA on human leukemic cells. In vitro, high AA markedly induced apoptosis in various leukemic cell lines by generating hydrogen peroxide (H2O2 but not in normal hematopoietic stem/progenitor cells. High AA significantly repressed leukemic cell proliferation as well as neoangiogenesis in immunodeficient mice. We then noted that in leukemic cells, HIF-1α transcription was strongly suppressed by high AA and correlated with the transcription of VEGF. Our data indicate that exposure to high AA markedly increased the intracellular AA content of leukemic cells and inhibited the nuclear translocation of NF-κB, which mediates expression of HIF-1α. We next generated K562 cells that overexpressed HIF-1α (K562-HIF1α cells and assessed the mechanistic relationship between inhibition of HIF-1α transcription and the antileukemic effect of high AA. The ability of high AA to induce apoptosis was significantly lower in K562-HIF1α cells than in K562 cells in vitro. We found that expression of HIF-1α-regulated antiapoptotic proteins of the Bcl-2 family, such as Mcl-1, Bcl-xL, and Bcl-2, was significantly suppressed by high AA in K562 cells, but was sustained at higher levels in K562-HIF1α cells, regardless of high AA exposure. Moreover, repression of cell proliferation and neoangiogenesis by high AA was completely abrogated in mice receiving transplants of K562-HIF1α cells. These results indicate that, along with H2O2 generation, downregulation of HIF-1α transcription plays a crucial role in growth inhibition of human leukemic cells by high AA.

  5. Non-genotype-specific role of the hepatitis C virus 5' untranslated region in virus production and in inhibition by interferon

    DEFF Research Database (Denmark)

    Li, Yi-Ping; Ramirez, Santseharay; Gottwein, Judith M;

    2011-01-01

    The 5' untranslated region (5'UTR) of hepatitis C virus (HCV) is structured into four domains (I-IV) with numerous genotype-specific nucleotides. It is unknown whether the polymorphisms confer genotype-specific functions to the 5'UTR. Using viable JFH1-based Core-NS2 recombinants, we developed an...

  6. Steroid receptor coactivator 1 deficiency increases MMTV-neu mediated tumor latency and differentiation specific gene expression, decreases metastasis, and inhibits response to PPAR ligands

    International Nuclear Information System (INIS)

    The peroxisome proliferator activated receptor (PPAR) subgroup of the nuclear hormone receptor superfamily is activated by a variety of natural and synthetic ligands. PPARs can heterodimerize with retinoid X receptors, which have homology to other members of the nuclear receptor superfamily. Ligand binding to PPAR/RXRs results in recruitment of transcriptional coactivator proteins such as steroid receptor coactivator 1 (SRC-1) and CREB binding protein (CBP). Both SRC-1 and CBP are histone acetyltransferases, which by modifying nucleosomal histones, produce more open chromatin structure and increase transcriptional activity. Nuclear hormone receptors can recruit limiting amounts of coactivators from other transcription factor binding sites such as AP-1, thereby inhibiting the activity of AP-1 target genes. PPAR and RXR ligands have been used in experimental breast cancer therapy. The role of coactivator expression in mammary tumorigenesis and response to drug therapy has been the subject of recent studies. We examined the effects of loss of SRC-1 on MMTV-neu mediated mammary tumorigenesis. SRC-1 null mutation in mammary tumor prone mice increased the tumor latency period, reduced tumor proliferation index and metastasis, inhibited response to PPAR and RXR ligands, and induced genes involved in mammary gland differentiation. We also examined human breast cancer cell lines overexpressing SRC-1 or CBP. Coactivator overexpression increased cellular proliferation with resistance to PPAR and RXR ligands and remodeled chromatin of the proximal epidermal growth factor receptor promoter. These results indicate that histone acetyltransferases play key roles in mammary tumorigenesis and response to anti-proliferative therapies

  7. Tissue-specific effects of aldose reductase inhibition on fluorescence and cross-linking of extracellular matrix in chronic galactosemia. Relationship to pentosidine cross-links.

    Science.gov (United States)

    Richard, S; Tamas, C; Sell, D R; Monnier, V M

    1991-08-01

    Chronic experimental hyperglycemia mediated by galactose has been shown to induce browning and cross-linking of rat tail tendon collagen that could be duplicated in vitro by nonenzymatic galactosylation. To investigate the nature of these changes, Sprague-Dawley rats were placed on a 33% galactose diet without and with sorbinil for 6 and 12 mo. Collagen-linked fluorescence and pentosidine cross-links increased with age and galactosemia in tail tendons (P less than 0.001) and skin but were essentially unresponsive to aldose reductase inhibition (ARI). In contrast, tendon breaking time in urea, a likely parameter of cross-linking, was markedly improved (P less than 0.001) by ARI. Fluorescence that was inhibited by sorbinil treatment was increased in pepsin and proteinase K digest of aortic tissue from galactosemic rats (P less than 0.001), but impaired enzymatic digestibility was not observed. Systolic blood pressure as potential consequence of aortic stiffening was not increased in galactosemia. These data suggest that fluorescence in skin and tendon might be in part due to advanced glycosylation and pentosidine formation because these were not decreased by ARI. However, they also suggest that nonfluorescent cross-links may also be forming because, in contrast to fluorescence, tail tendon breaking time was partly corrected by ARI. Thus, it appears that extracellular matrix changes in chronic galactosemia are complex, being partly attributable to advanced glycosylation and partly to polyol-pathway activation.

  8. Chlorine-36, bromide, and the origin of spring water

    Science.gov (United States)

    Davis, S.N.; Cecil, L.D.; Zreda, M.; Moysey, S.

    2001-01-01

    Natural ratios of chlorine-36 (36Cl) to stable chlorine (i.e., 36Cl/Cl ?? 10-15) vary in shallow groundwater of the United States from about 50 in coastal areas to about 1400 in the northern Rocky Mountains. Ratios lower than these indicate the presence of chloride (Cl-) that has been isolated from the atmosphere for hundreds of thousands of years, if not longer. Higher ratios, which can exceed 5000, usually originate from fallout from testing thermonuclear devices in the western Pacific in the 1950s. Natural mass ratios of chloride to bromide (Cl-/Br-) in precipitation vary in the United States from about 250 in coastal areas to about 50 in the north-central states. Lower ratios may suggest contamination from human sources. Higher ratios, which may exceed 2000, commonly reflect the dissolution of halite. Seawater has a Cl-/Br- ratio of 290. Both 36Cl and Cl-/Br- ratios have been measured in 21 samples of spring water collected from springs in 10 different states. Brackish water from Saratoga Springs area in New York has low values for both 36Cl and Cl-/Br- ratios. This indicates that a large component of the water has a very deep origin. Brackish water from Alexander Springs in Florida has a low 36Cl ratio but a high Cl-/Br- ratio similar to seawater. This suggests the addition of ancient seawater that may be trapped in the aquifer. Big Spring in Iowa discharges water with a very high Cl-/Br- ratio but a moderate 36Cl ratio. The high ratio of Cl-/Br- may be produced by dissolution of road salt or agricultural chemicals. Of the 21 springs sampled, only 10 appeared to have potable water not significantly affected by human activity. Chlorine-36 from testing of nuclear devices is still being flushed out of four of the spring systems that were sampled. Thus, more than 45 years have passed since 36Cl was introduced into the aquifers feeding the springs and the systems, as yet, have not been purged. Published by Elsevier Science B.V.

  9. Formation of bromate during ferrate(VI) oxidation of bromide in water.

    Science.gov (United States)

    Huang, Xin; Deng, Yang; Liu, Shuang; Song, Yali; Li, Nanzhu; Zhou, Jizhi

    2016-07-01

    Ferrate (VI) is traditionally recognized as a safe oxidant without production of disinfection byproducts (DBPs). However, here we detected probable carcinogenic bromate (BrO3(-)) during ferrate(VI) oxidation of bromide (Br(-))-containing water, and evaluated the effects of pH, ferrate(VI) dose, initial Br(-) concentration, and co-existing anions on the BrO3(-) formation. BrO3(-) was produced at a moderately-weakly acidic pH condition and in the absence of phosphate that was commonly applied as a buffer and stabilizing agent in previous ferrate(VI) studies. At pH 5.0, the produced BrO3(-) was increased from 12.5 to 273.8 μg/L with the increasing initial Br(-) concentration from 200 to 1000 μg/L at 10 mg/L Fe(VI), corresponding to an increase in the molar conversion ([BrO3(-)]/initial [Br(-)]) from 2.3% to 10.3%, in a bicarbonate-buffered solution. As pH increased to 7.0, the BrO3(-) concentration gradually dropped. The BrO3(-) production appeared to be associated with the oxidation by high valence iron species (i.e. Fe(VI), Fe(V) and Fe(IV)). Two key intermediate products (i.e. hypobromous acid/hypobromite (HOBr/OBr(-)) and hydrogen peroxide (H2O2)) relevant to the bromate formation were identified. The production of HOBr, a requisite intermediate for the ensuing bromate formation, was indirectly validated through identification of bromine-containing trihalomethanes and haloacetic acids during ferrate oxidation in a natural water, though these bromo-organic DBPs produced were insignificant. Furthermore, the inhibition effects of various anions on the formation of BrO3(-) followed chloride H2O2 was detected at higher phosphate concentration. It could reduce HOBr to Br(-), thereby inhibiting the bromate formation. PMID:27153235

  10. Cell Cycle Reprogramming for PI3K Inhibition Overrides Relapse-Specific C481S BTK Mutation Revealed by Longitudinal Functional Genomics in Mantle Cell Lymphoma

    OpenAIRE

    Chiron, David; Di Liberto, Maurizio; Martin, Peter; Huang, Xiangao; Sharman, Jeff; Blecua, Pedro; Mathew, Susan; Vijay, Priyanka; Eng, Ken; Ali, Siraj; Johnson, Amy; Chang, Betty; Ely, Scott; Elemento, Olivier; Mason, Christopher E.

    2014-01-01

    Despite the unprecedented clinical activity of the Bruton’s tyrosine kinase inhibitor ibrutinib in MCL, acquired-resistance is common. By longitudinal integrative whole-exome and whole-transcriptome sequencing and targeted sequencing, we identified the first relapse-specific C481S mutation at the ibrutinib-binding site of BTK in MCL cells at progression following a durable response. This mutation enhanced BTK and AKT activation and tissue-specific proliferation of resistant MCL cells driven b...

  11. The p16-Specific Reactivation and Inhibition of Cell Migration Through Demethylation of CpG Islands by Engineered Transcription Factors

    OpenAIRE

    Zhang, Baozhen; Xiang, Shengyan; Zhong, Qiming; Yin, Yanru; Gu, Liankun; Deng, Dajun

    2012-01-01

    Methylation of CpG islands inactivates transcription of tumor suppressor genes including p16 (CDKN2A). Inhibitors of DNA methylation and histone deacylation are recognized as useful cancer therapeutic chemicals through reactivation of the expression of methylated genes. However, these inhibitors are not target gene–specific, so that they lead to serious side effects as regular cytotoxic chemotherapy agents. To explore the feasibility of methylated gene-specific reactivation by artificial tran...

  12. Two specific drugs, BMS-345541 and purvalanol A induce apoptosis of HTLV-1 infected cells through inhibition of the NF-kappaB and cell cycle pathways

    Directory of Open Access Journals (Sweden)

    Wu Weilin

    2008-06-01

    Full Text Available Abstract Human T-cell leukemia virus type-1 (HTLV-1 induces adult T-cell leukemia/lymphoma (ATL/L, a fatal lymphoproliferative disorder, and HTLV-1-associated myelopathy/tropical spastic paraparesis (HAM/TSP, a chronic progressive disease of the central nervous system after a long period of latent infection. Although the mechanism of transformation and leukemogenesis is not fully elucidated, there is evidence to suggest that the viral oncoprotein Tax plays a crucial role in these processes through the regulation of several pathways including NF-κB and the cell cycle pathways. The observation that NF-κB, which is strongly induced by Tax, is indispensable for the maintenance of the malignant phenotype of HTLV-1 by regulating the expression of various genes involved in cell cycle regulation and inhibition of apoptosis provides a possible molecular target for these infected cells. To develop potential new therapeutic strategies for HTLV-1 infected cells, in this present study, we initially screened a battery of NF-κB and CDK inhibitors (total of 35 compounds to examine their effects on the growth and survival of infected T-cell lines. Two drugs namely BMS-345541 and Purvalanol A exhibited higher levels of growth inhibition and apoptosis in infected cell as compared to uninfected cells. BMS-345541 inhibited IKKβ kinase activity from HTLV-1 infected cells with an IC50 (the 50% of inhibitory concentration value of 50 nM compared to 500 nM from control cells as measured by in vitro kinase assays. The effects of Purvalanol A were associated with suppression of CDK2/cyclin E complex activity as previously shown by us. Combination of both BMS-345541 and Purvalanol A showed a reduced level of HTLV-1 p19 Gag production in cell culture. The apparent apoptosis in these infected cells were associated with increased caspase-3 activity and PARP cleavage. The potent and selective apoptotic effects of these drugs suggest that both BMS-345541 and Purvalanol A

  13. Steroid receptor coactivator 1 deficiency increases MMTV-neu mediated tumor latency and differentiation specific gene expression, decreases metastasis, and inhibits response to PPAR ligands

    Directory of Open Access Journals (Sweden)

    Crowe David L

    2010-11-01

    Full Text Available Abstract Background The peroxisome proliferator activated receptor (PPAR subgroup of the nuclear hormone receptor superfamily is activated by a variety of natural and synthetic ligands. PPARs can heterodimerize with retinoid X receptors, which have homology to other members of the nuclear receptor superfamily. Ligand binding to PPAR/RXRs results in recruitment of transcriptional coactivator proteins such as steroid receptor coactivator 1 (SRC-1 and CREB binding protein (CBP. Both SRC-1 and CBP are histone acetyltransferases, which by modifying nucleosomal histones, produce more open chromatin structure and increase transcriptional activity. Nuclear hormone receptors can recruit limiting amounts of coactivators from other transcription factor binding sites such as AP-1, thereby inhibiting the activity of AP-1 target genes. PPAR and RXR ligands have been used in experimental breast cancer therapy. The role of coactivator expression in mammary tumorigenesis and response to drug therapy has been the subject of recent studies. Methods We examined the effects of loss of SRC-1 on MMTV-neu mediated mammary tumorigenesis. Results SRC-1 null mutation in mammary tumor prone mice increased the tumor latency period, reduced tumor proliferation index and metastasis, inhibited response to PPAR and RXR ligands, and induced genes involved in mammary gland differentiation. We also examined human breast cancer cell lines overexpressing SRC-1 or CBP. Coactivator overexpression increased cellular proliferation with resistance to PPAR and RXR ligands and remodeled chromatin of the proximal epidermal growth factor receptor promoter. Conclusions These results indicate that histone acetyltransferases play key roles in mammary tumorigenesis and response to anti-proliferative therapies.

  14. M-HIFU inhibits tumor growth, suppresses STAT3 activity and enhances tumor specific immunity in a transplant tumor model of prostate cancer.

    Directory of Open Access Journals (Sweden)

    Xiaoyi Huang

    Full Text Available OBJECTIVE: In this study, we explored the use of mechanical high intensity focused ultrasound (M-HIFU as a neo-adjuvant therapy prior to surgical resection of the primary tumor. We also investigated the role of signal transducer and activator of transcription 3 (STAT3 in M-HIFU elicited anti-tumor immune response using a transplant tumor model of prostate cancer. METHODS: RM-9, a mouse prostate cancer cell line with constitutively activated STAT3, was inoculated subcutaneously in C57BL/6J mice. The tumor-bearing mice (with a maximum tumor diameter of 5∼6 mm were treated by M-HIFU or sham exposure two days before surgical resection of the primary tumor. Following recovery, if no tumor recurrence was observed in 30 days, tumor rechallenge was performed. The growth of the rechallenged tumor, survival rate and anti-tumor immune response of the animal were evaluated. RESULTS: No tumor recurrence and distant metastasis were observed in both treatment groups employing M-HIFU + surgery and surgery alone. However, compared to surgery alone, M-HIFU combined with surgery were found to significantly inhibit the growth of rechallenged tumors, down-regulate intra-tumoral STAT3 activities, increase cytotoxic T cells in spleens and tumor draining lymph nodes (TDLNs, and improve the host survival. Furthermore, M-HIFU combined with surgery was found to significantly decrease the level of immunosuppression with concomitantly increased number and activities of dendritic cells, compared to surgery alone. CONCLUSION: Our results demonstrate that M-HIFU can inhibit STAT3 activities, and when combined synergistically with surgery, may provide a novel and promising strategy for the treatment of prostate cancers.

  15. Inhibition of myeloid differentiation factor 88 signaling mediated by histidine-grafted poly(β-amino ester ester nanovector induces donor-specific liver allograft tolerance

    Directory of Open Access Journals (Sweden)

    Hu F

    2015-07-01

    Full Text Available Fanguo Hu,1,* Hanjie Wang,2,* Shuangnan Zhang,2 Yao Peng,2 Lin Su,2 Jin Chang,2 Gang Liu11Department of General Surgery, Tianjin Medical University General Hospital, Tianjin, People’s Republic of China; 2School of Life Sciences, Tianjin University, Collaborative Innovation Center of Chemical Science and Engineering, Tianjin Engineering Center of Micro-Nano Biomaterials and Detection-Treatment Technology, Tianjin, People’s Republic of China*These authors contributed equally to this workAbstract: Toll-like receptors (TLRs activate biochemical pathways that evoke activation of innate immunity, which leads to dendritic cell maturation and initiation of adaptive immune responses that provoke allograft rejection. We aimed to prolong allograft survival by selectively inhibiting expression of myeloid differentiation factor 88 (MyD88, which is an essential adaptor in TLR signaling. We designed and synthesized a novel histidine-grafted poly(β-amino ester(HGPAE nanovector, which was shown to be safe and efficient both in vitro and in vivo for the delivery of a plasmid containing shRNA targeting MyD88 (pMyD88. We also demonstrated that the pMyD88/HGPAE complex mediated remarkable inhibition of MyD88 expression in rat liver in vivo. We transplanted Dark Agouti rat livers lacking MyD88 as result of transfection with the pMyD88/HGPAE complex into Lewis rats. The recipients survived longer and graft rejection of the donor liver as well as serum levels of IL-2 and IFN-γ in the recipient were significantly reduced.Keywords: immune recognition, allograft rejection, MyD88, short hairpin RNA (shRNA, gene delivery, PAE

  16. VEGF-specific siRNAs modified with 2′-deoxy effectively suppress VEGF expression and inhibit growth of nasopharyngeal carcinoma xenograft in a mouse model

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    Vascular endothelial growth factor (VEGF) is up-regulated in the vast majority of human tumors. The up-regulation of VEGF not only plays important roles in tumor angiogenesis, but also provides a target for tumor treatment with small interfering RNA (siRNA) that targets VEGF; however, it is unclear whether a quite high up-regulation of VEGF will affect the efficiency of RNA interference strategies targeting VEGF. A high level expression of VEGF was found in CNE cells from a nasopharyngeal carcinoma cell line. In this study, we investigate whether VEGF-specific siRNAs can effectively suppress VEGF expression in CNE cells, and study the methods for the use of VEGF-specific siRNAs as potential therapeutic agents. CNE cells with high VEGF expression induced by hypoxia were transfected with VEGF-specific siRNAs. The expression of VEGF was effectively suppressed by VEGF-specific siRNAs, measured by ELISA, Western blot analysis and RT-PCR. Furthermore, experiments in nude mice bearing nasopharyngeal carcinoma xenograft were initiated 5 d after injection of CNE cells. VEGF-specific siRNAs were modified with 2′-deoxy, then injected into the tumors, and a liposome-mediated siRNA transfection system and ultrasound exposure were used to help delivery of the siRNAs. Tumor growth was reduced significantly after 3 weeks’ treatment. These studies suggest that VEGF-specific siRNAs still can effectively suppress VEGF expression even in tumor cell lines with a relatively high level of VEGF expression, such as CNE, and VEGF-specific siRNAs modified with 2′-deoxy can be used as potential agents for tumor therapy.

  17. Specific contacts of the -35 region of the galP1 promoter by RNA polymerase inhibit GalR-mediated DNA looping repression.

    Science.gov (United States)

    Csiszovszki, Zsolt; Lewis, Dale E A; Le, Phuoc; Sneppen, Kim; Semsey, Szabolcs

    2012-11-01

    The P1 promoter of the galactose operon in Escherichia coli is one of the best studied examples of 'extended -10' promoters. Recognition of the P1 promoter does not require specific contacts between RNA polymerase and its poor -35 element. To investigate whether specific recognition of the -35 element would affect the regulation of P1 by GalR, we mutagenized the -35 element of P1, isolated variants of the -35 element and studied the regulation of the mutant promoters by in vitro transcription assays and by mathematical modeling. The results show that the GalR-mediated DNA loop is less efficient in repressing P1 transcription when RNA polymerase binds to the -10 and -35 elements concomitantly. Our results suggest that promoters that lack specific -35 element recognition allow decoupling of local chromosome structure from transcription initiation. PMID:22941635

  18. Specific contacts of the −35 region of the galP1 promoter by RNA polymerase inhibit GalR-mediated DNA looping repression

    Science.gov (United States)

    Csiszovszki, Zsolt; Lewis, Dale E. A.; Le, Phuoc; Sneppen, Kim; Semsey, Szabolcs

    2012-01-01

    The P1 promoter of the galactose operon in Escherichia coli is one of the best studied examples of ‘extended −10’ promoters. Recognition of the P1 promoter does not require specific contacts between RNA polymerase and its poor −35 element. To investigate whether specific recognition of the −35 element would affect the regulation of P1 by GalR, we mutagenized the −35 element of P1, isolated variants of the −35 element and studied the regulation of the mutant promoters by in vitro transcription assays and by mathematical modeling. The results show that the GalR-mediated DNA loop is less efficient in repressing P1 transcription when RNA polymerase binds to the −10 and −35 elements concomitantly. Our results suggest that promoters that lack specific −35 element recognition allow decoupling of local chromosome structure from transcription initiation. PMID:22941635

  19. [Bowel obstruction-induced cholinergic crisis with progressive respiratory failure following distigmine bromide treatment].

    Science.gov (United States)

    Kobayashi, Kazuki; Sekiguchi, Hiroshi; Sato, Nobuhiro; Hirose, Yasuo

    2016-03-01

    A 54-year-old female experienced rapid respiratory failure while being transported in an ambulance to our emergency department for evaluation and management of constipation and abdominal pain. The patient was on treatment with distigmine bromide for postoperative urination disorder and magnesium oxide for constipation. Increased salivary secretions, diminished respiratory excursion, type 2 respiratory failure (PaCO2 : 65 mmHg), low serum cholinesterase, and hypermagnesemia were detected. Imaging studies revealed that the patient had bilateral aspiration pneumonia, fecal impaction in the rectum, and a distended colon causing ileus. The patient was mechanically ventilated and was weaned off the ventilator on day 3. Therapeutic drug monitoring after discharge revealed that the serum level of distigmine bromide on admission was markedly elevated (377.8 ng/mL vs. the normal therapeutic level of 5-10 ng/mL). Distigmine bromide induced a cholinergic crisis with a resultant increase in airway secretions and respiratory failure. In this particular case, orally administered distigmine bromide was excessively absorbed because of prolonged intestinal transit time secondary to fecal impaction and sluggish bowel movement; this caused a cholinergic crisis and hypermagnesemia contributing to respiratory failure. Clinicians should be aware that bowel obstruction in a patient treated with distigmine bromide can increase the risk of a cholinergic crisis. PMID:27255021

  20. The role of arginine 47 in the cyclization and coupling reactions of cyclodextrin glycosyltransferase from Bacillus circulans strain 251 - Implications for product inhibition and product specificity

    NARCIS (Netherlands)

    Uitdehaag, JCM; Dijkstra, BW; Dijkhuizen, L

    2000-01-01

    Cyclodextrin glycosyltransferase (CGTase) (EC 2.4.1.19) is used for the industrial production of cyclodextrins. Its application, however, is hampered by the limited cyclodextrin product specificity and the strong inhibitory effect of cyclodextrins on CGTase activity. Recent structural studies have i

  1. pERK 1/2 inhibit Caspase-8 induced apoptosis in cancer cells by phosphorylating it in a cell cycle specific manner.

    Science.gov (United States)

    Mandal, Ranadip; Raab, Monika; Matthess, Yves; Becker, Sven; Knecht, Rainald; Strebhardt, Klaus

    2014-03-01

    ERK 1/2 are found to be hyperactive in many cancers. Active ERK 1/2 (pERK 1/2) are known to protect cancer cells from undergoing death receptor-mediated apoptosis, although the mechanism(s) behind this is poorly understood. Through in vitro kinase assays and mass-spectrometry we demonstrate that pERK 1/2 can phosphorylate pro-Caspase-8 at S387. Also, in EGFR-overexpressing Type I and II ovarian and breast cancer cell lines respectively, ERK 1/2 remain active only during the interphase. During this period, pERK 1/2 could inhibit Trail-induced apoptosis, most effectively during the G1/S phase. By knocking-down the endogenous pro-Caspase-8 using RNAi and replacing it with its non-phosphorylatable counterpart (S387A), a significant increase in Caspase-8 activity upon Trail stimulation was observed, even in the presence of pERK 1/2. Taken together, we propose that a combination of Trail and an inhibitor of ERK 1/2 activities could potentially enhance of Trail's effectiveness as an anti-cancer agent in ERK 1/2 hyperactive cancer cells.

  2. Current and Potential Future Bromide Loads from Coal-Fired Power Plants in the Allegheny River Basin and Their Effects on Downstream Concentrations.

    Science.gov (United States)

    Good, Kelly D; VanBriesen, Jeanne M

    2016-09-01

    The presence of bromide in rivers does not affect ecosystems or present a human health risk; however, elevated concentrations of bromide in drinking water sources can lead to difficulty meeting drinking water disinfection byproduct (DBP) regulations. Recent attention has focused on oil and gas wastewater and coal-fired power plant wet flue gas desulfurization (FGD) wastewater bromide discharges. Bromide can be added to coal to enhance mercury removal, and increased use of bromide at some power plants is expected. Evaluation of potential increases in bromide concentrations from bromide addition for mercury control is lacking. The present work utilizes bromide monitoring data in the Allegheny River and a mass-balance approach to elucidate bromide contributions from anthropogenic and natural sources under current and future scenarios. For the Allegheny River, the current bromide is associated approximately 49% with oil- and gas-produced water discharges and 33% with coal-fired power plants operating wet FGD, with 18% derived from natural sources during mean flow conditions in August. Median wet FGD bromide loads could increase 3-fold from 610 to 1900 kg/day if all plants implement bromide addition for mercury control. Median bromide concentrations in the lower Allegheny River in August would rise to 410, 200, and 180 μg/L under low-, mean-, and high-flow conditions, respectively, for the bromide-addition scenario. PMID:27538590

  3. Corrosion Behavior of Austenitic and Duplex Stainless Steels in Lithium Bromide

    Directory of Open Access Journals (Sweden)

    Ayo Samuel AFOLABI

    2009-07-01

    Full Text Available The corrosion behavior of austenitic and duplex stainless steels in various concentrations of lithium, bromide solution was investigated by using the conventional weight loss measurement method. The results obtained show that corrosion of these steels occurred due to the aggressive bromide ion in the medium. Duplex stainless steel shows a greater resistance to corrosion than austenitic stainless steel in the medium. This was attributed to equal volume proportion of ferrite and austenite in the structure of duplex stainless steel coupled with higher content of chromium in its composition. Both steels produced electrochemical noise at increased concentrations of lithium bromide due to continuous film breakdown and repair caused by reduction in medium concentration by the alkaline corrosion product while surface passivity observed in duplex stainless steel is attributed to film stability on this steel.

  4. Chloride/bromide ratios in leachate derived from farm-animal waste

    International Nuclear Information System (INIS)

    Results have important implications for identifying animal sources of contaminated groundwater. - Ratios of conservative chemicals have been used to identify sources of groundwater contamination. While chloride/bromide ratios have been reported for several common sources of groundwater contamination, little work has been done on leachate derived from farm-animal waste. In this study, chloride/bromide ratios were measured in leachate derived from longhorn-cattle, quarter-horse, and pygme-goat waste at a farm in Abilene, Texas, USA. (Minimum, median, and maximum) chloride/bromide ratios of (66.5, 85.6, and 167), (119, 146, and 156), and (35.4, 57.8, and 165) were observed for cattle, horses, and goats, respectively. These ratios are below typical values for domestic wastewater and within the range commonly observed for oilfield brine. Results of this study have important implications for identifying sources of contaminated groundwater in settings with significant livestock and/or oil production

  5. Triplex targeting of human PDGF-B (c-sis, proto-oncogene) promoter specifically inhibits factors binding and PDGF-B transcription

    OpenAIRE

    Jing LIU; Xu, Ren-Huan; Jin, You-xin; Wang, De-Bao

    2001-01-01

    Human c-sis/PDGF-B proto-oncogene has been shown to be overexpressed in a large percentage of human tumor cells establishing a growth-promoting, autocrine growth circuit. Triplex forming oligonucleotides (TFOs) can recognize and bind sequences in duplex DNA, and have received considerable attention because of their potential for targeting specific genomic sites. The c-sis/PDGF-B promoter contains a unique homopurine/homopyrimidine sequence (SIS proximal element, ...

  6. Irradiation as a disinfestation method - update on methyl bromide phase out, regulatory action and emerging opportunities

    International Nuclear Information System (INIS)

    Methyl bromide (MeBr), is the most widely used agricultural fumigant in the world for the control of pests and plant diseases. It is used to control pests and diseases in food, agricultural and forestry commodities after harvest, before or during storage or transportation and/or at time of import to control quarantine or storage pests. Knowing MeBr will be phased out has spurred a search for alternative treatments and products, and has placed pressure on regulatory authorities to approve alternatives. Some of methyl bromide use could be replaced with irradiation. Methyl bromide is also used for soil and structural fumigation, and although there is some use of irradiation for packaged soil or greenhouse products, in general, these uses can not be replaced by irradiation. Some radiation processing facilities have either seen increased business to disinfest commodities, or have experienced more inquiries for service. There are many other processes and products competing for this market and irradiation will not win its share of the business without an improved regulatory picture, improved marketing to methyl bromide users and improved information to answer questions from commodity sectors. The United Nations Environment Program - Methyl Bromide Technical Options Committee (MBTOC) provides a venue for the publication or information about the use and availability of irradiation as an alternative to methyl bromide. It provides the technical base to the Montreal Protocol contributing to the setting of phase out dates; this committee is actively researching and assessing all alternatives and needs information about irradiation. The author is a member of the MBTOC committee

  7. Exploring the induction of preproinsulin-specific Foxp3+ CD4+ Treg cells that inhibit CD8+ T cell-mediated autoimmune diabetes by DNA vaccination

    Science.gov (United States)

    Stifter, Katja; Schuster, Cornelia; Schlosser, Michael; Boehm, Bernhard Otto; Schirmbeck, Reinhold

    2016-01-01

    DNA vaccination is a promising strategy to induce effector T cells but also regulatory Foxp3+ CD25+ CD4+ Treg cells and inhibit autoimmune disorders such as type 1 diabetes. Little is known about the antigen requirements that facilitate priming of Treg cells but not autoreactive effector CD8+ T cells. We have shown that the injection of preproinsulin (ppins)-expressing pCI/ppins vector into PD-1- or PD-L1-deficient mice induced Kb/A12-21-monospecific CD8+ T cells and autoimmune diabetes. A pCI/ppinsΔA12-21 vector (lacking the critical Kb/A12-21 epitope) did not induce autoimmune diabetes but elicited a systemic Foxp3+ CD25+ Treg cell immunity that suppressed diabetes induction by a subsequent injection of the diabetogenic pCI/ppins. TGF-β expression was significantly enhanced in the Foxp3+ CD25+ Treg cell population of vaccinated/ppins-primed mice. Ablation of Treg cells in vaccinated/ppins-primed mice by anti-CD25 antibody treatment abolished the protective effect of the vaccine and enabled diabetes induction by pCI/ppins. Adoptive transfer of Treg cells from vaccinated/ppins-primed mice into PD-L1−/− hosts efficiently suppressed diabetes induction by pCI/ppins. We narrowed down the Treg-stimulating domain to a 15-residue ppins76–90 peptide. Vaccine-induced Treg cells thus play a crucial role in the control of de novo primed autoreactive effector CD8+ T cells in this diabetes model. PMID:27406624

  8. Exploring the induction of preproinsulin-specific Foxp3(+) CD4(+) Treg cells that inhibit CD8(+) T cell-mediated autoimmune diabetes by DNA vaccination.

    Science.gov (United States)

    Stifter, Katja; Schuster, Cornelia; Schlosser, Michael; Boehm, Bernhard Otto; Schirmbeck, Reinhold

    2016-01-01

    DNA vaccination is a promising strategy to induce effector T cells but also regulatory Foxp3(+) CD25(+) CD4(+) Treg cells and inhibit autoimmune disorders such as type 1 diabetes. Little is known about the antigen requirements that facilitate priming of Treg cells but not autoreactive effector CD8(+) T cells. We have shown that the injection of preproinsulin (ppins)-expressing pCI/ppins vector into PD-1- or PD-L1-deficient mice induced K(b)/A12-21-monospecific CD8(+) T cells and autoimmune diabetes. A pCI/ppinsΔA12-21 vector (lacking the critical K(b)/A12-21 epitope) did not induce autoimmune diabetes but elicited a systemic Foxp3(+) CD25(+) Treg cell immunity that suppressed diabetes induction by a subsequent injection of the diabetogenic pCI/ppins. TGF-β expression was significantly enhanced in the Foxp3(+) CD25(+) Treg cell population of vaccinated/ppins-primed mice. Ablation of Treg cells in vaccinated/ppins-primed mice by anti-CD25 antibody treatment abolished the protective effect of the vaccine and enabled diabetes induction by pCI/ppins. Adoptive transfer of Treg cells from vaccinated/ppins-primed mice into PD-L1(-/-) hosts efficiently suppressed diabetes induction by pCI/ppins. We narrowed down the Treg-stimulating domain to a 15-residue ppins76-90 peptide. Vaccine-induced Treg cells thus play a crucial role in the control of de novo primed autoreactive effector CD8(+) T cells in this diabetes model. PMID:27406624

  9. Inhibition of GLI1 Expression by Targeting the CRD-BP-GLI1 mRNA Interaction Using a Specific Oligonucleotide.

    Science.gov (United States)

    Mehmood, Kashif; Akhtar, Daud; Mackedenski, Sebastian; Wang, Chuyi; Lee, Chow H

    2016-06-01

    The stabilization of glioma-associated oncogene 1 (GLI1) mRNA by coding region determinant binding protein (CRD-BP) through the Wnt/β-catenin signaling pathway is implicated in the proliferation of colorectal cancer and basal cell carcinoma. Here, we set out to characterize the physical interaction between CRD-BP and GLI1 mRNA so as to find inhibitors for such interaction. Studies using CRD-BP variants with a point mutation in the GXXG motif at each KH domain showed that KH1 and KH2 domain are critical for the binding of GLI1 RNA. The smallest region of GLI1 RNA binding to CRD-BP was mapped to nucleotides (nts) 320-380. A 37-nt S1 RNA sense oligonucleotide, containing two distinct stem-loops present in nts 320-380 of GLI1 RNA, was found to be effective in blocking CRD-BP-GLI1 RNA interaction. Studies using various competitor RNAs with modifications to S1 RNA oligonucleotide further displayed that both the sequences and the structure of the two stem-loops are important for CRD-BP-GLI1 RNA binding. The role of the two-stem-loop motif in influencing CRD-BP-RNA interaction was further investigated in cells. The 2'-O-methyl derivative of the S1 RNA oligonucleotide significantly decreased GLI1, c-myc, and CD44 mRNA levels, in a panel of colon and breast cancer cells. The results from this study demonstrate the potential importance of the two-stem-loop motif as a target region for the inhibition of the CRD-BP-GLI1 RNA interaction and Hedgehog signaling pathway. Such results pave the way for the development of novel inhibitors that act by destabilizing the CRD-BP-GLI1 mRNA interaction. PMID:27036131

  10. Thermodynamic evaluation of new absorbent mixtures of lithium bromide and organic salts for absorption refrigeration machines

    Energy Technology Data Exchange (ETDEWEB)

    Donate, Marina; Rodriguez, Luis; Lucas, Antonio De; Rodriguez, Juan F. [Department of Chemical Engineering, University of Castilla-La Mancha, Avda. de Camilo Jose Cela s/n, 13004 Ciudad Real (Spain)

    2006-01-01

    Mixtures of lithium bromide and organic salts of sodium and potassium (formate, acetate and lactate) have been evaluated as alternative absorbents for absorption refrigeration machines. The main objective is to overpass the limitations of lithium bromide and improve the characteristics and the efficiency of the refrigeration cycle. In order to select the mixture that presents better properties for its employment in absorption refrigeration cycles, a thermodynamic analysis have been done. Density, viscosity, enthalpies of dilution, solubility and vapour pressure data of the proposed mixtures have been measured. A simulation program has been developed to evaluate temperatures, heats exchanged in the different sections and the efficiency of the cycle. (author)

  11. COMPARISON OF ROCURONIUM BROMIDE AND SUCCINYLCHOLINE CHLORIDE FOR USE DURING RAPID SEQUENCE INTUBATION IN ADULTS

    Directory of Open Access Journals (Sweden)

    Ch. Penchalaiah

    2015-08-01

    Full Text Available BACKGROUND AND OBJECTIVE : The goal of rapid sequence intubation is to secure the patients airway smoothly and quickly, minimizing the chances of regurgitation and aspiration of gastric contents. Traditionally succinylcholine chloride has been the neuromuscular blocking drug of choi ce for use in rapid sequence intubation because of its rapid onset of action and profound relaxation. Succinylcholine chloride remains unsurpassed in providing ideal intubating conditions. However the use of succinylcholine chloride is associated with many side effects like muscle pain, bradycardia, hyperkalaemia and rise in intragastric and intraocular pressure. Rocuronium bromide is the only drug currently available which has the rapidity of onset of action like succinylcholine chloride. Hence the present study was undertaken to compare rocuronium bromide with succinylcholine chloride for use during rapid sequence intubation in adult patients. METHODOLOGY : The study population consisted of 90 patients aged between 18 - 60 years posted for various elective su rgeries requiring general anaesthesia . S tudy population was randomly divided into 3 groups with 30 patients in each sub group. 1. Group I : Intubated with 1 mg kg - 1 of succinylcholine chloride (n=30 . 2. Grou p II : Intubated with rocuronium bromide 0.6 mg kg - 1 (n=30 . 3. Group III : Intubated with rocuronium bromide 0.9 mg kg - 1 (n=30 . Intubating conditions were assessed at 60 seconds based on the scale adopted by Toni Magorian et al. 1993. The haemodynamic para meters in the present study were compared using p - value obtained from student t - test . RESULTS : It was noted that succinylcholine chloride 1 mg kg - 1 body weight produced excellent intubating conditions in all patients. Rocuronium bromide 0.6 mg kg - 1 body we ight produced excellent intubating conditions in 53.33% of patients but produced good to excellent intubating conditions in 96.67% of patients. Rocuronium bromide 0.9 mg kg - 1

  12. Cesium Enhances Long-Term Stability of Lead Bromide Perovskite-Based Solar Cells

    OpenAIRE

    Kulbak, Michael; Gupta, Satyajit; Kedem, Nir; Levine, Igal; Bendikov, Tatyana; Hodes, Gary; Cahen, David

    2015-01-01

    Direct comparison between perovskite-structured hybrid organic-inorganic - methyl ammonium lead bromide (MAPbBr3) and all-inorganic cesium lead bromide (CsPbBr3), allows identifying possible fundamental differences in their structural, thermal and electronic characteristics. Both materials possess a similar direct optical band-gap, but CsPbBr3 demonstrates a higher thermal stability than MAPbBr3. In order to compare device properties we fabricated solar cells, with similarly synthesized MAPbB...

  13. Well-Defined Copper(I) Fluoroalkoxide Complexes for Trifluoroethoxylation of Aryl and Heteroaryl Bromides

    KAUST Repository

    Huang, Ronglu

    2015-03-17

    © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim. Copper(I) fluoroalkoxide complexes bearing dinitrogen ligands were synthesized and the structure and reactivity of the complexes toward trifluoroethoxylation, pentafluoropropoxylation, and tetrafluoropropoxylation of aryl and heteroaryl bromides were investigated. Efficiency drive: A series of copper(I) fluoroalkoxide complexes bearing N,N ligands have been prepared and structurally characterized. These well-defined complexes serve as efficient reagents for the fluoroalkoxylation of aryl and heteroaryl bromides to produce a wide range of trifluoroethyl, pentafluoropropyl, and tetrafluoropropyl (hetero)aryl ethers in good to excellent yields.

  14. Bromide and other ions in the snow, firn air, and atmospheric boundary layer at Summit during GSHOX

    Directory of Open Access Journals (Sweden)

    J. E. Dibb

    2010-10-01

    Full Text Available Measurements of gas phase soluble bromide in the boundary layer and in firn air, and Br in aerosol and snow, were made at Summit, Greenland (72.5° N, 38.4° W, 3200 m a.s.l. as part of a larger investigation into the influence of Br chemistry on HOx cycling. The soluble bromide measurements confirm that photochemical activation of Br in the snow causes release of active Br to the overlying air despite trace concentrations of Br in the snow (means 15 and 8 nmol Br kg−1 of snow in 2007 and 2008, respectively. Mixing ratios of soluble bromide above the snow were also found to be very small (mean <1 ppt both years, with maxima of 3 and 4 ppt in 2007 and 2008, respectively, but these levels clearly oxidize and deposit long-lived gaseous elemental mercury and may perturb HOx partitioning. Concentrations of Br in surface snow tended to increase/decrease in parallel with the specific activities of the aerosol-associated radionuclides 7Be and 210Pb. Earlier work has shown that ventilation of the boundary layer causes simultaneous increases in 7Be and 210Pb at Summit, suggesting there is a pool of Br in the free troposphere above Summit in summer time. Speciation and the source of this free tropospheric Br are not well constrained, but we suggest it may be linked to extensive regions of active Br chemistry in the Arctic basin which are known to cause ozone and mercury depletion events shortly after polar sunrise. If this hypothesis is correct, it implies persistence of the free troposphere Br for several months after peak Br activation in March/April. Alternatively, there may be a ubiquitous pool of Br in the free troposphere, sustained by currently unknown sources and processes.

  15. Bromide and other ions in the snow, firn air, and atmospheric boundary layer at Summit during GSHOX

    Directory of Open Access Journals (Sweden)

    J. E. Dibb

    2010-05-01

    Full Text Available Measurements of gas phase soluble bromide in the boundary layer and in firn air, and Br in aerosol and snow, were made at Summit, Greenland (72.5° N, 38.4° W, 3200 m a.s.l. as part of a larger investigation into the influence of Br chemistry on HOx cycling. The soluble bromide measurements confirm that photochemical activation of Br in the snow causes release of active Br to the overlying air despite trace concentrations of Br in the snow (means 15 and 8 nmol Br kg−1 of snow in 2007 and 2008, respectively. Mixing ratios of soluble bromide above the snow were also found to be very small (mean <1 ppt both years, with maxima of 3 and 4 ppt in 2007 and 2008, respectively, but these levels clearly oxidize and deposit long-lived gaseous elemental mercury and may perturb HOx partitioning. Concentrations of Br in surface snow tended to increase/decrease in parallel with the specific activities of the aerosol-associated radionuclides 7Be and 210Pb. Earlier work has shown that ventilation of the boundary layer causes simultaneous increases in 7Be and 210Pb at Summit, suggesting there is a pool of Br in the free troposphere above Summit in summer time. Speciation and the source of this free tropospheric Br are not well constrained, but we suggest it may be linked to extensive regions of active Br chemistry in the Arctic basin which are known to cause ozone and mercury depletion events shortly after polar sunrise. If this hypothesis is correct, it implies persistence of the free troposphere Br for several months after peak Br activation in March/April. Alternatively, there may be a~ubiquitous pool of Br in the free troposphere, sustained by currently unknown sources and processes.

  16. Type-specific interaction between human papillomavirus type 58 E2 protein and E7 protein inhibits E7-mediated oncogenicity

    OpenAIRE

    Wang, Xin; Qi, Mei; Yu, Xiuping; Yuan, Yan; Zhao, Weiming

    2012-01-01

    Human papillomavirus type 58 (HPV-58) is a very common HPV type in eastern Asia. Little is known about its biology and tumorigenesis. In this study, HPV-58 E2 protein (58E2) was found to interact with E7 protein (58E7), and the hinge domain of 58E2 was shown to be responsible for binding to the 58E7 protein. Interestingly, the E2–E7 interaction appears to be HPV type-specific, as we found that the HPV-16 E2 could not bind to the 58E7 protein, and neither did 58E2 interact with HPV-16 E7. The ...

  17. Performance characteristics of single effect lithium bromide/ water absorption chiller for small data centers

    Science.gov (United States)

    Mysore, Abhishek Arun Babu

    A medium data center consists of servers performing operations such as file sharing, collaboration and email. There are a large number of small and medium data centers across the world which consume more energy and are less efficient when compared to large data center facilities of companies such as GOOGLE, APPLE and FACEBOOK. Such companies are making their data center facilities more environmental friendly by employing renewable energy solutions such as wind and solar to power the data center or in data center cooling. This not only reduces the carbon footprint significantly but also decreases the costs incurred over a period of time. Cooling of data center play a vital role in proper functioning of the servers. It is found that cooling consumes about 50% of the total power consumed by the data center. Traditional method of cooling includes the use of mechanical compression chillers which consume lot of power and is not desirable. In order to eliminate the use of mechanical compressor chillers renewable energy resources such as solar and wind should be employed. One such technology is solar thermal cooling by means of absorption chiller which is powered by solar energy. The absorption chiller unit can be coupled with either flat plate or evacuated tube collectors in order to achieve the required inlet temperature for the generator of the absorption chiller unit. In this study a modular data center is considered having a cooling load requirement of 23kw. The performance characteristics of a single stage Lithium Bromide/ water refrigeration is presented in this study considering the cooling load of 23kw. Performance characteristics of each of the 4 heat exchangers within the unit is discussed which helps in customizing the unit according to the users' specific needs. This analysis helps in studying the importance of different properties such as the effect of inlet temperatures of hot water for generator, inlet temperatures of cooling water for absorber and

  18. Brain-specific inactivation of the Crhr1 gene inhibits post-dependent and stress-induced alcohol intake, but does not affect relapse-like drinking

    DEFF Research Database (Denmark)

    Molander, Anna; Vengeliene, Valentina; Heilig, Markus;

    2012-01-01

    Corticotropin-releasing hormone (CRH) and its receptor, CRH receptor-1 (CRHR1), have a key role in alcoholism. Especially, post-dependent and stress-induced alcohol intake involve CRH/CRHR1 signaling within extra-hypothalamic structures, but a contribution of the hypothalamic-pituitary-adrenal (HPA......, a conditional brain-specific Crhr1-knockout (Crhr1(NestinCre)) and a global knockout mouse line were studied for basal alcohol drinking, stress-induced alcohol consumption, deprivation-induced intake, and escalated alcohol consumption in the post-dependent state. In a second set of experiments, we tested CRHR1...... antagonists in the ADE model. Stress-induced augmentation of alcohol intake was lower in Crhr1(NestinCre) mice as compared with control animals. Crhr1(NestinCre) mice were also resistant to escalation of alcohol intake in the post-dependent state. Contrarily, global Crhr1 knockouts showed enhanced stress...

  19. An Oral Salmonella-Based Vaccine Inhibits Liver Metastases by Promoting Tumor-Specific T-Cell-Mediated Immunity in Celiac and Portal Lymph Nodes: A Preclinical Study.

    Science.gov (United States)

    Vendrell, Alejandrina; Mongini, Claudia; Gravisaco, María José; Canellada, Andrea; Tesone, Agustina Inés; Goin, Juan Carlos; Waldner, Claudia Inés

    2016-01-01

    Primary tumor excision is one of the most widely used therapies of cancer. However, the risk of metastases development still exists following tumor resection. The liver is a common site of metastatic disease for numerous cancers. Breast cancer is one of the most frequent sources of metastases to the liver. The aim of this work was to evaluate the efficacy of the orally administered Salmonella Typhi vaccine strain CVD 915 on the development of liver metastases in a mouse model of breast cancer. To this end, one group of BALB/c mice was orogastrically immunized with CVD 915, while another received PBS as a control. After 24 h, mice were injected with LM3 mammary adenocarcinoma cells into the spleen and subjected to splenectomy. This oral Salmonella-based vaccine produced an antitumor effect, leading to a decrease in the number and volume of liver metastases. Immunization with Salmonella induced an early cellular immune response in mice. This innate stimulation rendered a large production of IFN-γ by intrahepatic immune cells (IHIC) detected within 24 h. An antitumor adaptive immunity was found in the liver and celiac and portal lymph nodes (LDLN) 21 days after oral bacterial inoculation. The antitumor immune response inside the liver was associated with increased CD4(+) and dendritic cell populations as well as with an inflammatory infiltrate located around liver metastatic nodules. Enlarged levels of inflammatory cytokines (IFN-γ and TNF) were also detected in IHIC. Furthermore, a tumor-specific production of IFN-γ and TNF as well as tumor-specific IFN-γ-producing CD8 T cells (CD8(+)IFN-γ(+)) were found in the celiac and portal lymph nodes of Salmonella-treated mice. This study provides first evidence for the involvement of LDLN in the development of an efficient cellular immune response against hepatic tumors, which resulted in the elimination of liver metastases after oral Salmonella-based vaccination.

  20. An oral Salmonella-based vaccine inhibits liver metastases by promoting tumor-specific T cell-mediated immunity in celiac & portal lymph nodes. A preclinical study.

    Directory of Open Access Journals (Sweden)

    Alejandrina eVendrell

    2016-03-01

    Full Text Available Primary tumor excision is one of the therapies of cancer most widely used. However, the risk of metastases development still exists following tumor resection. The liver is a common site of metastatic disease for numerous cancers. Breast cancer is one of the most frequent source of metastases to the liver. The aim of this work was to evaluate the efficacy of the orally-administered Salmonella Typhi vaccine strain CVD 915 on the development of liver metastases in a mouse model of breast cancer. To this end, one group of BALB/c mice was immunized with CVD 915 via o.g. while another received PBS as a control. After 24 h, mice were injected with LM3 mammary adenocarcinoma cells into the spleen and subjected to splenectomy. This oral Salmonella-based vaccine produced an antitumor effect, leading to a decrease in the number and volume of liver metastases. Immunization with Salmonella induced an early cellular immune response in mice. This innate stimulation rendered a large production of IFN-γ by intrahepatic immune cells (IHIC detected within 24 h. An antitumor adaptive immunity was found in the liver and celiac & portal lymph nodes (LDLN 21 days after oral bacterial inoculation. The antitumor immune response inside the liver was associated with increased CD4+ and DC cell populations as well as with an inflammatory infiltrate located around liver metastatic nodules. Enlarged levels of inflammatory cytokines (IFN-γ and TNF were also detected in IHIC. Furthermore, a tumor-specific production of IFN-γ and TNF as well as tumor-specific IFN-γ-producing CD8 T cells (CD8+IFN-γ+ were found in the celiac & portal lymph nodes of Salmonella-treated mice. This study provides first evidence for the involvement of LDLN in the development of an efficient cellular immune response against hepatic tumors, which resulted in the elimination of liver metastases after oral Salmonella-based vaccination.

  1. The microwave assisted synthesis of 1-alkyl-3-methylimidazolium bromide as potential corrosion inhibitor toward carbon steel in 1 M HCl solution saturated with carbon dioxide

    Energy Technology Data Exchange (ETDEWEB)

    Pasasa, Norman Vincent A., E-mail: npasasa@gmail.com; Bundjali, Bunbun; Wahyuningrum, Deana [Department of Chemistry, Faculty of Mathematics and Natural Sciences, Institut Teknologi Bandung, Jalan Ganesha No. 10 Bandung, Jawa Barat (Indonesia)

    2015-09-30

    Injection of corrosion inhibitor into the fluid current of oil and gas pipelines is an effective way to mitigate corrosion rate on the inner-surface parts of pipelines, especially carbon steel pipelines. In this research, two alkylimidazolium ionic liquids, 1-decyl-3-methylimidazolium bromide (IL1) and 1-dodecyl-3-methylimidazolium bromide (IL2) have been synthesized and studied as a potential corrosion inhibitor towards carbon steel in 1 M HCl solution saturated with carbon dioxide. IL1 and IL2 were synthesized using microwave assisted organic synthesis (MAOS) method. Mass Spectrometry analysis of IL1 and IL2 showed molecular mass [M-H+] peak at 223.2166 and 251.2484, respectively. The FTIR,{sup 1}H-NMR and {sup 13}C-NMR spectra confirmed that IL1 and IL2 were successfully synthesized. Corrosion inhibition activity of IL1 and IL2 were determined using weight loss method. The results showed that IL1 and IL2 have the potential as good corrosion inhibitors with corrosion inhibition efficiency of IL1 and IL2 are 96.00% at 100 ppm (343 K) and 95.60% at 50 ppm (343 K), respectively. The increase in the concentration of IL1 and IL2 tends to improve their corrosion inhibition activities. Analysis of the data obtained from the weight loss method shows that the adsorption of IL1 and IL2 on carbon steel is classified into chemisorption which obeys Langmuir’s adsorption isotherm.

  2. Once-daily glycopyrronium bromide (Seebri Breezhaler(®)) for the treatment of chronic obstructive pulmonary disease (COPD)

    DEFF Research Database (Denmark)

    Ulrik, Charlotte Suppli

    2015-01-01

    also on health status. Furthermore, glycopyrronium bromide also has beneficial effects on dynamic hyperinflation and, probably by that, exercise tolerance. Glycopyrronium bromide has been shown to reduce the rate of exacerbations in patients with moderate to severe COPD, although as a secondary outcome...

  3. Inhibition of Lysine-Specific Demethylase-1 (LSD1/KDM1A) Promotes the Adipogenic Differentiation of hESCs Through H3K4 Methylation.

    Science.gov (United States)

    Xiong, Yujing; Wang, Enyin; Huang, Yan; Guo, Xiaoyi; Yu, Yiping; Du, Qingyun; Ding, Xiaoyan; Sun, Yingpu

    2016-06-01

    Given their totipotency, human embryonic stem cells (hESCs) can differentiate into all types of cells, including adipocytes, and provide an excellent research model for studying diseases associated with the metabolism of adipocytes, such as obesity and diabetes mellitus. Epigenetic regulation, including DNA methylation and histone modification, plays an essential role in the development and differentiation of hESCs. Lysine-specific demethylase 1 (LSD1), a well-characterized histone-modifying enzyme, demethylates dimethylated histone H3 lysine 4 (H3K4) through a flavin adenine dinucleotide (FAD)-dependent oxidative reaction. LSD1 affects the growth and differentiation of human and mouse ES cells, and the deletion of this gene in mice leads to embryonic lethality. Here, we investigated the functional role of LSD1 during the adipogenic differentiation of hESCs involving the demethylation of H3K4. We also found that treating hESCs with the LSD1 inhibitor CBB1007 promotes the adipogenic differentiation of hESCs. PMID:27059868

  4. Reduced rates and alternatives to methyl bromide for snapdragon production in Florida

    Science.gov (United States)

    A field trial was conducted to evaluate soil solarization, Midas™ (iodomethane:chloropicrin 50:50, Arysta LifeScience Corp., Cary, NC) and different rates and formulations of methyl bromide under standard and metalized films for the production of snapdragon (Antirrhinum majus) in Martin County, Flor...

  5. Iodine catalyzed and tertiary butyl ammonium bromide promoted p reparation of b enzoxazaphosphininyl phenylboronates

    Directory of Open Access Journals (Sweden)

    K. R. Kishore K. Reddy,

    2009-05-01

    Full Text Available Benzoxazaphosphininyl Phenylboronates were prepared by O-Phosphorylation of potassium salt ofphenylboronic acid with cyclic phosphoromonochloridates in the presence of stoichiometric amount of Iodineand catalytic amount of tertiary butyl ammonium bromide at 50-60 °C in dry toluene.

  6. Effect of increasing bromide concentration on toxicity in treated drinking water.

    Science.gov (United States)

    Sawade, Emma; Fabris, Rolando; Humpage, Andrew; Drikas, Mary

    2016-04-01

    Research is increasingly indicating the potential chronic health effects of brominated disinfection by-products (DBPs). This is likely to increase with elevated bromide concentrations resulting from the impacts of climate change, projected to include extended periods of drought and the sudden onset of water quality changes. This will demand more rigorous monitoring throughout distribution systems and improved water quality management at water treatment plants (WTPs). In this work the impact of increased bromide concentration on formation of DBPs following conventional treatment and chlorination was assessed for two water sources. Bioanalytical tests were utilised to determine cytotoxicity of the water post disinfection. Coagulation was shown to significantly reduce the cytotoxicity of the water, indicating that removal of natural organic matter DBP precursors continues to be an important factor in drinking water treatment. Most toxic species appear to form within the first half hour following disinfectant addition. Increasing bromide concentration across the two waters was shown to increase the formation of trihalomethanes and shifted the haloacetic acid species distribution from chlorinated to those with greater bromine substitution. This correlated with increasing cytotoxicity. This work demonstrates the challenges faced by WTPs and the possible effects increasing levels of bromide in source waters could have on public health. PMID:27105403

  7. Palladium-Catalyzed Carbonylation of Aryl Bromides with N-Substituted Cyanamides

    DEFF Research Database (Denmark)

    Lian, Zhong; Friis, Stig D.; Lindhardt, Anders T.;

    2014-01-01

    The palladium(0)-catalyzed three-component coupling reaction of aryl bromides, carbon monoxide, and N-alkyl cyan­amides has been developed employing a two-chamber system with ex situ generation of carbon monoxide from a silacarboxylic acid. The reactions proceeded well and were complete with a...

  8. Mild Pd-catalyzed aminocarbonylation of (hetero)aryl bromides with a palladacycle precatalyst.

    Science.gov (United States)

    Friis, Stig D; Skrydstrup, Troels; Buchwald, Stephen L

    2014-08-15

    A palladacyclic precatalyst is employed to cleanly generate a highly active XantPhos-ligated Pd-catalyst. Its use in low temperature aminocarbonylations of (hetero)aryl bromides provides access to a range of challenging products in good to excellent yields with low catalyst loading and only a slight excess of CO. Some products are unattainable by traditional carbonylative coupling.

  9. Palladium-catalyzed carbonylative sonogashira coupling of aryl bromides using near stoichiometric carbon monoxide

    DEFF Research Database (Denmark)

    Neumann, Karoline T.; Laursen, Simon R.; Lindhardt, Anders T.;

    2014-01-01

    A general procedure for the palladium-catalyzed carbonylative Sonogashira coupling of aryl bromides is reported, using near stoichiometric amounts of carbon monoxide. The method allows a broad substrate scope in moderate to excellent yields. The formed alkynone motive serves as a platform for...

  10. Measurement and Computation of Movement of Bromide Ions and Carbofuran in Ridged HUmic-Sandy Soil

    NARCIS (Netherlands)

    Leistra, M.; Boesten, J.J.T.I.

    2010-01-01

    Water flow and pesticide transport in the soil of fields with ridges and furrows may be more complex than in the soil of more level fields. Prior to crop emergence, the tracer bromide ion and the insecticide carbofuran were sprayed on the humic-sandy soil of a potato field with ridges and furrows. R

  11. Methyl Bromide Alternatives Area-Wide Pest Management Project - South Atlantic Progress Report

    Science.gov (United States)

    Protocols and Standard Operational Procedures (SOPs) were developed for collecting environmental and soil edaphic information during and after application of methyl bromide alternatives. Parameters measured included soil moisture, soil bulk density, percent moisture at field capacity (-0.3 bars wat...

  12. Bromate formation from bromide oxidation by the UV/persulfate process.

    Science.gov (United States)

    Fang, Jing-Yun; Shang, Chii

    2012-08-21

    Bromate formation from bromide oxidation by the UV/persulfate process was investigated, along with changes in pH, persulfate dosages, and bromide concentrations in ultrapure water and in bromide-spiked real water. In general, the bromate formation increased with increasing persulfate dosage and bromide concentration. The bromate formation was initiated and primarily driven by sulfate radicals (SO(4)(•-)) and involved the formation of hypobromous acid/hypobromite (HOBr/OBr(-)) as an intermediate and bromate as the final product. Under the test conditions, the rate of the first step driven by SO(4)(•-) is slower than that of the second step. Direct UV photolysis of HOBr/OBr(-) to form bromate and the photolysis of bromate are insignificant. The bromate formation was similar for pH 4-7 but decreased over 90% with increasing pH from 7 to above 9. Less bromate was formed in the real water sample than in ultrapure water, which was primarily attributable to the presence of natural organic matter that reacts with bromine atoms, HOBr/OBr(-) and SO(4)(•-). The extent of bromate formation and degradation of micropollutants are nevertheless coupled processes unless intermediate bromine species are consumed by NOM in real water. PMID:22831804

  13. Strontium and bromide as tracers in X-ray microanalysis of biological tissue

    Energy Technology Data Exchange (ETDEWEB)

    Wroblewski, J.; Sagstroem, S.M.; Mulders, H.; Roomans, G.M. (Karolinska Institutet, Stockholm (Sweden))

    1989-09-01

    Since energy dispersive X-ray microanalysis cannot distinguish between isotopes of the same element, alternative methods have to be used to get information similar to that obtained in experiments with radioactive tracers. In the present study, strontium was used as a tracer for calcium, and bromide as a tracer for chloride. Rats were injected with strontium chloride in vivo, and the uptake of strontium in the acinar cells of the submandibular gland was studied. Eventually a Sr/Ca ratio of 0.3 was reached. In some animals, secretion of mucus had been elicited by stimulation with isoproterenol 4 h prior to injection of strontium chloride. Exchange of calcium for strontium was enhanced by prior injection with isoproterenol. In a second experiment, rats were injected with sodium bromide, and the uptake of bromide by the submandibular acinar cells was followed in time, both in pilocarpine-stimulated and unstimulated glands. Under the experimental conditions, bromide was rapidly taken up by the cells, and the cellular Br/Cl ratio was close to that found in serum. Submandibular glands take up Br somewhat faster than other tissues (liver, heart muscle, skeletal muscle). The uptake of Br in pancreatic acinar cells was studied in vitro. These experiments showed a 1:1 ratio (molar) exchange of Cl for Br.

  14. Effects of intraoperative magnetic resonance imaging on the neuromuscular blockade of vecuronium bromide in neurosurgery

    International Nuclear Information System (INIS)

    The effects of intraoperative magnetic resonance (iMR) imaging on the neuromuscular blockade of vecuronium bromide were investigated in neurosurgery. Fifty patients with American Society of Anesthesiologists grades I-II scheduled for craniotomy operation were divided into two groups (n=25 each) with no difference in demographic data: the iMR imaging group and control group. Train-of-four (TOF) stimulation through an accelerometer was used to monitor onset, maintenance, and recovery of muscle relaxation caused by vecuronium. Vecuronium bromide was intravenously injected after anesthesia induction. The dosage of vecuronium bromide in the iMR imaging group was larger than in the control group, but not significantly. Duration of vecuronium bromide administration and operation time were significantly longer in the iMR imaging group than in the control group. Time from drug discontinuation to operation termination, and to return to neurosurgery intensive care unit were not different. Time taken by first twitch (T1) in response to TOF stimulation to recover by 25%, and muscle relaxant recovery index were significantly greater in the control group than in the iMR imaging group. The body temperature of the patients increased gradually in the iMR imaging group but decreased in the control group. iMR imaging can prolong the operation time, increase the body temperature of the patient, and remarkably shorten the clinical action time and muscle relaxation recovery index of vecuronium. (author)

  15. Facile Syntheses of N-Substituted Imidazoles and Benzotriazoles from Baylis-Hillman Bromides

    Institute of Scientific and Technical Information of China (English)

    YE Dongyan; LI Jian; LI Chunju; JIA Xueshun

    2009-01-01

    A facile synthesis of N-substituted imidazole and benzotriazole derivatives from Baylis-Hiilman bromides with imidazole and benzotriazole at room temperature was reported. In view of the simple operation, mild reaction con-ditions, good to excellent yields, good regio- and stereoselectivity, the present method exhibited its superiority.

  16. Efficient loading of primary alcohols onto a solid phase using a trityl bromide linker

    DEFF Research Database (Denmark)

    Crestey, François; Ottesen, Lars Korsgaard; Jaroszewski, Jerzy Witold;

    2008-01-01

    The Letter describes an improved, rapid and mild strategy for the loading of primary alcohols onto a polystyrene trityl resin via a highly reactive trityl bromide linker. This protocol facilitates an efficient resin loading even of acid-sensitive or heat-labile alcohols, which otherwise require...

  17. Methyl bromide release from activated carbon and the soil/water/carbon interface

    Science.gov (United States)

    Methyl Bromide (MB) is a major source of stratospheric bromine radical, a known depletor of ozone. The use of ozone-depleting chemicals, including MB, is regulated by the Montreal Protocol. Critical uses of MB are permitted, such as when postharvest fumigation is mandated by an importing country. Fo...

  18. SYNTHESIS AND CATALYTIC PROPERTIES OF CROSS-LINKED HYDROPHOBICALLY ASSOCIATING POLY(ALKYLMETHYLDIALLYLAMMONIUM BROMIDES)

    NARCIS (Netherlands)

    WANG, GJ; ENGBERTS, JBFN

    1994-01-01

    Cross-linked, hydrophobically associating homo- and copolymers were synthesized by free-radical cyclo(co)polymerization of alkylmethyldiallylammonium bromide monomers with a small amount of N,N'-methylenebisacrylamide in aqueous solution using ammonium persulfate as the initiator. The cross-linked h

  19. Effect of increasing bromide concentration on toxicity in treated drinking water.

    Science.gov (United States)

    Sawade, Emma; Fabris, Rolando; Humpage, Andrew; Drikas, Mary

    2016-04-01

    Research is increasingly indicating the potential chronic health effects of brominated disinfection by-products (DBPs). This is likely to increase with elevated bromide concentrations resulting from the impacts of climate change, projected to include extended periods of drought and the sudden onset of water quality changes. This will demand more rigorous monitoring throughout distribution systems and improved water quality management at water treatment plants (WTPs). In this work the impact of increased bromide concentration on formation of DBPs following conventional treatment and chlorination was assessed for two water sources. Bioanalytical tests were utilised to determine cytotoxicity of the water post disinfection. Coagulation was shown to significantly reduce the cytotoxicity of the water, indicating that removal of natural organic matter DBP precursors continues to be an important factor in drinking water treatment. Most toxic species appear to form within the first half hour following disinfectant addition. Increasing bromide concentration across the two waters was shown to increase the formation of trihalomethanes and shifted the haloacetic acid species distribution from chlorinated to those with greater bromine substitution. This correlated with increasing cytotoxicity. This work demonstrates the challenges faced by WTPs and the possible effects increasing levels of bromide in source waters could have on public health.

  20. 76 FR 29238 - Methyl Bromide; Cancellation Order for Registration Amendments To Terminate Certain Soil Uses

    Science.gov (United States)

    2011-05-20

    ... provided, EPA received no comments in response to the February 9, 2011, Federal Register notice (76 FR 7200... AGENCY Methyl Bromide; Cancellation Order for Registration Amendments To Terminate Certain Soil Uses... for the amendments to terminate soil uses, voluntarily requested by the registrants and accepted...

  1. Ozone decomposition under the irradiation of 253.7 nm in the presence of methyl bromide

    Institute of Scientific and Technical Information of China (English)

    2000-01-01

    In this paper the mechanism and kinetic of ozone decomposition under the irradiation of 253.7 nm UV-light were studied.The quantum yield of the ozone depletion in the presence of methyl bromide is further determined and a reaction model is provided to explain the experimental fact.

  2. COMPARISON OF ONSET TIME, DURATION OF ACTION AND INTUBATING CONDITION SACHIEVED WITH SUXAMETHONIUM AND ROCURONIUM BROMIDE

    OpenAIRE

    Ajit P; Alok P; Devendra Singh

    2013-01-01

    Adverse event profile ofSuxamethonium which is still the relaxant of choice to facilitate tracheal intubation inspired us to conduct a study in which we compared Onset time, Duration of Action and Intubating Conditions Achieved with Suxametho nium and Rocuronium Bromide with the Help of TOF Guard. AIMS : W e compared the onset of relaxation time, intubating condition, and duration of action, the ...

  3. Effect of pinaverium bromide on stress-induced colonic smooth muscle contractility disorder in rats

    OpenAIRE

    Dai, Yun; Liu, Jian-Xiang; Li, Jun-Xia; Xu, Yun-Feng

    2003-01-01

    AIM: To investigate the effect of pinaverium bromide, a L-type calcium channel blocker with selectivity for the gastrointestinal tract on contractile activity of colonic circular smooth muscle in normal or cold-restraint stressed rats and its possible mechanism.

  4. Quantitative gas chromatographic mass spectrometric determination of pinaverium-bromide in human serum.

    Science.gov (United States)

    de Weerdt, G A; Beke, R P; Verdievel, H G; Barbier, F; Jonckheere, J A; de Leenheer, A P

    1983-03-01

    A method has been developed for quantitative determination of pinaverium-bromide, a quaternary ammonium derivative with papaverine-like activity, in human serum. The method involves a chloroform extraction of serum spiked with N-(6,6-dimethyl bicyclo[3.1.1]2-heptenyl-ethoxyethyl) perhydro-1,4-oxazine as internal standard. After evaporation of the solvent, and reduction of the residue with Raney-Nickel, the internal standard and the reduced pinaverium-bromide are re-extracted from the reaction mixture with toluene and analysed isothermally on a fused silica column coated with OV-101. Although chemical ionization with methane revealed intense protonated molecular ions for both pinaverium-bromide and the internal standard, selectivity and sensitivity were significantly lower in comparison with electron impact ionization at 70 e V. Therefore, quantification was performed in the electron impact mode by single ion monitoring of the common fragment ion at m/z 100.2. A linear detector response was observed up to 160 ng ml-1. A within-run assay precision better than 2% CV (n = 5) was found, and a detection limit of 1 ng pinaverium-bromide ml-1 of serum was attained. PMID:6850068

  5. TRIBROMOPYRROLE, BROMINATED ACIDS, AND OTHER DISINFECTION BYPRODUCTS PRODUCED BY DISINFECTION OF DRINKING WATER RICH IN BROMIDE

    Science.gov (United States)

    Using gas chromatography/mass spectrometry (GC/MS), we investigated the formation of disinfection byproducts (DBPs) from high bromide waters (2 mg/L) treated with chlorine or chlorine dioxide used in combination with chlorine and chloramines. This study represents the first comp...

  6. Equine infectious anemia viral vector-mediated codelivery of endostatin and angiostatin driven by retinal pigmented epithelium-specific VMD2 promoter inhibits choroidal neovascularization.

    Science.gov (United States)

    Kachi, Shu; Binley, Katie; Yokoi, Katsutoshi; Umeda, Naoyasu; Akiyama, Hideo; Muramatu, Daisuke; Iqball, Sharifah; Kan, On; Naylor, Stuart; Campochiaro, Peter A

    2009-01-01

    Equine infectious anemia virus (EIAV) is a nonprimate lentivirus that does not cause human disease. Subretinal injection into mice of a recombinant EIAV lentiviral vector in which lacZ is driven by a CMV promoter (EIAV CMV LacZ) resulted in rapid and strong expression of LacZ in retinal pigmented epithelial (RPE) cells and some other cells including ganglion cells, resulting in the presence of 5-bromo-4-chloro-3-indolyl-beta-D-galactopyranoside within the optic nerve. Substitution of the RPE-specific promoter from the vitelliform macular dystrophy (VMD2) gene for the CMV promoter resulted in prolonged (at least 1 year) expression of LacZ that was restricted to RPE cells, albeit reduced 6- to 10-fold compared with the CMV promoter. Similarly, the amount of FLAG-tagged endostatin detected in eyes injected with the EIAV VMD2 Endo(FLAG) vector was similar to that seen in eyes injected with a vector that expressed both endostatin and angiostatin [EIAV VMD2 Endo(FLAG)/Angio]; expression was approximately 6-fold lower than with identical vectors in which the CMV promoter drove expression. Compared with murine eyes treated with a control EIAV vector, subretinal injection of EIAV vectors expressing murine endostatin alone or in combination with angiostatin driven by either the CMV or VMD2 promoter caused significant suppression of choroidal neovascularization (NV) at laser-induced rupture sites in Bruch's membrane. These data support proceeding toward clinical studies with EIAV-based gene therapy for choroidal NV, using the VMD2 promoter to selectively drive expression of a combination of endostatin and angiostatin in RPE cells. PMID:20377369

  7. Evaluation of the effect of tetraethylammonium bromide and chloride on the growth and development of terrestrial plants.

    Science.gov (United States)

    Pawłowska, Barbara; Biczak, Robert

    2016-04-01

    Quaternary ammonium salts (QAS), which also include ionic liquids, constitute a vast group of chemical compounds that are increasingly common in the commercial use. This situation may lead to the contamination of the natural environment and may constitute a potential threat to all its elements, including terrestrial higher plants. This paper presents the effect of tetraethylammonium chloride [TEA][Cl] and tetraethylammonium bromide [TEA][Br] on the growth and development of spring barley and common radish. The applied QAS were characterized with phytotoxicity dependent on the concentration of compound and characteristics of the study plants. Spring barley turned out to be highly susceptible plant to the analyzed compounds, which was confirmed by % inhibition of length of plants, root length and fresh weight of plants and by calculated values for EC50, NOEC as well as LOEC. On the contrary, a common radish revealed the resistance to QAS used in the study; although, phytotoxic symptoms were still observed when high concentrations of dry weight of soil were applied (1000, 3000 and 5000 mg/kg). The applied QAS caused oxidative stress symptoms, mainly in spring barley seedlings, which were manifested by decreased assimilation of pigments content, increased hydrogen peroxide (H2O2) and malondialdehyde (MDA) content in plant cells and with a changed activity of superoxide dismutase (SOD), catalase (CAT) and peroxidase (POD). PMID:26844662

  8. Reaction of Polymer-supported Selenovinyl Bromide with Grignard Reagents: A Facile Route to the Synthesis of(E)-1, 2-Disubstituted Olefins

    Institute of Scientific and Technical Information of China (English)

    E TANG; Xiang Jin LIN; Lu Ling WU

    2005-01-01

    Polymer-supported selenovinyl bromide, easily prepared from polymer-supported selenenyl bromide with acetylene, reacts with different Grignard reagents using a step-by-step strategy to obtain (E)-1, 2-disubstituted ethenes in good yields.

  9. [Effectiveness of pinaverium bromide therapy on colonic motility disorders in irritable bowel syndrome].

    Science.gov (United States)

    Wittmann, T; Fehér, A; Rosztóczy, A; Jánosi, J

    1999-02-28

    The special patterns of the slow wave activity in irrittable bowel syndrome by means of surface electromyography were examined and the effect of pinaverium bromide on the symptoms and on the colonic motility in this disease was estimated. Twenty two patients with irritable bowel syndrome and 7 healthy controls were selected to the study. The clinical symptoms were abdominal pain and bloating in all patients, constipation in 9, and diarrhoea in 6 cases. Surface electromyography was carried out before and on the 14th day of the treatment with pinaverium bromide (50 mg t. i. d). The colonic motility was analysed in a 2 hour fasting and a 2 hour postprandial period following a standard (800 kCal) meal. The slow wave frequency of 0.01-0.04 Hz were selected and analysed. The mean frequency of activity peaks (n/10 min) and power-index (area under curve, microV 10 min) were measured. For statistical analysis Student's t-test was applied. Electromyogram of patients with irritable bowel syndrome showed a significant increase of the measured colonic motility parameters both in fasting and postprandial states. Fourteen days of pinaverium bromide treatment was able to significantly reduce the intensity of the colonic motor activity. Administration of pinaverium bromide completely released in 6 and significantly improved the abdominal pain in other 12 patients, while the bloating disappeared in 12 and was significantly improved in 5 from 22 patients. Pinaverium bromide was able to normalise the stool frequency: the weekly number of stools was decreased from 16 to 7 in the patients complaining diarrhoea ant it was increased from 2 to 6 in the patients with constipation. PMID:10204402

  10. Determination of bromine contents in blood and hair of workers exposed to methyl by radioactivation analysis method bromide

    International Nuclear Information System (INIS)

    The bromine contained in blood and hair samples obtained from workers exposed to methyl bromide was analyzed by nondestructive activation analysis. The samples were irradiated for 1 min in pneumatic irradiation facility of Kyoto University research reactor with an estimated thermal neutron flux density at 2 x 1013 n.cm-2.sec-1. The irradiation was counted with Ge(Li) detector. The duration of measurement of radionuclide bromine in blood and hair was 200 sec within 2 - 10 min after irradiation. The bromine content of serum sample obtained from a worker suspected of methyl bromide poisoning was found to be 412 μg/g on 13 days apart from exposure to methyl bromide. The biological half-life of bromine in this case was found to be about 16 days. Then bromine contents in serum and hair samples obtained from workers exposed to methyl bromide were found to be 1.7 and 2.6 times higher respectively than those of nonexposed workers. Any correlations of bromine contents were not observed between serum and hair samples obtained from workers exposed to methyl bromide, nor between bromine amount in the serum of workers exposed to methyl bromide and the terms exposed to it, but statistically significant positive correlation was observed between bromine amount in the hair of workers exposed to methyl bromide and the terms exposed to it. (author)

  11. Comparative microvascular exchange kinetics of [{sup 77}Br]bromide and {sup 99m}Tc-DTPA in humans

    Energy Technology Data Exchange (ETDEWEB)

    Cousins, Claire [Department of Clinical Radiology, Addenbrooke' s Hospital, Cambridge (United Kingdom); Skehan, Stephen J.; Rolph, Susan M.; Flaxman, Mary E.; Ballinger, James R.; Bird, Nicholas J.; Barber, Robert W.; Peters, Michael A. [Department of Nuclear Medicine, Addenbrooke' s Hospital, Cambridge (United Kingdom)

    2002-05-01

    The plasma clearance curves of small hydrophilic solutes comprise three exponentials, consistent with a three-compartmental distribution model. A previous comparison between inulin and diethylene triamine penta-acetic acid (DTPA) suggested that these three compartments are in series, the first being plasma and the second and third representing compartments within the extravascular space. Moreover, whilst the total distribution volumes of these two indicators were similar, the volume of the second compartment was higher for DTPA. The purpose of the current study was to investigate whether a solute smaller than DTPA, namely bromide, fits the hypothesis that the second space volume is an inverse function of the size of the solute. Two groups of subjects were studied: group A comprised eight patients undergoing routine diagnostic arteriography and group B, eight patients referred for routine measurement of glomerular filtration rate plus two normal volunteers. {sup 99m}Tc-DTPA and sodium [{sup 77}Br]bromide were intravenously administered simultaneously. In group A, frequent arterial samples were obtained up to 40 min after injection, and antecubital venous samples 30 s after each arterial sample. In group B, frequent venous samples were obtained up to 280 min after injection. Volume measurements based on bromide were corrected for erythrocyte bromide accumulation. In both subject groups, the normalised venous concentration ratio of bromide to DTPA, corrected for red cell bromide uptake, was significantly less than unity in the earliest blood samples, being 0.56 (SD 0.08) at 1 min, consistent with faster diffusion of bromide from plasma to interstitial fluid. Furthermore, the extraction fraction of bromide from plasma to interstitial fluid in the forearm was about 0.6, higher than that of DTPA (about 0.5) in spite of red cell bromide accumulation which equilibrated with plasma bromide within 20 s and resulted in a red cell to plasma concentration ratio of 0.51 (0

  12. Synthesis of polyhydroxylated pyrrolidines from sugar-derived bromonitriles through a cascade addition of allylmagnesium bromide/cyclization/reduction.

    Science.gov (United States)

    Malik, Michał; Jarosz, Sławomir

    2016-02-01

    The synthesis of polyhydroxylated 2-allylpyrrolidines from sugar-derived bromonitriles in a cascade addition of allylmagnesium bromide/SN2 cyclization/reduction with Zn(BH4)2 is described. The stereochemical course of the reduction step is rationalized. Two of the obtained compounds are transformed into stereoisomers of naturally-occurring iminosugar (+)-lentiginosine. In an alternative approach, 2,2-diallylpyrrolidines are obtained from bromonitriles in a cascade addition of allylmagnesium bromide/SN2 cyclization/addition of another equivalent of allylmagnesium bromide.

  13. Tiotropium bromide in the routine care of GOLD stage II COPD patients: a pharmaeconomic evaluation

    Directory of Open Access Journals (Sweden)

    Orietta Zaniolo

    2011-06-01

    Full Text Available Background: a secondary pre-specified analysis of the UPLIFT cohort demonstrated that the inclusion of tiotropium bromide in the routine care of GOLD stage II (moderate chronic obstructive pulmonary disease (COPD patients is associated with stronger improvements of survival, quality of life, and exacerbation rate than those shown in the total cohort; in this subgroup, tiotropium furthermore induces a significant reduction in the rate of FEV1 decline.Objective: to adapt the Spiriva® model, originally built to evaluate cost-effectiveness of tiotropium inclusion in the general COPD population, to GOLD II patients.Methods: the Spiriva® model is a probabilistic Markov patient-level simulation developed over a lifetime horizon to compare outcomes associated with the inclusion of tiotropium in routine care (RC for COPD treatment with those obtained with RC alone. Patients are characterised by gender, age, height, smoking status and FEV1. Model structure and sources have been maintained unvaried, except for demographic characteristics, specific for GOLD II patients, as extrapolated from an Italian observational study, and tiotropium efficacy, based on the secondary analysis of GOLD II UPLIFT patients. As in the original model, only direct health care costs are considered.Results: patients treated with tiotropium on average (95% CI gain 0.70 (0.00/7.23 LYs or 0.77 (0.02/4.67 QALYs compared to RC. The incremental lifetime cost is € 3,520 (-6,391/26,686, meaning that the incremental cost required to gain a QALY (incremental cost-effectiveness ratio – ICER is equal to € 4,548. Sensitivity analysis shows that tiotropium has a 50% probability of being cost-effective for a willingness-to-pay (WTP around 4,600 €/QALY; 100% probability is achieved with a WTP of € 9,300.Conclusions: the adoption of a strategy based on the inclusion of tiotropium from the early COPD stages represents good value for money in Italy, as the ICER estimated for GOLD II

  14. Atomic basis for the species-specific inhibition of αV integrins by monoclonal antibody 17E6 is revealed by the crystal structure of αVβ3 ectodomain-17E6 Fab complex.

    Science.gov (United States)

    Mahalingam, Bhuvaneshwari; Van Agthoven, Johannes F; Xiong, Jian-Ping; Alonso, José Luis; Adair, Brian D; Rui, Xianliang; Anand, Saurabh; Mehrbod, Mehrdad; Mofrad, Mohammad R K; Burger, Christa; Goodman, Simon L; Arnaout, M Amin

    2014-05-16

    The function-blocking, non-RGD-containing, and primate-specific mouse monoclonal antibody 17E6 binds the αV subfamily of integrins. 17E6 is currently in phase II clinical trials for treating cancer. To elucidate the structural basis of recognition and the molecular mechanism of inhibition, we crystallized αVβ3 ectodomain in complex with the Fab fragment of 17E6. Protein crystals grew in presence of the activating cation Mn(2+). The integrin in the complex and in solution assumed the genuflected conformation. 17E6 Fab bound exclusively to the Propeller domain of the αV subunit. At the core of αV-Fab interface were interactions involving Propeller residues Lys-203 and Gln-145, with the latter accounting for primate specificity. The Propeller residue Asp-150, which normally coordinates Arg of the ligand Arg-Gly-Asp motif, formed contacts with Arg-54 of the Fab that were expected to reduce soluble FN10 binding to cellular αVβ3 complexed with 17E6. This was confirmed in direct binding studies, suggesting that 17E6 is an allosteric inhibitor of αV integrins.

  15. Anthocyanin Induces Apoptosis of DU-145 Cells In Vitro and Inhibits Xenograft Growth of Prostate Cancer

    Science.gov (United States)

    Ha, U-Syn; Bae, Woong Jin; Kim, Su Jin; Yoon, Byung Il; Hong, Sung Hoo; Lee, Ji Youl; Hwang, Tae-Kon; Hwang, Sung Yeoun; Wang, Zhiping

    2015-01-01

    Purpose To investigate the effects of anthocyanins extracted from black soybean, which have antioxidant activity, on apoptosis in vitro (in hormone refractory prostate cancer cells) and on tumor growth in vivo (in athymic nude mouse xenograft model). Materials and Methods The growth and viability of DU-145 cells treated with anthocyanins were assessed using the 3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyltetrazolium bromide (MTT) assay and apoptosis was assessed by DNA laddering. Immunoblotting was conducted to evaluate differences in the expressions of p53, Bax, Bcl, androgen receptor (AR), and prostate specific antigen (PSA). To study the inhibitory effects of anthocyanins on tumor growth in vivo, DU-145 tumor xenografts were established in athymic nude mice. The anthocyanin group was treated with daily oral anthocyanin (8 mg/kg) for 14 weeks. After 2 weeks of treatment, DU-145 cells (2×106) were inoculated subcutaneously into the right flank to establish tumor xenografts. Tumor dimensions were measured twice a week using calipers and volumes were calculated. Results Anthocyanin treatment of DU-145 cells resulted in 1) significant increase in apoptosis in a dose-dependent manner, 2) significant decrease in p53 and Bcl-2 expressions (with increased Bax expression), and 3) significant decrease in PSA and AR expressions. In the xenograft model, anthocyanin treatment significantly inhibit tumor growth. Conclusion This study suggests that anthocyanins from black soybean inhibit the progression of prostate cancer in vitro and in a xenograft model. PMID:25510742

  16. Demethylation of FANCF gene may be a potential treatment through inhibiting the proliferation of cervical cancer

    Institute of Scientific and Technical Information of China (English)

    Min Li; Chanyu Zhang

    2013-01-01

    Objective: The aim of the study was to explore the effect of demethylating agent 5-Aza-2'-deoxycytidine (5-ADC) on expression of Fanconi anemia complementation group F (FANCF) gene and the proliferation of cervical cancer cells, to observe cell's sensitivity to chemotherapeutic drug taxol, and to explore the antitumor effect of 5-ADC as well as the new treatment of cervical cancer. Methods: Cervical cancer cell lines SiHa (FANCF gene full-methylated) and Hela (unmethylated) were treated with 5-ADC. We used the methylation-specific PCR (MSP), reverse transcription-polymerase chain reaction (RT-PCR) and Western blot to detect the FANCF methylation, mRNA and protein respectively. The 3-(4,5-dimethylthiazol-2- yl)-2,5-diphenyltetrazolium bromide (MTT) assay was used to detect the proliferation of cells. The cytotoxicity of taxol was measured by flow cytometer. The nude mice bearing SiHa was used to observe the effect of 5-ADC in vivo. Results: Inhibition of DNA promoter methylation by 5-ADC reactivated the expression of FANCF mRNA and protein in SiHa cells, consistent with decreased growth speed and increased taxol resistance. These results were proven in experiments in vivo. Conclusion: The 5-ADC probably become a potential treatment drug through inhibiting the proliferation of cervical cancer cells in taxol-resistant patients.

  17. Hydrophobic interactions are involved in the inhibition of human leukocyte elastase by alkyltrimethylammonium salts.

    Science.gov (United States)

    Kouadri-Boudjelthia, A; Wallach, J M

    1997-02-01

    Electrostatic forces and hydrophobic interactions had been suggested to modify the adsorption of elastases onto insoluble fibrous elastin, which is the initial stage of elastolysis, but conflicting results had been obtained, and comparison between compounds with different structures was difficult. In order to explore these observations, we have studied the effect of six alkyltrimethylammonium bromides, with alkyl chain length ranging from six to 16 carbon atoms, on human leucocyte elastase activities, either with a synthetic substrate or with insoluble elastin. The enzymatic studies were performed either spectrophotometrically or using conductimetry, and direct binding on to elastin was conductimetrically measured. Binding of the alkyltrimethylammonium salts is increasing with alkyl chain length and we could demonstrate a cooperative binding for tetra- and hexadecyl chains. No effect of the six compounds could be evidenced on hydrolysis of a specific synthetic substrate. With insoluble elastin, elastolysis inhibition could be demonstrated for alkyl chain longer than ten carbon atoms, the effect increasing with chain length. A similar inhibition was observed with the soluble kappa-elastin, but it was less effective. The study shows that the interaction between the alkyltrimethylammonium salts and elastin plays a major role in the inhibitory potency of these molecules. As this effect is enhanced with alkyl chain length, it was concluded that hydrophobic interactions favour their binding, protecting elastin against elastase adsorption.

  18. A novel model-based approach for dose determination of glycopyrronium bromide in COPD

    Directory of Open Access Journals (Sweden)

    Arievich Helen

    2012-12-01

    Full Text Available Abstract Background Glycopyrronium bromide (NVA237 is an inhaled long-acting muscarinic antagonist in development for treatment of COPD. This study compared the efficacy and safety of once-daily (OD and twice-daily (BID glycopyrronium bromide regimens, using a novel model-based approach, in patients with moderate-to-severe COPD. Methods Double-blind, randomized, dose-finding trial with an eight-treatment, two-period, balanced incomplete block design. Patients (smoking history ≥10 pack-years, post-bronchodilator FEV1 ≥30% and 1/FVC 1 at Day 28. Results 385 patients (mean age 61.2 years; mean post-bronchodilator FEV1 53% predicted were randomized; 88.6% completed. All OD and BID dosing regimens produced dose-dependent bronchodilation; at Day 28, increases in mean trough FEV1 versus placebo were statistically significant for all regimens, ranging from 51 mL (glycopyrronium bromide 12.5 μg OD to 160 mL (glycopyrronium bromide 50 μg BID. Pharmacodynamic steady-state was reached by Day 7. There was a small separation (≤37 mL between BID and OD dose–response curves for mean trough FEV1 at steady-state in favour of BID dosing. Over 24 hours, separation between OD and BID regimens was even smaller (FEV1 AUC0-24h maximum difference for equivalent daily dose regimens: 8 mL. Dose–response results for FEV1 at 12 hours, FEV1 AUC0-12h and FEV1 AUC0-4h at steady-state showed OD regimens provided greater improvement over placebo than BID regimens for total daily doses of 25 μg, 50 μg and 100 μg, while the reverse was true for OD versus BID regimens from 12–24 hours. The 12.5 μg BID dose produced a marginally higher improvement in trough FEV1 versus placebo than 50 μg OD, however, the response at 12 hours over placebo was suboptimal (74 mL. Glycopyrronium bromide was safe and well tolerated at all doses. Conclusions Glycopyrronium bromide 50 μg OD provides significant bronchodilation over a 24 hour period

  19. Facile Synthesis of Heterocycles via 2-Picolinium Bromide and Antimicrobial Activities of the Products

    Directory of Open Access Journals (Sweden)

    Elham S. Darwish

    2008-05-01

    Full Text Available The 2-picolinium N-ylide 4, generated in situ from the N-acylmethyl-2-picolinium bromide 3, underwent cycloaddition to N-phenylmaleimide or carbon disulfideto give the corresponding cycloadducts 6 and 8, respectively similar reactions ofcompound 3 with some electron-deficient alkenes in the presence of MnO2 yielded theproducts 11 and 12. In addition, reaction of 4 with arylidene cyanothioacetamide andmalononitrile derivatives afforded the thiophene and aniline derivatives 15 and 17,respectively. Heating of picolinium bromide 3 with triethylamine in benzene furnished 2-(2-thienylindolizine (18. The structures of the isolated products were confirmed byelemental analysis as well as by 1H- and 13C-NMR, IR, and MS data. Both thestereochemistry and the regioselectivity of the studied reactions are discussed. Thebiological activity of the newly synthesized compounds was examined and showedpromising results.

  20. Indirect complexometric determination of mercury(II) using potassium bromide as selective masking agent

    International Nuclear Information System (INIS)

    A complexometric method for the determination of mercury in presence of other metal ions based on the selective masking ability of potassium bromide towards mercury is described. Mercury(II) present in a given sample solution is first complexed with a known excess of EDTA and the surplus EDTA is titrated against zinc sulfate solution at pH 5-6 using xylenol orange as the indicator. A known excess of 10 % solution of potassium bromide is then added and the EDTA released from Hg-EDTA complex is titrated against standard zinc sulfate solution. Reproducible and accurate results are obtained for 8 mg to 250 mg of mercury(II) with a relative error ±0.28 % and standard deviations /leg 0.5 mg. The interference of various ions is studied. This method was applied to the determination of mercury(II) in its alloys. (author)

  1. Thermodynamic Properties of Hydrogen + Tetra-n-Butyl Ammonium Bromide Semi-Clathrate Hydrate

    Directory of Open Access Journals (Sweden)

    Shunsuke Hashimoto

    2010-01-01

    Full Text Available Thermodynamic stability and hydrogen occupancy on the hydrogen + tetra-n-butyl ammonium bromide semi-clathrate hydrate were investigated by means of Raman spectroscopic and phase equilibrium measurements under the three-phase equilibrium condition. The structure of mixed gas hydrates changes from tetragonal to another structure around 95 MPa and 292 K depending on surrounding hydrogen fugacity. The occupied amount of hydrogen in the semi-clathrate hydrate increases significantly associated with the structural transition. Tetra-n-butyl ammonium bromide semi-clathrate hydrates can absorb hydrogen molecules by a pressure-swing without destroying the hydrogen bonds of hydrate cages at 15 MPa or over.

  2. Formation pathways of brominated products from benzophenone-4 chlorination in the presence of bromide ions

    Institute of Scientific and Technical Information of China (English)

    Ming Xiao; Dongbin Wei; Liping Li; Qi Liu; Huimin Zhao; Yuguo Du

    2014-01-01

    The brominated products,formed in chlorination treatment of benzophenone-4 in the presence of bromide ions,were identified,and the formation pathways were proposed.Under disinfection conditions,benzophenone-4 would undertake electrophilic substitution generating mono-or di-halogenated products,which would be oxidized to esters and further hydrolyzed to phenol derivatives.The generated catechol intermediate would be transformed into furan-like heterocyclic product.The product species were pH-dependent,while benzophenone-4 ehmination was chlorine dose-dependent.When the chlorination treatment was performed on ambient water spiked with benzophenone-4 and bromide ions,most of brominated byproducts could be detected,and the acute toxicity significantly increased as well.

  3. Synthesis of Dimethyl Aryl Acylsulfonium Bromides from Aryl Methyl Ketones in a DMSO-HBr System

    OpenAIRE

    Zhiling Cao; Dahua Shi; Yingying Qu; Chuanzhou Tao; Weiwei Liu; Guowei Yao

    2013-01-01

    A new, simplified method for the synthesis of dimethyl aryl acylsulfonium salts has been developed. A series of dimethyl aryl acylsulfonium bromides were prepared by the reaction of aryl methyl ketones with hydrobromic acid and dimethylsulfoxide (DMSO). This sulfonium salt confirms that bromine production and the bromination reaction take place in the DMSO-HBr oxidation system. What’s more, it is also a key intermediate for the synthesis of arylglyoxals.

  4. Linear free energy relationship in reactions between diphenyl amine and benzyl bromides

    Indian Academy of Sciences (India)

    S Ranga Reddy; P Manikyamba

    2006-05-01

    Rate of reaction between benzyl bromide and diphenyl amine is retarded by electron-donating groups and enhanced by electron-withdrawing groups present on the benzene ring of the substrate. Hammett's reaction constant of the reaction decreases with increase in temperature according to the equation, \\rho = -11.92 + 3.54/ T. Minimal structural effects observed are attributed to the fact that the isokinetic temperature of the reaction is close to the reaction temperature.

  5. Comparison of injection drotaverine and injection valethamate bromide on duration and course of labor

    OpenAIRE

    Pradnya Rajendra Changede

    2016-01-01

    Background: Numerous drugs have been used to shorten the active phase of labor. How rationale is it to use these drugs to shorten the active phase of labor? Do they really shorten the duration of labor? What adverse effects do they have on the baby and the mother? These questions were the basis to perform the present study of comparing two of such drugs, injection drotaverine and injection Valethamate bromide with control subjects. Methods: This was a prospective study conducted in a terti...

  6. Effect of Impeller Agitation on Preparation of Tetra-n-Butyl Ammonium Bromide Semiclathrate Hydrate Slurries

    OpenAIRE

    Yoshiro Inoue; Kazunari Ohgaki; Shunsuke Hashimoto; Hiroyuki Ito

    2012-01-01

    The slurries-containing tetra-n-butyl ammonium bromide (TBAB) solution and its semiclathrate hydrate have attracted a lot of interest as latent heat transport media. These hydrate slurries contain some microparticles of crystal, and the size and shape of these hydrate particles could affect the mobility of slurries. Hence, it is essential to investigate the efficient hydrate-slurry preparation methods and the effect of hydrate particles on the fluid property of slurries for the application to...

  7. Acute hepatitis after starting pinaverium bromide in a patient taking mirtazapine

    OpenAIRE

    Tak, Sandeep; Tak, Shubhanjali

    2014-01-01

    A 56-year-old man presented with chronic abdominal pain. He had been evaluated extensively in the recent past undergoing upper gastrointestinal endoscopy, colonoscopy and CT scan of the abdomen with normal results. The provisional diagnosis of irritable bowel syndrome was performed and pinaverium bromide was started. The patient had pre-existing hypertension, a major depressive disorder and gastro-oesophageal reflux disease. He had been taking nebivolol and pantoprazole for several years and ...

  8. Role of pinaverium bromide in south Indian patients with irritable bowel syndrome.

    Science.gov (United States)

    Jayanthi, V; Malathi, S; Ramathilakam, B; Dinakaran, N; Balasubramanian, V; Mathew, S

    1998-04-01

    The effect of pinaverium bromide in controlling gastrointestinal symptoms in 61 patients with irritable bowel syndrome was studied, as an open trial. Individually, there was significant relief in abdominal discomfort/pain as well as in bowel symptoms in most of the patients. Abdominal pain was reduced in 49%, stool consistency improved in 74%, straining and urgency decreased in 71% and mucus decreased in 64%. Tolerance to the drug administered was good and side-effects reported were few. PMID:11273320

  9. Tetrabutylammonium Bromide (TBABr)-Based Deep Eutectic Solvents (DESs) and Their Physical Properties

    OpenAIRE

    Rizana Yusof; Emilia Abdulmalek; Kamaliah Sirat; Mohd. Basyaruddin Abdul Rahman

    2014-01-01

    Density, viscosity and ionic conductivity data sets of deep eutectic solvents (DESs) formed by tetrabutylammonium bromide (TBABr) paired with ethlyene glycol, 1,3-propanediol, 1,5-pentanediol and glycerol hydrogen bond donors (HBDs) are reported. The properties of DES were measured at temperatures between 303 K and 333 K for HBD percentages of 66.7% to 90%. The effects of HBDs under different temperature and percentages are systematically analyzed. As expected, the measured density and viscos...

  10. Tiotropium bromide in the routine care of GOLD stage II COPD patients: a pharmaeconomic evaluation

    OpenAIRE

    Orietta Zaniolo; Michela Carsi; Sergio Iannazzo

    2011-01-01

    Background: a secondary pre-specified analysis of the UPLIFT cohort demonstrated that the inclusion of tiotropium bromide in the routine care of GOLD stage II (moderate) chronic obstructive pulmonary disease (COPD) patients is associated with stronger improvements of survival, quality of life, and exacerbation rate than those shown in the total cohort; in this subgroup, tiotropium furthermore induces a significant reduction in the rate of FEV1 decline.Objective: to adapt the Spiriva® model, o...

  11. Flight Experiment to Study Double-Diffusive Instabilities in Silver-Doped Lead Bromide Crystals

    Science.gov (United States)

    Singh, N. B.; Rosch, W. R.; Suhre, D. R.; Coriell, S. R.; Duval, W. M. B.

    1999-01-01

    A detailed study on the effect of convection on crystal quality was carried out by growing lead bromide crystals in transparent Bridgman furnace. Direct observations were made on the solid-liquid interface and a new kind of instability was observed. This could be explained on the basis of toroidal flow in the AgBr-doped lead bromide sample. With the increasing translation velocity, the interface changed from flat to depressed, and then formed a cavity in the center of the growth tube. The crystal grown at the lowest thermal Rayleigh number showed the highest quality and crystal grown at the largest thermal Rayleigh number showed the worst quality. Numerical studies were carried out to provide a framework for interpreting the observed convective and morphological instabilities, and to determine the critical (limiting) concentration of dopant for a particular growth velocity and gravity level. Theoretical instability diagrams were compared with data obtained from the experimental studies. These studies provided basic data on convective behavior in doped lead bromide crystals grown by the commercially important Bridgman process.

  12. A bio-product as alternative to methyl bromide for replant disease control on strawberry

    Institute of Scientific and Technical Information of China (English)

    Yu ZHANG; Tongle HU; Lijing JI; Keqiang CAO

    2008-01-01

    Pre-plant soil fumigation with methyl bromide (MB) is a standard practice for controlling soil-borne diseases especially for strawberry diseases. However, the application of MB will be forbidden in China in the year 2015. For this reason, a bio-product named Kangdi 3 was tested as an alternative to MB in strawberry greenhouses in Mancheng (Hebei Province) and Donggang (Liaoning province), China in 2005 and 2006. Methyl bromide at a normal dosage of 500 kg/hm2 and Kangdi 3 at three dosages of 750, 1500 and 2250 kg/hm2 were tested. Plots without any treatment were used as the control. During the growing stage, assessments were made on fungal communities in rhizosphere, growth status of strawberry, the disease levels on roots as well as the yields. Results showed that Kangdi 3 significantly reduced the quantity of fungi and the disease index, while enhancing strawberry growth and the yields compared with the untreated control. Therefore, Kangdi 3 is a great potential substitute for methyl bromide to control replant diseases in strawberry.

  13. Transport of bromide measured by soil coring, suction plates, and lysimeters under transient flow conditions.

    Science.gov (United States)

    Kasteel, R.; Pütz, Th.; Vereecken, H.

    2003-04-01

    Lysimeter studies are one step within the registration procedure of pesticides. Flow and transport in these free-draining lysimeters do not reflect the field situation mainly because of the occurence of a zone of local saturation at the lower boundary (seepage face). The objective of this study is to evaluate the impact of flow and transport behaviour of bromide detected with different measuring devices (lysimeters, suction plates, and soil coring) by comparing experimental results with numerical simulations in heterogeneous flow domains. We applied bromide as a small pulse to the bare soil surface (Orthic Luvisol) of the three devices and the displacement of bromide was regurlarly sampled for three years under natural wheather conditions. Based on the mean breakthrough curves we observe experimentally that lysimeters have a lower effective pore-water velocity and exhibit more solute spreading resulting in a larger dispersivity than the suction plates. This can be ascribed to the artefact of the lower boundary. We performed numerical transport simulations in 2-D heterogeneous flow fields (scaling approach) choosing appropriate boundary conditions for the various devices. The simulations allow to follow the temporal evolution of flow and transport processes in the various devices and to gain additional process understanding. We conclude that the model is essentially capable to reproduce the main experimental findings only if we account for the spatial correlation structure of the hydraulic properties, i.e. soil heterogeneity.

  14. Recent trends in atmospheric methyl bromide: analysis of post-Montreal Protocol variability

    Directory of Open Access Journals (Sweden)

    S. A. Yvon-Lewis

    2009-03-01

    Full Text Available The atmospheric methyl bromide (CH3Br burden has declined in recent years, in response to the phaseout of agricultural and structural fumigation consumption under the amendments to the Montreal Protocol. The timing and magnitude of this decrease represents an opportunity to examine our current understanding of the CH3Br budget, the phaseout schedule, and recent estimates of interannual variability in biomass burning and global OH. In this study, simulations obtained from a time-dependent global model of atmospheric CH3Br emissions and uptake are compared to observations from the NOAA flask network. The model includes an updated global methyl bromide source inventory that includes biofuel combustion emissions estimated at 6.1±3 Gg yr−1 globally. The phaseout of CH3Br production for agricultural uses began in 1998, concurrent with the pulse in biomass burning associated with the 1998 El Niño. The combined effects of three factors (biomass burning, global OH, and anthropogenic phaseout appear to explain most of the observed atmospheric methyl bromide trend over the 1997–2005 period. The global budget remains imbalanced, with a large missing source. These results suggest that more than 80% of the missing source does not exhibit significant interannual variability during the phaseout period and, therefore, does not result from underestimating agricultural CH3Br emissions.

  15. Replacing methyl bromide in annual strawberry production with glucosinolate-containing green manure crops.

    Science.gov (United States)

    Lazzeri, Luca; Baruzzi, Gianluca; Malaguti, Lorena; Antoniacci, Loredana

    2003-09-01

    The use of biocidal green manure crops is an agronomic technique for amending soil with fresh organic matter containing volatile compounds active in controlling some soil-borne pests and diseases. Two new selections of the Brassicaceae family were cultivated, incorporated before planting strawberries and tested as an alternative to fumigation with methyl bromide. Two biocidal green manure crops (Brassica juncea L sel ISCI20, Eruca sativa Mill cv Nemat) containing glucosinolate-myrosinase systems, a conventional green manure (barley), untreated soil and a fumigated control were evaluated during two seasons. The effect of these soil management systems on subsequent strawberry performance was evaluated by monitoring yield and plant growth parameters. In both years, biocidal plant green manure treatments led to a fruit yield lower than with methyl bromide, but higher than with conventional green manure or untreated soil. These results confirm the good prospects for biocidal green manures, not only as an environmentally friendly alternative to methyl bromide in conventional agriculture, but also in organic agriculture as an alternative to conventional green manure crops.

  16. Toxic impact of bromide and iodide on drinking water disinfected with chlorine or chloramines.

    Science.gov (United States)

    Yang, Yang; Komaki, Yukako; Kimura, Susana Y; Hu, Hong-Ying; Wagner, Elizabeth D; Mariñas, Benito J; Plewa, Michael J

    2014-10-21

    Disinfectants inactivate pathogens in source water; however, they also react with organic matter and bromide/iodide to form disinfection byproducts (DBPs). Although only a few DBP classes have been systematically analyzed for toxicity, iodinated and brominated DBPs tend to be the most toxic. The objectives of this research were (1) to determine if monochloramine (NH2Cl) disinfection generated drinking water with less toxicity than water disinfected with free chlorine (HOCl) and (2) to determine the impact of added bromide and iodide in conjunction with HOCl or NH2Cl disinfection on mammalian cell cytotoxicity and genomic DNA damage induction. Water disinfected with chlorine was less cytotoxic but more genotoxic than water disinfected with chloramine. For both disinfectants, the addition of Br(-) and I(-) increased cytotoxicity and genotoxicity with a greater response observed with NH2Cl disinfection. Both cytotoxicity and genotoxicity were highly correlated with TOBr and TOI. However, toxicity was weakly and inversely correlated with TOCl. Thus, the forcing agents for cytotoxicity and genotoxicity were the generation of brominated and iodinated DBPs rather than the formation of chlorinated DBPs. Disinfection practices need careful consideration especially when using source waters containing elevated bromide and iodide.

  17. The Effect of Ozonation Process on Bromide-Containing Groundwaters in Bandung Area and Its Surroundings

    Directory of Open Access Journals (Sweden)

    Mindriany Syafila

    2012-11-01

    Full Text Available Disinfection process was applied as the last step of the water treatment to kill pathogenic bacteria in the water. However, according to several studies, the ozonation disinfection process could form undesired by-products. One of the by-products potentially affecting human life is bromate produced from bromide ionic-containing water. This study was carried out to examine the effect of raw water characteristics and pH on bromate formation. Also, the performance of bromate formation for a period of exposure time was analyzed. Raw waters taken from four different areas around Bandung were exposed to ozone introduced to a reactor with a flow rate of 2 L/min. The pH of the raw waters varied from 4, 7 to 10. The results show that there was no evidence of an initial bromide ion concentration, whereas a change in pH value gives a significantly different outcome. In acidic condition (pH of 4 the bromate formation tends to decrease, whereas when the pH value increases to a pH of 10, the bromate formation increases. Therefore, for drinking water with a neutral pH, when bromide ions are detected in the raw water, the drinking water may be toxic due to the presence of bromate.

  18. Efficient ring-closing metathesis of alkenyl bromides: the importance of protecting the catalyst during the olefin approach.

    Science.gov (United States)

    Gatti, Michele; Drinkel, Emma; Wu, Linglin; Pusterla, Ivano; Gaggia, Fiona; Dorta, Reto

    2010-11-01

    We present the first productive ring-closing metathesis reaction that leads to the construction of cyclic alkenyl bromides. Efficient catalysis employing commercially available Grubbs II catalyst is possible through appropriate modification of the starting bromoalkene moiety.

  19. Prostate cancer and toxicity from critical use exemptions of methyl bromide: Environmental protection helps protect against human health risks

    Directory of Open Access Journals (Sweden)

    Budnik Lygia T

    2012-01-01

    Full Text Available Abstract Background Although ozone-depleting methyl bromide was destined for phase-out by 2005, it is still widely applied as a consequence of various critical-use-exemptions and mandatory international regulations aiming to restrict the spread of pests and alien species (e.g. in globalized transport and storage. The withdrawal of methyl bromide because of its environmental risk could fortuitously help in the containment of its human toxicity. Methods We performed a systematic review of the literature, including in vitro toxicological and epidemiological studies of occupational and community exposure to the halogenated hydrocarbon pesticide methyl bromide. We focused on toxic (especially chronic or carcinogenic effects from the use of methyl bromide, on biomonitoring data and reference values. Eligible epidemiological studies were subjected to meta-analysis. Results Out of the 542 peer reviewed publications between 1990-2011, we found only 91 referring to toxicity of methyl bromide and 29 using the term "carcinogenic", "neoplastic" or "mutagenic". Several studies provide new additional data pertaining to the mechanistic aspects of methyl bromide toxicity. Few studies have performed a detailed exposure assessment including biomonitoring. Three evaluated epidemiological studies assessed a possible association between cancer and methyl bromide. Overall, exposure to methyl bromide is associated with an increased risk of prostate cancer OR, 1.21; 95% CI (0,98-1.49, P = 0.076. Two epidemiological studies have analyzed environmental, non-occupational exposure to methyl bromide providing evidence for its health risk to the general public. None of the epidemiological studies addressed its use as a fumigant in freight containers, although recent field and case reports do refer to its toxic effects associated with its use in shipping and storage. Conclusions Both the epidemiological evidence and toxicological data suggest a possible link between methyl

  20. Comparison of pinaverium bromide, manganese chloride and D600 effects on electrical and mechanical activities in rat uterine smooth muscle.

    Science.gov (United States)

    Mironneau, J; Lalanne, C; Mironneau, C; Savineau, J P; Lavie, J L

    1984-02-10

    The effects of pinaverium bromide, were compared with those of D600 and manganese chloride (Mn), on membrane potentials, ionic currents and isometric contractions in uterine smooth muscle strips from pregnant rats. Pinaverium bromide (10(-7) - 10(-6) M) depressed twitch contractions and K-contractures within 15-20 min while D600 (2 X 10(-6) M) and Mn (10(-3) M) abolished both contractions. D600 and pinaverium bromide were more potent inhibitors in K-depolarized preparations than in polarized tissues. At a supramaximal dose (10(-5) M), pinaverium bromide decreased the rate of rise, amplitude, and rate of repolarization of the action potential, and prolonged the potential duration. The inward Ca current was depressed and the reduction in Cai was responsible for the decrease in K current. Pinaverium bromide (10(-5) M) depressed the myometrial contractions induced in Ca-free solution by acetylcholine (10(-4) M) and by prolonged membrane depolarizations. Mn (2.5 X 10(-3) M) only reduced the Ach-induced contraction and D600 (10(-5) M) had no effect on intracellular Ca stores. The results indicate that pinaverium bromide has Ca channel blocking properties similar to those of currently used Ca antagonists; it may also exert an effect to depress contractions supported by intracellular Ca release. PMID:6325214

  1. Labelling of polysaccharides using [{sup 11}C]cyanogen bromide. In vivo and in vitro evaluation of {sup 11}C-hyaluronan uptake kinetics

    Energy Technology Data Exchange (ETDEWEB)

    Westerberg, Goeran; Bergstroem, Mats; Gustafson, Stefan; Lindqvist, Ulla; Sundin, Anders; Laangstroem, Bengt

    1995-02-01

    A method for the {sup 11}C-labelling of polysaccharides in high specific radioactivity is described. Dextran and hyaluronan were treated with [{sup 11}C]cyanogen bromide in aqueous solution at pH 11.5 to give 30-47% radiochemical yields with higher than 98% radiochemical purity in synthesis times of 24-26 min counted from the end of bombardment. Specific radioactivities at the end of synthesis ranged from 0.12 to 3.1 Ci/{mu}mol. The biodistribution kinetics of [{sup 11}C]hyaluronan injected intravenously was studied in rats by means of positron emission tomography, showing a rapid and displaceable uptake in liver. Uptake and displacement of [{sup 11}C]hyaluronan was also demonstrated in cultured rat liver endothelial cells.

  2. Inhibition behavior of some new mixed additives upon copper electrowinning

    Institute of Scientific and Technical Information of China (English)

    YU Run-lan; LIU Qing-ming; QIU Guan-zhou; FANG Zheng; TAN Jian-xi; YANG Peng

    2008-01-01

    As thiourea and sulfur-containing mixed additives contaminate cathodic copper, inhibition behavior of some new mixed additives such as gelatin+hexadecylpyridinium bromide (HDPBr), gelatin+polyethylene glycol(PEG), gelatin+polyacryl amide (PAM), gelatin+PEG+cetyl-tri-methyl ammonium bromide (CTABr) and gelatin+PAM+CTABr was investigated by cyclic voltammetry as well as cathodic polarization in order to improve the quality of cathodic copper in bio-metallurgical process. The results indicate that the inhibition performances of these additives are dependent on complex and adsorption behaviors as well as the deposit potential. For a solution of acidic copper sulpate containing 40 g/L Cu2+ and 180 g/L H2SO4, the additive (gelatin+HDPBr) is the most efficient among the investigated additives because HDPBr with a large organic cation and π electron can adsorb on the cathodic surface to block the active sites and Br- ion can precipitate Cu,'2+. To form Cu2Br2. The additive (gelatin+PAM) also has a better inhibition performance, while the additives (gelatin+PEG), (gelatin+PEG+CTABr) and (gelatin+PAM+CTABr) are comparatively lower inhibition performance compared with the additive (gelatin+thiourea) which has been frequently used so far.

  3. The Inhibition of Stat5 by a Peptide Aptamer Ligand Specific for the DNA Binding Domain Prevents Target Gene Transactivation and the Growth of Breast and Prostate Tumor Cells

    Directory of Open Access Journals (Sweden)

    Vida Vafaizadeh

    2013-08-01

    Full Text Available The signal transducer and activator of transcription Stat5 is transiently activated by growth factor and cytokine signals in normal cells, but its persistent activation has been observed in a wide range of human tumors. Aberrant Stat5 activity was initially observed in leukemias, but subsequently also found in carcinomas. We investigated the importance of Stat5 in human tumor cell lines. shRNA mediated downregulation of Stat5 revealed the dependence of prostate and breast cancer cells on the expression of this transcription factor. We extended these inhibition studies and derived a peptide aptamer (PA ligand, which directly interacts with the DNA-binding domain of Stat5 in a yeast-two-hybrid screen. The Stat5 specific PA sequence is embedded in a thioredoxin (hTRX scaffold protein. The resulting recombinant protein S5-DBD-PA was expressed in bacteria, purified and introduced into tumor cells by protein transduction. Alternatively, S5-DBD-PA was expressed in the tumor cells after infection with a S5-DBD-PA encoding gene transfer vector. Both strategies impaired the DNA-binding ability of Stat5, suppressed Stat5 dependent transactivation and caused its intracellular degradation. Our experiments describe a peptide based inhibitor of Stat5 protein activity which can serve as a lead for the development of a clinically useful compound for cancer treatment.

  4. Measurement and computation of movement of bromide ions and carbofuran in ridged humic-sandy soil.

    Science.gov (United States)

    Leistra, Minze; Boesten, Jos J T I

    2010-07-01

    Water flow and pesticide transport in the soil of fields with ridges and furrows may be more complex than in the soil of more level fields. Prior to crop emergence, the tracer bromide ion and the insecticide carbofuran were sprayed on the humic-sandy soil of a potato field with ridges and furrows. Rainfall was supplemented by sprinkler irrigation. The distribution of the substances in the soil profile of the ridges and furrows was measured on three dates in the potato growing season. Separate ridge and furrow systems were simulated by using the pesticide emission assessment at regional and local scales (PEARL) model for pesticide behavior in soil-plant systems. The substances travelled deeper in the furrow soil than in the ridge soil, because of runoff from the ridges to the furrows. At 19 days after application, the peak of the bromide distribution was measured to be in the 0.1-0.2 m layer of the ridges, while it was in the 0.3-0.5 m layer of the furrows. After 65 days, the peak of the carbofuran distribution in the ridge soil was still in the 0.1 m top layer, while the pesticide was rather evenly distributed in the top 0.6 m of the furrow soil. The wide ranges in concentration measured with depth showed that preferential water flow and substance transport occurred in the sandy soil. Part of the bromide ion distribution was measured to move faster in soil than the computed wave. The runoff of water and pesticide from the ridges to the furrows, and the thinner root zone in the furrows, are expected to increase the risk of leaching to groundwater in ridged fields, in comparison with more level fields.

  5. ACCIDENTAL SUBCUTANEOUS INJECTION OF VECURONIUM BROMIDE IN A PATIENT WITH BURNS

    Directory of Open Access Journals (Sweden)

    Usha Dev

    2014-10-01

    Full Text Available BACKGROUND AND OBJECTIVES: In patients with burn injury drug pharmacology will be altered and this poses special anaesthetic challenge when an subcutaneous injection of a non- depolarizing muscle relaxant occurs in such a patient. Small studies remain an important source of knowledge and hence this study aims to provide information on the anaesthetic management in a case of accidental subcutaneous injection of vecuronium bromide in a burns patient. PRESENTATION, DIAGNOSIS & MANAGEMENT: A 22 year young male with 4 days old hot water induced grade 1 burns involving 45% of body surface area was posted for burns dressing. Anaesthesia was induced with propofol and vecuronium bromide through an external jugular vein to aid tracheal intubation. As the patient was not anaesthetized even after 10 minutes routine check lead to the discovery of fullness at the tip of the intravenous catheter indicating an extravasation of the drugs. Hence the other external jugular vein was cannulated and the patient induced and intubated using propofol, sevoflurane, nitrous oxide and oxygen. The action of vecuronium outlasted the duration of surgery. So the patient continued to receive support of mechanical ventilation with nitrous oxide and oxygen. It took 130 minutes for the clinical signs of recovery from the muscle relaxant to manifest. He was then reversed & extubated with subsequent good recovery. CONCLUSION: Subcutaneous injection of these drugs poses problems of delayed onset of action and prolonged duration of action. In an inadvertent accidental subcutaneous 0.1 mg/kg vecuronium bromide injection in a patient with 4 day old 45% burns showed delayed onset action and prolonged neuromuscular blockade due to subcutaneous deposition of the drug which was managed with mechanical ventilation .The reported resistance to the action of NDMR drugs in patient with burns was not noticed here probably because of the age of the thermal injury.

  6. Efficient SN2 fluorination of primary and secondary alkyl bromides by copper(I) fluoride complexes

    KAUST Repository

    Liu, Yanpin

    2013-11-11

    Copper(I) fluoride complexes ligated by phenanthroline derivatives have been synthesized and structurally characterized by X-ray crystallography. These complexes adopt as either ionic or neutral forms in the solid state, depending on the steric bulkiness of the substituent groups on the phenanthroline ligands. These complexes react with primary and secondary alkyl bromides to produce the corresponding alkyl fluorides in modest to good yields. This new method is compatible with a variety of important functional groups such as ether, thioether, amide, nitrile, methoxyl, hydroxyl, ketone, ester, and heterocycle moieties. © 2013 American Chemical Society.

  7. Radiation Induced Formation of Acrylated Palm Oil Nanoparticles using Cetyltrimethylammonium Bromide Microemulsion System

    International Nuclear Information System (INIS)

    In this study, we report the preparation of Acrylated Palm Oil (APO) nanoparticles using aqueous Cetyltrimethylammonium bromide (CTAB) microemulsion system. This microemulsion system which contains the dispersed APO nano droplets was subjected to the gamma irradiation to induce the formation of the crosslinked APO nanoparticle. After irradiation at higher doses, the size of APO nanoparticles was transformed from a submicron-sized to a nano-sized of the particles. Size decreasing might be due to the intermolecular and the intramolecular crosslinking reactions of the APO nanoparticles during the irradiation process. (author)

  8. Promotion of hexadecyltrimethyleamine bromide to the damage of Alexandrium sp. LC3 by cupric glutamate

    Institute of Scientific and Technical Information of China (English)

    LI Hao; MIAO Jin-lai; CUI Feng-xia; LI Guang-you

    2006-01-01

    The effect of hexadecyltrimethyleamine bromide (HDTMAB) on the removal of A lexandrium sp. LC3 under cupric glutamate stress was investigated. Toxic effect of cupric glutamate on A lexandrium sp. LC3 was significantly promoted in the presence of HDTMAB, especially at 3.0 cmc of HDTMAB. It was found that the sulfhydryl group content of the cell decreased, while the malonaldehyde content and membrane permeability increased when Alexandrium sp. LC3 was treated with HDTMAB and cupric glutamate complex, compared with cupric glutamate alone. The data suggest that HDTMAB might stimulate the damage of A lexandrium sp. LC3 by enhancing the membrane permeability.

  9. Efficient Stille cross-coupling reaction using aryl chlorides or bromides in water.

    Science.gov (United States)

    Wolf, Christian; Lerebours, Rachel

    2003-09-19

    An efficient Stille cross-coupling reaction using a variety of aryl halides in neat water has been developed. Employing palladium-phosphinous acid catalyst [(t-Bu)(2)P(OH)](2)PdCl(2) allows formation of biaryls from aryl chlorides and bromides in good to high yields. Functional groups such as ketones and nitriles are tolerated, and organic cosolvents are not required. The air stability and solubility in water of the palladium complexes used in this study facilitate operation of the coupling reaction and product isolation. The feasibility of catalyst recycling has also been demonstrated. PMID:12968920

  10. Highly stable, luminescent core-shell type methylammonium-octylammonium lead bromide layered perovskite nanoparticles.

    Science.gov (United States)

    Bhaumik, Saikat; Veldhuis, Sjoerd A; Ng, Yan Fong; Li, Mingjie; Muduli, Subas Kumar; Sum, Tze Chien; Damodaran, Bahulayan; Mhaisalkar, Subodh; Mathews, Nripan

    2016-06-01

    A new protocol for the synthesis of a highly stable (over 2 months under ambient conditions) solution-processed core-shell type structure of mixed methylammonium-octylammonium lead bromide perovskite nanoparticles (5-12 nm), having spherical shape, color tunability in the blue to green spectral region (438-521 nm) and a high photoluminescence quantum yield (PLQY) of up to 92% is described. The color tunability, high PLQY and stability are due to the quantum confinement imparted by the crystal engineering associated with core-shell nanoparticle formation during growth. PMID:27165565

  11. Nitrate ion photolysis in thin water films in the presence of bromide ions.

    Science.gov (United States)

    Richards, Nicole K; Wingen, Lisa M; Callahan, Karen M; Nishino, Noriko; Kleinman, Michael T; Tobias, Douglas J; Finlayson-Pitts, Barbara J

    2011-06-16

    Nitrate ions commonly coexist with halide ions in aged sea salt particles, as well as in the Arctic snowpack, where NO(3)(-) photochemistry is believed to be an important source of NO(y) (NO + NO(2) + HONO + ...). The effects of bromide ions on nitrate ion photochemistry were investigated at 298 ± 2 K in air using 311 nm photolysis lamps. Reactions were carried out using NaBr/NaNO(3) and KBr/KNO(3) deposited on the walls of a Teflon chamber. Gas phase halogen products and NO(2) were measured as a function of photolysis time using long path FTIR, NO(y) chemiluminescence and atmospheric pressure ionization mass spectrometry (API-MS). Irradiated NaBr/NaNO(3) mixtures show an enhancement in the rates of production of NO(2) and Br(2) as the bromide mole fraction (χ(NaBr)) increased. However, this was not the case for KBr/KNO(3) mixtures where the rates of production of NO(2) and Br(2) remained constant over all values of χ(KBr). Molecular dynamics (MD) simulations show that the presence of bromide in the NaBr solutions pulls sodium toward the solution surface, which in turn attracts nitrate to the interfacial region, allowing for more efficient escape of NO(2) than in the absence of halides. However, in the case of KBr/KNO(3), bromide ions do not appreciably affect the distribution of nitrate ions at the interface. Clustering of Br(-) with NO(3)(-) and H(2)O predicted by MD simulations for sodium salts may facilitate a direct intermolecular reaction, which could also contribute to higher rates of NO(2) production. Enhanced photochemistry in the presence of halide ions may be important for oxides of nitrogen production in field studies such as in polar snowpacks where the use of quantum yields from laboratory studies in the absence of halide ions would lead to a significant underestimate of the photolysis rates of nitrate ions.

  12. Cytotoxicity evaluation of Clinacanthus nutans through dimethylthiazol diphenyltetrazolium bromide and neutral red uptake assays

    OpenAIRE

    Vajrabhaya, La-Ongthong; Korsuwannawong, Suwanna

    2016-01-01

    Objectives: The aim of this study was to compare the results of dimethylthiazol diphenyltetrazolium bromide (MTT) and neutral red uptake (NRU) assays of Clinacanthus nutans cytotoxicity. Materials and Methods: Mouse fibroblast (L929) cells were exposed to 0.01%, 0.1%, 0.25%, and 0.5% (W/V) C. nutans in a 96-cluster-well-culture plate for 24 h. The cell viability after exposure to C. nutans was determined by MTT and NRU assays in separate tissue culture plates. The two assays were compared thr...

  13. Ethidium bromide transport across Mycobacterium smegmatis cell-wall: correlation with antibiotic resistance

    OpenAIRE

    Couto Isabel; Ramos Jorge; Rodrigues Liliana; Amaral Leonard; Viveiros Miguel

    2011-01-01

    Abstract Background Active efflux systems and reduced cell-wall permeability are considered to be the main causes of mycobacterial intrinsic resistance to many antimicrobials. In this study, we have compared the Mycobacterium smegmatis wild-type strain mc2155 with knockout mutants for porins MspA (the main porin of M. smegmatis) and MspC, the efflux pump LfrA (the main efflux pump system of M. smegmatis) and its repressor LfrR for their ability to transport ethidium bromide (EtBr) on a real-t...

  14. Generation, spectroscopy, and structure of cyanoformyl chloride and cyanoformyl bromide, XC(O)CN.

    Science.gov (United States)

    Pasinszki, Tibor; Vass, Gábor; Klapstein, Dieter; Westwood, Nicholas P C

    2012-04-01

    Cyanoformyl chloride and cyanoformyl bromide, XC(O)CN (X = Cl and Br), have been investigated in the gas phase by UV photoelectron and mid-infrared spectroscopies. The ground-state geometries of the neutral molecules have been obtained from quantum-chemical calculations at the B3LYP and CCSD(T) levels using the aug-cc-pVTZ basis set. The individual spectroscopies provide a detailed investigation into the vibrational and electronic character of the molecules and are supported by quantum-chemical calculations. The results are compared to data for structurally and chemically related molecules.

  15. Bromine and bromide in rainfall, cloud, stream and groundwater in the Plynlimon area of mid-Wales

    Directory of Open Access Journals (Sweden)

    2007-01-01

    Full Text Available Bromine in rainfall, cloud water, stream water and groundwater were measured in the upper River Severn catchments at Plynlimon in mid-Wales using two analytical procedures for bromide determination: a colorimetric method and, later, ion chromatography. Discrepancies between the methods indicated that the colorimetric method was measuring more than just bromide so it was "dissolved labile bromine" (DLBr (Neal et al., 2007. This paper reports the variation in DLBr and bromide across the Plynlimon region and assesses the differences between these two measures. The average DLBr concentration in the streams ranges between 18.3 and 27.8 µg l−1 compared with a rainfall average concentration of 15.6 µg l−1. The corresponding bromide concentrations in the streams are 13.8–18.6 µg l−1 and 13.2 µg l−1 in rainfall. For cloud water, throughfall and stemflow, DLBr concentrations are an order of magnitude higher than in rainfall and the concentrations are strongly correlated with chloride. Average values of bromide in rainfall and cloud water are similar to those of DLBr and are strongly correlated with chloride: unfortunately, no bromide measurements were taken in throughfall and stemflow. These results indicate that marine aerosol inputs are high and that the DLBr in these inputs is dominated by bromide. For cloud water, DLBr was correlated with dissolved organic carbon (DOC as well as with chloride; hence, there may well be an organic-associated component. Within the streams draining the forested areas, DLBr increases with time as DOC increases. DLBr concentrations in the streams are correlated with DOC in most cases and, to a lesser degree, with chloride. However, for bromide there is no correlation with DOC, but a weak correlation with chloride remains and the gradient is higher than for the DLBr case. Increasing concentrations of both DLBr and DOC may well reflect the wetting up of the catchments as transpiration diminshes as the trees age

  16. Simultaneous inhibition of epidermal growth factor receptor (EGFR) signaling and enhanced activation of tumor necrosis factor-related apoptosis-inducing ligand (TRAIL) receptor-mediated apoptosis induction by an scFv : sTRAIL fusion protein with specificity for human EGFR

    NARCIS (Netherlands)

    Bremer, E; Samplonius, DF; van Genne, L; Dijkstra, MH; Kroesen, BJ; de Leij, LFMH; Helfrich, W

    2005-01-01

    Epidermal growth factor receptor (EGFR) signaling inhibition by monoclonal antibodies and EGFR-specific tyrosine kinase inhibitors has shown clinical efficacy in cancer by restoring susceptibility of tumor cells to therapeutic apoptosis induction. Tumor necrosis factor-related apoptosis-inducing lig

  17. Re-evaluation of the sorption behaviour of Bromide and Sulfamethazine under field conditions using leaching data and modelling methods

    Science.gov (United States)

    Gassmann, Matthias; Olsson, Oliver; Höper, Heinrich; Hamscher, Gerd; Kümmerer, Klaus

    2016-04-01

    The simulation of reactive transport in the aquatic environment is hampered by the ambiguity of environmental fate process conceptualizations for a specific substance in the literature. Concepts are usually identified by experimental studies and inverse modelling under controlled lab conditions in order to reduce environmental uncertainties such as uncertain boundary conditions and input data. However, since environmental conditions affect substance behaviour, a re-evaluation might be necessary under environmental conditions which might, in turn, be affected by uncertainties. Using a combination of experimental data and simulations of the leaching behaviour of the veterinary antibiotic Sulfamethazine (SMZ; synonym: sulfadimidine) and the hydrological tracer Bromide (Br) in a field lysimeter, we re-evaluated the sorption concepts of both substances under uncertain field conditions. Sampling data of a field lysimeter experiment in which both substances were applied twice a year with manure and sampled at the bottom of two lysimeters during three subsequent years was used for model set-up and evaluation. The total amount of leached SMZ and Br were 22 μg and 129 mg, respectively. A reactive transport model was parameterized to the conditions of the two lysimeters filled with monoliths (depth 2 m, area 1 m²) of a sandy soil showing a low pH value under which Bromide is sorptive. We used different sorption concepts such as constant and organic-carbon dependent sorption coefficients and instantaneous and kinetic sorption equilibrium. Combining the sorption concepts resulted in four scenarios per substance with different equations for sorption equilibrium and sorption kinetics. The GLUE (Generalized Likelihood Uncertainty Estimation) method was applied to each scenario using parameter ranges found in experimental and modelling studies. The parameter spaces for each scenario were sampled using a Latin Hypercube method which was refined around local model efficiency maxima

  18. Corrosion inhibition performance of a ionic liquid surfactant Br

    Directory of Open Access Journals (Sweden)

    Jing LIU

    2016-02-01

    Full Text Available In order to study the novel green organic mercury-substituting inhibitors, the ionic liquid surfactant 1-methyl-3-dodecyl imidazole bromide ( Br is synthesized with N-methyl imidazole and 1-bromodecane as raw materials. The corrosion inhibition of Br for zinc in zinc-manganese batteries is investigated using electrochemical methods and weight loss methods. The results show that corrosion inhibition efficiency increases with the increase of the concentration of Br, and when the concentration is higher than 8×10-3 mol/L, the inhibition efficiency tends to be stable. The polarization curve shows that Br belongs to mixed-type corrosion inhibitor. The thermodynamic parameters show that Br is spontaneously adsorbed on the zinc surface, forming a monomolecular adsorption layer, which fits with Langmuir adsorption isotherm with physical and chemical adsorption mechanism.

  19. Using prechloramination to control trihalomethanes formation in River Huang water with high bromide

    Institute of Scientific and Technical Information of China (English)

    TAO Hui; CHEN Wei; LIN Tao; LIU Cheng; CHEN Jie; LI Gui-bai

    2008-01-01

    An effective technology in controlling trihalomethanes (THMs)formation in the case of large amounts of bromide presenting wag proposed,and the water of River Huang seriously polluted by bromide in winter in Tianjin City wag studied.The THMs formation characteristics during prechloramination using preformed chloramines and convened chloramines were studied through jar tests.Results show that,in prechloramination process,the formation of THMs by preformed chloramines is very few,while that by converted chloramines is a little higher.And the formation of THMs,especially Br-substituted THMs,increases with tIle increase of time and Cl2:N ratio as well as the decrease of pH.The result obtained in a pilot plant shows that compared with preehlorination,the prechlommination process can efficiendy control the formation of THMs,especially the Br-substituted species.With equal chlorine dosage.the prechloramination can maintain a hrser chlorine residue which offers a larger CT value than prechlorination.

  20. Moving away from methyl bromide: political economy of pesticide transition for California strawberries since 2004.

    Science.gov (United States)

    Mayfield, Erin N; Norman, Catherine Shelley

    2012-09-15

    We examine the progress of the phaseout of the use of the pesticide methyl bromide in the production of California field strawberries. This phaseout is required under the Montreal Protocol and has been contentious in this sector, which receives exemptions from the schedule initially agreed under the treaty, and in international negotiations over the future of the Protocol. We examine the various ex-ante predictions of the impacts on growers, consumers and trade patterns in light of several years of declining allocations under the Critical Use provisions of the Protocol and the 2010 approval of iodomethane for use in California and subsequent 2012 withdrawal of this alternative from the US market. We find that, contrary to ex-ante industry claims, the years of declining methyl bromide use have been years of rising yields, acreage, exports, revenues and market share for California growers, even when faced with a global recession and increased imports from Mexican growers who retain the right to use the chemical under the Protocol. This has implications for the Protocol as a whole and for the remainder of the US phaseout of this chemical in particular. PMID:22575205

  1. Model prediction uncertainty of bromide and pesticides transport in laboratory column

    Science.gov (United States)

    Dusek, Jaromir; Dohnal, Michal; Snehota, Michal; Sobotkova, Martina; Ray, Chittaranjan; Vogel, Tomas

    2016-04-01

    Knowledge of transport parameters of reactive solutes such as pesticides is a prerequisite for reliable predictions of their fate and transport in soil porous systems. Water flow and transport of bromide tracer and five pesticides (atrazine, imazaquin, sulfometuron methyl, S-metolachlor, and imidacloprid) through an undisturbed soil column of tropical Oxisol were analyzed using a one-dimensional numerical model. Laboratory column leaching experiment with three flow interruptions was conducted. The applied numerical model is based on Richards' equation for solving water flow and the advection-dispersion equation for solving solute transport. A global optimization method was used to evaluate the model's sensitivity to transport parameters and the uncertainty of model predictions. Within the Monte Carlo modeling framework, multiple forward simulations searching through the parametric space, were executed to describe the observed breakthrough curves. All pesticides were found to be relatively mobile. Experimental data indicated significant non-conservative behavior of bromide tracer. All pesticides, with the exception of imidacloprid, were found less persistent. Three of the five pesticides (atrazine, sulfometuron methyl, and S-metolachlor) were better described by the linear kinetic sorption model, while the breakthrough curves of imazaquin and imidacloprid were more appropriately approximated using nonlinear instantaneous sorption. Sensitivity analysis suggested that the model is most sensitive to sorption distribution coefficient. The prediction limits contained most of the measured points of the experimental breakthrough curves, indicating adequate model concept and model structure for the description of transport processes in the soil column under study.

  2. Recent trends in atmospheric methyl bromide: analysis of post-Montreal Protocol variability

    Directory of Open Access Journals (Sweden)

    S. A. Yvon-Lewis

    2009-08-01

    Full Text Available The atmospheric methyl bromide (CH3Br burden has declined in recent years, in response to the phaseout of agricultural and structural fumigation consumption under the amendments to the Montreal Protocol. The timing and magnitude of this decrease represents an opportunity to examine our current understanding of atmospheric CH3Br and its budget, response to the phaseout, and response to interannual variability in biomass burning and global OH. In this study, simulations obtained from a time-dependent global model of atmospheric CH3Br emissions and uptake are compared to observations from the NOAA flask network. The model includes a detailed gridded ocean model coupled to a time-dependant atmospheric 2-box model. The phaseout of CH3Br production for agricultural uses began in 1998, concurrent with the pulse in biomass burning associated with the 1998 El Niño. The combined effects of three factors (biomass burning, global OH, and anthropogenic phaseout appear to explain most of the observed atmospheric methyl bromide variability over the 1997–2008 period. The global budget remains imbalanced, with a large missing source indicated. The missing source does not exhibit a systematic decline during the phaseout period, and therefore, is not the result of significantly underestimating non-QPS agricultural CH3Br emissions. The model results suggest that the oceans should be less undersaturated than before the phaseout began.

  3. Thermodynamics of micellization of hexadecyltrimethylammonium bromide in propylene glycol-water mixture: A conductivity study

    Directory of Open Access Journals (Sweden)

    Janošević-Ležaić Aleksandra M.

    2014-01-01

    Full Text Available Micellization of hexadecyltrimethylammonium bromide (syn. cetyltrimethylammonium bromide, CTAB in propylene glycol-water (30% v/v binary mixture, as well as the thermodynamic properties of the resulting micelles, were investigated by electrical conductivity measurements. The conductivity data were used to determine both the critical micellar concentration (CMC and the micellar ionization degree (α of CTin the temperature range 298.2-310.2 K. The equilibrium model of micelle formation was applied in order to obtain the thermodynamic parameters (the standard molar Gibbs free energy, ΔGm0, enthalpy, ΔHm0 and entropy, ΔSm0 of the micellization process. The values of DGm0 and DHm0 were found to be negative at all investigated temperatures, while the values of ΔSm0 were positive and became more positive as temperature increased. A linear dependence between ΔSm0 and ΔHm0, i.e. an enthalpy-entropy compensation effect, was observed. [Projekat Ministarstva nauke Republike Srbije, br. 172015

  4. Natural Oxidation of Bromide to Bromine in Evaporated Dead Sea Brines

    Science.gov (United States)

    Gavrieli, Ittai; Golan, Rotem; Lazar, Boaz; Baer, Gidi; Zakon, Yevgeni; Ganor, Jiwchar

    2016-04-01

    Highly evaporated Dead Sea brines are found in isolated sinkholes along the Dead Sea. Many of these brines reach densities of over 1.3 kg/L and pHacidic with a value of ~6.3. In comparison, seawater with the same alkalinity would have a pH value well above 8.3, meaning that H+ activity is 100 fold lower than that of Dead Sea brine. In the present work we assess the apparent dissociation constant value of boric acid (K`B) for the Dead Sea brine and use it to explain the brine's low pH value. We then show that pH decreases further as the brine evaporates and salinity increases. Finally we explain the reddish hue of the hypersaline brines in the sinkholes as due to the presence of dissolved bromine. The latter is the product of oxidation of dissolved bromide, a process that is enabled by the low pH of the hypersaline brines and their high bromide concentration.

  5. Modelling of a Tracer experiment (Bromide) at the lysimeter Wagna/Austria with MIKE-SHE

    Science.gov (United States)

    Reszler, Christian; Fank, Johann

    2015-04-01

    Data of a tracer experiment with Bromide at one of the three lysimeters in Wagna/Austria are used to test the unsaturated zone solute transport model in MIKE-SHE. On April 4th, 2005 50 mg/l of Bromide were applied on the lysimeter operated with conventional farming. At this time the lysimeter was covered with bare soil until the start of the cultivation of pumpkin one month later. Concentrations at the lysimeter bottom (180 cm depth) were measured and, after break-through, plant uptake was measured to quantify mass recovery. The model using the Richards-Van Genuchten-Mualem approach is setup by comprehensive data of vegetation and soil hydraulic properties available at the lysimeter. Water movement simulation in the unsaturated zone is tested against measured seepage rates at the lysimeter bottom and soil water contents in different soil depths in a period of five years. A sensitivity study shows that, particularly in the quaternary gravel zone two different parameter sets are necessary to represent the different dynamics of water content and seepage. With both two sets the general dynamics of the tracer experiment are simulated well. However, the early rapid rise of the measured concentrations could not be represented by either parameter set, which indicates a complex pore system consisting of different flow paths in the gravel zone, e.g., a system of matrix flow and macro-pore flow.

  6. Modeling Water Flow and Bromide Transport in a Two-Scale-Structured Lignitic Mine Soil

    Science.gov (United States)

    Dusek, J.; Gerke, H. H.; Vogel, T.; Maurer, T.; Buczko, U.

    2008-12-01

    Two-dimensional single- and dual-permeability simulations are used to analyze water and solute fluxes in heterogeneous lignitic mine soil at a forest-reclaimed mine spoil heap. The soil heterogeneity on this experimental site "Barenbrucker Hohe" resulted from inclined dumping structures and sediment mixtures that consist of sand with lignitic dust and embedded lignitic fragments. Observations on undisturbed field suction- cell lysimeters including tracer experiments revealed funneling-type preferential flow with lateral water and bromide movement along inclined sediment structures. The spatial distribution of soil structures and fragment distributions was acquired by a digital camera and identified by a supervised classification of the digital profile image. First, a classical single-domain modeling approach was proposed with spatially variable scaling factors inferred from image analyses. In the next step, a two-continuum scenario was constructed to examine additional effects of nonequilibrium on the flow regime. The scaling factors used for the preferential flow domain are here obtained from the gradient of the grayscale images. So far, the single domain scenarios failed to predict the bromide leaching patterns although water effluent could be described. Dual-permeability model allows the incorporation of structural effects and can be used as a tool to further testing other approaches that account for structure effects. The numerical study suggests that additional experiments are required to obtain better understanding of the highly complex transport processes on this experimental site.

  7. Pressure-Induced Structural and Optical Properties of Organometal Halide Perovskite-Based Formamidinium Lead Bromide.

    Science.gov (United States)

    Wang, Lingrui; Wang, Kai; Zou, Bo

    2016-07-01

    Organometal halide perovskites (OMHPs) are attracting an ever-growing scientific interest as photovoltaic materials with moderate cost and compelling properties. In this Letter, pressure-induced optical and structural changes of OMHP-based formamidinium lead bromide (FAPbBr3) were systematically investigated. We studied the pressure dependence of optical absorption and photoluminescence, both of which showed piezochromism. Synchrotron X-ray diffraction indicated that FAPbBr3 underwent two phase transitions and subsequent amorphization, leading directly to the bandgap evolution with redshift followed by blueshift during compression. Raman experiments illustrated the high pressure behavior of organic cation and the surrounding inorganic octahedra. Additionally, the effect of cation size and the different intermolecular interactions between organic cation and inorganic octahedra result in the fact that FAPbBr3 is less compressible than the reported methylammonium lead bromide (MAPbBr3). High pressure studies of the structural evolution and optical properties of OMHPs provide important clues in optimizing photovoltaic performance and help to design novel OMHPs with higher stimuli-resistant ability. PMID:27321024

  8. Acute hepatitis after starting pinaverium bromide in a patient taking mirtazapine.

    Science.gov (United States)

    Tak, Sandeep; Tak, Shubhanjali

    2014-01-01

    A 56-year-old man presented with chronic abdominal pain. He had been evaluated extensively in the recent past undergoing upper gastrointestinal endoscopy, colonoscopy and CT scan of the abdomen with normal results. The provisional diagnosis of irritable bowel syndrome was performed and pinaverium bromide was started. The patient had pre-existing hypertension, a major depressive disorder and gastro-oesophageal reflux disease. He had been taking nebivolol and pantoprazole for several years and mirtazapine for the last 1 year. The patient developed nausea, vomiting and anorexia after 5 days of starting pinaverium bromide. Investigations revealed marked elevation of liver enzymes and bilirubin. He was negative for HIV, HBSAg, anti-hepatitis C virus, IgM for hepatitis A virus, hepatitis E virus, antinuclear antibody and antimitochondrial antibody. An ultrasound showed mild hepatomegaly with hypoechoic echo texture; the rest of scan was normal. Pinaverium and mirtazapine were stopped immediately. The patient was treated symptomatically and his liver profile returned to normal after 4 weeks. PMID:25015163

  9. The influence of nitrogen oxides on the activation of bromide and chloride in salt aerosol

    Science.gov (United States)

    Bleicher, S.; Buxmann, J. C.; Sander, R.; Riedel, T. P.; Thornton, J. A.; Platt, U.; Zetzsch, C.

    2014-04-01

    Experiments on salt aerosol with different salt contents were performed in a Teflon chamber under tropospheric light conditions with various initial contents of nitrogen oxides (NOx = NO + NO2). A strong activation of halogens was found at high NOx mixing ratios, even in samples with lower bromide contents such as road salts. The ozone depletion by reactive halogen species released from the aerosol, was found to be a function of the initial NOx mixing ratio. Besides bromine, large amounts of chlorine have been released in our smog chamber. Time profiles of the halogen species Cl2, Br2, ClNO2, BrNO2 and BrO, ClO, OClO and Cl atoms were simultaneously measured by various techniques (chemical ionization mass spectrometry, differential optical absorption spectrometry coupled with a multi-reflection cell and gas chromatography of hydrocarbon tracers for Cl and OH, employing cryogenic preconcentration and flame ionization detection). Measurements are compared to calculations by the CAABA/MECCA 0-D box model, which was adapted to the chamber conditions and took the aerosol liquid water content and composition into account. The model results agree reasonably with the observations and provide important information about the prerequisites for halogen release, such as the time profiles of the aerosol bromide and chloride contents as well as the aerosol pH.

  10. The application of activation analysis for the control of bromide accumulation in vegetable

    International Nuclear Information System (INIS)

    Soil desinfestation with methyl bromide increases the uptake of bromine by plants. The natural bromine content of crops and fruits was found in the range of 1 up to 5 ppm in fresh weight. The highest acceptable level is 50 ppm in fresh weight. By using methyl bromide as a soil fumigant, a bromine accumulation was found in the crops to levels up to 20-500 ppm in fresh matter. The uptake of bromine differs in various parts of the vegetable crops. The highest bromine concentration could be observed in the leaves. The bromine uptake by plants depends on (a) the fumigation technique (applied amounts, reaction time, date of cultivation); (b) the growing conditions (soil type, climate and irrigation); (c) the plants (species, rotation, harvesting time etc.). The INAA is a simple and rapid method to analyse bromine in vegetables within a wide range using Br-80 and Br-82. Since several years this method has also been used to control imported crops. The samples were subjected to a short irradiation (1-3 minutes at 1013ncm-2sec-1). After the decay time of a few minutes the induced activity was measured with a Ge(Li) detector coupled to a multi-channel analyzer. The limit of detection varies between 0.1 and 0.5 ppm Br in fresh vegetable samples. (T.G.)

  11. Effects of Cr(III) and CR(VI) on nitrification inhibition as determined by SOUR, function-specific gene expression and 16S rRNA sequence analysis of wastewater nitrifying enrichments

    Data.gov (United States)

    U.S. Environmental Protection Agency — Data generated to test nitrification inhibition of chromium This dataset is associated with the following publication: Kapoor, V., M. Elk, X. Li, C. Impellitteri ,...

  12. Bromide as a tracer for studying water movement and nitrate displacement in soils: comparison with stable isotope tracers; Bromid als Tracer zur Untersuchung der Wasserbewegung und der Nitratverlagerung in Boeden: Vergleich mit stabilisotopen Tracern

    Energy Technology Data Exchange (ETDEWEB)

    Russow, R.; Knappe, S. [UFZ - Umweltforschungszentrum Leipzig-Halle GmbH, Bad Lauchstaedt (Germany). Sektion Bodenforschung

    1999-02-01

    Tracers are an ideal means of studying water movement and associated nitrate displacement. Often bromide is preferred as a tracer because it is considered a representative tracer for water and because, being a conservative tracer (i.e. not involved in chemical and biological soil processes), it can be used for studying anion transport in soils. Moreover, it is less expensive and easier to measure than the stable isotopes deuterium and {sup 15}N. Its great advantage over radioactive tracers (e.g. tritium), which outweighs their extreme sensitivity and ease of measurement and which it has in common with stable isotopes, is that it does not require radiation protection measures. However, there are also constraints on the use of bromide as a tracer in soil/water/plant systems. Our own studies on different soils using D{sub 2}O, bromide and [{sup 15}N]-nitrate in lysimeters suggest that the above assumptions on bromide tracers need not always be valid under conditions as they prevail in biologically active soils. As the present paper shows, these studies permit a good assessment of the possibilities and limits to these tracers. [Deutsch] Fuer die Untersuchung der Wasserbewegung sowie der daran gekoppelten Nitrat-Verlagerung ist der Einsatz von Tracern das Mittel der Wahl. Dabei wird Bromid als Tracer haeufig bevorzugt, da es allgemein als ein repraesentativer Tracer fuer Wasser und als konservativer Tracer (nicht involviert in chemische und biologische Bodenprozesse) zur Untersuchung des Anionentransportes in Boeden angesehen wird und es gegenueber den stabilen Isotopen Deuterium und {sup 15}N billiger und einfacher zu bestimmen ist. Gegenueber den radioaktiven Tracern (z.B. Tritium), die zwar sehr empfindlich und einfach messbar sind, besteht der grosse Vorteil, dass, wie bei den stabilen Isotopen, keine Strahlenschutzmassnahmen ergriffen werden muessen. Es gibt jedoch auch einschraenkende Hinweise fuer die Verwendung von Bromid als Tracer im System Boden

  13. The Research on Programmable Control System of Lithium-Bromide Absorption Refrigerating Air Conditioner Based on the Network

    Directory of Open Access Journals (Sweden)

    Sun Lunan

    2016-01-01

    Full Text Available This article regard the solar lithium-bromide absorption refrigerating air conditioning system as the research object, and it was conducting adequate research of the working principle of lithium bromide absorption refrigerating machine, also it was analyzing the requirements of control system about solar energy air conditioning. Then the solar energy air conditioning control system was designed based on PLC, this system was given priority to field bus control system, and the remote monitoring is complementary, which was combining the network remote monitoring technology. So that it realized the automatic control and intelligent control of new lithium bromide absorption refrigerating air conditioning system with solar energy, also, it ensured the control system can automatically detect and adjust when the external conditions was random changing, to make air conditioning work effectively and steadily, ultimately ,it has great research significance to research the air conditioning control system with solar energy.

  14. Combination of ozonation and photocatalysis for purification of aqueous effluents containing formic acid as probe pollutant and bromide ion.

    Science.gov (United States)

    Parrino, F; Camera-Roda, G; Loddo, V; Palmisano, G; Augugliaro, V

    2014-03-01

    The treatment by advanced oxidation processes (AOPs) of waters contaminated by organic pollutants and containing also innocuous bromide ions may generate bromate ions as a co-product. In the present work heterogeneous photocatalysis and ozonation have individually been applied and in combination (integrated process) to degrade the organic compounds in water containing also bromide anions. The results show that: i) the sole photocatalysis does not produce bromate ions and in the case of its presence, it is able to reduce bromate to innocuous bromide ions; ii) the integration of photocatalysis and ozonation synergistically enhances the oxidation capabilities; and iii) in the integrated process bromate ions are not produced as long as some oxidizable organics are present.

  15. Inhibition of HIV-1 in Vitro by Combination of Vpr and Tat Specific Short Hairpin RNA via Lentiviral Vectors%慢病毒介导双shRNA靶向于HIV的抑制作用研究

    Institute of Scientific and Technical Information of China (English)

    郝彦哲; 滕智平; 杨怡姝; 孙晓娜; 马晶; 金孝华; 曾毅

    2013-01-01

    RNA干扰可以有效地抑制特定基因的表达,在HIV基因治疗中成为一种重要的方法.为了防止病毒逃逸株的出现,本研究分别构建了靶向于HIV-1调控蛋白基因vpr和tat的shRNA重组慢病毒载体以及含有这两种shRNA的双表达重组慢病毒载体,分别由U6和H1两种启动子启动,通过与靶向基因tat和vpr表达质粒在293T细胞中进行共转染,采用荧光定量PCR方法测定细胞内靶向基因的表达丰度,结果显示双表达shRNA的重组慢病毒载体对vpr和tat的表达抑制率分别可以达到89.20%和62.00%.与pNL4-3病毒包装质粒共转染,P24ELISA显示plvx-vpr-tat shRNA对病毒包装产量的抑制率可以达到99.05%,比单个shRNA的抑制率都要强,HIV-1 NL4-3体外对MT4细胞攻毒实验表明双shRNA重组慢病毒载体具有很强的抑制病毒复制的能力.%Gene therapy offers the promise of curing the HIV-infected patients. Specific, potent, and sustained short hairpin RNA (shRNA)-mediated gene silencing is crucial for the successful application of RNA interference technology to therapeutic interventions. To reduce the probability of viral escape mutants, in this study, we constructed lentiviral vector containing vpr and tat shRNA, respectively, furthermore the bispecific lentiviral vector harboring vpr and tat shRNA expression cassettes from U6 pro-motor and H1 promotor was cotransfected with recombinant plasmid expressing the vpr and tat gene. The result showed that the bispecific lentiviral vector plvx-vpr-tatshRNA could inhibit the vpr and tat effectively, with ratios of 89. 20% and 62. 00% respectively. When cotransfected with pNL4-3 in 293T cell, plvx-vpr-tatshRNA showed higher efficacy in down regulating the HIV NL4-3 packaging production than the plvx-vprshRNA or plvx-tatshRNA individually. MT4 cell clones transduced with recombinant lentiviral vectors were screened and challenged with HIV NL4-3. P24 ELISA test showed that MT4 transduced with the

  16. HCV 5′NCR调控抑制活性的反义寡核苷酸的筛选%Specific regulatory inhibition of transfected HepG2 with HCV 5'NCR by antisense phosphorothioate oligodeoxynucleotides

    Institute of Scientific and Technical Information of China (English)

    王升启; 管伟; 王小红; 李梦东

    2000-01-01

    目的:寻找高效特异的新型抗HCV药物, 探讨针对HCV基因的硫代修饰反义寡核甘酸(S-ASODNs)最佳作用靶序列。 方法:参考HCV 5′NCR计算机预测的二级结构图,设计合成了15条S-ASODN、3条正义寡核苷酸及1条随机序列,采用HCV 5′NCR调控荧光素酶基因的瞬时表达系统,将S-ASODN与pHCV-neo4共转染,通过荧光素酶活性表达高低,反映S-ASODN对HCV调控基因的抑制活性。结果:5条S-ASODN即HCV65、HCV279、HCV363、HCV349及HCV352在25~100nmol/L浓度范围内,对HCV调控基因具有特异性的剂量依赖性抑制活性。当浓度为100nmol/L时,这些ASODN的抑制率可达80%以上,IC50值提示HCV363的抑制活性最强。通过阴性对照实验包括正义寡核苷酸、随机序列及不含HCV序列的靶载体pGL3提示ASODN仅存在轻度非特异性作用。此外,实验结果还提示不同作用靶位的ASODN之间具有一定的协同作用。 结论:HCV 5′NCR第二茎环结构Ⅱa、第三茎环结构Ⅲd和翻译起始区可能是ASODN作用的重要靶序列。%Objective: To screen efficient and specific new drugs against hepatitis C virus (HCV) and find the best target sequence of antisense oligodeoxynucleotides (ASODNs) targeting at HCV gene. Methods: Fifteen S-ASODNs targeting at the 5'NCR and start AUG of HCV RNA were designed and synthesized according to the predicted RNA secondary structure of the HCV 5'NCR and the adjacent AUG region. HepG2 cells were co-transfected with pHCV-neo4 and S-ASODN. The inhibitory effects of S-ASODNs on gene expression controlled by HCV 5'NCR were determined by the assay of luciferase activity. Results: Five S-ASODNs, i.e. HCV65, HCV279, HCV363, HCV349 and HCV352, showed sequence-specific and dose-dependent inhibitory activities with an inhibition rate of more than 80% at a concentration of 100 nmol/L. According to 50% inhibitory concentrations, the inhibitory activity of HCV363 was the best. On the

  17. Inhibition of ERK1/2 worsens intestinal ischemia/reperfusion injury.

    Directory of Open Access Journals (Sweden)

    Kechen Ban

    Full Text Available BACKGROUND: The role of extracellular signal-regulated protein kinase (ERK in intestinal ischemia/reperfusion (I/R injury has not been well investigated. The aim of the current study was to examine the effect of inhibition of the ERK pathway in an in vitro and in vivo model of intestinal I/R injury. METHODS: ERK1/2 activity was inhibited using the specific inhibitor, U0126, in intestinal epithelial cells under hypoxia/reoxygenation conditions and in mice subjected to 1 hour of intestinal ischemia followed by 6 hours reperfusion. In vitro, cell proliferation was assessed by MTT (3-(4,5-dimethylthiazol-2-yl-2,5-diphenyl tetrazolium bromide assay, apoptosis by DNA fragmentation, and migration using an in vitro model of intestinal wound healing. Cells were also transfected with a p70S6K plasmid and the effects of overexpression similarly analyzed. In vivo, the effects of U0126 on intestinal cell proliferation and apoptosis, intestinal permeability, lung and intestinal neutrophil infiltration and injury, and plasma cytokine levels were measured. Survival was also assessed after U0126. Activity of p70S6 kinase (p70S6K was measured by Western blot. RESULTS: In vitro, inhibition of ERK1/2 by U0126 significantly decreased cell proliferation and migration but enhanced cell apoptosis. Overexpression of p70S6K promoted cell proliferation and decreased cell apoptosis. In vivo, U0126 significantly increased cell apoptosis and decreased cell proliferation in the intestine, increased intestinal permeability, intestinal and lung neutrophil infiltration, and injury, as well as systemic pro-inflammatory cytokines, TNF-α, IL-6 and IL-1β. Mortality was also significantly increased by U0126. Inhibition of ERK1/2 by U0126 also abolished activity of p70S6K both in vitro and in vivo models. CONCLUSION: Pharmacologic inhibition of ERK1/2 by U0126 worsens intestinal IR injury. The detrimental effects are mediated, at least in part, by inhibition of p70S6K, the major

  18. [Effects of bromide and ferric ions on formation of tri-halomethanes during disinfection of drinking water by chlorine].

    Science.gov (United States)

    Zhu, Zhi-Liang; Wang, Jing; Ge, Yuan-Xin; Ma, Hong-Mei; Zhao, Jian-Fu

    2007-06-01

    Effects of bromide and ferric ions on the formation and distribution of tri-halomethanes (THMs) have been investigated. As disinfection by-product (DBP) model precursors of natural water, humic acid solutions were used and a series of experiments were conducted. The results showed that bromide in this reaction system not only contributed to the increase of brominated species, but also the total tri-halomethanes. When the concentration of Br(-) was 1.0 mg/L, the total amount of produced THMs reached to 270% of that without bromide ions. In the presence of bromide, ferric ions decreased the production of THMs at pH 6, but increased the production of THMs at pH 8, especially for the amount of tri-bromomethanes. When the concentration of Fe3+ was 5 mg/L, the amount of produced tri-bromomethanes had an increment of 54% (from 51.7 microg/L to 79.4 microg/L), and the total amount of THMs increased from 113.49 microg/L to 162.09 microg/L. Bromide ions had a significant effect on carcinogenicity risk in disinfection of drinking water by chlorine, and the co-existence of ferric ion and bromide in alkalescent environment can result in the biggest challenge on carcinogenicity risk. Under the condition of 0.2 mg/L Br(-), 5 mg/L Fe3+ and pH 6, the carcinogenicity risk increased 2.5 times than that without Br(-) and Fe3+, and much higher increment of 5.1 times appeared when pH was 8.

  19. Characterization of the corrosion products formed on mild steel in acidic medium with N-octadecylpyridinium bromide as corrosion inhibitor

    Energy Technology Data Exchange (ETDEWEB)

    Nava, N., E-mail: tnava@imp.mx; Likhanova, N. V. [Direccion de Investigacion y Posgrado, Instituto Mexicano del Petroleo (Mexico); Olivares-Xometl, O. [Benemerita Universidad Autonoma de Puebla, Facultad de Ingenieria Quimica (Mexico); Flores, E. A. [Direccion de Investigacion y Posgrado, Instituto Mexicano del Petroleo (Mexico); Lijanova, I. V. [CIITEC, Instituto Politecnico Nacional (Mexico)

    2011-11-15

    The characterization of the corrosion products formed on mild steel SAE 1018 after 2 months exposure in aqueous sulfuric acid with and without corrosion inhibitor N-octadecylpyridinium bromide has been carried out by means of transmission {sup 57}Fe Moessbauer spectroscopy and X-ray powder diffraction (XRD). The major constituent of the rust formed in this environment without corrosion inhibitor is goethite ({alpha}-FeOOH). The samples with N-octadecylpyridinium bromide contain rozenite and large amounts of melanterite in the corrosion layers.

  20. Enhanced Degradation of the Volatile Fumigant-Nematicides 1,3-D and Methyl Bromide in Soil

    OpenAIRE

    Ou, L.-T.

    1998-01-01

    The use of the gaseous funaigant-nematicide methyl bromide in agriculture is scheduled to be phased out in the year 2001.1,3-Dichloropropene (1,3-D) in combination with chloropicrin and an herbicide is considered to be a viable alternative to methyl bromide for some crops. 1,3-Dichloropropene consists of two isomers, cis- and trans-l,3-D. A number of soil bacteria have been shown to initially degrade 1,3-D or one of its isomers, cis-l,3-D, via hydrolysis. Until recently, the degradation of ci...

  1. Characterization of the corrosion products formed on mild steel in acidic medium with N-octadecylpyridinium bromide as corrosion inhibitor

    International Nuclear Information System (INIS)

    The characterization of the corrosion products formed on mild steel SAE 1018 after 2 months exposure in aqueous sulfuric acid with and without corrosion inhibitor N-octadecylpyridinium bromide has been carried out by means of transmission 57Fe Mössbauer spectroscopy and X-ray powder diffraction (XRD). The major constituent of the rust formed in this environment without corrosion inhibitor is goethite (α-FeOOH). The samples with N-octadecylpyridinium bromide contain rozenite and large amounts of melanterite in the corrosion layers.

  2. Spectral and Non Radiative Decay Studies of Lead Di Bromide Single Crystals by Mode Matched Thermal Lens Technique.

    Science.gov (United States)

    Rejeena, I; Lillibai, B; Thomas, V; Nampoori, V P N; Radhakrishnan, P

    2016-07-01

    In the present paper, the investigations on the non radiative decay mechanism, optical band gap determination from absorption spectroscopic studies and fluorescence emission by photo luminescence techniques using different excitation wavelengths on gel derived lead di bromide single crystals are reported. Non radiative decay of the sample is studied using high sensitive dual beam mode matched thermal lens technique. For the thermal lensing experiment the crystal in solution phase is incorporated with rhodamine 6G dye for enhancing the absorption of the crystal sample. The thermal diffusivity of lead di bromide is determined using the probe beam intensity v/s time measurements. PMID:27165040

  3. Impact of organic nano-vesicles in soil: The case of sodium dodecyl sulphate/didodecyl dimethylammonium bromide.

    Science.gov (United States)

    Gavina, A; Bouguerra, S; Lopes, I; Marques, C R; Rasteiro, M G; Antunes, F; Rocha-Santos, T; Pereira, R

    2016-03-15

    Aiming at contributing new insights into the effects of nanomaterials (NMs) in the terrestrial ecosystem, this study evaluated the impacts of organic nano-vesicles of sodium dodecyl sulphate/didodecyl dimethylammonium bromide (SDS/DDAB) on the emergence and growth of plant seeds, and on the avoidance and reproduction of soil invertebrates. For this purpose several ecotoxicological assays were performed with different test species (terrestrial plants: Zea mays, Avena sativa, Brassica oleracea and Lycopersicon esculentum; soil invertebrates: Eisenia andrei and Folsomia candida). A wide range of SDS/DDAB concentrations were tested, following standard protocols, and using the standard OECD soil as a test substrate (5% of organic matter). The aqueous suspensions of SDS/DDAB, used to spike the soils, were characterised by light scattering techniques for hydrodynamic size of the vesicles, aggregation index, polydispersity index, zeta potential and surface charge. The SDS/DDAB concentrations in the test soil were analysed by HPLC-UV at the end of the assays. Invertebrate species were revealed to be sensitive to nano-SDS/DDAB upon immediate exposure to freshly spiked soils. However, the degradation of SDS/DDAB nano-vesicles in the soil with time prevented the occurrence of significant reproduction effects on soil invertebrates. Plants were not particularly sensitive to SDS/DDAB, except B. oleracea (at concentrations above 375 mg kg(-1)dw). The results gathered in this study allowed a preliminary determination of a risk limit to nano-SDS/DDAB. The low toxicity of SDS/DDAB nano-vesicles could be explained by its high and fast degradation in the soil. The soil microbial community could have an important role in the fate of this NM, thus it is of remarkable importance to improve this risk limit by taking into account specific data addressing this community. PMID:26795542

  4. Physicochemical and thermodynamic characterization of N-alkyl-N-methylpyrrolidinium bromides and its aqueous solutions

    Energy Technology Data Exchange (ETDEWEB)

    Zawadzki, Maciej, E-mail: mzawadzki@ch.pw.edu.pl; Królikowska, Marta; Lipiński, Paweł

    2014-08-10

    Highlights: • The aqueous solutions of bromide-based ionic liquids have been studied. • The synthesis and basic thermal characterization of pure IL have been done. • The density, dynamic viscosity, SLE and VLE have been determined. • The experimental data have been correlated using appropriate equations. - Abstract: This work is a continuation of our research of ionic liquids to investigate the physicochemical and thermodynamic properties of (ionic liquid + water) binary mixtures as a novel alternative working pair for the absorption heat pump cycle. In this work, a series of organic salts: N-propyl-N-methyl-pyrrolidinium bromide, [C{sub 1}C{sub 3}PYR]Br; N-butyl-N-methylpyrrolidinium, [C{sub 1}C{sub 4}PYR]Br and N-pentyl-N-methylpyrrolidinium bromide, [C{sub 1}C{sub 5}PYR]Br have been synthesized. The structures of new compounds have been confirmed using NMR spectra and elementary analysis. The basic thermal characterization of pure ILs, including temperature and enthalpy of phase transition (T{sub tr}, Δ{sub tr}H), temperature and enthalpy of melting (T{sub m,} Δ{sub m}H) have been measured using a differential scanning microcalorimetry technique (DSC). Decomposition temperature of the tested ILs were detected by the simultaneous TG/DTA experiments. The effect of temperature on the density (ρ) and dynamic viscosity (η) is reported over a wide temperature range from 298.15 to 343.15 K at ambient pressure. From experimental density data, the excess molar volumes (V{sup E}) were calculated and correlated using Redlich–Kister equation. The isothermal vapour–liquid phase equilibria (VLE) have been measured by an ebulliometric method at wide temperature range from 328.15 to 368.15 K and pressure up to 85 kPa. Experimental data have been correlated by means of NRTL equation. The solid–liquid phase equilibria (SLE) for the tested binary mixtures have been determined over whole composition range using dynamic method. The NRTL equation using parameters

  5. Nanosized sustained-release pyridostigmine bromide microcapsules: process optimization and evaluation of characteristics

    Directory of Open Access Journals (Sweden)

    Tan Q

    2013-02-01

    Full Text Available Qunyou Tan,1,* Rong Jiang,3,* Meiling Xu,2,4,* Guodong Liu,5,* Songlin Li,1 Jingqing Zhang21Department of Thoracic Surgery, Institute of Surgery Research, Daping Hospital, Third Military Medical University, 2Medicine Engineering Research Center, Chongqing Medical University, 3Stem Cells and Tissue Engineering Research, Chongqing Medical University, 4Department of Pharmacy, Chongqing Emergency Medical Center, 5Eighth Department, Institute of Surgery Research, Daping Hospital, Third Military Medical University, Chongqing, People’s Republic of China*These authors contributed equally to this workBackground: Pyridostigmine bromide (3-[[(dimethylamino-carbonyl]oxy]-1-methylpyridinium bromide, a reversible inhibitor of cholinesterase, is given orally in tablet form, and a treatment schedule of multiple daily doses is recommended for adult patients. Nanotechnology was used in this study to develop an alternative sustained-release delivery system for pyridostigmine, a synthetic drug with high solubility and poor oral bioavailability, hence a Class III drug according to the Biopharmaceutics Classification System. Novel nanosized pyridostigmine-poly(lactic acid microcapsules (PPNMCs were expected to have a longer duration of action than free pyridostigmine and previously reported sustained-release formulations of pyridostigmine.Methods: The PPNMCs were prepared using a double emulsion-solvent evaporation method to achieve sustained-release characteristics for pyridostigmine. The preparation process for the PPNMCs was optimized by single-factor experiments. The size distribution, zeta potential, and sustained-release behavior were evaluated in different types of release medium.Results: The optimal volume ratio of inner phase to external phase, poly(lactic acid concentration, polyvinyl alcohol concentration, and amount of pyridostigmine were 1:10, 6%, 3% and 40 mg, respectively. The negatively charged PPNMCs had an average particle size of 937.9 nm

  6. COPD patient satisfaction with ipratropium bromide/albuterol delivered via Respimat: a randomized, controlled study

    Directory of Open Access Journals (Sweden)

    Ferguson GT

    2013-03-01

    Full Text Available Gary T Ferguson,1 Mo Ghafouri,2 Luyan Dai,2 Leonard J Dunn31Pulmonary Research Institute of Southeast Michigan, Livonia, MI, USA; 2Boehringer Ingelheim Pharmaceuticals, Inc, Ridgefield, CT, USA; 3Clinical Research of West Florida, Inc, Clearwater, FL, USABackground: Ipratropium bromide/albuterol Respimat inhaler (CVT-R was developed as an environmentally friendly alternative to ipratropium bromide/albuterol metered-dose inhaler (CVT-MDI, which uses a chlorofluorocarbon propellant.Objective: The objective of this study was to evaluate patient satisfaction, device usage, and long-term safety of CVT-R compared to CVT-MDI, and to the simultaneous administration of ipratropium bromide hydrofluoroalkane (HFA; I and albuterol HFA (A metered-dose inhalers as dual monotherapies (I + A.Design: This is a 48-week, open-label, randomized, active-controlled, parallel-group study (n = 470 comparing CVT-R to CVT-MDI and to I + A.Participants: Patients were at least 40 years of age, diagnosed with chronic obstructive pulmonary disease (COPD, and current or exsmokers.Interventions: Patients were randomized to receive: (1 CVT-R, one inhalation four times daily (QID; or (2 CVT-MDI, two inhalations QID; or (3 I + A two inhalations of each inhaler QID.Main measures: Patient Satisfaction and Preference Questionnaire (PASAPQ performance score (primary endpoint and adverse events.Key results: PASAPQ performance score was significantly higher (CVT-R versus CVT-MDI, 9.6; and CVT-R versus I + A, 6.2; both P < 0.001 when using CVT-R compared to CVT-MDI or I + A at all visits starting from week 3, while CVT-MDI and I + A treatment groups were similar. Time to first COPD exacerbation was slightly longer in the CVT-R group compared to the other treatment groups, although it did not reach statistical significance (CVT-R versus CVT-MDI, P = 0.57; CVT-R versus I + A, P = 0.22. Rates of withdrawal and patient refusal to continue treatment were lower in CVT-R compared with CVT

  7. Memory inhibition across the lifespan

    OpenAIRE

    Teale, Julia C.

    2015-01-01

    Age can affect memory performance. This statement is so often heard that it has become almost a truism. When research surrounding memory inhibition – the ability to ignore irrelevant material to aid in the retrieval of a target memory – is examined specifically, a more mixed picture of findings emerges. Whilst some previous work has found evidence of an age-related deficit, other research has rather found intact memory inhibition in older adults. Less often discussed, too, are the effects of ...

  8. Relationship between high esterase activity and in vitro degradation of /sup 14/C-malathion by organophosphate-resistant and susceptible strains of the Kanzawa spider mite, Tetranychus kanzawai Kishida (Acarina: Tetranychidae), and their inhibition with specific synergists

    Energy Technology Data Exchange (ETDEWEB)

    Kuwahara, M. (National Inst. of Agricultural Sciences, Yatabe, Ibaraki (Japan)); Miyata, T.; Saito, T.; Eto, M.

    1981-08-01

    The relationship between the enzymes which catalyze hydrolysis of ..beta..-naphthyl acetate and degradation of malathion was studied in resistant and susceptible strains of the Kanzawa spider mite, Tetranychus kanzawai Kishida. The homogenate of resistant mites exhibited higher activity in the degradation of malathion in vitro than that of susceptible mites, but such activity was remarkably inhibited by the compound K-1, which also manifested a prominent synergism with malathion to resistant mites. Six esterase bands and three peaks of malathion degradation were resolved by agar-gel electrophoresis. Resistance to malathion was associated with increased esterase activity at E/sub 3/ and E/sub 4/ bands on which the main peak of malathion degradation was detected. The compound K-1 selectively inhibited the esterase and degradation activities. Compounds K-9 and IBP, on the other hand, selectively inhibited E/sub 1/ and E/sub 2/ bands which overlapped with the minor peaks of malanthion degradation.

  9. Copper-catalysed N-arylation of arylsulfonamides with aryl bromides and aryl iodides using KF/Al2O3

    Indian Academy of Sciences (India)

    Rahman Hosseinzadeh; Mahmood Tajbakhsh; Maryam Mohadjerani; Mohammad Alikarami

    2010-03-01

    An efficient synthesis of -arylsulfonamides with a variety of aryl bromides, aryl iodides and heteroaryl bromides using KF/Al2O3 as a suitable base, CuI as an inexpensive catalyst and ,'-dimethylethylenediamine (,'-DMEDA) as an effective ligand is described.

  10. Carbon nanotubes as an efficient hole collector for high voltage methylammonium lead bromide perovskite solar cells.

    Science.gov (United States)

    Li, Zhen; Boix, Pablo P; Xing, Guichuan; Fu, Kunwu; Kulkarni, Sneha A; Batabyal, Sudip K; Xu, Wenjing; Cao, Anyuan; Sum, Tze Chien; Mathews, Nripan; Wong, Lydia Helena

    2016-03-28

    A high open circuit voltage (V(OC)) close to 1.4 V under AM 1.5, 100 mW cm(-2) conditions is achieved when carbon nanotubes (CNTs) are used as a hole conductor in methyl ammonium lead bromide (MAPbBr3) perovskite solar cells. Time-resolved photoluminescence and impedance spectroscopy investigations suggest that the observed high V(OC) is a result of the better charge extraction and lower recombination of the CNT hole conductor. Tandem solar cells with all perovskite absorbers are demonstrated with a MAPbBr3/CNT top cell and a MAPbI3 bottom cell, achieving a V(OC) of 2.24 V in series connection. The semitransparent and high voltage MAPbBr3/CNT solar cells show great potential for applications in solar cell windows, tandem solar cells and solar driven water splitting. PMID:26646241

  11. Increase in mitotic recombination in diploid cells of Aspergillus nidulans in response to ethidium bromide

    Directory of Open Access Journals (Sweden)

    Tânia C.A. Becker

    2003-01-01

    Full Text Available Ethidium bromide (EB is an intercalating inhibitor of topoisomerase II and its activities are related to chemotherapeutic drugs used in anti-cancer treatments. EB promotes several genotoxic effects in exposed cells by stabilising the DNA-enzyme complex. The recombinagenic potential of EB was evaluated in our in vivo study by the loss of heterozygosity of nutritional markers in diploid Aspergillus nidulans cells through Homozygotization Index (HI. A DNA repair mutation, uvsZ and a chromosome duplication DP (II-I were introduced in the genome of tested cells to obtain a sensitive system for the recombinagenesis detection. EB-treated diploid cells had HI values significantly greater than the control at both concentrations (4.0 x 10-3 and 5.0 x 10-3 mM. Results indicate that the intercalating agent is potentially capable of inducing mitotic crossing-over in diploid A. nidulans cells.

  12. Behavior of aqueous Tetrabutylammonium bromide - a combined approach of microscopic simulation and neutron scattering

    CERN Document Server

    Bhowmik, Debsindhu

    2016-01-01

    Aqueous solution of tetrabutylammonium bromide is studied by quasi-elastic neutron scattering, to give information on the dynamic modes involving the ions present. Using a careful combination of two techniques, time-of-flight (TOF) and neutron spin echo (NSE), we de- couple the dynamic information in both the coherently and incoherently scattered signal from this system. We take advantage of the different intensity ratio of the two signals, as detected by each of the techniques, to achieve this decoupling. By using heavy water as the sol- vent, the tetrabutylammonium cation is the only hydrogen-containing species in the system and gives rise to a significant incoherent scattered intensity. The dynamic analysis of the incoherent signal (measured by TOF) leads to a translational diffusion coefficient of the cation as that is in good agreement with previous NMR, neutron scattering and tracer diffusion measurements. The dynamic analysis of the coherent signal observed at wave-vectors < 0.6 angstrom^(-1) (measu...

  13. Copper bromide vapor brightness amplifiers with 100 kHz pulse repetition frequency

    Science.gov (United States)

    Trigub, M. V.; Evtushenko, G. S.; Torgaev, S. N.; Shiyanov, D. V.; Evtushenko, T. G.

    2016-10-01

    The paper presents a laser monitor with 10 μs time-resolution based on a high-frequency copper bromide vapor brightness amplifier. A sync circuit has been designed for single-pulse imaging. The analysis of amplifying characteristics of the active elements and active optical system (laser monitor) parameters allowed to determine the optimal concentration of HBr at which the images can be obtained with minimum distortions. For the active element operating at high frequencies (more than 50 kHz) as a brightness amplifier, the concentration of HBr must be lower than that needed for obtaining the maximum output power. The limiting brightness temperature of the background radiation which does not affect the image quality is determined. The potential feasibility of using a proposed brightness amplifier for visualizing processes blocked from viewing by the background radiation with the brightness temperature up to 8000 K is demonstrated.

  14. Spectroscopic study one thiosemicarbazone derivative with ctDNA using ethidium bromide as a fluorescence probe.

    Science.gov (United States)

    Geng, Shaoguang; Wu, Qing; Shi, Lei; Cui, Fengling

    2013-09-01

    In this study, a thiosemicarbazone derivative (E)-2-((1,4-dihydroxy-9,10-anthraquinone-2-yl)methylene)-N-(4-fluorophenyl)hydrazinecarbothioamide (DAFPT) was synthesized, and the interaction of DAFPT with calf thymus DNA (ctDNA) was explored using ethidium bromide (EB) as a fluorescence probe. The binding mode between DAFPT and ctDNA was investigated by UV absorption spectroscopy, fluorescence spectroscopy and molecular docking. The fluorescence quenching mechanism of EB-ctDNA by DAFPT might be a combined quenching type. Thermodynamic parameters showed that the reaction was spontaneous. According to ionic strength, fluorescence polarization and melting temperature (T(m)) curve results, DAFPT-ctDNA interaction was groove binding. The molecular modeling results indicated that DAFPT could slide into the A-T rich region of ctDNA. PMID:23769721

  15. Lithium bromide absorption machines: Pressure drop and mass transfer in solutions conical sheets

    Energy Technology Data Exchange (ETDEWEB)

    Palacios, E. [Escuela Universitaria de Ingenieria Tecnica Industrial, U.P.M., Ronda de Valencia 3, Madrid 28012 (Spain); Izquierdo, M. [Instituto de Ciencias de la Construccion Eduardo Torroja. C.S.I.C., Serrano Galvache 4, Madrid 28033 (Spain); Lizarte, R. [Escuela Politecnica Superior, Universidad Carlos III de Madrid, Avda. de la Universidad 30, Madrid 28911 (Spain); Marcos, J.D. [Escuela Tecnica Superior de Ingenieria Industrial, U.N.E.D., Juan del Rosal 12, Madrid 28040 (Spain)

    2009-07-15

    Adiabatic vapour absorption in conical liquid sheets is studied with a view to use in air conditioning. The sheets consist in a lithium bromide aqueous solution sprayed at mass flow rates ranging from 0.0078 to 0.0116 kg/s (28-42 kg/h). The experimental results show that the deformation rate associated with conical sheet development has a significant effect on absorption, with 60% of the total reached by the time the liquid sheet disintegrates, 4 ms after injection. In the conical sheet configuration, about 150 g of vapour are absorbed per kJ of solution flow work. The vapour absorption rate per chamber absorption volume, in turn, is found to be over 1 g/s l in absorption chambers 75 mm long or less. (author)

  16. [Investigation of the oxidation reaction of O3 with bromide ion in aqueous solution].

    Science.gov (United States)

    Yu, Xiao-Ting; Zhang, Jia-Hui; Pan, Xun-Xi; Zhang, Ren-Xi; Hou, Hui-Qi

    2012-09-01

    The reaction mechanism of O3 with bromide ion in aqueous solution was studied by ion chromatography and UV-Vis spectrometry instruments. Ion chromatography analysis showed that only 10% of Br- which was oxidized by ozone was formed into bromate ion. The results demonstrated that the final products of the oxidation reaction were identified as Br2 and Br3- except for BrO3-. The formation of Br3- which was yielded from the reaction of Br2 with Br- was the major process in the reaction of Br attacked by O3. The characteristic absorption spectrum of Br3- with an absorption peak at 260 nm was also investigated. The results may provide helpful information about the mechanism of the oxidation reaction of Br- with O3 and fate of Br- or its derivatives in the environment by the oxidation processes.

  17. 2-(4-Methylsulfanylphenyl-1H-benzimidazol-3-ium bromide

    Directory of Open Access Journals (Sweden)

    Mohamed Ziaulla

    2011-02-01

    Full Text Available In the cation of the title compound, C14H13N2S+·Br−, the essentially planar benzimidazole system (r.m.s. deviation = 0.0082 Å is substituted with a 4-methylsulfanylphenyl ring. The dihedral angle between the benzimidazole system and the 4-methylsulfanylphenyl ring is 2.133 (2°. The crystal structure is characterized by strong and highly directional intermolecular N—H...Br hydrogen bonds involving the bromide ion. Moreover, C—H...S interactions result in chains of molecules along the c axis. The supramolecular assembly is further stabilized by π–π stacking interactions between the benzimidazole system and 4-methylsulfanylphenyl rings [centroid–centroid distance = 3.477 (4 Å].

  18. Solubilization Using Some Novel N-Methyl Diethanolammonium Bromide Cationic Surfactants

    International Nuclear Information System (INIS)

    A novel series of N-methyl diethanolammonium bromide cationic surfactants was used as solubilizing agent for nonpolar substrate (paraffin oil) at 25 degree C. The results of solubilization measurements showed good ability for the used surfactants towards solubilizing paraffin oil in aqueous medium. The results showed also, that the chemical structure of the soluble plays an important rule in its solubilization. Several factors were found to influence the extent of solubilization, which are: number of alkyl chains within surfactant molecule, symmetry of molecules and chain length of hydrophobic parts. The results were rationalized by the Kraft point and HLB values of the used surfactants. Furthermore, solubilization curves showed the steady state solubilization of each surfactant used

  19. Improved hydrogen evolution on glassy carbon electrode modified with novel Pt/cetyltrimethylammonium bromide nanoscale aggregates

    Institute of Scientific and Technical Information of China (English)

    Jahan-Bakhsh Raoof; Sayed Reza Hosseini; Seyedeh Zeinab Mousavi-Sani

    2015-01-01

    A novel, cost‐effective, and simple electrocatalyst based on a Pt‐modified glassy carbon electrode (GCE), using cetyltrimethylammonium bromide (CTAB) as a cationic surfactant, is reported. Am‐phiphilic CTAB molecules were adsorbed on GCE by immersion in a CTAB solution. The positively charged hydrophilic layer, which consisted of small aggregates of average size less than 100 nm, was used for accumulation and complexation of [PtCl6]2− anions by immersing the electrode in K2PtCl6 solution. The modified electrode was characterized using scanning electron microscopy, energy‐dispersive X‐ray spectroscopy, impedance spectroscopy, and electrochemical methods. The electrocatalytic activity of the Pt particles in the hydrogen evolution reaction (HER) was investigat‐ed. The results show that the CTAB surfactant enhances the electrocatalytic activity of the Pt parti‐cles in the HER in acidic solution.

  20. Flotation de-silicating from diasporic-bauxite with cetyl trimethylammonium bromide

    Institute of Scientific and Technical Information of China (English)

    王毓华; 胡岳华; 刘晓文

    2003-01-01

    Using cetyl trimethylammonium bromide (CTAB) as collector, the flotation de-silicating from diasporicbauxite was investigated. And the Zeta potentials and contact-angles of silicate minerals and diaspore were also stuite and illite become more positive, and the contact angles of these three silicates also increase evidently in the pH range of 2-8, but the Zeta potentials and contact angles of diaspore change little. So, the floatability of the four minerals is in the following order: pyrophyllite>kaolinite≈illite>diaspore. The open-circuit flotation results also show that a bauxite concentrate with m(Al2 O3 )/m(SiO2 ) over 9.3 and Al2 O3 recovery over 76% can be obtained from diasporic-bauxite ore. The result of XRD of the bauxite concentrate shows that pyrophyllite is easier to be removed from diasporic-bauxite than illite and kaolinite due to its better floatability.

  1. Spectroscopic probe of the competitive binding of ethidium bromide and neomycin to DNA

    Science.gov (United States)

    Pal, Medini Kanta; Ghosh, Jimut Kanti

    1995-03-01

    The three spectroscopic changes of ethidium bromide (EB) on its binding to DNA, namely red-shift of the νmax, enhancement of fluorescence and induced dichroism are utilized to study the competitive binding of neomycin (NMC) and EB to DNA. Reversion of νmax, decrease in fluorescence and reduction of dichroism of DNA-EB on addition of NMC shows that the binding of NMC and EB to DNA is competitive in nature, over a limited concentration of the polymer. The binding constant of EB-DNA falls from 4.00 × 10 6 to 2.27 × 10 4 1 mol -1 in the presence of added NMC.

  2. Successful treatment of migrating partial seizures in Wolf-Hirschhorn syndrome with bromide.

    Science.gov (United States)

    Itakura, Ayako; Saito, Yoshiaki; Nishimura, Yoko; Okazaki, Tetsuya; Ohno, Koyo; Sejima, Hitoshi; Yamamoto, Toshiyuki; Maegaki, Yoshihiro

    2016-08-01

    A girl with mild psychomotor developmental delay developed right or left hemiclonic convulsion at 10months of age. One month later, clusters of hemiclonic or bilateral tonic seizures with eyelid twitching emerged, resulting in status epilepticus. Treatment with phenobarbital and potassium bromide completely terminated the seizures within 10days. Ictal electroencephalography revealed a migrating focus of rhythmic 3-4Hz waves from the right temporal to right frontal regions and then to the left frontal regions. Genetic analysis was conducted based on the characteristic facial appearance of the patient, which identified a 2.1-Mb terminal deletion on chromosome 4p. This is the first case of Wolf-Hirschhorn syndrome complicated by epilepsy with migrating partial seizures. PMID:26797656

  3. The matlockite-type praseodymium(III oxide bromide PrOBr

    Directory of Open Access Journals (Sweden)

    Pia Talmon-Gros

    2011-12-01

    Full Text Available The crystal structure of the praseodymium(III oxide bromide, PrOBr, can be best described with layers of agglomerated square antiprisms [PrO4Br4]9−. These slabs are stacked along the c axis and linked via two different secondary contacts between Pr3+ and Br−. The Pr3+ cations occupy the Wyckoff site 2c with 4mm symmetry and carry four O2− anions as well as four primary Br− anions, yielding a coordination number of 8. While the Br− anions exhibit the same site symmetry as the Pr3+ cations, the oxide anions are located at the Wyckoff position 2a with site symmetry overline{4}m2 and have four Pr3+ cations as neighbours, defining a tetrahedron.

  4. Bio-conjugated silver nanoparticles: from Ocimum sanctum and role of cetyltrimethyl ammonium bromide.

    Science.gov (United States)

    Zaheer, Zoya; Rafiuddin

    2013-08-01

    In this paper we have reported the spectrophotometeric and transmission electron microscopic (TEM) data to the shape-directing role of cetyltrimethylammonium bromide (CTAB) on the green extra-cellular synthesis of bio-conjugated Ag-nanoparticles using Ocimum sanctum leaves extract. TEM images revealed that the nanoparticles are mostly spherical (average particle size ranged from 18 to 35nm) with some truncated triangular nanoplates, aggregated in a beautiful manner to yield locket-like silver and capped by a thin layer of biomolecules of O. sanctum, whereas nanoparticles are highly poly-dispersed in presence of CTAB. The shape and position of wavelength maxima strongly depends on the reaction time, [leaves extract] and [CTAB]. The visual observations also suggest that the prefect transparent silver sol becomes turbid in presence of CTAB after some time. PMID:23524081

  5. Synthesis and photoluminescence of semiconductor quantum dots/cetyltrimethylammonium bromide vesicle core/shell nanostructures

    International Nuclear Information System (INIS)

    The synthesis and photoluminescence properties of the SiC quantum dots (QDs)/cetyltrimethylammonium bromide (CTAB) multilayered vesicle core/shell nanostructures are reported. The Coulomb attraction force between the negatively charged surface of the QD and the positively charged ionized CTAB molecules drives the formation of the core/shell nanostructures. The outer CTAB molecules are demonstrated to form multilayered vesicles. The core/shell nanostructures exhibit strong near-UV photoluminescence which is supposed to stem from the outer CTAB vesicles. This novel semiconductor QD/vesicle core/shell structures can serve as a prototype for studying the QD–organic molecule interaction as well as the building block for constructing nanoscale devices.

  6. Fluorescence studies on the interaction of ethidium bromide with duplex, triplex and quadruplex DNA structures

    Institute of Scientific and Technical Information of China (English)

    孙雪光; 曹恩华; 何裕建; 秦静芬

    1999-01-01

    Under different conditions, oligonucleotides can form several alternative DNA structures such as duplex, triplex and quadruplex. All these structures can interact with ethidium bromide (EB) and make its fluorescence intensity change. The fluorescence spectra and other related parameters provided by static fluorescence techniques showed that the interaction mechanisms between EB and these structures were not always the same. Among them, B type duplex and triplex DNA adopt an intercalative mode when binding to the EB, which has a relatively high efficiency of energy transfer and the fluorescence of EB cannot be quenched easily. While for the parallel duplex DNA, the interaction mode is an outside binding in which energy transfer can hardly happen and its fluorescence intensity as well as Stern-Volmer constant is almost the same to the free EB. For the quadruplex, the binding mechanism to EB is more complex. Results from the energy transfer and quenching studies indicate that the two interaction modes note

  7. Suzuki Reaction of Aryl Bromides Using a Phosphine-Free Magnetic Nanoparticle-Supported Palladium Catalyst

    Institute of Scientific and Technical Information of China (English)

    Nghia T. BUI; Trung B. DANG; Ha V. LE; Nam T. S. PHAN

    2011-01-01

    A palladium catalyst immobilized on superparaganetic nanoparticles was prepared with a palladium loading of 0.30 mmol/g.The catalyst was characterized using X-ray diffraction,scanning electron microscopy,transmission electron microscopy,vibrating sample magnetometry,thermogravimetric analysis,Fourier transform infrared,atomic absorption spectrophotometry,and nitrogen adsorption.The immobilized palladium catalyst was an efficient catalyst without added phosphine ligands for the Suzuki cross-coupling reaction of several aryl bromides with phenylboronic acid.The recovery of catalyst was simply by magnetic decantation in the presence of a magnet.The immobilized palladium catalyst can be reused many times without significant degradation in catalytic activity.No leaching of active palladium species into the reaction solution was detected.

  8. Tetrabutylammonium Bromide (TBABr-Based Deep Eutectic Solvents (DESs and Their Physical Properties

    Directory of Open Access Journals (Sweden)

    Rizana Yusof

    2014-06-01

    Full Text Available Density, viscosity and ionic conductivity data sets of deep eutectic solvents (DESs formed by tetrabutylammonium bromide (TBABr paired with ethlyene glycol, 1,3-propanediol, 1,5-pentanediol and glycerol hydrogen bond donors (HBDs are reported. The properties of DES were measured at temperatures between 303 K and 333 K for HBD percentages of 66.7% to 90%. The effects of HBDs under different temperature and percentages are systematically analyzed. As expected, the measured density and viscosity of the studied DESs decreased with an increase in temperature, while ionic conductivity increases with temperature. In general, DESs made of TBABr and glycerol showed the highest density and viscosity and the lowest ionic conductivity when compared to other DESs. The presence of an extra hydroxyl group on glycerol in a DES affected the properties of the DES.

  9. Precipitation of silicic acid from geothermal water by addition of cetyl-trimethyl-ammonium bromide

    Energy Technology Data Exchange (ETDEWEB)

    Kitsuki, Harumi; Yokoyama, Takushi; Shimada, Kanichi; Yamanaka, Chiho; Nishu, Keisuke; Shimizu, Shin; Tarutani, Toshikazu

    1986-01-25

    Cetyl-trimethyl-ammonium bromide (CTAB) was added to sodium silicate solution and geothermal hot water (Ohtake Geothermal Power Plant and Hatchobaru Geo-thermal Power Plant) to precipitate silica. 1) CTA ions do not react with monosilicic acid, but only the polymerization among the polysilicic acids proceeds and causes silica to precipitate. Optimum pH for the silica precipitation is 6 - 7 and the higher concentration of polysilicic acid will cause more precipitation. 2) When added to geothermal hot water, the silica precipita-tion increases with the increase of CTAB concentration within the range of 10/sup -7/ - 10/sup -4/ mol dm/sup 3/ concentration. Almost all poly-silicic acid precipitated at 10/sup -4/ mol dm/sup 3/ when measured for silica precipitation after 5 minutes. Total concentration of silicic acid was higher in the Hatchobaru geothermal water than that of the Ohtake geothermal water. (10 figs, 14 refs)

  10. INTERACTION OF POLY(SODIUM SULFODECYL METHACRYLATE) WITH CETYLTRIMETHYL AMMONIUM BROMIDE IN AQUEOUS SOLUTION

    Institute of Scientific and Technical Information of China (English)

    Cong-hua Lu; Chuan-qiou Luo; Wei-xiao Cao

    2003-01-01

    The interaction of poly(sodium sulfodecyl methacrylate) (PSSM) with cetyltrimethyl ammonium bromide (CTAB)was studied. It was found that the precipitate formed from PSSM and CTAB will be dissolved by excessive CTAB, resultingin the appearance of two maxima of the solution viscosity at the molar ratio (CTAB/-SO3-) of ≈ 0.68 and ≈ 1.30,respectively. The first one is related closely to the aggregation of polymer chains via CTAB molecules and the second oneshould be ascribed to the formation of the mixed micelles comprising surfactant and the polymer's hydrophobic chains. Theeffect of NaCl on the viscosity, the transmittance of the aqueous solution and the solubility of oil-soluble dye (dimethylyellow) in the mixed system were also investigated.

  11. Direct electrochemistry and electrocatalysis of myoglobin in dodecyltrimethylammonium bromide film modified carbon ceramic electrode

    Institute of Scientific and Technical Information of China (English)

    Yuan Zhen Zhou; Hui Wang; She Ying Dong; An Xiang Tian; Zhi Xian He; Bin Chen

    2011-01-01

    Direct electrochemistry and electrocatalysis of myoglobin (Mb) were studied with Mb immobilized on dodecyltrimethylammonium bromide (DTAB) film modified carbon ceramic (CC) electrode. Cyclic voltammetry showed a pair of well-defined and nearly reversible redox peaks of Mb (FeⅡ/FeⅢ) at about -0.3 V vs. SCE (pH = 6.98). The currents of the redox peak were linear to scan rate, and rate constant (Ks) was estimated to be 3.03 s-1. The formal potential (E01) of Mb in the DTAB/CC electrodes shifted linearly with pH with a slope of-36.44 mV/pH, implying that the electron transfer between DTAB and CC electrodes is accompanied by proton transportation. The immobilized Mb exhibited excellent electrocatalytic response to the reduction of hydrogen peroxide (H2O2).

  12. Multimetallic catalysed cross-coupling of aryl bromides with aryl triflates

    Science.gov (United States)

    Ackerman, Laura K. G.; Lovell, Matthew M.; Weix, Daniel J.

    2015-08-01

    The advent of transition-metal catalysed strategies for forming new carbon-carbon bonds has revolutionized the field of organic chemistry, enabling the efficient synthesis of ligands, materials, and biologically active molecules. In cases where a single metal fails to promote a selective or efficient transformation, the synergistic cooperation of two distinct catalysts--multimetallic catalysis--can be used instead. Many important reactions rely on multimetallic catalysis, such as the Wacker oxidation of olefins and the Sonogashira coupling of alkynes with aryl halides, but this approach has largely been limited to the use of metals with distinct reactivities, with only one metal catalyst undergoing oxidative addition. Here, we demonstrate that cooperativity between two group 10 metal catalysts--(bipyridine)nickel and (1,3-bis(diphenylphosphino)propane)palladium--enables a general cross-Ullmann reaction (the cross-coupling of two different aryl electrophiles). Our method couples aryl bromides with aryl triflates directly, eliminating the use of arylmetal reagents and avoiding the challenge of differentiating between multiple carbon-hydrogen bonds that is required for direct arylation methods. Selectivity can be achieved without an excess of either substrate and originates from the orthogonal reactivity of the two catalysts and the relative stability of the two arylmetal intermediates. While (1,3-bis(diphenylphosphino)propane)palladium reacts preferentially with aryl triflates to afford a persistent intermediate, (bipyridine)nickel reacts preferentially with aryl bromides to form a transient, reactive intermediate. Although each catalyst forms less than 5 per cent cross-coupled product in isolation, together they are able to achieve a yield of up to 94 per cent. Our results reveal a new method for the synthesis of biaryls, heteroaryls, and dienes, as well as a general mechanism for the selective transfer of ligands between two metal catalysts. We anticipate that this

  13. Carbon nanotubes as an efficient hole collector for high voltage methylammonium lead bromide perovskite solar cells

    Science.gov (United States)

    Li, Zhen; Boix, Pablo P.; Xing, Guichuan; Fu, Kunwu; Kulkarni, Sneha A.; Batabyal, Sudip K.; Xu, Wenjing; Cao, Anyuan; Sum, Tze Chien; Mathews, Nripan; Wong, Lydia Helena

    2016-03-01

    A high open circuit voltage (VOC) close to 1.4 V under AM 1.5, 100 mW cm-2 conditions is achieved when carbon nanotubes (CNTs) are used as a hole conductor in methyl ammonium lead bromide (MAPbBr3) perovskite solar cells. Time-resolved photoluminescence and impedance spectroscopy investigations suggest that the observed high VOC is a result of the better charge extraction and lower recombination of the CNT hole conductor. Tandem solar cells with all perovskite absorbers are demonstrated with a MAPbBr3/CNT top cell and a MAPbI3 bottom cell, achieving a VOC of 2.24 V in series connection. The semitransparent and high voltage MAPbBr3/CNT solar cells show great potential for applications in solar cell windows, tandem solar cells and solar driven water splitting.A high open circuit voltage (VOC) close to 1.4 V under AM 1.5, 100 mW cm-2 conditions is achieved when carbon nanotubes (CNTs) are used as a hole conductor in methyl ammonium lead bromide (MAPbBr3) perovskite solar cells. Time-resolved photoluminescence and impedance spectroscopy investigations suggest that the observed high VOC is a result of the better charge extraction and lower recombination of the CNT hole conductor. Tandem solar cells with all perovskite absorbers are demonstrated with a MAPbBr3/CNT top cell and a MAPbI3 bottom cell, achieving a VOC of 2.24 V in series connection. The semitransparent and high voltage MAPbBr3/CNT solar cells show great potential for applications in solar cell windows, tandem solar cells and solar driven water splitting. Electronic supplementary information (ESI) available. See DOI: 10.1039/c5nr06177f

  14. Thallium bromide chloride (TlBrxCl1-x) nuclear radiation detector

    International Nuclear Information System (INIS)

    Thallium bromide (TlBr) has been studied as an X- and gamma-ray detector material and relatively good spectrometric performances have been obtained from the detectors. However, the energy resolution of the TlBr detectors is limited by the relatively low resistivity of the crystals. Thallium bromide chloride (TlBrxCl1-x) is a mixed crystal of TlBr and thallium chloride (TlCl). TlBr0.8Cl0.2 crystals have been grown by the traveling molten zone method (TMZ) from purified materials. Nuclear radiation detectors have been fabricated from the grown TlBr0.8Cl0.2 crystals and the detector performance has been characterized. Optical transmittance was evaluated in order to characterize bandgap of the grown crystal. The results confirm that the bandgap of TlBr0.8Cl0.2 is wider than the bandgap of TlBr. Leakage currents of the detectors were measured as a function of the bias voltage at room temperature. The resistivity of the TlBr0.8Cl0.2 detector is approximately equal to the resistivity of typical TlBr detector. A TlBr0.8Cl0.2 detector operated at room temperature was irradiated with gamma-rays from 137Cs source. The detector exhibited a clear peak corresponding 662 keV gamma-rays. The resolution obtained by the TlBr0.8Cl0.2 detector, however, was presently not better than the resolution obtained by the typical TlBr detector. (M. Suetake)

  15. Ethidium bromide transport across Mycobacterium smegmatis cell-wall: correlation with antibiotic resistance

    Directory of Open Access Journals (Sweden)

    Couto Isabel

    2011-02-01

    Full Text Available Abstract Background Active efflux systems and reduced cell-wall permeability are considered to be the main causes of mycobacterial intrinsic resistance to many antimicrobials. In this study, we have compared the Mycobacterium smegmatis wild-type strain mc2155 with knockout mutants for porins MspA (the main porin of M. smegmatis and MspC, the efflux pump LfrA (the main efflux pump system of M. smegmatis and its repressor LfrR for their ability to transport ethidium bromide (EtBr on a real-time basis. This information was then correlated with minimum inhibitory concentrations (MICs of several antibiotics in the presence or absence of the efflux inhibitors chlorpromazine, thioridazine and verapamil. Results In the absence of porins MspA and MspC, accumulation of ethidium bromide decreased and the cells became more resistant to several antibiotics, whereas the knockout mutant for the LfrA pump showed increased accumulation of EtBr and increased susceptibility to EtBr, rifampicin, ethambutol and ciprofloxacin. Moreover, the efflux inhibitors caused a reduction of the MICs of streptomycin, rifampicin, amikacin, ciprofloxacin, clarithromycin and erythromycin in most of the strains tested. Conclusions The methodology used in this study demonstrated that porin MspA plays an important role in the influx of quaternary ammonium compounds and antibiotics and that efflux via the LfrA pump is involved in low-level resistance to several antimicrobial drugs in M. smegmatis. The results obtained with this non-pathogenic mycobacterium will be used in future studies as a model for the evaluation of the activity of the same efflux inhibitors on the susceptibility of multidrug resistant strains of Mycobacterium tuberculosis to isoniazid and rifampicin.

  16. The aqueous catanionic system sodium perfluorooctanoate-dodecyltrimethylammonium bromide at low concentration.

    Science.gov (United States)

    López-Fontán, José Luis; Blanco, Elena; Ruso, Juan M; Prieto, Gerardo; Schulz, Pablo C; Sarmiento, Félix

    2007-08-15

    The interaction between sodium perfluorooctanoate (SPFO) and dodecyltrimethylammonium bromide (DTAB) was studied by several methods and it was found strongly synergistic. Above a mole fraction of SPFO in the surfactant mixture (alpha(SPFO))=0.38, the interaction is repulsive and increases with the content of SPFO in both, the overall mixture and micelles, whereas the interaction is attractive if DTAB is in excess. At alpha(SPFO)=0.38 the low miscibility between hydrocarbon and fluorocarbon is counterbalanced by the electrostatic attraction between the opposite charged head groups, and the micelle composition is ideal (i.e., the mole fraction of SPFO in micelles X(SPFO)=alpha(SPFO)=0.38). The solubility of fluorocarbon in hydrocarbon is lower than that of hydrocarbon in fluorocarbon. Micelles of DTAB act as a solvent for SPFO without important structural changes, whilst micelles of SPFO undergo important changes when dissolve DTAB. This asymmetry may be interpreted as caused by the difference in chain length that favors the inclusion of the shorter chain in micelles of the longer surfactant, but disfavors the opposite process. Above X(SPFO)=0.5 there is an excess adsorption of bromide ions on the mixed micelles surface, giving rise to a high zeta potential. Micelles of pure SPFO or pure DTAB show an important energy barrier which prevents micelle flocculation. The inclusion of SPFO in DTAB micelles produces a reduction of the energy barrier, which disappeared when alpha(SPFO)=0.5. This produces the flocculation of micelles giving rise to the formation of a non-birefringent coacervate, which is probably formed by unordered isometric clusters of micelles.

  17. C-N Coupling of nitrogen nucleophiles with aryl and heteroaryl bromides using aminoarenethiolato-copper(I) (pre-)catalyst

    NARCIS (Netherlands)

    Sperotto, Elena; Klink, Gerard P.M. van; Vries, Johannes G. de; Koten, Gerard van

    2010-01-01

    The activity of a library of 2-aminoarenethiolato-copper(I) (CuSAr) (pre-)catalyst was explored in the arylation reaction of amines and N-containing heterocycles with aryl and heteroaryl bromides, respectively. These CuSAr pre-catalysts are thermally stable, are soluble in common organic solvents an

  18. Protective antiviral immune responses to pseudorabies virus induced by DNA vaccination using dimethyldioctadecylammonium bromide as an adjuvant

    NARCIS (Netherlands)

    Rooij, van E.M.A.; Glansbeek, H.L.; Hilgers, L.A.T.; Lintelo, te E.G.; Visser, de Y.E.; Boersma, W.J.A.; Haagmans, B.L.; Bianchi, A.T.J.

    2002-01-01

    To enhance the efficacy of a DNA vaccine against pseudorabies virus (PRV), we evaluated the adjuvant properties of plasmids coding for gamma interferon or interleukin-12, of CpG immunostimulatory motifs, and of the conventional adjuvants dimethyldioctadecylammonium bromide in water (DDA) and sulfoli

  19. Suzuki coupling reactions catalyzed by poly(N-ethyl-4-vinylpyridinium bromide stabilized palladium nanoparticles in aqueous solution

    Directory of Open Access Journals (Sweden)

    2008-04-01

    Full Text Available InIn this work, it was investigated to use of poly(N-ethyl-4-vinylpyridinium bromide stabilized palladium nanoparticles in the Suzuki reaction between phenylboronic acid and aryl halides in aqueous solution. The nanoparticles were isolated and re-used several times with low loss of activity.

  20. FLUORESCENCE SPECTROSCOPIC STUDY OF THE FORMATION OF HYDROPHOBIC MICRODOMAINS IN AQUEOUS-SOLUTIONS OF POLY(ALKYLMETHYLDIALLYLAMMONIUM BROMIDES)

    NARCIS (Netherlands)

    YANG, YJ; ENGBERTS, JBFN

    1991-01-01

    The conformational state of poly(alkylmethyldiallylammonium bromides) was studied in aqueous solutions using pyrene as a fluorescence probe. The results are indicative for the formation of hydrophobic microdomains in the case of several copolymers which possess sufficiently hydrophobic alkyl side ch

  1. Grafting, metham sodium, soil solarization and virtually impermeable films as alternative technologies to methyl bromide for Chinese protected tomatoes

    Institute of Scientific and Technical Information of China (English)

    Han Xuemei; Cao Zhiping; Chen Yunfeng; Chen Guokang; Andrea Camponogara; Yang Hang; Maria Lodovica Gullino

    2009-01-01

    In the frame of the Sino-ltalian Cooperation Program for Environmental Protection,jointly launched in the year 2000 by the Italian Ministry for Environment and Territory and Sea (IMETS) and the China State Environ nental Protection Administration (SEPA),experimental trials were carried out in Qingzhou city (Shandong Prov ince,China) during 2001-2003 to test several methyl bromide alternative methods to control soilborne diseases in greenhouse tomatoes.Grafting tomatoes on resistant rootstock (Lycopersicon lycopersicum×L.hirsutum),metham sodium applied under traditional polyethylene ptastic films,metham sodium applied at low rate under virtually im permeable films and soil solarization combined with biocontrol agents were the alternatives tested and compared to methyl bromide applied under virtually impermeable plastic films too.Collected data show that resistant rootstock (Lycopersicon lycopersicum × L.hirsutum) introduced from Italy is a promising alternative to methyl bromide for to cal tomato cultivars.Metham sodium applied under traditional polyethylene plastic films is an effective alternative Moreover,virtually impermeable.films demonstrate the help to reduce methyl bromide and metham sodium rates.Finally,soil solarization combined with biocontrol agents does not provide satisfactory resuhs in terms of disease control.

  2. High—Speed Analyzing PCR Products of M.tuberculosis Genome Stained by Ethidium Bromide on Microchip Gel Electrophoresis

    Institute of Scientific and Technical Information of China (English)

    金庆辉; 陈继锋; 等

    2002-01-01

    The technique of microchip gel electrophoresis(MCGE) was used to analyze the polymerase chain reaction (PCR) products of M.tuberculosis Genome stained by ethidium bromide,The electrophoretic Process was completed within 3-4 min and the results show that the technique of microchip electrophoresis is a high-speed and high-sensitivity analyzing method.

  3. Impact of Long-Term Tiotropium Bromide Therapy on Annual Lung Function Decline in Adult Patients with Cystic Fibrosis.

    Directory of Open Access Journals (Sweden)

    Claudia Brandt

    Full Text Available Chronic lung disease is the leading cause of death in patients with Cystic Fibrosis (CF and is often treated with bronchodilators. It is not known whether long-term tiotropium bromide treatment may have a positive impact on lung function.This retrospective cohort study estimated annual lung function decline utilizing longitudinal data for forced expiratory volume in 1 s (FEV1.A total of 160 adult patients with CF were analyzed. The subjects treated for 24 months with tiotropium bromide had a significantly slower decline of mean annual change of FEV1 (treated: -0.3±4.0%; control: -2.3±5.0%; p = 0.0130. In patients with FEV1 ≥70% predicted, long-term tiotropium bromide treatment was associated with greater improvements in annual lung function decline (FEV1 ≥70% predicted: treated: +0.5±4.7%; control: -4.0±6.3%; p = 0.0132; FEV1 50-69% predicted: treated: -0.5±4.4%; control: -0.8±3.8%; p = 0.7142; FEV1 ≤49% predicted: treated: -0.6±3.4%; control: -2.4±4.8%; p = 0.0898.This study suggests that long-term tiotropium bromide treatment may be associated with reduced annual decline of FEV1 in patients with CF, particularly in adults with a mild degree of severity.

  4. Formation of halogenated organic byproducts during medium-pressure UV and chlorine coexposure of model compounds, NOM and bromide.

    Science.gov (United States)

    Zhao, Quan; Shang, Chii; Zhang, Xiangru; Ding, Guoyu; Yang, Xin

    2011-12-01

    When chlorine is applied before or during UV disinfection of bromide-containing water, interactions between chlorine, bromide and UV light are inevitable. Formation of halogenated organic byproducts was studied during medium-pressure UV (MPUV) and chlorine coexposure of phenol, nitrobenzene and benzoic acid and maleic acid, chosen to represent electron-donating aromatics, electron-withdrawing aromatics, and aliphatic structures in natural organic matter (NOM), respectively. All were evaluated in the presence and absence of bromide. MPUV and chlorine coexposure of phenol produced less total organic halogen (TOX, a collective parameter for halogenated organic byproducts) than chlorination in the dark, and more haloacetic acids instead of halophenols. Increases in TOX were found in the coexposure of nitrobenzene and benzoic acid, but maleic acid was rather inert during coexposure. The presence of bromide increased the formation of brominated TOX but did not significantly affect total TOX formation, in spite of the fact that it reduced hydroxyl radical levels. MPUV and chlorine coexposure of NOM gave a higher differential UV absorbance of NOM and a larger shift to lower molecular weight compounds than chlorination in the dark. However, TOX formation with NOM remained similar to that observed from dark chlorination.

  5. Development of a specific affinity-matured exosite inhibitor to MT1-MMP that efficiently inhibits tumor cell invasion in vitro and metastasis in vivo

    DEFF Research Database (Denmark)

    Botkjaer, Kenneth A; Kwok, Hang Fai; Terp, Mikkel G;

    2016-01-01

    -fold with the ability to interfere with cell-surface MT1-MMP functions, displaying IC50 values down to 5 nM. Importantly, the new inhibitors were able to inhibit collagen invasion by tumor-cells in vitro and in vivo primary tumor growth and metastasis of MDA-MB-231 cells in a mouse orthotopic xenograft...

  6. On preparation and conductivity of N- Propylpyridine bromide%溴化N-正丙基吡啶的合成及其在水中的电导率研究

    Institute of Scientific and Technical Information of China (English)

    陶玫蓉; 赵志刚; 田鹏; 秦雨; 张璇; 马鑫

    2012-01-01

    In this paper, the intermediates of ionic liquids N- Propyl Pyridine Bromide is compound by N-propyl bromide and pyridine, and its structure was characterized by infrared spectroscopy. It analyzed the specific location of the peak, then the spectrogram indicating that the synthetic product is the target product. Using the ultraviolet spectrophotometer for N- Propyl Pyridine Bromide to analysis, we determine the ionic liquid N- Propyl Pyridine Bromide in ethanol, methanol, acetonitrile by the ultraviolet spectrum, spectrum analysis can be concluded that; the ionic liquid intermediates N- Propyl Pyridine Bromide ultraviolet absorption spectra by solvent polarity and pH effects. We should pay attention to the use of solvents when the ionic liquid mixture with other solvents for ultraviolet spectra. Conductivity was measured using the different molality of the ionic liquid intermediates N- Propyl Pyridine Bromide in water, and draw the linear whit the molality and conductivity. The empirical equation is y=18.903 03-60.532 49/( l+exp( (C+0.937 58 )/l. 073 67) ) , the correlation coefficient is 0. 999 59. It can be seen, the conductivity of ionic liquids intermediate N- Propyl Pyridine Bromide increased with the molality and has a good linear relationship.%用溴代正丙烷与吡啶合成了离子液体溴化N-正丙基吡啶,并对其结构进行红外光谱表征,表明合成产物为目标产物.对离子液体溴化N-正丙基吡啶进行紫外光谱分析,测定了其在水、乙醇、乙腈三种溶剂中的紫外光谱.实验结果表明离子液体溴化N-正丙基吡啶的紫外吸收光谱受到溶剂极性和酸碱性的影响,在对离子液体与其他溶剂的混合溶液进行紫外光谱分析时,要指明所使用的溶剂.测定了不同质量摩尔浓度离子液体溴化N-正丙基吡啶在水中的电导率,将测得的电导率对质量摩尔浓度进行拟合,得到经验方程式:y=18.903 03-60.532 49/(1+exp((C+0.937 58)/1.073 67)),

  7. Impact of bromide on halogen incorporation into organic moieties in chlorinated drinking water treatment and distribution systems.

    Science.gov (United States)

    Tan, J; Allard, S; Gruchlik, Y; McDonald, S; Joll, C A; Heitz, A

    2016-01-15

    The impact of elevated bromide concentrations (399 to 750 μg/L) on the formation of halogenated disinfection by-products (DBPs), namely trihalomethanes, haloacetic acids, haloacetonitriles, and adsorbable organic halogen (AOX), in two drinking water systems was investigated. Bromine was the main halogen incorporated into all of the DBP classes and into organic carbon, even though chlorine was present in large excess to maintain a disinfectant residual. Due to the higher reactivity of bromine compared to chlorine, brominated DBPs were rapidly formed, followed by a slower increase in chlorinated DBPs. Higher bromine substitution and incorporation factors for individual DBP classes were observed for the chlorinated water from the groundwater source (lower concentration of dissolved organic carbon (DOC)), which contained a higher concentration of bromide, than for the surface water source (higher DOC). The molar distribution of adsorbable organic bromine to chlorine (AOBr/AOCl) for AOX in the groundwater distribution system was 1.5:1 and almost 1:1 for the surface water system. The measured (regulated) DBPs only accounted for 16 to 33% of the total organic halogen, demonstrating that AOX measurements are essential to provide a full understanding of the formation of halogenated DBPs in drinking waters. In addition, the study demonstrated that a significant proportion (up to 94%) of the bromide in source waters can be converted AOBr. An evaluation of AOBr and AOCl through a second groundwater treatment plant that uses conventional treatment processes for DOC removal produced 70% of AOX as AOBr, with 69% of the initial source water bromide converted to AOBr. Exposure to organobromine compounds is suspected to result in greater adverse health consequences than their chlorinated analogues. Therefore, this study highlights the need for improved methods to selectively reduce the bromide content in source waters.

  8. Balanced feedforward inhibition and dominant recurrent inhibition in olfactory cortex.

    Science.gov (United States)

    Large, Adam M; Vogler, Nathan W; Mielo, Samantha; Oswald, Anne-Marie M

    2016-02-23

    Throughout the brain, the recruitment of feedforward and recurrent inhibition shapes neural responses. However, disentangling the relative contributions of these often-overlapping cortical circuits is challenging. The piriform cortex provides an ideal system to address this issue because the interneurons responsible for feedforward and recurrent inhibition are anatomically segregated in layer (L) 1 and L2/3 respectively. Here we use a combination of optical and electrical activation of interneurons to profile the inhibitory input received by three classes of principal excitatory neuron in the anterior piriform cortex. In all classes, we find that L1 interneurons provide weaker inhibition than L2/3 interneurons. Nonetheless, feedforward inhibitory strength covaries with the amount of afferent excitation received by each class of principal neuron. In contrast, intracortical stimulation of L2/3 evokes strong inhibition that dominates recurrent excitation in all classes. Finally, we find that the relative contributions of feedforward and recurrent pathways differ between principal neuron classes. Specifically, L2 neurons receive more reliable afferent drive and less overall inhibition than L3 neurons. Alternatively, L3 neurons receive substantially more intracortical inhibition. These three features--balanced afferent drive, dominant recurrent inhibition, and differential recruitment by afferent vs. intracortical circuits, dependent on cell class--suggest mechanisms for olfactory processing that may extend to other sensory cortices. PMID:26858458

  9. Corrosion Inhibition by – Phthalic Acid - Zn2+ System

    Directory of Open Access Journals (Sweden)

    R. Mohan

    2014-05-01

    Full Text Available The inhibition effect of Phthalic acid(PA – Zn2+ system controls the corrosion of carbon steel has been studied by weight – loss method. The weight – loss study reveals that the formulation consisting of 60 ppm of Zn2+, 50 ppm of phthalic acid has 82 % inhibition efficiency. Synergistic effect exists between phthalic acid- Zn2+ system. The influence of N-cetyl- N, N, N-trimethylammonium bromide(CTAB on the PA- Zn2+ system control the microbial corrosion. The value of the separation factor, RL indicated the phthalic acid- Zn2+ system was favorable adsorption. The Adsorption equilibrium exhibited better fit to Langmuir isotherm than Freundlich isotherm. The protective film consists of Fe2+ - Phthalic acid and Zn(OH2 by FTIR spectroscopy.

  10. Bm-CPI-2, a cystatin from Brugia malayi nematode parasites, differs from Caenorhabditis elegans cystatins in a specific site mediating inhibition of the antigen-processing enzyme AEP.

    Science.gov (United States)

    Murray, Janice; Manoury, Bénédicte; Balic, Adam; Watts, Colin; Maizels, Rick M

    2005-02-01

    The filarial parasite Brugia malayi survives for many years in the human lymphatic system. One immune evasion mechanism employed by Brugia is thought to be the release of cysteine protease inhibitors (cystatins), and we have previously shown that the recombinant cystatin Bm-CPI-2 interferes with protease-dependent antigen processing in the MHC class II antigen presentation pathway. Analogy with vertebrate cystatins suggested that Bm-CPI-2 is bi-functional, with one face of the protein blocking papain-like proteases, and the other able to inhibit legumains such as asparaginyl endopeptidase (AEP). Site-directed mutagenesis was carried out on Bm-CPI-2 at Asn-77, the residue on which AEP inhibition is dependent in vertebrate homologues. Two mutations at this site (to Asp and Lys) showed 10-fold diminished and ablated activity respectively, in assays of AEP inhibition, while blocking of papain-like proteases was reduced by only a small degree. Comparison of the B. malayi cystatins with two homologues encoded by the free-living model organism, Caenorhabditis elegans, suggested that while the papain site may be intact, the AEP site would not be functional. This supposition was tested with recombinant C. elegans proteins, Ce-CPI-1 (K08B4.6) and Ce-CPI-2 (R01B10.1), both of which block cathepsins and neither of which possess the ability to block AEP. Thus, Brugia CPI-2 may have convergently evolved to inhibit an enzyme important only in the mammalian environment.

  11. Suppression of tumor necrosis factor receptor-associated protein 1 expression induces inhibition of cell proliferation and tumor growth in human esophageal cancer cells.

    Science.gov (United States)

    Tian, Xin; Ma, Ping; Sui, Cheng-Guang; Meng, Fan-Dong; Li, Yan; Fu, Li-Ye; Jiang, Tao; Wang, Yang; Jiang, You-Hong

    2014-06-01

    Tumor necrosis factor receptor-associated protein 1 (TRAP1) is a molecular chaperone involved in multidrug resistance and antiapoptosis in some human tumors, but its regulatory mechanisms have not been revealed in esophageal squamous cell carcinoma (ESCC). In this study, 138 specimens of ESCC were analyzed. TRAP1 was overexpressed in ESCC, particularly in poorly differentiated tumors. To further explore the molecular regulatory mechanism, we constructed specific small interfering RNA-expressing vectors targeting Trap1, and knocked down Trap1 expression in the esophageal cancer cell lines ECA109 and EC9706. Knockdown of Trap1 induced increases in reactive oxygen species and mitochondrial depolarization, which have been proposed as critical regulators of apoptosis. The cell cycle was arrested in G2/M phase, and in vitro inhibition of cell proliferation was confirmed with 3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyl-tetrazolium bromide and bromodeoxyuridine assays. Furthermore, re-expression of TRAP1 in Trap1 small interfering RNA-transfected ESCC cells restored cell proliferation and cell apoptosis. Bioluminescence of subcutaneously xenografted ESCC tumor cells demonstrated significant inhibition of in vivo tumor growth by Trap1 knockdown. This study shows that TRAP1 was overexpressed in most patients with ESCC, and caused an increase in antiapoptosis potency. TRAP1 may be regarded as a target in ESCC biotherapy.

  12. Transport of Alachlor, Atrazine, Dicamba, and Bromide through Silt and Loam Soils

    Science.gov (United States)

    Tindall, J. A.

    2015-12-01

    The herbicides alachlor, atrazine, and dicamba, as well as bromide were applied to soils overlying the High Plains aquifer in Nebraska, to both macropore and non-macropore sites. Three of 6 study areas (exhibiting a high percentage of macropores) were used for analysis of chemical transport. Twelve intact soil cores (30 cm diameter; 40 cm height), were excavated (two each from 0-40 cm and 40-80 cm depths). The first three study areas and soil cores were used to study preferential flow characteristics using dye staining and to determine hydraulic properties; the remaining cores were treated the same as field macropore sites. Two undisturbed experimental field plots, each with a 1 m2 surface area, were established in each of the three macropore study areas. Each preferential plot was instrumented with suction lysimeters, tensiometers, and neutron access tubes - 10 cm increments to 80 cm - and planted in corn. Three study areas that did not exhibit macropores had alachlor, atrazine, and dicamba and bromide disked into the top 15 cm of soil; concentrations were tracked for 120 days - samples were collected on a grid, distributed within 3 plots measuring 50 m x 50 m each. Core samples were collected prior to and immediately after application, and then at 30, 60, and 120 days after application. Each lab core sample was in 15-cm lengths from 0-15 cm, 15-30 cm, 45-60 cm, and 75-90 cm. For areas exhibiting macropores, herbicides had begun to move between 10-15 days after application with concentrations peaking at various depths after heavy rainfall events. Field lysimeter samples showed increases in concentrations of herbicides at depths where laboratory data indicated greater percentages of preferential flowpaths. Concentrations of atrazine, alachlor and dicamba exceeding 0.30, 0.30, and 0.05 μg m1-1 respectively were observed with depth (10-30 cm and 50-70 cm) after two months following heavy rainfall events indicating that preferential flowpaths were a significant

  13. HYOSCINE BUTYL BROMIDE VERSUS DROTAVERINE HYDROCHLORIDE IN ACTIVE STAGE OF LABOUR-A COMPARATIVE STUDY OF RATE OF CERVICAL DILATATION

    Directory of Open Access Journals (Sweden)

    Misha Pepsi

    2014-05-01

    Full Text Available AIM: This study was conducted to compare the rate of cervical dilatation with hyoscine butyl bromide and drotaverine hydrochloride in active stage of labour. MATERIALS AND METHODOLOGY: This prospective study was conducted in the department of Obstetrics and Gynaecology. Inclusion Criteria: 1. All women with initial cervical dilatation of 3 cms. 2. When there is a slow rate of cervical dilatation of less than 1.5 cms per hour or decent of less than 1 cm per hour for nulliparous and if dilatation was less than 2cms per hour for a multigravida. 3. And all singleton and cephalic pregnancies were included in this study. Exclusion Criteria included complications like Antepartum haemorrhage, Breech, C.P.D. In this study 400 women were allocated into two groups to receive either Hyoscine butyl bromide or Drotaverine hydrochloride. Two hours after admission in the active stage of labour, progress of labour was reassessed. If the progress of labour was satisfactory, then the wait and watch policy was adopted. If there was no progress they were administered one of the two drugs. 200 patients were administered 10mg of hyoscine butyl bromide suppositories rectally, (GROUP-1 AND THE OTHER 200 WITH 40mg of drotaverine hydrochloride intravenously (GROUP-2. The progress of labour was monitored by the partogram. Not more than 3 doses of hyoscine butyl bromide were administered. RESULTS: The rate of cervical dilatation was 2 cms per hour in group 1 (Hyoscine butyl bromide as compared to 1cm per hour in group 2 (Drotaverine hydrochloride. The difference in rate of cervical dilatation in both the groups was statistically significant. CONCLUSION: There was significant improvement in the rate of cervical dilatation with Hyoscine butyl bromide group of patients. There was a significant reduction in the duration of active stage of labour, and there was no significant second and third stage complication when these drugs were used. No untoward side effects were noted when

  14. Inhibition and promotion of copper corrosion by CTAB in a microreactor system.

    Science.gov (United States)

    Murira, Caroline M; Punckt, Christian; Schniepp, Hannes C; Khusid, Boris; Aksay, Ilhan A

    2008-12-16

    We report on an optical microscopy technique for the analysis of corrosion kinetics of metal thin films in microreactor systems and use it to study the role of cetyltrimethylammonium bromide surfactant as a corrosion inhibitor in a copper-gold galvanic coplanar microsystem. A minimum in the dissolution rate of copper is observed when the surfactant concentration is approximately 0.8 mM. To explain why the inhibitory role of the surfactant does not extend to higher concentrations, we use zero resistance ammetry with separated half cells and show that while the surfactant inhibits cathodic reactions on gold, it also promotes the corrosion of copper because of the catalytic action of bromide counterions. These two competing processes lead to the observed minimum in the dissolution rate.

  15. 婴儿双歧杆菌对花生过敏小鼠模型肠道Th2反应的调节%Bifidobacterium infantis inhibits peanut-specific intestinal Th2 response

    Institute of Scientific and Technical Information of China (English)

    杨丽; 刘志强; CHEN Xiao; YANG Ping-chang; 郑鹏远

    2012-01-01

    Objective To study the effects of Bifidobacterium infantis in regulating peanut-specific intestinal Th2 re-sponse. Methods Food allergy mice model were established by using peanut allergen to induce intestinal Th2 response. Al-lergic mice were treated without or with Bifidobacterium infantis (ATCC or CGMCC0313-2) via gavage-feeding. CD4 + T cells or DC were purified from intestine mononuclear cells of mice. Paraffin embedded intestine were stained with toluidine blue to count the mast cells and with HE to count the mononuclear cells and eosinophils. The proportion of Th2 cell (CD4+IL-4+ T) and Treg ( CD4 + CD25 + Foxp3 + T) in the CD4 + T cells were determined with flow cytometry. The proliferitive response of CD4 + T cells labeled by CFSE, co-cultured with DC for 4 days, were detected by flow cytometry. The levels of IL-4, IL-5 and IL-13 in supernatant were detected respectively by ELISA. Results The proportion of Th2 cell, the proliferitive response of CD4 + T, the levels of IL-4, IL-5 and IL-13 , and the counts of mast cells, mononuclear cells and eosinophils were significantly increased in allergic mice compared with controls ( P < 0.01) , while the proportion of Treg was decreased in allergic mice com-pared with controls (P<0.01). After treatment with Bifidobacterium infantis, the proportion of Th2 cell, the proliferitive re-sponse of CD4 + T, the levels of IL-4, IL-5 and IL-13, and the counts of mast cells, mononuclear cells and eosinophils were decreased compared with allergic mice group ( P < 0. 01 ). The proportion of Treg was also increased in mice treated with Bifidobacterium infantis compared with allergic mice group (P < 0. 01). Conclusion Oral administration of Bifidobacterium infantis can inhibit peanut allergic Th2 response in the intestine.%目的 研究婴儿型双歧杆菌对花生过敏小鼠肠道Th2型反应的调节作用.方法 通过应用花生蛋白诱导肠道的Th2型反应,建立食物过敏小鼠模型.过敏小鼠灌胃给予

  16. Bromate ion formation in dark chlorination and ultraviolet/chlorination processes for bromide-containing water

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    Bormate (BrO3-) is a carcinogenic chemical produced in ozonation or chlorination of bromide-containing water. Although its formation in seawater with or without sunlight has been previously investigated, the formation of bromate in dilute solutions,particularly raw water for water treatment plant, is unknown. In this article, the results of bench scale tests to measure the formation rates of bromate formation in dilute solutions, including de-ionized water and raw water from Yangtze River, were presented in dark chlorination and ultraviolet (UV)/chlorination processes. And the effects of initial pH, initial concentration of NaOCl, and UV light intensity on bromate formation in UV/chlorination of the diluted solutions were investigated. Detectable bromate was formed in dark chlorination of the two water samples with a relatively slow production rate. Under routine disinfecting conditions, the amount of formed bromate is not likely to exceed the national standards (10 μg/L). UV irradiation enhanced the decay of free chlorine, and,simultaneously, 6.6%-32% of Br- was oxidized to BrO3-. And the formation of bromate exhibited three stages: rapid stage, slow stage and plateau. Under the experimental conditions (pH = 4.41-11.07, CCl2= 1.23-4.50 mg/L), low pH and high chlorine concentration favored the generation of bromate. High light intensity promoted the production rate of bromate, but decreased its total generation amount due to acceleration of chlorine decomposition.

  17. Ozone Therapy in Ethidium Bromide-Induced Demyelination in Rats: Possible Protective Effect.

    Science.gov (United States)

    Salem, Neveen A; Assaf, Naglaa; Ismail, Manal F; Khadrawy, Yasser A; Samy, Mohga

    2016-08-01

    Multiple sclerosis, an autoimmune inflammatory disease of the central nervous system, is characterized by excessive demyelination. The study aimed to investigate the possible protective effect of ozone (O3) therapy in ethidium bromide (EB)-induced demyelination in rats either alone or in combination with corticosteroids in order to decrease the dose of steroid therapy. Rats were divided into Group (1) normal control rats received saline, Group (2) Sham-operated rats received saline, Group (3) Sham-operated rats received vehicle (oxygen), Group (4) EB-treated rats received EB, Group (5) EB-treated rats received O3, Group (6) EB-treated rats received methylprednisolone (MP), and Group (7) EB-treated rats received half the dose of MP concomitant with O3. EB-treated rats showed a significant increase in the number of footfalls in the grid walk test, decreased brain GSH, and paraoxonase-1 enzyme activity, whereas brain MDA, TNF-α, IL-1β, INF-γ, Cox-2 immunoreactivity, and p53 protein levels were increased. A significant decline in brain serotonin, dopamine, norepinephrine, and MBP immunoreactivity was also reported. Significant improvement of the above-mentioned parameters was demonstrated with the administration of either MP or O3, whereas best amelioration was achieved by combining half the dose of MP with ozone. PMID:26467344

  18. Photocontrol of Voltage-Gated Ion Channel Activity by Azobenzene Trimethylammonium Bromide in Neonatal Rat Cardiomyocytes.

    Directory of Open Access Journals (Sweden)

    Sheyda R Frolova

    Full Text Available The ability of azobenzene trimethylammonium bromide (azoTAB to sensitize cardiac tissue excitability to light was recently reported. The dark, thermally relaxed trans- isomer of azoTAB suppressed spontaneous activity and excitation propagation speed, whereas the cis- isomer had no detectable effect on the electrical properties of cardiomyocyte monolayers. As the membrane potential of cardiac cells is mainly controlled by activity of voltage-gated ion channels, this study examined whether the sensitization effect of azoTAB was exerted primarily via the modulation of voltage-gated ion channel activity. The effects of trans- and cis- isomers of azoTAB on voltage-dependent sodium (INav, calcium (ICav, and potassium (IKv currents in isolated neonatal rat cardiomyocytes were investigated using the whole-cell patch-clamp technique. The experiments showed that azoTAB modulated ion currents, causing suppression of sodium (Na+ and calcium (Ca2+ currents and potentiation of net potassium (K+ currents. This finding confirms that azoTAB-effect on cardiac tissue excitability do indeed result from modulation of voltage-gated ion channels responsible for action potential.

  19. Pourbaix diagrams for titanium in concentrated aqueous lithium bromide solutions at 25 oC

    International Nuclear Information System (INIS)

    Research highlights: → The titanium solubility range increases slightly with increasing Br- activity. → The passivation area decreases slightly with increasing Br- activity. → Immunity area increases slightly with increasing Br- activity. → The titanium immunity disappears in the presence of titanium hydrides. → TiH2 is the stable species at low potentials in the presence of titanium hydrides. - Abstract: Pourbaix diagrams (electrode potential-pH diagrams) for Ti-Br--H2O system at 25 oC in the absence and presence of titanium hydrides were developed in 400, 700, 850, and 992 g/L LiBr solutions. The diagrams were compared with the simple Ti-H2O system at 25 oC. Comparison of the simple Ti-H2O system with the diagrams of the Ti-Br--H2O system at 25 oC showed that the titanium solubility range in the acid, neutral, and weak alkaline areas of the diagrams extended slightly to both higher pH values and potentials with increasing bromide ion activity and decreasing water activity.

  20. Influence of Low Cetyltrimethylammonium Bromide Concentration on the Interactions and Properties of Hemoglobin with Acyclovir

    Institute of Scientific and Technical Information of China (English)

    LIU Tian-Qing; GUO Rong

    2006-01-01

    The effects of cetyltrimethylammonium bromide (CTAB) on the properties of hemoglobin (Hb) at low CTAB concentration were studied in Hb/acyclovir/CTAB system by the methods of UV-Vis spectrum, fluorescence, zeta potential, conductivity and negative-staining transmission electron microscope (TEM). With the increase of CTAB concentration, the UV peak intensity at 276 nm, the intrinsic fluorescence, the zeta potential of Hb and the system conductivity were all enhanced. Hb was easily oxidized to oxyHb and hemichrome. In Hb/acyclovir/CTAB system,CTAB made the UV-Vis spectrum, fluorescence, conductivity and conformation of Hb tend to be returned to those of the original Hb but the zeta potential not to do so. The UV absorption peak of Hb-acyclovir complex disappeared,and the tight structure of Hb aroused by acyclovir was refolded. When CTAB concentration was higher than 5 ×10-5 mol/L, the two absorption peaks at 536 and 576 nm appeared again, and the Hb structure became looser again.