
Sample records for bromeliad-living jumping spiders

  1. Ant mimicry lessens predation on a North American jumping spider by larger salticid spiders. (United States)

    Durkee, Caitlin A; Weiss, Martha R; Uma, Divya B


    Ant-like appearance (myrmecomorphy) has evolved >70 times in insects and spiders, accounting for >2,000 species of myrmecomorphic arthropods. Most myrmecomorphic spiders are considered to be Batesian mimics; that is, a palatable spider avoids predation through resemblance to an unpalatable ant-although this presumption has been tested in relatively few cases. Here we explicitly examined the extent to which Peckhamia picata (Salticidae), a North American ant-mimicking jumping spider, is protected from four species of jumping spider predators, relative to nonmimetic salticids and model ants. In addition, we conducted focused behavioral observations on one salticid predator, Thiodina puerpera, to determine the point at which the predators' behaviors toward model, mimic, and nonmimic diverge. We also examined the behaviors of Peckhamia in the presence of Thiodina. We found that mimetic jumping spiders were consumed less than a third as often as nonmimetic jumping spiders, suggesting that Peckhamia does indeed gain protection as a result of its resemblance to ants, and so can be considered a Batesian mimic. Furthermore, our focal predator did not consume any ant-mimicking spiders, and seemed to categorize Peckhamia with its model ant early in the hunting sequence. Such early determination of prey versus nonprey may be the result of speed-accuracy trade-offs in predator decision-making.

  2. Salticid predation as one potential driving force of ant mimicry in jumping spiders (United States)

    Huang, Jin-Nan; Cheng, Ren-Chung; Li, Daiqin; Tso, I-Min


    Many spiders possess myrmecomorphy, and species of the jumping spider genus Myrmarachne exhibit nearly perfect ant mimicry. Most salticids are diurnal predators with unusually high visual acuity that prey on various arthropods, including conspecifics. In this study, we tested whether predation pressure from large jumping spiders is one possible driving force of perfect ant mimicry in jumping spiders. The results showed that small non-ant-mimicking jumping spiders were readily treated as prey by large ones (no matter whether heterospecific or conspecific) and suffered high attack and mortality rates. The size difference between small and large jumping spiders significantly affected the outcomes of predatory interactions between them: the smaller the juvenile jumping spiders, the higher the predation risk from large ones. The attack and mortality rates of ant-mimicking jumping spiders were significantly lower than those of non-ant-mimicking jumping spiders, indicating that a resemblance to ants could provide protection against salticid predation. However, results of multivariate behavioural analyses showed that the responses of large jumping spiders to ants and ant-mimicking salticids differed significantly. Results of this study indicate that predation pressure from large jumping spiders might be one selection force driving the evolution of nearly perfect myrmecomorphy in spiders and other arthropods. PMID:20961898

  3. Early environmental conditions shape personality types in a jumping spider

    Directory of Open Access Journals (Sweden)

    Jannis eLiedtke


    Full Text Available Individuals of many species across the animal kingdom are found to be less plastic than expected, even in behavioral traits. The existence of consistent behavioral differences between individuals, termed personality differences, is puzzling, since plastic behavior is considered ideal to enable animals to adaptively respond to changes in environmental conditions. In order to elucidate which mechanisms are important for the evolution of personality differences, it is crucial to understand which aspects of the environment are important for the development of personality differences. Here, we tested whether physical or social aspects of the environment during development influence individual differentiation (mean level of behavior using the jumping spider Marpissa muscosa. Furthermore, we assessed whether those behaviors were repeatable, i.e. whether personalities existed. We applied a split-brood design and raised spider siblings in three different environments: a deprived environment with no enrichment, a socially and a physically enriched environment. We focused on exploratory behavior and repeatedly assessed individual behavior in a novel environment and a novel object test. Results show that the environment during development influenced spiders’ exploratory tendencies: spiders raised in enriched environments tended to be more exploratory. Most investigated behaviors were repeatable (i.e. personalities existed across all individuals tested, whereas only few behaviors were also repeatable across individuals that had experienced the same environmental condition. Taken together, our results indicate that external stimuli can influence the development of one aspect of personality, the inter-individual variation (mean level of behavior, in a jumping spider. We also found family by environment interactions on behavioral traits potentially suggesting genetic variation in developmental plasticity.

  4. Innate pattern recognition and categorization in a jumping spider.

    Directory of Open Access Journals (Sweden)

    Yinnon Dolev

    Full Text Available The East African jumping spider Evarcha culicivora feeds indirectly on vertebrate blood by preferentially preying upon blood-fed Anopheles mosquitoes, the vectors of human malaria1, using the distinct resting posture and engorged abdomen characteristic of these specific prey as key elements for their recognition. To understand perceptual categorization of objects by these spiders, we investigated their predatory behavior toward different digital stimuli--abstract 'stick figure' representations of Anopheles constructed solely by known key identification elements, disarranged versions of these, as well as non-prey items and detailed images of alternative prey. We hypothesized that the abstract images representing Anopheles would be perceived as potential prey, and would be preferred to those of non-preferred prey. Spiders perceived the abstract stick figures of Anopheles specifically as their preferred prey, attacking them significantly more often than non-preferred prey, even when the comprising elements of the Anopheles stick figures were disarranged and disconnected from each other. However, if the relative angles between the elements of the disconnected stick figures of Anopheles were altered, the otherwise identical set of elements was no longer perceived as prey. These data show that E. culicivora is capable of making discriminations based on abstract concepts, such as the hypothetical angle formed by discontinuous elements. It is this inter-element angle rather than resting posture that is important for correct identification of Anopheles. Our results provide a glimpse of the underlying processes of object recognition in animals with minute brains, and suggest that these spiders use a local processing approach for object recognition, rather than a holistic or global approach. This study provides an excellent basis for a comparative analysis on feature extraction and detection by animals as diverse as bees and mammals.

  5. Innate Pattern Recognition and Categorization in a Jumping Spider (United States)

    Dolev, Yinnon; Nelson, Ximena J.


    The East African jumping spider Evarcha culicivora feeds indirectly on vertebrate blood by preferentially preying upon blood-fed Anopheles mosquitoes, the vectors of human malaria1, using the distinct resting posture and engorged abdomen characteristic of these specific prey as key elements for their recognition. To understand perceptual categorization of objects by these spiders, we investigated their predatory behavior toward different digital stimuli - abstract ‘stick figure’ representations of Anopheles constructed solely by known key identification elements, disarranged versions of these, as well as non-prey items and detailed images of alternative prey. We hypothesized that the abstract images representing Anopheles would be perceived as potential prey, and would be preferred to those of non-preferred prey. Spiders perceived the abstract stick figures of Anopheles specifically as their preferred prey, attacking them significantly more often than non-preferred prey, even when the comprising elements of the Anopheles stick figures were disarranged and disconnected from each other. However, if the relative angles between the elements of the disconnected stick figures of Anopheles were altered, the otherwise identical set of elements was no longer perceived as prey. These data show that E. culicivora is capable of making discriminations based on abstract concepts, such as the hypothetical angle formed by discontinuous elements. It is this inter-element angle rather than resting posture that is important for correct identification of Anopheles. Our results provide a glimpse of the underlying processes of object recognition in animals with minute brains, and suggest that these spiders use a local processing approach for object recognition, rather than a holistic or global approach. This study provides an excellent basis for a comparative analysis on feature extraction and detection by animals as diverse as bees and mammals. PMID:24893306

  6. Phylogeny with introgression in Habronattus jumping spiders (Araneae: Salticidae). (United States)

    Leduc-Robert, Geneviève; Maddison, Wayne P


    Habronattus is a diverse clade of jumping spiders with complex courtship displays and repeated evolution of Y chromosomes. A well-resolved species phylogeny would provide an important framework to study these traits, but has not yet been achieved, in part because the few genes available in past studies gave conflicting signals. Such discordant gene trees could be the result of incomplete lineage sorting (ILS) in recently diverged parts of the phylogeny, but there are indications that introgression could be a source of conflict. To infer Habronattus phylogeny and investigate the cause of gene tree discordance, we assembled transcriptomes for 34 Habronattus species and 2 outgroups. The concatenated 2.41 Mb of nuclear data (1877 loci) resolved phylogeny by Maximum Likelihood (ML) with high bootstrap support (95-100%) at most nodes, with some uncertainty surrounding the relationships of H. icenoglei, H. cambridgei, H. oregonensis, and Pellenes canadensis. Species tree analyses by ASTRAL and SVDQuartets gave almost completely congruent results. Several nodes in the ML phylogeny from 12.33 kb of mitochondrial data are incongruent with the nuclear phylogeny and indicate possible mitochondrial introgression: the internal relationships of the americanus and the coecatus groups, the relationship between the altanus, decorus, banksi, and americanus group, and between H. clypeatus and the coecatus group. To determine the relative contributions of ILS and introgression, we analyzed gene tree discordance for nuclear loci longer than 1 kb using Bayesian Concordance Analysis (BCA) for the americanus group (679 loci) and the VCCR clade (viridipes/clypeatus/coecatus/roberti groups) (517 loci) and found signals of introgression in both. Finally, we tested specifically for introgression in the concatenated nuclear matrix with Patterson's D statistics and D FOIL . We found nuclear introgression resulting in substantial admixture between americanus group species, between H. roberti

  7. Social makes smart: rearing conditions affect learning and social behaviour in jumping spiders. (United States)

    Liedtke, J; Schneider, J M


    There is a long-standing debate as to whether social or physical environmental aspects drive the evolution and development of cognitive abilities. Surprisingly few studies make use of developmental plasticity to compare the effects of these two domains during development on behaviour later in life. Here, we present rearing effects on the development of learning abilities and social behaviour in the jumping spider Marpissa muscosa. These spiders are ideally suited for this purpose because they possess the ability to learn and can be reared in groups but also in isolation without added stress. This is a critical but rarely met requirement for experimentally varying the social environment to test its impact on cognition. We split broods of spiders and reared them either in a physically or in a socially enriched environment. A third group kept under completely deprived conditions served as a 'no-enrichment' control. We tested the spiders' learning abilities by using a modified T-maze. Social behaviour was investigated by confronting spiders with their own mirror image. Results show that spiders reared in groups outperform their conspecifics from the control, i.e. 'no-enrichment', group in both tasks. Physical enrichment did not lead to such an increased performance. We therefore tentatively suggest that growing up in contact with conspecifics induces the development of cognitive abilities in this species.

  8. Tisaniba, a new genus of marpissoid jumping spiders from Borneo (Araneae: Salticidae). (United States)

    Zhang, Jun-Xia; Maddison, Wayne P


    Six new species of marpissoid jumping spiders from Sarawak, Borneo, are described in the new genus Tisaniba Zhang & Maddison. They are the type species, T. mulu Zhang & Maddison sp. nov., as well as the species T. bijibijan Zhang & Maddison sp. nov., T. dik Zhang & Maddison sp. nov., T. kubah Zhang & Maddison sp. nov., T. selan Zhang & Maddison sp. nov., and T. selasi Zhang & Maddison sp. nov. The spiders are small and brown to black, living in leaf litter in the tropical forest. Phylogenetic analyses based on 28s and 16sND1 genes indicate that they are a distinctive group within the marpissoids. Diagnostic illustrations and photographs of living spiders are provided for all species.

  9. Trichobothrial mediation of an aquatic escape response: Directional jumps by the fishing spider, Dolomedes triton, foil frog attacks

    Directory of Open Access Journals (Sweden)

    Robert B. Suter


    Full Text Available Fishing spiders (Pisauridae frequent the surfaces of ponds and streams and thereby expose themselves to predation by a variety of aquatic and semi-aquatic vertebrates. To assess the possibility that the impressive jumps of fishing spiders from the water surface function in evading attacks by frogs, attacks by bullfrogs (Rana catesbiana and green frogs (R. clamitans on Dolomedes triton were studied. Both the attack dynamics of the frogs and the evasive behaviors of the spiders were recorded at 250 frames per second. A freeze-dried bullfrog, propelled toward spiders with acceleration, posture, and position that approximated the natural attack posture and dynamics, was used to assess the spiders' behavior. Qualitatively, the spiders responded to these mock-attacks just as they had to attacks by live frogs: jumping (N=29 jumps, 56.9% of instances, rearing the legs nearest the attacking frog (N=15, 29.4%, or showing no visible response (N=7, 13.7%. Spiders that jumped always did so away (in the vertical plane from the attack (mean =137° vs. vertical at 90° or horizontally toward the frog at 0°. The involvement of the trichobothria (leg hairs sensitive to air movements, and the eyes as sensory mediators of the evasion response was assessed. Spiders with deactivated trichobothria were significantly impaired relative to intact and sham-deactivated spiders, and relative to spiders in total darkness. Thus, functional trichobothria, unlike the eyes, are both necessary and sufficient mediators of the evasion response. Measurements of air flow during frog attacks suggest that an exponential rise in flow velocity is the airborne signature of an attack.

  10. Frequent misdirected courtship in a natural community of colorful Habronattus jumping spiders. (United States)

    Taylor, Lisa A; Powell, Erin C; McGraw, Kevin J


    Male courtship display is common in many animals; in some cases, males engage in courtship indiscriminately, spending significant time and energy courting heterospecifics with whom they have no chance of mating or producing viable offspring. Due to high costs and few if any benefits, we might expect mechanisms to evolve to reduce such misdirected courtship (or 'reproductive interference'). In Habronattus jumping spiders, males frequently court heterospecifics with whom they do not mate or hybridize; females are larger and are voracious predators, posing a severe risk to males who court indiscriminately. In this study, we examined patterns of misdirected courtship in a natural community of four sympatric Habronattus species (H. clypeatus, H. hallani, H. hirsutus, and H. pyrrithrix). We used direct field observations to weigh support for two hypotheses (differential microhabitat use and species recognition signaling) to explain how these species reduce the costs associated with misdirected courtship. We show that, while the four species of Habronattus do show some differences in microhabitat use, all four species still overlap substantially, and in three of the four species individuals equally encountered heterospecifics and conspecifics. Males courted females at every opportunity, regardless of species, and in some cases, this led to aggression and predation by the female. These results suggest that, while differences in microhabitat use might reduce misdirected courtship to some extent, co-existence of these four species may be possible due to complex communication (i.e. species-specific elements of a male's courtship display). This study is the first to examine misdirected courtship in jumping spiders. Studies of misdirected courtship and its consequences in the field are limited and may broaden our understanding of how biodiversity is maintained within a community.

  11. Genera of euophryine jumping spiders (Araneae: Salticidae), with a combined molecular-morphological phylogeny. (United States)

    Zhang, Junxia; Maddison, Wayne P


    Morphological traits of euophryine jumping spiders were studied to clarify generic limits in the Euophryinae and to permit phylogenetic classification of genera lacking molecular data. One hundred and eight genera are recognized within the subfamily. Euophryine generic groups and the delimitation of some genera are reviewed in detail. In order to explore the effect of adding formal morphological data to previous molecular phylogenetic studies, and to find morphological synapomorphies, eighty-two morphological characters were scored for 203 euophryine species and seven outgroup species. The morphological dataset does not perform as well as the molecular dataset (genes 28S, Actin 5C; 16S-ND1, COI) in resolving the phylogeny of Euophryinae, probably because of frequent convergence and reversal. The formal morphological data were mapped on the phylogeny in order to seek synapomorphies, in hopes of extending the phylogeny to include taxa for which molecular data are not available. Because of homoplasy, few globally-applicable morphological synapomorphies for euophryine clades were found. However, synapomorphies that are unique locally in subclades still help to delimit euophryine generic groups and genera. The following synonyms of euophryine genera are proposed: Maeotella with Anasaitis; Dinattus with Corythalia; Paradecta with Compsodecta; Cobanus, Chloridusa and Wallaba with Sidusa; Tariona with Mopiopia; Nebridia with Amphidraus; Asaphobelis and Siloca with Coryphasia; Ocnotelus with Semnolius; Palpelius with Pristobaeus; Junxattus with Laufeia; Donoessus with Colyttus; Nicylla, Pselcis and Thianitara with Thiania. The new genus Saphrys is erected for misplaced species from southern South America.

  12. A new species of jumping spider Neonella Gertsch, with notes on the genus and male identification key (Araneae, Salticidae) (United States)

    Rubio, Gonzalo D.; Argañaraz, Carina I.; Gleiser, Raquel M.


    Abstract The American genus Neonella Gertsch, 1936 consists of very small jumping spiders whose biology is not well known. The genus currently includes eleven valid species, of which eight are known from both sexes and two are only known from one sex. This paper describes and illustrates a new species Neonella acostae sp. n., demonstrates male palpal variation in Neonella montana Galiano, 1988, and provides some information on the ecology of three sympatric species. New records of Neonella montana and Neonella minuta Galiano, 1965 are reported. Because the previously described species of Neonella were well illustrated and diagnosed, a dichotomous key to males is given along with genital illustrations of both sexes for all known species. PMID:26692804

  13. A wolf in sheep's clothing: The description of a fly resembling jumping spider of the genus Scoturius Simon, 1901 (Araneae: Salticidae: Huriini). (United States)

    Perger, Robert; Rubio, Gonzalo D


    Fly resemblance in arthropods is much less common than e.g., resemblance to ants or wasps, and has been mainly observed in beetles. Putative fly mimicry in arachnids has been reported only from the jumping spider genus Saitis. However, recent literature has attributed the fly-resembling characteristics in Saitis to sexual signalling during courtship. The lack of observation of fly mimicry in spiders is not surprising as flies belong to the most important prey item group of spiders. In this study, a new fly-resembling species of the jumping spider tribe Huriini, Scoturius dipterioides sp. nov., from the pre-Andean Chiquitano forest at the Bolivian orocline is described and illustrated. The new species was tentatively placed into Scoturius because the epigynum has a single large elliptical opening. Scoturius dipterioides sp. nov. is distinguished from all other species of this tribe by a combination of following characteristics: epigynum with a large anterior elliptical atrium and initial portion of the copulation ducts dilated as a chamber (shared with Urupuyu); relatively joined copulation openings and short copulation ducts; kidney-shaped spermathecae, advanced at the atrium level. Several somatic features, two of them found exclusively in S. dipterioides sp. nov., increase the resemblance to flies. The Huriini are currently the only spider tribe that is suggested to feature fly mimics.

  14. Freyinae, a major new subfamily of Neotropical jumping spiders (Araneae: Salticidae). (United States)

    Edwards, G B


    Freyinae, new subfamily, is described for a group of genera of Neotropical jumping spiders that can be distinguished from other non-ant mimic salticoid Neotropical salticids by having the following three morphological features: a slightly more elongate carapace, a distinctive prolateral tibial macrosetae arrangement (medially placed subdistal and subproximal macrosetae, with a subdorsal medial macroseta in some males), and an unusual dorsoventrally thick tegulum basal division (although one or two of these features are sometimes lost). It includes 20 genera previously considered valid, of which 19 are retained: Akela Peckham & Peckham, 1896, Aphirape C.L. Koch, 1850, Asaracus C.L. Koch, 1846, Capidava Simon, 1902, Chira Peckham & Peckham, 1896, Edilemma Ruiz & Brescovit, 2006, Eustiromastix Simon, 1902, Freya C.L. Koch, 1850, Frigga C.L. Koch, 1850, Kalcerrytus Galiano, 2000, Nycerella Galiano, 1982, Onofre Ruiz & Brescovit, 2007, Pachomius Peckham & Peckham, 1896, Phiale C.L. Koch, 1846, Rishaschia Makhan, 2006, Sumampattus Galiano, 1983, Trydarssus Galiano, 1995, Tullgrenella Mello‑Leitão, 1941, and Wedoquella Galiano, 1984. Romitia Caporiacco, 1947 (and its synonym Uspachus Galiano, 1995) is synonymized with Pachomius, new synonymy. New genera described in the subfamily are: Drizztius, Leptofreya, Megafreya, Philira, Tarkas, Triggella, and Xanthofreya. The following nomenclatorial changes are made: New synonyms: Freya demarcata Chamberlin & Ivie, 1936 = Freya (sub Cyrene) albosignata (F.O.P.-Cambridge, 1901); Freya (sub Cyrene) grisea (F.O.P.-Cambridge, 1901) = Freya (sub Cyrene) infuscata (F.O.P.-Cambridge, 1901); Freya (sub Cyrene) emarginata (F.O.P.-Cambridge, 1901) and Nycerella (sub Heraclea) sanguinea paradoxa (Peckham & Peckham, 1896) = Nycerella (sub Heraclea) sanguinea (Peckham & Peckham, 1896); Pachomius (sub Phiale) maculosus (Chickering, 1946) = Phiale (sub Cyrene) bilobata (F.O.P.-Cambridge, 1901); Phiale (sub Cyrene) mediocava (F

  15. First record of the jumping spider Epocilla praetextata Thorell, 1887 (Araneae: Salticidae from India

    Directory of Open Access Journals (Sweden)

    A. Kananbala


    Full Text Available A salticidae spider Epocilla praetextata Thorell, 1887 is reported for the first time from India.  The present record is from Manipur, northeastern India, which shares an International border with Myanmar.  This is the 3rd species of the genus Epocilla recorded in India.  We provide the description and drawings of diagnostic characteristics for this species along with photographs.

  16. Mating-induced sexual inhibition in the jumping spider Servaea incana (Araneae: Salticidae: A fast-acting and long-lasting effect.

    Directory of Open Access Journals (Sweden)

    Vivian Mendez

    Full Text Available Mating-induced sexual inhibition has been studied extensively as an important facet of many insect mating systems but remains little understood in spiders. Once mated, females of many spider species become unreceptive and aggressive toward males, but the speed of onset and persistence of this effect are not known. Addressing this gap, the present study considers (1 mating tendency of virgins, latency to remating, and lifetime mating frequency and (2 how quickly sexual inhibition is expressed after the first mating in female Servaea incana jumping spiders. Encounters between males and females took place in two contexts that simulated locations where mating occurs in nature: in the light away from nests ('in the open' and in low light within the shelter of silken retreats ('at a retreat'. Virgin females exhibited high receptivity levels in both contexts but sexual inhibition was induced immediately after their first copulation. The most common tendency was for just one mating in a lifetime, and few females mated more than twice. Context also had an effect on female mating tendency, as virgin females in the open rejected more males before accepting their first mate than did virgin females in retreats. Considering only those females that did remate, females in the open tended to reject fewer males before remating. Given low levels of female remating, virgin females appear to be at a premium for male reproductive fitness in S. incana jumping spiders and this is a likely explanation for protandry found in nature.

  17. Contribution to the knowledge of jumping spiders (Araneae: Salticidae from vicinity of Jagodina, Central Serbia

    Directory of Open Access Journals (Sweden)

    Stanković, B.


    Full Text Available During last 10 years, based on personal collectings, 21 species from 14 genera of Salticidae (Araneae are recorded from vicinity of Jagodina: Ballus chalybeius, Carrhotus xanthogramma, Evarcha arcuata, Evarcha falcata, Heliophanus auratus, Heliophanus cupreus, Heliophanus flavipes, Heliophanus kochii, Icius hamatus, Icius subinermis, Leptorchestes berolinensis, Macaroeris nidicolens, Marpissa muscosa, Marpissa nivoyi, Mendoza canestrinii, Pellenes tripunctatus, Phintella castriesiana, Phlegra fasciata, Pseudeuophrys erratica, Pseudeuophrys lanigera, Salticus scenicus. All those species are provided with habitat notes and global distribution. New records for the spider fauna of Serbia are Heliophanus kochii (Simon 1868, Icius subinermis (Simon, 1937, Marpissa nivoyi (Lucas, 1846 and Mendoza canestrinii (Ninni, 1868.

  18. Animal coloration: sexy spider scales. (United States)

    Taylor, Lisa A; McGraw, Kevin J


    Many male jumping spiders display vibrant colors that are used in visual communication. A recent microscopic study on a jumping spider from Singapore shows that three-layered 'scale sandwiches' of chitin and air are responsible for producing their brilliant iridescent body coloration.

  19. Attending to detail by communal spider-eating spiders. (United States)

    Jackson, Robert R; Nelson, Ximena J


    Communal predators may often need to make especially intricate foraging decisions, as a predator's success may depend on the actions of its neighbours. Here,we consider the decisions made by Portia africana, a jumping spider (Salticidae) that preys on other spiders, including Oecobius amboseli (Oecobiidae), a small prey spider that lives under small sheets of silk (nests) on the walls of buildings. P. africana juveniles settle near oecobiid nests and then ambush oecobiids as they leave or enter the nest. Two or more P. africana juveniles sometimes settle at the same nest and, when an oecobiid is captured, the P. africana juveniles may share the meal. We investigated the joining decisions made by naïve P. africana juveniles. Experiments were based on using lures (dead spiders positioned in lifelike posture) arranged in a series of 17 different scenes defined by the presence/absence of a nest, the lure types present and the configuration of the lures and the nest. Our findings imply that P. africana juveniles make remarkably precise predatory decisions, with the variables that matter including whether a nest is present, the identity of spiders inside and outside a nest and how spiders are positioned relative to each other and the nest.

  20. Tarantula spider (United States)

    ... page: // Tarantula spider bite To use the sharing features on this ... This article describes the effects of a tarantula spider bite. The class of insects to which the ...

  1. Jumping hoops on water (United States)

    Yang, Eunjin; Kim, Ho-Young


    Small aquatic arthropods, such as water striders and fishing spiders, are able to jump off water to a height several times their body length. Inspired by the unique biological motility on water, we study a simple model using a flexible hoop to provide fundamental understanding and a mimicking principle of small jumpers on water. Behavior of a hoop on water, which is coated with superhydrophobic particles and initially bent into an ellipse from an equilibrium circular shape, is visualized with a high speed camera upon launching it into air by releasing its initial elastic strain energy. We observe that jumping of our hoops is dominated by the dynamic pressure of water rather than surface tension, and thus it corresponds to the dynamic condition experienced by fishing spiders. We calculate the reaction forces provided by water adopting the unsteady Bernoulli equation as well as the momentum loss into liquid inertia and viscous friction. Our analysis allows us to predict the jumping efficiency of the hoop on water in comparison to that on ground, and to discuss the evolutionary pressure rendering fishing spiders select such dynamic behavior.


    Directory of Open Access Journals (Sweden)

    PORAV Viorica


    Full Text Available The strengthness and toughness of spider fiber and its multifunctional nature is only surpassed in some cases by synthetic high performance fibers. In the world of natural fibers, spider silk has been long time recognized as a wonder fiber for its unique combination of high strength and rupture elongation. Scientists in civil military engineering reveal that the power of biological material (spider silk lies in the geometric configuration of structural protein, and the small cluster of week hydrogen bonds that works together to resist force and dissipate energy. Each spider and each type of silk has a set of mechanical properties optimized for their biological function. Most silks, in particular deagline silk, have exceptional mechanical properties. They exhibit a unique combination of high tensile strength and extensibility (ductility. This enables a silk fiber to absorb a lot of energy before breaking (toughness, the area under a stress- strain curve. A frequent mistake made in the mainstream media is to confuse strength and toughness when comparing silk to other materials. As shown below in detail, weight for weight, silk is stronger than steel, but not as strong as Kevlar. Silk is,however, tougher than both.This paper inform about overview on the today trend in the world of spider silk.

  3. Spider Vein Removal (United States)

    Spider veins: How are they removed? I have spider veins on my legs. What options are available ... M.D. Several options are available to remove spider veins — thin red lines or weblike networks of ...

  4. Spider Bites (For Parents) (United States)

    ... Videos for Educators Search English Español First Aid: Spider Bites KidsHealth / For Parents / First Aid: Spider Bites ... rare. Signs and Symptoms Of a brown recluse spider bite: red blister in the center with surrounding ...

  5. Jumping Dynamics

    DEFF Research Database (Denmark)

    Sannino, Francesco


    paradigm the physical scale and henceforth also the massive spectrum of the theory jump at the lower boundary of the conformal window. In particular we propose that a theory can suddenly jump from a Quantum Chromodynamics type spectrum, at the lower boundary of the conformal window, to a conformal one...... without particle interpretation. The jumping scenario, therefore, does not support a near-conformal dynamics of walking type. We will also discuss the impact of jumping dynamics on the construction of models of dynamical electroweak symmetry breaking....

  6. Spider Bites: First Aid (United States)

    ... care immediately if: You were bitten by a black widow or brown recluse spider You are unsure whether the bite ... in the South. Signs and symptoms of a black widow spider bite may include: At ... fever and nausea Brown recluse spider The brown recluse spider has a ...

  7. Brown Recluse Spider (United States)

    ... to a group of spiders commonly known as violin spiders or fiddlebacks. The characteristic fiddle-shaped pattern ... 4-19.1mm) • Color: Golden brown • A dark violin/fiddle shape (see top photo) is located on ...

  8. Nature Study Tips. Spiders. (United States)

    Mulaik, Stanley B.


    Different types of spiders, their ranges and habits are discussed. Activities associated with the study of spiders are suggested. Four references are listed which may be of interest to beginners. (CW)

  9. Black widow spider (United States)

    ... Black widow spider To use the sharing features on this page, please enable JavaScript. The black widow spider (Latrodectus) has a shiny black body with a ...

  10. Jumping together

    DEFF Research Database (Denmark)

    Lund, Ole; Ravn, Susanne; Christensen, Mette Krogh


    , in order to reach a deeper understanding of how practice facilitates learning. Results: We encircle the athletes’ interrelated learning processes by introducing the training environment of the national team and situations in which the athletes guide each other verbally or by jumping together. Discussion...

  11. Did You Say Spiders? (United States)

    Campbell, Alene

    This spider unit focuses on students' development of cooperative learning and inquiry-based skills. Students read "The Very Busy Spider" by Eric Carle, and then work in cooperative groups using the Internet to research and synthesize important information about spiders. Technology is used for vocabulary instruction and to create a…

  12. Spiders in dermatology. (United States)

    Kang, Jun K; Bhate, Chinmoy; Schwartz, Robert A


    Spider bites represent an unusual and potentially over-represented clinical diagnosis. Despite a common fear of spiders, known as arachnophobia, current knowledge suggests that only a small number of families within the order Araneae are medically relevant. Moreover, most cutaneous spider reactions, including both evenomations and physical trauma, produce mild, local symptoms which may be managed with supportive care alone. The differential diagnosis for spider bites may be broad, especially if the offending arachnid is not seen or found. We describe a series of spiders relevant to the dermatologist in the United States.

  13. Supersonic Jump (United States)

    Muller, Andreas


    On October 14,2012, Felix Baumgartner, an Austrian sky-diver, set some new world records for his discipline. Jumping from a height of about 39 km, he reached a top speed of 1342 km/h, becoming the first human being to break the sound barrier in free fall. In order to understand some essential physics aspects of this remarkable feat, we wonder why…

  14. Funnel-web spider bite (United States)

    ... page: // Funnel-web spider bite To use the sharing features on ... the effects of a bite from the funnel-web spider. Male funnel-web spiders are more poisonous ...

  15. Spiders in caves. (United States)

    Mammola, Stefano; Isaia, Marco


    World experts of different disciplines, from molecular biology to macro-ecology, recognize the value of cave ecosystems as ideal ecological and evolutionary laboratories. Among other subterranean taxa, spiders stand out as intriguing model organisms for their ecological role of top predators, their unique adaptations to the hypogean medium and their sensitivity to anthropogenic disturbance. As the description of the first eyeless spider ( Stalita taenaria ), an array of papers on subterranean spider biology, ecology and evolution has been published, but a comprehensive review on these topics is still lacking. We provide a general overview of the spider families recorded in hypogean habitats worldwide, we review the different adaptations of hypogean spiders to subterranean life, and we summarize the information gathered so far about their origin, population structure, ecology and conservation status. Finally, we point out the limits of the knowledge we currently have regarding hypogean spiders, aiming to stimulate future research. © 2017 The Author(s).

  16. Coordination in vertical jumping

    NARCIS (Netherlands)

    Bobbert, Maarten F.; van Ingen Schenau, Gerrit Jan


    The present study was designed to investigate for vertical jumping the relationships between muscle actions, movement pattern and jumping achievement. Ten skilled jumpers performed jumps with preparatory countermovement. Ground reaction forces and cinematographic data were recorded. In addition,

  17. Conditioning exercises in ski jumping: biomechanical relationship of squat jumps, imitation jumps, and hill jumps. (United States)

    Lorenzetti, Silvio; Ammann, Fabian; Windmüller, Sabrina; Häberle, Ramona; Müller, Sören; Gross, Micah; Plüss, Michael; Plüss, Stefan; Schödler, Berni; Hübner, Klaus


    As hill jumps are very time-consuming, ski jumping athletes often perform various imitation jumps during training. The performed jumps should be similar to hill jumps, but a direct comparison of the kinetic and kinematic parameters has not been performed yet. Therefore, this study aimed to correlate 11 common parameters during hill jumps (Oberstdorf Germany), squat jumps (wearing indoor shoes), and various imitation jumps (rolling 4°, rolling flat, static; jumping equipment or indoor shoes) on a custom-built instrumented vehicle with a catch by the coach. During the performed jumps, force and video data of the take-off of 10 athletes were measured. The imitation and squat jumps were then ranked. The main difference between the hill jumps and the imitation and squat jumps is the higher maximal force loading rate during the hill jumps. Imitation jumps performed on a rolling platform, on flat ground were the most similar to hill jumps in terms of the force-time, and leg joint kinematic properties. Thus, non-hill jumps with a technical focus should be performed from a rolling platform with a flat inrun with normal indoor shoes or jumping equipment, and high normal force loading rates should be the main focus of imitation training.

  18. Respiration in spiders (Araneae). (United States)

    Schmitz, Anke


    Spiders (Araneae) are unique regarding their respiratory system: they are the only animal group that breathe simultaneously with lungs and tracheae. Looking at the physiology of respiration the existence of tracheae plays an important role in spiders with a well-developed tracheal system. Other factors as sex, life time, type of prey capture and the high ability to gain energy anaerobically influence the resting and the active metabolic rate intensely. Most spiders have metabolic rates that are much lower than expected from body mass; but especially those with two pairs of lungs. Males normally have higher resting rates than females; spiders that are less evolved and possess a cribellum have lower metabolic rates than higher evolved species. Freely hunting spiders show a higher energy turnover than spiders hunting with a web. Spiders that live longer than 1 year will have lower metabolic rates than those species that die after 1 year in which development and reproduction must be completed. Lower temperatures and starvation, which most spiders can cope with, will decrease the metabolic rate as well.

  19. Bat Predation by Spiders (United States)

    Nyffeler, Martin; Knörnschild, Mirjam


    In this paper more than 50 incidences of bats being captured by spiders are reviewed. Bat-catching spiders have been reported from virtually every continent with the exception of Antarctica (∼90% of the incidences occurring in the warmer areas of the globe between latitude 30° N and 30° S). Most reports refer to the Neotropics (42% of observed incidences), Asia (28.8%), and Australia-Papua New Guinea (13.5%). Bat-catching spiders belong to the mygalomorph family Theraphosidae and the araneomorph families Nephilidae, Araneidae, and Sparassidae. In addition to this, an attack attempt by a large araneomorph hunting spider of the family Pisauridae on an immature bat was witnessed. Eighty-eight percent of the reported incidences of bat catches were attributable to web-building spiders and 12% to hunting spiders. Large tropical orb-weavers of the genera Nephila and Eriophora in particular have been observed catching bats in their huge, strong orb-webs (of up to 1.5 m diameter). The majority of identifiable captured bats were small aerial insectivorous bats, belonging to the families Vespertilionidae (64%) and Emballonuridae (22%) and usually being among the most common bat species in their respective geographic area. While in some instances bats entangled in spider webs may have died of exhaustion, starvation, dehydration, and/or hyperthermia (i.e., non-predation death), there were numerous other instances where spiders were seen actively attacking, killing, and eating the captured bats (i.e., predation). This evidence suggests that spider predation on flying vertebrates is more widespread than previously assumed. PMID:23516436

  20. Bat predation by spiders. (United States)

    Nyffeler, Martin; Knörnschild, Mirjam


    In this paper more than 50 incidences of bats being captured by spiders are reviewed. Bat-catching spiders have been reported from virtually every continent with the exception of Antarctica (≈ 90% of the incidences occurring in the warmer areas of the globe between latitude 30° N and 30° S). Most reports refer to the Neotropics (42% of observed incidences), Asia (28.8%), and Australia-Papua New Guinea (13.5%). Bat-catching spiders belong to the mygalomorph family Theraphosidae and the araneomorph families Nephilidae, Araneidae, and Sparassidae. In addition to this, an attack attempt by a large araneomorph hunting spider of the family Pisauridae on an immature bat was witnessed. Eighty-eight percent of the reported incidences of bat catches were attributable to web-building spiders and 12% to hunting spiders. Large tropical orb-weavers of the genera Nephila and Eriophora in particular have been observed catching bats in their huge, strong orb-webs (of up to 1.5 m diameter). The majority of identifiable captured bats were small aerial insectivorous bats, belonging to the families Vespertilionidae (64%) and Emballonuridae (22%) and usually being among the most common bat species in their respective geographic area. While in some instances bats entangled in spider webs may have died of exhaustion, starvation, dehydration, and/or hyperthermia (i.e., non-predation death), there were numerous other instances where spiders were seen actively attacking, killing, and eating the captured bats (i.e., predation). This evidence suggests that spider predation on flying vertebrates is more widespread than previously assumed.

  1. Risk, Jumps, and Diversification

    DEFF Research Database (Denmark)

    Bollerslev, Tim; Law, Tzuo Hann; Tauchen, George

    We test for price discontinuities, or jumps, in a panel of high-frequency intraday returns for forty large-cap stocks and an equiweighted index from these same stocks. Jumps are naturally classified into two types: common and idiosyncratic. Common jumps affect all stocks, albeit to varying degrees......, while idiosyncratic jumps are stock-specific. Despite the fact that each of the stocks has a of about unity with respect to the index, common jumps are virtually never detected in the individual stocks. This is truly puzzling, as an index can jump only if one or more of its components jump. To resolve...... this puzzle, we propose a new test for cojumps. Using this new test we find strong evidence for many modest-sized common jumps that simply pass through the standard jump detection statistic, while they appear highly significant in the cross section based on the new cojump identification scheme. Our results...

  2. Arachnid aloft: directed aerial descent in neotropical canopy spiders. (United States)

    Yanoviak, Stephen P; Munk, Yonatan; Dudley, Robert


    The behaviour of directed aerial descent has been described for numerous taxa of wingless hexapods as they fall from the tropical rainforest canopy, but is not known in other terrestrial arthropods. Here, we describe similar controlled aerial behaviours for large arboreal spiders in the genus Selenops (Selenopidae). We dropped 59 such spiders from either canopy platforms or tree crowns in Panama and Peru; the majority (93%) directed their aerial trajectories towards and then landed upon nearby tree trunks. Following initial dorsoventral righting when necessary, falling spiders oriented themselves and then translated head-first towards targets; directional changes were correlated with bilaterally asymmetric motions of the anterolaterally extended forelegs. Aerial performance (i.e. the glide index) decreased with increasing body mass and wing loading, but not with projected surface area of the spider. Along with the occurrence of directed aerial descent in ants, jumping bristletails, and other wingless hexapods, this discovery of targeted gliding in selenopid spiders further indicates strong selective pressures against uncontrolled falls into the understory for arboreal taxa. © 2015 The Author(s).

  3. Biomechanics of Spider Silks (United States)


    water and deformation conditions. Such fibres [Nexia ’ biosteel ’ silk ] were spun from recombinant silk ’cloned’ from Spidroin II and indeed show 67...SUBTITLE 5. FUNDING NUMBERS Biomechanics of Spider Silks F49620-03-1-0111 6. AUTHOR(S) Fritz Vollrath 7. PERFORMING ORGANIZATION NAME(S) AND ADDRESS(ES...Perform Pro, WHSIDIOR, Oct 94 COVER SHEET FINAL (3rd Year) Report to AFOSR on: BIOMECHANICS OF SPIDER SILKS Fritz Vollrath, Oxford University, England

  4. Attentional bias to moving spiders in spider fearful individuals. (United States)

    Vrijsen, Janna N; Fleurkens, Pascal; Nieuwboer, Wieteke; Rinck, Mike


    We investigated if an attentional bias for spiders in spider fearful individuals (SFs) can also be found for moving spiders, rather than static images. In Study 1, 28 SFs and 33 non-anxious controls (NACs) participated in a modified version of the dot probe paradigm: they had to react to a probe that appeared either in the next, previous, or side position of a spider's or a wheel's path. 24 SFs and 29 NACs participated in Study 2, in which a fourth, highly predictable, probe position was added. We expected that moving spiders would capture the attention of SFs. In addition, we tested whether SFs try to predict the movement of the spider to make it less threatening. As expected, SFs showed an attentional bias towards moving spiders. However, both groups reacted fastest to unpredictable movements, indicating that SFs and NACs alike anticipate unpredictable spider movements.

  5. Jumping in Arithmetic

    NARCIS (Netherlands)

    Visser, Albert

    In this paper we study a new relation between sentences: the jump relation. The idea of the jump relation is based on an analysis of Feferman's Theorem that the inconsistency of a theory U is interpretable over U. The jump relation is based on a converse of Feferman's Theorem: if a sentence is

  6. Jumping in Arithmetic

    NARCIS (Netherlands)

    Visser, Albert


    In this paper we study a new relation between sentences: the jump relation. The idea of the jump relation is based on an analysis of Feferman's Theorem that the inconsistency of a theory U is interpretable over U. The jump relation is based on a converse of Feferman's Theorem: if a sentence is

  7. Estimation of Jump Tails

    DEFF Research Database (Denmark)

    Bollerslev, Tim; Todorov, Victor

    We propose a new and flexible non-parametric framework for estimating the jump tails of Itô semimartingale processes. The approach is based on a relatively simple-to-implement set of estimating equations associated with the compensator for the jump measure, or its "intensity", that only utilizes...... the weak assumption of regular variation in the jump tails, along with in-fill asymptotic arguments for uniquely identifying the "large" jumps from the data. The estimation allows for very general dynamic dependencies in the jump tails, and does not restrict the continuous part of the process...... and the temporal variation in the stochastic volatility. On implementing the new estimation procedure with actual high-frequency data for the S&P 500 aggregate market portfolio, we find strong evidence for richer and more complex dynamic dependencies in the jump tails than hitherto entertained in the literature....

  8. What are quantum jumps?

    International Nuclear Information System (INIS)

    Cook, R.J.


    This paper answers the title question by giving an operational definition of quantum jumps based on measurement theory. This definition forms the basis of a theory of quantum jumps which leads to a number of testable predictions. Experiments are proposed to test the theory. The suggested experiments also test the quantum Zeno paradox, i.e., they test the proposition that frequent observation of a quantum system inhibits quantum jumps in that system. (orig.)

  9. The Spider Files (United States)

    McDonald, James; Dominguez, Lynn


    As children develop misconceptions about animals they believe are dangerous, they also adopt attitudes that are difficult to change. Changing these attitudes is challenging for teachers. One animal that is easy to find but difficult for children to understand is a spider. As with most wild animals, they are difficult to teach about because…


    NARCIS (Netherlands)


    Using a revised version of the Phobic Origin Questionnaire (POQ; Ost, L. G. & Hugdahl, K. Behaviour Research and Therapy, 19,439-477; 1981), the present study examined whether conditioning experiences, modeling experiences, and/or informational learning experiences were more often reported by spider

  11. Spider Web Pattern (United States)


    A delicate pattern, like that of a spider web, appears on top of the Mars residual polar cap, after the seasonal carbon-dioxide ice slab has disappeared. Next spring, these will likely mark the sites of vents when the carbon-dioxide ice cap returns. This Mars Global Surveyor, Mars Orbiter Camera image is about 3-kilometers wide (2-miles).

  12. Drop jumping. I. The influence of jumping technique on the biomechanics of jumping

    NARCIS (Netherlands)

    Bobbert, M F; Huijing, P A; van Ingen Schenau, G J

    In the literature, drop jumping is advocated as an effective exercise for athletes who prepare themselves for explosive activities. When executing drop jumps, different jumping techniques can be used. In this study, the influence of jumping technique on the biomechanics of jumping is investigated.

  13. Spider-Ant Associations: An Updated Review of Myrmecomorphy, Myrmecophily, and Myrmecophagy in Spiders

    Directory of Open Access Journals (Sweden)

    Paula E. Cushing


    Full Text Available This paper provides a summary of the extensive theoretical and empirical work that has been carried out in recent years testing the adaptational significance of various spider-ant associations. Hundreds of species of spiders have evolved close relationships with ants and can be classified as myrmecomorphs, myrmecophiles, or myrmecophages. Myrmecomorphs are Batesian mimics. Their close morphological and behavioral resemblance to ants confers strong survival advantages against visually hunting predators. Some species of spiders have become integrated into the ant society as myrmecophiles or symbionts. These spider myrmecophiles gain protection against their own predators, live in an environment with a stable climate, and are typically surrounded by abundant food resources. The adaptations by which this integration is made possible are poorly known, although it is hypothesized that most spider myrmecophiles are chemical mimics and some are even phoretic on their hosts. The third type of spider-ant association discussed is myrmecophagy—or predatory specialization on ants. A table of known spider myrmecophages is provided as is information on their biology and hunting strategies. Myrmecophagy provides these predators with an essentially unlimited food supply and may even confer other protections to the spiders.

  14. Optimal Ski Jump (United States)

    Rebilas, Krzysztof


    Consider a skier who goes down a takeoff ramp, attains a speed "V", and jumps, attempting to land as far as possible down the hill below (Fig. 1). At the moment of takeoff the angle between the skier's velocity and the horizontal is [alpha]. What is the optimal angle [alpha] that makes the jump the longest possible for the fixed magnitude of the…

  15. Extended spider cognition. (United States)

    Japyassú, Hilton F; Laland, Kevin N


    There is a tension between the conception of cognition as a central nervous system (CNS) process and a view of cognition as extending towards the body or the contiguous environment. The centralised conception requires large or complex nervous systems to cope with complex environments. Conversely, the extended conception involves the outsourcing of information processing to the body or environment, thus making fewer demands on the processing power of the CNS. The evolution of extended cognition should be particularly favoured among small, generalist predators such as spiders, and here, we review the literature to evaluate the fit of empirical data with these contrasting models of cognition. Spiders do not seem to be cognitively limited, displaying a large diversity of learning processes, from habituation to contextual learning, including a sense of numerosity. To tease apart the central from the extended cognition, we apply the mutual manipulability criterion, testing the existence of reciprocal causal links between the putative elements of the system. We conclude that the web threads and configurations are integral parts of the cognitive systems. The extension of cognition to the web helps to explain some puzzling features of spider behaviour and seems to promote evolvability within the group, enhancing innovation through cognitive connectivity to variable habitat features. Graded changes in relative brain size could also be explained by outsourcing information processing to environmental features. More generally, niche-constructed structures emerge as prime candidates for extending animal cognition, generating the selective pressures that help to shape the evolving cognitive system.

  16. Spider Movement, UV Reflectance and Size, but Not Spider Crypsis, Affect the Response of Honeybees to Australian Crab Spiders (United States)

    Llandres, Ana L.; Rodríguez-Gironés, Miguel A.


    According to the crypsis hypothesis, the ability of female crab spiders to change body colour and match the colour of flowers has been selected because flower visitors are less likely to detect spiders that match the colour of the flowers used as hunting platform. However, recent findings suggest that spider crypsis plays a minor role in predator detection and some studies even showed that pollinators can become attracted to flowers harbouring Australian crab spider when the UV contrast between spider and flower increases. Here we studied the response of Apis mellifera honeybees to the presence of white or yellow Thomisus spectabilis Australian crab spiders sitting on Bidens alba inflorescences and also the response of honeybees to crab spiders that we made easily detectable painting blue their forelimbs or abdomen. To account for the visual systems of crab spider's prey, we measured the reflectance properties of the spiders and inflorescences used for the experiments. We found that honeybees did not respond to the degree of matching between spiders and inflorescences (either chromatic or achromatic contrast): they responded similarly to white and yellow spiders, to control and painted spiders. However spider UV reflection, spider size and spider movement determined honeybee behaviour: the probability that honeybees landed on spider-harbouring inflorescences was greatest when the spiders were large and had high UV reflectance or when spiders were small and reflected little UV, and honeybees were more likely to reject inflorescences if spiders moved as the bee approached the inflorescence. Our study suggests that only the large, but not the small Australian crab spiders deceive their preys by reflecting UV light, and highlights the importance of other cues that elicited an anti-predator response in honeybees. PMID:21359183

  17. Spider movement, UV reflectance and size, but not spider crypsis, affect the response of honeybees to Australian crab spiders. (United States)

    Llandres, Ana L; Rodríguez-Gironés, Miguel A


    According to the crypsis hypothesis, the ability of female crab spiders to change body colour and match the colour of flowers has been selected because flower visitors are less likely to detect spiders that match the colour of the flowers used as hunting platform. However, recent findings suggest that spider crypsis plays a minor role in predator detection and some studies even showed that pollinators can become attracted to flowers harbouring Australian crab spider when the UV contrast between spider and flower increases. Here we studied the response of Apis mellifera honeybees to the presence of white or yellow Thomisus spectabilis Australian crab spiders sitting on Bidens alba inflorescences and also the response of honeybees to crab spiders that we made easily detectable painting blue their forelimbs or abdomen. To account for the visual systems of crab spider's prey, we measured the reflectance properties of the spiders and inflorescences used for the experiments. We found that honeybees did not respond to the degree of matching between spiders and inflorescences (either chromatic or achromatic contrast): they responded similarly to white and yellow spiders, to control and painted spiders. However spider UV reflection, spider size and spider movement determined honeybee behaviour: the probability that honeybees landed on spider-harbouring inflorescences was greatest when the spiders were large and had high UV reflectance or when spiders were small and reflected little UV, and honeybees were more likely to reject inflorescences if spiders moved as the bee approached the inflorescence. Our study suggests that only the large, but not the small Australian crab spiders deceive their preys by reflecting UV light, and highlights the importance of other cues that elicited an anti-predator response in honeybees.

  18. Jumping on water (United States)

    Kim, Ho-Young


    Water striders can jump on water as high as they can jump on land. Quick jumps allow them to avoid sudden dangers such as predators' attacks, and therefore understanding how they make such a dramatic motion for survival can shed light on the ultimate level of semi-aquatic motility achievable through evolution. However, the mechanism of their vertical jumping from a water surface has eluded hydrodynamic explanations so far. By observing movements of water strider legs and theoretically analyzing their dynamic interactions with deforming liquid-air interface, we have recently found that different species of jumping striders always tune their leg rotation speed with a force just below that required to break the water surface to reach the maximum take-off velocity. Here, we start with discussing the fundamental theories of dynamics of floating and sinking of small objects. The theories then enable us to analyze forces acting on a water strider while it presses down the water surface to fully exploit the capillary force. We further introduce a 68-milligram at-scale robotic insect capable of jumping on water without splash, strikingly similar to the real strider, by utilizing the water surface just as a trampoline.

  19. A spider elevator

    Energy Technology Data Exchange (ETDEWEB)

    Butylkin, A.V.; Butylkin, V.A.; Izosimov, A.M.


    A spider elevator is proposed which contains a body, a wedge clamp with wedges hinged to each other, a subassembly for holding the wedge clamp in the open and closed positions and a mechanism for changing the wedge clamp, which is made in the form of levers with ears for cleats and installed in the body with the capability of turning. To increase reliability in the operational mode through using the external force for clamping the pipe, the free ends of the levers are hinged with the body by a power cylinder.

  20. Relationships Between Countermovement Jump Ground Reaction Forces and Jump Height, Reactive Strength Index, and Jump Time. (United States)

    Barker, Leland A; Harry, John R; Mercer, John A


    Barker, LA, Harry, JR, and Mercer, JA. Relationships between countermovement jump ground reaction forces and jump height, reactive strength index, and jump time. J Strength Cond Res 32(1): 248-254, 2018-The purpose of this study was to determine the relationship between ground reaction force (GRF) variables to jump height, jump time, and the reactive strength index (RSI). Twenty-six, Division-I, male, soccer players performed 3 maximum effort countermovement jumps (CMJs) on a dual-force platform system that measured 3-dimensional kinetic data. The trial producing peak jump height was used for analysis. Vertical GRF (Fz) variables were divided into unloading, eccentric, amortization, and concentric phases and correlated with jump height, RSI (RSI = jump height/jump time), and jump time (from start to takeoff). Significant correlations were observed between jump height and RSI, concentric kinetic energy, peak power, concentric work, and concentric displacement. Significant correlations were observed between RSI and jump time, peak power, unload Fz, eccentric work, eccentric rate of force development (RFD), amortization Fz, amortization time, second Fz peak, average concentric Fz, and concentric displacement. Significant correlations were observed between jump time and unload Fz, eccentric work, eccentric RFD, amortization Fz, amortization time, average concentric Fz, and concentric work. In conclusion, jump height correlated with variables derived from the concentric phase only (work, power, and displacement), whereas Fz variables from the unloading, eccentric, amortization, and concentric phases correlated highly with RSI and jump time. These observations demonstrate the importance of countermovement Fz characteristics for time-sensitive CMJ performance measures. Researchers and practitioners should include RSI and jump time with jump height to improve their assessment of jump performance.

  1. More than a safety line: jump-stabilizing silk of salticids. (United States)

    Chen, Yung-Kang; Liao, Chen-Pan; Tsai, Feng-Yueh; Chi, Kai-Jung


    Salticids are diurnal hunters known for acute vision, remarkable predatory strategies and jumping ability. Like other jumpers, they strive for stability and smooth landings. Instead of using inertia from swinging appendages or aerodynamic forces by flapping wings as in other organisms, we show that salticids use a different mechanism for in-air stability by using dragline silk, which was previously believed to function solely as a safety line. Analyses from high-speed images of jumps by the salticid Hasarius adansoni demonstrate that despite being subject to rearward pitch at take-off, spiders with dragline silk can change body orientation in the air. Instantaneous drag and silk forces calculated from kinematic data further suggest a comparable contribution to deceleration and energy dissipation, and reveal that adjustments by the spider to the silk force can reverse its body pitch for a predictable and optimal landing. Without silk, upright-landing spiders would slip or even tumble, deferring completion of landing. Thus, for salticids, dragline silk is critical for dynamic stability and prey-capture efficiency. The dynamic functioning of dragline silk revealed in this study can advance the understanding of silk's physiological control over material properties and its significance to spider ecology and evolution, and also provide inspiration for future manoeuvrable robot designs.

  2. Why is countermovement jump height greater than squat jump height?

    NARCIS (Netherlands)

    Bobbert, Maarten F.; Gerritsen, Karin G M; Litjens, Maria C A; Van Soest, Arthur J.


    In the literature, it is well established that subjects are able to jump higher in a countermovement jump (CMJ) than in a squat jump (SJ). The purpose of this study was to estimate the relative contribution of the time available for force development and the storage and reutilization of elastic

  3. Drop Jumping as a Training Method for Jumping Ability

    NARCIS (Netherlands)

    Bobbert, Maarten F.


    Vertical jumping ability is of importance for good performance in sports such as basketball and volleyball. Coaches are in need of exercises that consume only little time and still help to improve their players’ jumping ability, without involving a high risk of injury. Drop jumping is assumed to

  4. Spiders from Mars? (United States)


    MGS MOC Release No. MOC2-426, 19 July 2003No, this is not a picture of a giant, martian spider web. This Mars Global Surveyor (MGS) Mars Orbiter Camera (MOC) image shows a plethora of polygonal features on the floor of a northern hemisphere impact crater near 65.6oN, 327.7oW. The picture was acquired during spring, after the seasonal carbon dioxide frost cap had largely migrated through the region. At the time the picture was taken, remnants of seasonal frost remained on the crater rim and on the edges of the troughs that bound each of the polygons. Frost often provides a helpful hint as to where polygons and patterned ground occur. The polygons, if they were on Earth, would indicate the presence of freeze-thaw cycles in ground ice. Although uncertain, the same might be true of Mars. Sunlight illuminates the scene from the lower left.

  5. Jump into Action (United States)

    Ball, Stephen; Cohen, Ann; Meyer, Margaret


    Jump Into Action (JIA) is a school-based team-taught program to help fifth-grade students make healthy food choices and be more active. The JIA team (physical education teacher, classroom teacher, school nurse, and parent) work together to provide a supportive environment as students set goals to improve food choices and increase activity.…

  6. Egg Bungee Jump! (United States)

    Fitzgerald, Mike; Brand, Lance


    In this article, the authors present an egg bungee jumping activity. This activity introduces students to ways that engineers might apply calculations of failure to meet a challenge. Students are required to use common, everyday materials such as rubber bands, string, plastic bags, and eggs. They will apply technological problem solving, material…

  7. SARS – virus jumps species

    Indian Academy of Sciences (India)

    SARS – virus jumps species. Coronavirus reshuffles genes; Rotteir et al, Rotterdam showed the virus to jump from cats to mouse cells after single gene mutation ? Human disease due to virus jumping from wild or domestic animals; Present favourite animal - the cat; - edible or domestic.

  8. Sclerotherapy of Varicose Veins and Spider Veins (United States)

    ... Index A-Z Sclerotherapy of Varicose Veins and Spider Veins Sclerotherapy uses injections from a very fine, ... Sclerotherapy? What is Sclerotherapy of Varicose Veins and Spider Veins? Sclerotherapy is a minimally invasive treatment used ...

  9. Application of 3 kinds of practical electromagnetic spiders in electromagnetic spider web


    Jiang Min


    Electromagnetic spider web the launch circuit has introduced a lot, but in the center position of the utility of the spider generally have 3 kinds of circuits respectively, the use of single-chip microcomputer circuit of the low energy consumption spider by multi-channel transmission, single circuit receiver circuit. Direct use of the 3 channels of the spider and the use of PLC circuit spider, depending on the actual situation were placed.

  10. Application of 3 kinds of practical electromagnetic spiders in electromagnetic spider web

    Directory of Open Access Journals (Sweden)

    Jiang Min


    Full Text Available Electromagnetic spider web the launch circuit has introduced a lot, but in the center position of the utility of the spider generally have 3 kinds of circuits respectively, the use of single-chip microcomputer circuit of the low energy consumption spider by multi-channel transmission, single circuit receiver circuit. Direct use of the 3 channels of the spider and the use of PLC circuit spider, depending on the actual situation were placed.

  11. Spider phylogenomics: untangling the Spider Tree of Life

    Directory of Open Access Journals (Sweden)

    Nicole L. Garrison


    Full Text Available Spiders (Order Araneae are massively abundant generalist arthropod predators that are found in nearly every ecosystem on the planet and have persisted for over 380 million years. Spiders have long served as evolutionary models for studying complex mating and web spinning behaviors, key innovation and adaptive radiation hypotheses, and have been inspiration for important theories like sexual selection by female choice. Unfortunately, past major attempts to reconstruct spider phylogeny typically employing the “usual suspect” genes have been unable to produce a well-supported phylogenetic framework for the entire order. To further resolve spider evolutionary relationships we have assembled a transcriptome-based data set comprising 70 ingroup spider taxa. Using maximum likelihood and shortcut coalescence-based approaches, we analyze eight data sets, the largest of which contains 3,398 gene regions and 696,652 amino acid sites forming the largest phylogenomic analysis of spider relationships produced to date. Contrary to long held beliefs that the orb web is the crowning achievement of spider evolution, ancestral state reconstructions of web type support a phylogenetically ancient origin of the orb web, and diversification analyses show that the mostly ground-dwelling, web-less RTA clade diversified faster than orb weavers. Consistent with molecular dating estimates we report herein, this may reflect a major increase in biomass of non-flying insects during the Cretaceous Terrestrial Revolution 125–90 million years ago favoring diversification of spiders that feed on cursorial rather than flying prey. Our results also have major implications for our understanding of spider systematics. Phylogenomic analyses corroborate several well-accepted high level groupings: Opisthothele, Mygalomorphae, Atypoidina, Avicularoidea, Theraphosoidina, Araneomorphae, Entelegynae, Araneoidea, the RTA clade, Dionycha and the Lycosoidea. Alternatively, our results

  12. Spider phylogenomics: untangling the Spider Tree of Life (United States)

    Garrison, Nicole L.; Rodriguez, Juanita; Agnarsson, Ingi; Coddington, Jonathan A.; Griswold, Charles E.; Hamilton, Christopher A.; Hedin, Marshal; Kocot, Kevin M.; Ledford, Joel M.


    Spiders (Order Araneae) are massively abundant generalist arthropod predators that are found in nearly every ecosystem on the planet and have persisted for over 380 million years. Spiders have long served as evolutionary models for studying complex mating and web spinning behaviors, key innovation and adaptive radiation hypotheses, and have been inspiration for important theories like sexual selection by female choice. Unfortunately, past major attempts to reconstruct spider phylogeny typically employing the “usual suspect” genes have been unable to produce a well-supported phylogenetic framework for the entire order. To further resolve spider evolutionary relationships we have assembled a transcriptome-based data set comprising 70 ingroup spider taxa. Using maximum likelihood and shortcut coalescence-based approaches, we analyze eight data sets, the largest of which contains 3,398 gene regions and 696,652 amino acid sites forming the largest phylogenomic analysis of spider relationships produced to date. Contrary to long held beliefs that the orb web is the crowning achievement of spider evolution, ancestral state reconstructions of web type support a phylogenetically ancient origin of the orb web, and diversification analyses show that the mostly ground-dwelling, web-less RTA clade diversified faster than orb weavers. Consistent with molecular dating estimates we report herein, this may reflect a major increase in biomass of non-flying insects during the Cretaceous Terrestrial Revolution 125–90 million years ago favoring diversification of spiders that feed on cursorial rather than flying prey. Our results also have major implications for our understanding of spider systematics. Phylogenomic analyses corroborate several well-accepted high level groupings: Opisthothele, Mygalomorphae, Atypoidina, Avicularoidea, Theraphosoidina, Araneomorphae, Entelegynae, Araneoidea, the RTA clade, Dionycha and the Lycosoidea. Alternatively, our results challenge the

  13. Accuracy of Jump-Mat Systems for Measuring Jump Height. (United States)

    Pueo, Basilio; Lipinska, Patrycja; Jiménez-Olmedo, José M; Zmijewski, Piotr; Hopkins, Will G


    Vertical-jump tests are commonly used to evaluate lower-limb power of athletes and nonathletes. Several types of equipment are available for this purpose. To compare the error of measurement of 2 jump-mat systems (Chronojump-Boscosystem and Globus Ergo Tester) with that of a motion-capture system as a criterion and to determine the modifying effect of foot length on jump height. Thirty-one young adult men alternated 4 countermovement jumps with 4 squat jumps. Mean jump height and standard deviations representing technical error of measurement arising from each device and variability arising from the subjects themselves were estimated with a novel mixed model and evaluated via standardization and magnitude-based inference. The jump-mat systems produced nearly identical measures of jump height (differences in means and in technical errors of measurement ≤1 mm). Countermovement and squat-jump height were both 13.6 cm higher with motion capture (90% confidence limits ±0.3 cm), but this very large difference was reduced to small unclear differences when adjusted to a foot length of zero. Variability in countermovement and squat-jump height arising from the subjects was small (1.1 and 1.5 cm, respectively, 90% confidence limits ±0.3 cm); technical error of motion capture was similar in magnitude (1.7 and 1.6 cm, ±0.3 and ±0.4 cm), and that of the jump mats was similar or smaller (1.2 and 0.3 cm, ±0.5 and ±0.9 cm). The jump-mat systems provide trustworthy measurements for monitoring changes in jump height. Foot length can explain the substantially higher jump height observed with motion capture.

  14. Approach and avoidance in fear of spiders

    NARCIS (Netherlands)

    Rinck, M.; Becker, E.S.


    We examined attitudes towards spiders by employing an Approach-Avoidance Task, in which participants respond to pictures by pulling a joystick towards themselves or by pushing it away from themselves. For spider fearfuls, this stimulus–response assignment is either compatible (push spiders away) or

  15. Spider and burnable poison rod combinations

    International Nuclear Information System (INIS)

    Edwards, G.T.; Schluderberg, D.C.


    An improved design of burnable poison rods and associated spiders used in fuel assemblies of pressurized water power reactor cores, is described. The rods are joined to the spider arms in a manner which is proof against the reactor core environment and yet allows the removal of the rods from the spider simply, swiftly and delicately. (U.K.)

  16. Optimal Ski Jump (United States)

    Rebilas, Krzysztof


    Consider a skier who goes down a takeoff ramp, attains a speed V, and jumps, attempting to land as far as possible down the hill below (Fig. 1). At the moment of takeoff the angle between the skier's velocity and the horizontal is α. What is the optimal angle α that makes the jump the longest possible for the fixed magnitude of the velocity V? Of course, in practice, this is a very sophisticated problem; the skier's range depends on a variety of complex factors in addition to V and α. However, if we ignore these and assume the jumper is in free fall between the takeoff ramp and the landing point below, the problem becomes an exercise in kinematics that is suitable for introductory-level students. The solution is presented here.

  17. Undular Hydraulic Jump

    Directory of Open Access Journals (Sweden)

    Oscar Castro-Orgaz


    Full Text Available The transition from subcritical to supercritical flow when the inflow Froude number Fo is close to unity appears in the form of steady state waves called undular hydraulic jump. The characterization of the undular hydraulic jump is complex due to the existence of a non-hydrostatic pressure distribution that invalidates the gradually-varied flow theory, and supercritical shock waves. The objective of this work is to present a mathematical model for the undular hydraulic jump obtained from an approximate integration of the Reynolds equations for turbulent flow assuming that the Reynolds number R is high. Simple analytical solutions are presented to reveal the physics of the theory, and a numerical model is used to integrate the complete equations. The limit of application of the theory is discussed using a wave breaking condition for the inception of a surface roller. The validity of the mathematical predictions is critically assessed using physical data, thereby revealing aspects on which more research is needed

  18. Molecular phylogeny of moth-specialized spider sub-family Cyrtarachninae, which includes bolas spiders. (United States)

    Tanikawa, Akio; Shinkai, Akira; Miyashita, Tadashi


    The evolutionary process of the unique web architectures of spiders of the sub-family Cyrtarachninae, which includes the triangular web weaver, bolas spider, and webless spider, is thought to be derived from reduction of orbicular 'spanning-thread webs' resembling ordinal orb webs. A molecular phylogenetic analysis was conducted to explore this hypothesis using orbicular web spiders Cyrtarachne, Paraplectana, Poecilopachys, triangular web spider Pasilobus, bolas spiders Ordgarius and Mastophora, and webless spider Celaenia. The phylogeny inferred from partial sequences of mt-COI, nuclear 18S-rRNA and 28S-rRNA showed that the common ancestor of these spiders diverged into two clades: a spanning-thread web clade and a bolas or webless clade. This finding suggests that the triangular web evolved by reduction of an orbicular spanning web, but that bolas spiders evolved in the early stage, which does not support the gradual web reduction hypothesis.

  19. Reconstitutable control rod spider assembly

    International Nuclear Information System (INIS)

    Shallenberger, J.M.; Ferian, S.J.


    A reconstitutable control rod/spider assembly includes a hollow connecting finger of the spider having a pair of opposing flat segments formed on the interior thereof and engaging a pair of opposing flat sectors formed on the exterior of a stem extending form the upper end of control rod. The stem also has an externally-threaded portion engaging a nut and a pilot aligning portion for the nut. The nut has a radially flexible and expandable thread-defining element captured in its bore. The segments and sectors allow the rod to be removed and reattached after turning through 180 0 to allow more even wear on the rod. (author)


    Cross, Fiona R.; Jackson, Robert R.


    Many spiders from the salticid subfamily Spartaeinae specialize at preying on other spiders and they adopt complex strategies when targeting these dangerous prey. We tested 15 of these spider-eating spartaeine species for the capacity to plan detours ahead of time. Each trial began with the test subject on top of a tower from which it could view two boxes: one containing prey and the other not containing prey. The distance between the tower and the boxes was too far to reach by leaping and the tower sat on a platform surrounded by water. As the species studied are known to avoid water, the only way they could reach the prey without getting wet was by taking one of two circuitous walkways from the platform: one leading to the prey (‘correct’) and one not leading to the prey (‘incorrect’). After leaving the tower, the test subject could not see the prey and sometimes it had to walk past the incorrect walkway before reaching the correct walkway. Yet all 15 species chose the correct walkway significantly more often than the incorrect walkway. We propose that these findings exemplify genuine cognition based on representation. PMID:26781057

  1. BPS Jumping Loci are Automorphic (United States)

    Kachru, Shamit; Tripathy, Arnav


    We show that BPS jumping loci-loci in the moduli space of string compactifications where the number of BPS states jumps in an upper semi-continuous manner—naturally appear as Fourier coefficients of (vector space-valued) automorphic forms. For the case of T 2 compactification, the jumping loci are governed by a modular form studied by Hirzebruch and Zagier, while the jumping loci in K3 compactification appear in a story developed by Oda and Kudla-Millson in arithmetic geometry. We also comment on some curious related automorphy in the physics of black hole attractors and flux vacua.

  2. Double Deception: Ant-Mimicking Spiders Elude Both Visually- and Chemically-Oriented Predators (United States)

    Uma, Divya; Durkee, Caitlin; Herzner, Gudrun; Weiss, Martha


    Biological mimicry is often multimodal, in that a mimic reinforces its resemblance to another organism via different kinds of signals that can be perceived by a specific target audience. In this paper we describe a novel scenario, in which a mimic deceives at least two distinct audiences, each of which relies primarily on a different sensory modality for decision-making. We have previously shown that Peckhamia picata, a myrmecomorphic spider that morphologically and behaviorally resembles the ant Camponotus nearcticus, experiences reduced predation by visually-oriented jumping spiders. Here we report that Peckhamia also faces reduced aggression from spider-hunting sphecid wasps as well as from its model ant, both of which use chemical cues to identify prey. We also report that Peckhamia does not chemically resemble its model ants, and that its total cuticular hydrocarbons are significantly lower than those of the ants and non-mimic spiders. Although further studies are needed to clarify the basis of Peckhamia's chemically-mediated protection, to our knowledge, such ‘double deception,’ in which a single organism sends misleading visual cues to one set of predators while chemically misleading another set, has not been reported; however, it is likely to be common among what have until now been considered purely visual mimics. PMID:24236152

  3. Nectar Meals of a Mosquito-Specialist Spider

    Directory of Open Access Journals (Sweden)

    Josiah O. Kuja


    Full Text Available Evarcha culicivora, an East African jumping spider, is known for feeding indirectly on vertebrate blood by actively choosing blood-carrying mosquitoes as prey. Using cold-anthrone tests to detect fructose, we demonstrate that E. culicivora also feeds on nectar. Field-collected individuals, found on the plant Lantana camara, tested positive for plant sugar (fructose. In the laboratory, E. culicivora tested positive for fructose after being kept with L. camara or one of another ten plant species (Aloe vera, Clerodendron magnifica, Hamelia patens, Lantana montevideo, Leonotis nepetaefolia, Parthenium hysterophorus, Ricinus communis, Senna didymobotrya, Striga asiatica, and Verbena trivernia. Our findings demonstrate that E. culicivora acquires fructose from its natural diet and can ingest fructose directly from plant nectaries. However, experiments in the laboratory also show that E. culicivora can obtain fructose indirectly by feeding on prey that have fed on fructose, implying a need to consider this possibility when field-collected spiders test positive for fructose. In laboratory tests, 53.5% of 1,215 small juveniles, but only 3.4% of 622 adult E. culicivora, left with plants for 24 hours, were positive for fructose. These findings, along with the field data, suggest that fructose is especially important for early-instar juveniles of E. culicivora.

  4. The Spider and the Fly (United States)

    Mellinger, Keith E.; Viglione, Raymond


    The Spider and the Fly puzzle, originally attributed to the great puzzler Henry Ernest Dudeney, and now over 100 years old, asks for the shortest path between two points on a particular square prism. We explore a generalization, find that the original solution only holds in certain cases, and suggest how this discovery might be used in the…

  5. Exploring Lightning Jump Characteristics (United States)

    Chronis, Themis; Carey, Larry D.; Schultz, Christopher J.; Schultz, Elise; Calhoun, Kristin; Goodman, Steven J.


    This study is concerned with the characteristics of storms exhibiting an abrupt temporal increase in the total lightning flash rate (i.e., lightning jump, LJ). An automated storm tracking method is used to identify storm "clusters" and total lightning activity from three different lightning detection systems over Oklahoma, northern Alabama and Washington, D.C. On average and for different employed thresholds, the clusters that encompass at least one LJ (LJ1) last longer, relate to higher Maximum Expected Size of Hail, Vertical Integrated Liquid and lightning flash rates (area-normalized) than the clusters that did not exhibit any LJ (LJ0). The respective mean values for LJ1 (LJ0) clusters are 80 min (35 min), 14 mm (8 mm), 25 kg per square meter (18 kg per square meter) and 0.05 flash per min per square kilometer (0.01 flash per min per square kilometer). Furthermore, the LJ1 clusters are also characterized by slower decaying autocorrelation functions, a result that implies a less "random" behavior in the temporal flash rate evolution. In addition, the temporal occurrence of the last LJ provides an estimate of the time remaining to the storm's dissipation. Depending of the LJ strength (i.e., varying thresholds), these values typically range between 20-60 min, with stronger jumps indicating more time until storm decay. This study's results support the hypothesis that the LJ is a proxy for the storm's kinematic and microphysical state rather than a coincidental value.

  6. Specialised use of working memory by Portia africana, a spider-eating salticid. (United States)

    Cross, Fiona R; Jackson, Robert R


    Using expectancy-violation methods, we investigated the role of working memory in the predatory strategy of Portia africana, a salticid spider from Kenya that preys by preference on other spiders. One of this predator's tactics is to launch opportunistic leaping attacks on to other spiders in their webs. Focussing on this particular tactic, our experiments began with a test spider on a ramp facing a lure (dead prey spider mounted on a cork disc) that could be reached by leaping. After the test spider faced the lure for 30 s, we blocked the test spider's view of the lure by lowering an opaque shutter before the spider leapt. When the shutter was raised 90 s later, either the same lure came into view again (control) or a different lure came into view (experimental: different prey type in same orientation or same prey type in different orientation). We recorded attack frequency (number of test spiders that leapt at the lure) and attack latency (time elapsing between shutter being raised and spiders initiating a leap). Attack latencies in control trials were not significantly different from attack latencies in experimental trials, regardless of whether it was prey type or prey orientation that changed in the experimental trials. However, compared with test spiders in the no-change control trials, significantly fewer test spiders leapt when prey type changed. There was no significant effect on attack frequency when prey orientation changed. These findings suggest that this predator represents prey type independently of prey orientation.

  7. The evolution of sociality in spiders

    DEFF Research Database (Denmark)

    Lubin, Yael; Bilde, T.


    . Anelosimus (Theridiidae) C. Sociality in Spiders: An Evolutionary Dead End? V. Evolution and Maintenance of Sociality in Spiders: Relevant Models A. Kin Selection 1. Kin Recognition 2. Inbreeding and Kin Selection B. Multilevel Selection (Group Selection) C. Ecological Benefits D. Ecological Constraints E......I. Introducing Social Spiders II. Social and Subsocial Species: A Survey of Behavioral Traits III. Inbred Sociality in Spiders A. Cooperation Versus Competition: A Balancing Act B. Do Social Spiders Have Division of Labor? C. Colony Foundation: Propagule Dispersal Versus Fission D. Female......-Biased Colony Sex Ratios: Primary and Operational Sex Ratios E. Mating System: Inbreeding and Its Population-Genetic Consequences F. "Boom and Bust" Colony Dynamics IV. Phylogenetic Relationships Among Social Spider Species A. Common Features of Social Evolution B. Case Studies 1. Stegodyphus (Eresidae) 2...

  8. Radiation effect onto biodiversity of spiders

    International Nuclear Information System (INIS)

    Mehrabova, M.A.; Naghiyev, J.A; Huseynov, N.I; Topchiyeva, Sh.A.; Hasanov, N.H.


    At present time spiders are one of the considerably diverse groups of living organisms in fauna of Azerbayjan Republic. They play an important in environmental chain, being the main group of wild arthropodas in most biocoenoses. Therefore, it's not surprised that recently an increased interest has being observed to the study of spiders as indicators of environmental conditions. Spiders have been collected in polluted areas, their identification and sampling of soil, water and plants has been conducted. The degree of radionuclides' impact on the number and distribution of spiders and their venom in the observed zones of Azerbaijan has been revealed and preliminarily predicted. The number of the collected spiders equals to 292 which has been determined later at an electronic identifier Spinnen Mitteleuropas. The radionuclides in spiders have been determined at Canberra facility. Different natural radioactive elements were revealed in the investigated samples.

  9. Jump conditions in transonic equilibria

    International Nuclear Information System (INIS)

    Guazzotto, L.; Betti, R.; Jardin, S. C.


    In the present paper, the numerical calculation of transonic equilibria, first introduced with the FLOW code in Guazzotto et al.[Phys. Plasmas 11, 604 (2004)], is critically reviewed. In particular, the necessity and effect of imposing explicit jump conditions at the transonic discontinuity are investigated. It is found that “standard” (low-β, large aspect ratio) transonic equilibria satisfy the correct jump condition with very good approximation even if the jump condition is not explicitly imposed. On the other hand, it is also found that high-β, low aspect ratio equilibria require the correct jump condition to be explicitly imposed. Various numerical approaches are described to modify FLOW to include the jump condition. It is proved that the new methods converge to the correct solution even in extreme cases of very large β, while they agree with the results obtained with the old implementation of FLOW in lower-β equilibria.

  10. Mechanics of jumping on water (United States)

    Kim, Ho-Young; Amauger, Juliette; Jeong, Han-Bi; Lee, Duck-Gyu; Yang, Eunjin; Jablonski, Piotr G.


    Some species of semiaquatic arthropods including water striders and springtails can jump from the water surface to avoid sudden dangers like predator attacks. It was reported recently that the jump of medium-sized water striders is a result of surface-tension-dominated interaction of thin cylindrical legs and water, with the leg movement speed nearly optimized to achieve the maximum takeoff velocity. Here we describe the mathematical theories to analyze this exquisite feat of nature by combining the review of existing models for floating and jumping and the introduction of the hitherto neglected capillary forces at the cylinder tips. The theoretically predicted dependence of body height on time is shown to match the observations of the jumps of the water striders and springtails regardless of the length of locomotory appendages. The theoretical framework can be used to understand the design principle of small jumping animals living on water and to develop biomimetic locomotion technology in semiaquatic environments.

  11. Thersites: a `jumping' Trojan? (United States)

    Tsiganis, K.; Dvorak, R.; Pilat-Lohinger, E.


    In this paper, we examine the dynamical evolution of the asteroid (1868) Thersites, a member of the Trojan belt. Thersites is librating around the Lagrangian point L_4, following, however, a chaotic orbit. The equations of motion for Thersites as well as for a distribution of neighboring initial conditions are integrated numerically for 50 million years in the Outer Solar System model (OSS), which consists of the Sun and the four giant planets. Our results indicate that the probability that this asteroid will eventually escape from the Trojan swarm is rather high. In fact, 20% from our initial distribution escaped within the integration time. Many of the remaining ones also show characteristic `jumps' in the orbital elements, especially the inclination. Secular resonances involving the nodes of the outer planets are found to be responsible for this chaotic behavior. The width of libration and eccentricity values that lead to grossly unstable orbits are calculated and compared with previously known results on the stability of the Trojans. Finally, a very interesting behavior has been observed for one of the escaping asteroids as he `jumped' from L_4 to L_5 where he remained performing a highly inclined libration for ~ 2 Myrs before escaping from the Trojan swarm. According to Homer, Thersites was not only the ugliest of all Greeks that took part in the Trojan war, but also had the most intolerable personality. His nasty habit of making fun of everybody cost him his life, as the last person for whom he spoke ironically about was Achilles, the mightiest warrior of all Greeks, who killed Thersites with just one punch!

  12. Jump probabilities in the non-Markovian quantum jump method

    International Nuclear Information System (INIS)

    Haerkoenen, Kari


    The dynamics of a non-Markovian open quantum system described by a general time-local master equation is studied. The propagation of the density operator is constructed in terms of two processes: (i) deterministic evolution and (ii) evolution of a probability density functional in the projective Hilbert space. The analysis provides a derivation for the jump probabilities used in the recently developed non-Markovian quantum jump (NMQJ) method (Piilo et al 2008 Phys. Rev. Lett. 100 180402).

  13. Choice of jumping strategy in two standard jumps, squat and countermovement jump--effect of training background or inherited preference?

    DEFF Research Database (Denmark)

    Ravn, Susanne; Voigt, M; Simonsen, Erik Bruun


    . The jumps were recorded on highspeed film (500 Hz) combined with registration of ground reaction forces, and net joint moments were calculated by inverse dynamics. The purpose was to investigate the choice of strategy in two standard jumps, squat jump and countermovement jump. The volleyball jump...... was performed with a sequential strategy and the ballet jump was performed with a simultaneous strategy. In the two standard jumps, the choice of strategy was individual and not related to training background. This was additionally confirmed in a test of seven ballet dancers and seven volleyball players....

  14. Science Education Resources on the Web--Spiders. (United States)

    Thirunarayanan, M. O.


    Lists Web sites containing information on spiders and offers brief descriptions of the information available at those sites. The 11 sites provide information on taxonomy of spiders, anatomy, different ways spiders use silk, Internet mailing lists, folk literature and art, bibliographies, night collection, and spiders commonly found in the state of…

  15. Hydraulic jumps in a channel

    DEFF Research Database (Denmark)

    Bonn, D.; Andersen, Anders Peter; Bohr, Tomas


    We present a study of hydraulic jumps with flow predominantly in one direction, created either by confining the flow to a narrow channel with parallel walls or by providing an inflow in the form of a narrow sheet. In the channel flow, we find a linear height profile upstream of the jump as expected......'s mixing-length theory with a mixing length that is proportional to the height of the fluid layer. Using averaged boundary-layer equations, taking into account the friction with the channel walls and the eddy viscosity, the flow both upstream and downstream of the jump can be understood. For the downstream...... subcritical flow, we assume that the critical height is attained close to the channel outlet. We use mass and momentum conservation to determine the position of the jump and obtain an estimate which is in rough agreement with our experiment. We show that the averaging method with a varying velocity profile...

  16. Tangled in a sparse spider web

    DEFF Research Database (Denmark)

    Dimitrov, Dimitar Stefanov; Lopardo, Lara; Giribet, Gonzalo


    In order to study the tempo and the mode of spider orb web evolution and diversification, we conducted a phylogenetic analysis using six genetic markers along with a comprehensive taxon sample. The present analyses are the first to recover the monophyly of orb-weaving spiders based solely on DNA ...

  17. Birth of a hydraulic jump (United States)

    Duchesne, Alexis; Bohr, Tomas; Andersen, Anders


    The hydraulic jump, i.e., the sharp transition between a supercritical and a subcritical free-surface flow, has been extensively studied in the past centuries. However, ever since Leonardo da Vinci asked it for the first time, an important question has been left unanswered: How does a hydraulic jump form? We present an experimental and theoretical study of the formation of stationary hydraulic jumps in centimeter wide channels. Two starting situations are considered: The channel is, respectively, empty or filled with liquid, the liquid level being fixed by the wetting properties and the boundary conditions. We then change the flow-rate abruptly from zero to a constant value. In an empty channel, we observe the formation of a stationary hydraulic jump in a two-stage process: First, the channel fills by the advancing liquid front, which undergoes a transition from supercritical to subcritical at some position in the channel. Later the influence of the downstream boundary conditions makes the jump move slowly upstream to its final position. In the pre-filled channel, the hydraulic jump forms at the injector edge and then moves downstream to its final position.

  18. Verified spider bites in Oregon (USA) with the intent to assess hobo spider venom toxicity. (United States)

    McKeown, Nathanael; Vetter, Richard S; Hendrickson, Robert G


    This study compiled 33 verified spider bites from the state of Oregon (USA). The initial goal was to amass a series of bites by the hobo spider to assess whether it possesses toxic venom, a supposition which is currently in a contested state. None of the 33 bites from several spider species developed significant medical symptoms nor did dermonecrosis occur. The most common biters were the yellow sac spider, Cheiracanthium mildei (N = 10) and orb-weavers of the genus Araneus (N = 6). There were 10 bites from three genera of funnel web spiders of the family Agelenidae including one hobo spider bite and one from the congeneric giant house spider which is readily confused as a hobo spider. The hobo spider bite resulted in pain, redness, twitching in the calf muscle and resolved in 12 h. Also generated from this study were possibly the first records of bites from spiders of the genera Callobius (Amaurobiidae) and Antrodiaetus (Antrodiaetidae), both with minor manifestations. Published by Elsevier Ltd.

  19. Variation in free jumping technique within and among horses with little experience in show jumping

    NARCIS (Netherlands)

    Santamaria, S.; Bobbert, M.F.; Back, W.; Barneveld, A.; van Weeren, P.R.


    Objective - To quantify variation in the jumping technique within and among young horses with little jumping experience, establish relationships between kinetic and kinematic variables, and identify a limited set of variables characteristic for detecting differences in jumping performance among

  20. Maternal care and subsocial behaviour in spiders. (United States)

    Yip, Eric C; Rayor, Linda S


    While most spiders are solitary and opportunistically cannibalistic, a variety of social organisations has evolved in a minority of spider species. One form of social organisation is subsociality, in which siblings remain together with their parent for some period of time but disperse prior to independent reproduction. We review the literature on subsocial and maternal behaviour in spiders to highlight areas in which subsocial spiders have informed our understanding of social evolution and to identify promising areas of future research. We show that subsocial behaviour has evolved independently at least 18 times in spiders, across a wide phylogenetic distribution. Subsocial behaviour is diverse in terms of the form of care provided by the mother, the duration of care and sibling association, the degree of interaction and cooperation among siblings, and the use of vibratory and chemical communication. Subsocial spiders are useful model organisms to study various topics in ecology, such as kin recognition and the evolution of cheating and its impact on societies. Further, why social behaviour evolved in some lineages and not others is currently a topic of debate in behavioural ecology, and we argue that spiders offer an opportunity to untangle the ecological causes of parental care, which forms the basis of many other animal societies. © 2013 The Authors. Biological Reviews © 2013 Cambridge Philosophical Society.

  1. Learned predation risk management by spider mites

    Directory of Open Access Journals (Sweden)

    Thomas eHackl


    Full Text Available Predation is a prime selective force shaping prey behavior. Investment in anti-predator behavior is traded-off against time and energy for other fitness-enhancing activities such as foraging or reproduction. To optimize this benefit/cost trade-off, prey should be able to innately and/or by experience modulate their behavior to the level of predation risk. Here, we assessed learned predation risk management in the herbivorous two-spotted spider mite Tetranychus urticae. We exposed spider mites coming from benign (naïve or high immediate predation risk (experienced environments to latent and/or no risk and assessed their site choice, activity and oviposition. Benign environments were characterized by the absence of any predator cues, high immediate risk environments by killed spider mites, physical presence of the predatory mite Phytoseiulus persimilis and associated chemosensory traces left on the surface, and latent risk environments by only predator traces. In the no-choice experiment both naïve and experienced spider mites laid their first egg later on leaves with than without predator traces. Irrespective of predator traces presence/absence, experienced mites laid their first egg earlier than naïve ones did. Naïve spider mites were more active, indicating higher restlessness, and laid fewer eggs on leaves with predator traces, whereas experienced mites were less active and laid similar numbers of eggs on leaves with and without predator traces. In the choice experiment both naïve and experienced spider mites preferentially resided and oviposited on leaves without predator traces but experienced mites were less active than naïve ones. Overall, our study suggests that spider mites experienced with high predation risk behave bolder under latent risk than naïve spider mites. Since predator traces alone do not indicate immediate risk, we argue that the attenuated anti-predator response of experienced spider mites represents adaptive learned

  2. Understanding Spider-Man: Your Everyday Superhero


    Falk, Nicklas; Blomsterberg, Sofie Amalie; Suciu, Alice Sabrina; Pedersen, Mads Peter; Lucas, Vilhelm


    This project focuses on the understanding of Spider-Man, and the morals and ethics that lie behind the choices he makes. Through the Dimensions Philosophy & Science/Text & Sign, this understanding is concluded by looking at ethical theories and comic book analysis. Based on the Ultimate Spider-Man comic book series, the aim is to clarify who Spider-Man is and what causes him to act in certain ways; before and after his realization of power. Some theories used to investigate these area...

  3. Timeless Approach to Quantum Jumps

    Directory of Open Access Journals (Sweden)

    Ignazio Licata


    Full Text Available According to the usual quantum description, the time evolution of the quantum state is continuous and deterministic except when a discontinuous and indeterministic collapse of state vector occurs. The collapse has been a central topic since the origin of the theory, although there are remarkable theoretical proposals to understand its nature, such as the Ghirardi–Rimini–Weber. Another possibility could be the assimilation of collapse with the now experimentally well established phenomenon of quantum jump, postulated by Bohr already in 1913. The challenge of nonlocality offers an opportunity to reconsider the quantum jump as a fundamental element of the logic of the physical world, rather than a subsidiary accident. We propose here a simple preliminary model that considers quantum jumps as processes of entry to and exit from the usual temporal domain to a timeless vacuum, without contradicting the quantum relativistic formalism, and we present some potential connections with particle physics. Quanta 2015; 4: 10–26.

  4. Quantum jumps on Anderson attractors (United States)

    Yusipov, I. I.; Laptyeva, T. V.; Ivanchenko, M. V.


    In a closed single-particle quantum system, spatial disorder induces Anderson localization of eigenstates and halts wave propagation. The phenomenon is vulnerable to interaction with environment and decoherence that is believed to restore normal diffusion. We demonstrate that for a class of experimentally feasible non-Hermitian dissipators, which admit signatures of localization in asymptotic states, quantum particle opts between diffusive and ballistic regimes, depending on the phase parameter of dissipators, with sticking about localization centers. In a diffusive regime, statistics of quantum jumps is non-Poissonian and has a power-law interval, a footprint of intermittent locking in Anderson modes. Ballistic propagation reflects dispersion of an ordered lattice and introduces the second timescale for jumps, resulting in non-nonmonotonous probability distribution. Hermitian dephasing dissipation makes localization features vanish, and Poissonian jump statistics along with normal diffusion are recovered.

  5. Scaling of interfacial jump conditions

    International Nuclear Information System (INIS)

    Quezada G, S.; Vazquez R, A.; Espinosa P, G.


    To model the behavior of a nuclear reactor accurately is needed to have balance models that take into account the different phenomena occurring in the reactor. These balances have to be coupled together through boundary conditions. The boundary conditions have been studied and different treatments have been given to the interface. In this paper is a brief description of some of the interfacial jump conditions that have been proposed in recent years. Also, the scaling of an interfacial jump condition is proposed, for coupling the different materials that are in contact within a nuclear reactor. (Author)

  6. Non-webbuilding spiders: prey specialists or generalists? (United States)

    Nentwig, Wolfgang


    Feeding experiments were performed with seven species of non-webbuilding spiders and a variety of prey taxa. Some species were generally polyphagous whereas other spiders restricted their prey to a few groups. At one end of the spectrum of prey specialization the thomisid Misumena vatia is limited to a few taxa of possible prey (Table 1). The literature of prey records of non-webbuilding spiders is reviewed (Table 2) with special emphasis on oligophagous or monophagous spiders. Monophagous spiders are generally rare and have specialized on only a few prey taxa: social insects (ants, bees, termites) and spiders.

  7. Almost a spider: a 305-million-year-old fossil arachnid and spider origins. (United States)

    Garwood, Russell J; Dunlop, Jason A; Selden, Paul A; Spencer, Alan R T; Atwood, Robert C; Vo, Nghia T; Drakopoulos, Michael


    Spiders are an important animal group, with a long history. Details of their origins remain limited, with little knowledge of their stem group, and no insights into the sequence of character acquisition during spider evolution. We describe a new fossil arachnid, Idmonarachne brasierigen. et sp. nov. from the Late Carboniferous (Stephanian,ca 305-299 Ma) of Montceau-les-Mines, France. It is three-dimensionally preserved within a siderite concretion, allowing both laboratory- and synchrotron-based phase-contrast computed tomography reconstruction. The latter is a first for siderite-hosted fossils and has allowed us to investigate fine anatomical details. Although distinctly spider-like in habitus, this remarkable fossil lacks a key diagnostic character of Araneae: spinnerets on the underside of the opisthosoma. It also lacks a flagelliform telson found in the recently recognized, spider-related, Devonian-Permian Uraraneida. Cladistic analysis resolves our new fossil as sister group to the spiders: the spider stem-group comprises the uraraneids and I. brasieri While we are unable to demonstrate the presence of spigots in this fossil, the recovered phylogeny suggests the earliest character to evolve on the spider stem-group is the secretion of silk. This would have been followed by the loss of a flagelliform telson, and then the ability to spin silk using spinnerets. This last innovation defines the true spiders, significantly post-dates the origins of silk, and may be a key to the group's success. The Montceau-les-Mines locality has previously yielded a mesothele spider (with spinnerets). Evidently, Late Palaeozoic spiders lived alongside Palaeozoic arachnid grades which approached the spider condition, but did not express the full suite of crown-group autapomorphies. © 2016 The Authors.

  8. Edge effect on weevils and spiders


    Horváth, R.; Magura, T.; Péter, G.; Tóthmérész, B.


    The edge effect on weevils and spiders was tested along oak forest – meadow transects using sweep-net samples at the Síkfökút Project in Hungary. For spiders the species richness was significantly higher in the forest edge than either in the meadow or the forest interior. For weevils the species richness of the forest edge was higher than that of the meadow, but the difference was not statistically significant whereas the species richness of the forest...

  9. Pressure Jumps during Drainage in Macroporous Soils

    DEFF Research Database (Denmark)

    Soto, Diego; Paradelo Pérez, Marcos; Corral, A


    Tensiometer readings obtained at high resolution during drainage of structured soil columns revealed pressure jumps with long range correlations and burst sequences with a hierarchical structure. The statistical properties of jumps are similar to Haines jumps described in invasion percolation...... processes at pore scale, but they are much larger in amplitude and duration. Pressure jumps can result from transient redistribution of water potential in internal regions of soil and can be triggered during drainage by capillary displacements at the scale of structural pores....

  10. The identification of price jumps

    Czech Academy of Sciences Publication Activity Database

    Hanousek, Jan; Kočenda, Evžen; Novotný, Jan


    Roč. 18, č. 1 (2012), s. 53-77 ISSN 0929-9629 R&D Projects: GA ČR(CZ) GAP403/11/0020; GA ČR(CZ) GBP402/12/G097 Institutional support: PRVOUK-P23 Keywords : price jumps * non-parametric testing * financial econometrics Subject RIV: AH - Economics

  11. Regime Jumps in Electricity Prices

    NARCIS (Netherlands)

    R. Huisman (Ronald); R.J. Mahieu (Ronald)


    textabstractElectricity prices are known to be very volatile and subject to frequent jumps due to system breakdown, demand shocks, and inelastic supply. As many international electricity markets are in some state of deregulation, more and more participants in these markets are exposed to these

  12. Spiders do have melanin after all. (United States)

    Hsiung, Bor-Kai; Blackledge, Todd A; Shawkey, Matthew D


    Melanin pigments are broadly distributed in nature - from bacteria to fungi to plants and animals. However, many previous attempts to identify melanins in spiders were unsuccessful, suggesting that these otherwise ubiquitous pigments were lost during spider evolution. Yet, spiders exhibit many dark colours similar to those produced by melanins in other organisms, and the low solubility of melanins makes isolation and characterization difficult. Therefore, whether melanins are truly absent or have simply not yet been detected is an open question. Raman spectroscopy provides a reliable way to detect melanins in situ, without the need for isolation. In this study, we document the presence of eumelanin in diverse species of spiders using confocal Raman microspectroscopy. Comparisons of spectra with theoretically calculated data falsify the previous hypothesis that dark colours are produced solely by ommochromes in spiders. Our data indicate that melanins are present in spiders and further supporting that they are present in most living organisms. © 2015. Published by The Company of Biologists Ltd.

  13. Genus-specificity of araneophagy of linyphiid spiders and spiders of other families (Arachnida, Araneae)

    NARCIS (Netherlands)

    Heuts, B.; Brunt, T.


    We found genus specificity of predation by spiders on other spiders in captivity which surpass them in body size (araneophagy). Adult specimens of three species of the linyphiid genus Walckenaeria which were successively tested for araneophagy (in the laboratory) in the order of first species

  14. Cognitive bias in spider-phobic children: Comparison of a pictorial and a linguistic spider Stroop.

    NARCIS (Netherlands)

    Kindt, M.; Brosschot, J.F.


    Examined the relation between spider fear in children and cognitive processing bias toward threatening information. It was investigated whether spider fear in children is related to a cognitive bias for threatening pictures and words. Pictorial and linguistic Stroop stimuli were administered to 28

  15. Mesopause Jumps: Observations and Explanation (United States)

    Luebken, F. J.; Becker, E.; Höffner, J.; Viehl, T. P.; Latteck, R.


    Recent high resolution temperature measurements by resonance lidar at Davis (69°S) occasionally showed a sudden mesopause altitude increase by 5km and an associated mesopause temperature decrease by 10K. We present further observations which are closely related to this `mesopause jump', namely the increase of mean height of polar mesospheric summer echoes (PMSE) observed by a VHF radar, very strong westward winds in the upper mesosphere measured by an MF radar, and relatively large eastward winds in the stratosphere taken from reanalysis. We compare to similar observations in the Northern Hemisphere, namely at ALOMAR (69°N) where such mesopause jumps have never been observed. We present a detailed explanation of mesopause jumps. They occur only when stratospheric winds are moderately eastward and mesospheric winds are very large (westward). Under these conditions, gravity waves with comparatively large eastward phase speeds can pass the stratosphere and propagate to the lower thermosphere because their vertical wavelengths in the mesosphere are rather large which implies reduced dynamical stability. When finally breaking in the lower thermosphere, these waves drive an enhanced residual circulation that causes a cold and high-altitude mesopause. The conditions for a mesopause jump occur only in the Southern Hemisphere (SH) and are associated with the late breakdown of the polar vortex.Mesopause jumps are primarily, but not only, observed prior and close to solstice. We also show that during the onset of PMSE in the SH, stratospheric zonal winds are still eastward (up to 30m/s), and that the onset is not closely related to the transition of the stratospheric circulation.

  16. Effects of timing of signal indicating jump directions on knee biomechanics in jump-landing-jump tasks. (United States)

    Stephenson, Mitchell L; Hinshaw, Taylour J; Wadley, Haley A; Zhu, Qin; Wilson, Margaret A; Byra, Mark; Dai, Boyi


    A variety of the available time to react (ATR) has been utilised to study knee biomechanics during reactive jump-landing tasks. The purpose was to quantify knee kinematics and kinetics during a jump-land-jump task of three possible directions as the ATR was reduced. Thirty-four recreational athletes performed 45 trials of a jump-land-jump task, during which the direction of the second jump (lateral, medial or vertical) was indicated before they initiated the first jump, the instant they initiated the first jump, 300 ms before landing, 150 ms before landing or at the instant of landing. Knee joint angles and moments close to the instant of landing were significantly different when the ATR was equal to or more than 300 ms before landing, but became similar when the ATR was 150 ms or 0 ms before landing. As the ATR was decreased, knee moments decreased for the medial jump direction, but increased for the lateral jump direction. When the ATR is shorter than an individual's reaction time, the movement pattern cannot be pre-planned before landing. Knee biomechanics are dependent on the timing of the signal and the subsequent jump direction. Precise control of timing and screening athletes with low ATR are suggested.

  17. Energetics, scaling and sexual size dimorphism of spiders. (United States)

    Grossi, B; Canals, M


    The extreme sexual size dimorphism in spiders has motivated studies for many years. In many species the male can be very small relative to the female. There are several hypotheses trying to explain this fact, most of them emphasizing the role of energy in determining spider size. The aim of this paper is to review the role of energy in sexual size dimorphism of spiders, even for those spiders that do not necessarily live in high foliage, using physical and allometric principles. Here we propose that the cost of transport or equivalently energy expenditure and the speed are traits under selection pressure in male spiders, favoring those of smaller size to reduce travel costs. The morphology of the spiders responds to these selective forces depending upon the lifestyle of the spiders. Climbing and bridging spiders must overcome the force of gravity. If bridging allows faster dispersal, small males would have a selective advantage by enjoying more mating opportunities. In wandering spiders with low population density and as a consequence few male-male interactions, high speed and low energy expenditure or cost of transport should be favored by natural selection. Pendulum mechanics show the advantages of long legs in spiders and their relationship with high speed, even in climbing and bridging spiders. Thus small size, compensated by long legs should be the expected morphology for a fast and mobile male spider.

  18. Spider diffraction: a comparison of curved and straight legs

    International Nuclear Information System (INIS)

    Richter, J.L.


    It has been known for some time that, if curved legs rather than the usual straight ones are used in the spider that supports the secondary optics in certain telescopes, the visible diffraction effect is reduced. Fraunhofer theory is used to calculate the diffraction effects due to the curved leg spider. Calculated and photographic diffraction patterns are compared for straight and curved leg spiders

  19. Acute Generalized Exanthematous Pustulosis (AGEP Triggered by a Spider Bite

    Directory of Open Access Journals (Sweden)

    Michael Makris


    Discussion: A spider bite may represent a possible causative factor of AGEP. A spider's venom contains sphingomyelinase that stimulates the release of IL8 and GM-CSF, which are involved in AGEP pathogenesis. Whether or not the con-current use of antibiotics has an effect in AGEP appearance when combined with a spider's venom, cannot be excluded.

  20. Locomotion of Mexican jumping beans

    International Nuclear Information System (INIS)

    West, Daniel M; K Lal, Ishan; Leamy, Michael J; Hu, David L


    The Mexican jumping bean, Laspeyresia saltitans, consists of a hollow seed housing a moth larva. Heating by the sun induces movements by the larva which appear as rolls, jumps and flips by the bean. In this combined experimental, numerical and robotic study, we investigate this unique means of rolling locomotion. Time-lapse videography is used to record bean trajectories across a series of terrain types, including one-dimensional channels and planar surfaces of varying inclination. We find that the shell encumbers the larva's locomotion, decreasing its speed on flat surfaces by threefold. We also observe that the two-dimensional search algorithm of the bean resembles the run-and-tumble search of bacteria. We test this search algorithm using both an agent-based simulation and a wheeled Scribbler robot. The algorithm succeeds in propelling the robot away from regions of high temperature and may have application in biomimetic micro-scale navigation systems. (paper)

  1. Model for polygonal hydraulic jumps

    DEFF Research Database (Denmark)

    Martens, Erik Andreas; Watanabe, Shinya; Bohr, Tomas


    We propose a phenomenological model for the polygonal hydraulic jumps discovered by Ellegaard and co-workers [Nature (London) 392, 767 (1998); Nonlinearity 12, 1 (1999); Physica B 228, 1 (1996)], based on the known flow structure for the type-II hydraulic jumps with a "roller" (separation eddy...... nonhydrostatic pressure contributions from surface tension in light of recent observations by Bush and co-workers [J. Fluid Mech. 558, 33 (2006); Phys. Fluids 16, S4 (2004)]. The model can be analyzed by linearization around the circular state, resulting in a parameter relationship for nearly circular polygonal...... states. A truncated but fully nonlinear version of the model can be solved analytically. This simpler model gives rise to polygonal shapes that are very similar to those observed in experiments, even though surface tension is neglected, and the condition for the existence of a polygon with N corners...

  2. Data-Driven Jump Detection Thresholds for Application in Jump Regressions

    Directory of Open Access Journals (Sweden)

    Robert Davies


    Full Text Available This paper develops a method to select the threshold in threshold-based jump detection methods. The method is motivated by an analysis of threshold-based jump detection methods in the context of jump-diffusion models. We show that over the range of sampling frequencies a researcher is most likely to encounter that the usual in-fill asymptotics provide a poor guide for selecting the jump threshold. Because of this we develop a sample-based method. Our method estimates the number of jumps over a grid of thresholds and selects the optimal threshold at what we term the ‘take-off’ point in the estimated number of jumps. We show that this method consistently estimates the jumps and their indices as the sampling interval goes to zero. In several Monte Carlo studies we evaluate the performance of our method based on its ability to accurately locate jumps and its ability to distinguish between true jumps and large diffusive moves. In one of these Monte Carlo studies we evaluate the performance of our method in a jump regression context. Finally, we apply our method in two empirical studies. In one we estimate the number of jumps and report the jump threshold our method selects for three commonly used market indices. In the other empirical application we perform a series of jump regressions using our method to select the jump threshold.

  3. Remembering the object you fear: brain potentials during recognition of spiders in spider-fearful individuals. (United States)

    Michalowski, Jaroslaw M; Weymar, Mathias; Hamm, Alfons O


    In the present study we investigated long-term memory for unpleasant, neutral and spider pictures in 15 spider-fearful and 15 non-fearful control individuals using behavioral and electrophysiological measures. During the initial (incidental) encoding, pictures were passively viewed in three separate blocks and were subsequently rated for valence and arousal. A recognition memory task was performed one week later in which old and new unpleasant, neutral and spider pictures were presented. Replicating previous results, we found enhanced memory performance and higher confidence ratings for unpleasant when compared to neutral materials in both animal fearful individuals and controls. When compared to controls high animal fearful individuals also showed a tendency towards better memory accuracy and significantly higher confidence during recognition of spider pictures, suggesting that memory of objects prompting specific fear is also facilitated in fearful individuals. In line, spider-fearful but not control participants responded with larger ERP positivity for correctly recognized old when compared to correctly rejected new spider pictures, thus showing the same effects in the neural signature of emotional memory for feared objects that were already discovered for other emotional materials. The increased fear memory for phobic materials observed in the present study in spider-fearful individuals might result in an enhanced fear response and reinforce negative beliefs aggravating anxiety symptomatology and hindering recovery.

  4. Flee or fight: ontogenetic changes in the behavior of cobweb spiders in encounters with spider-hunting wasps. (United States)

    Uma, Divya B; Weiss, Martha R


    An animal's body size plays a predominant role in shaping its interspecific interactions, and, in encounters between two predators, often determines which shall be predator and which shall be prey. Spiders are top predators of insects, yet can fall prey to mud-dauber wasps that provision their larval nests with paralyzed spiders. Here we examined predator-prey interactions between Chalybion californicum (Saussure) (Sphecidae), a mud-dauber wasp, and Parasteatoda tepidariorum C. L. Koch (Theridiidae), a cobweb spider. We examined whether a spider's size influences its response to an attacking wasp, and report a size-dependent change in spider behavior: small-sized spiders fled, whereas medium- and large-sized spiders fought in response to wasp attacks. From the wasps' perspective, we examined whether spider size influences a wasp's hunting behavior and capture success. We found that wasps commonly approached small spiders, but were much less likely to approach medium and large spiders. However, wasp capture success did not vary with spider size. We also report a strategy used by Chalybion wasps toward cobweb spiders that is consistent with an interpretation of aggressive mimicry.

  5. Fish predation by semi-aquatic spiders: a global pattern.

    Directory of Open Access Journals (Sweden)

    Martin Nyffeler

    Full Text Available More than 80 incidences of fish predation by semi-aquatic spiders--observed at the fringes of shallow freshwater streams, rivers, lakes, ponds, swamps, and fens--are reviewed. We provide evidence that fish predation by semi-aquatic spiders is geographically widespread, occurring on all continents except Antarctica. Fish predation by spiders appears to be more common in warmer areas between 40° S and 40° N. The fish captured by spiders, usually ranging from 2-6 cm in length, are among the most common fish taxa occurring in their respective geographic area (e.g., mosquitofish [Gambusia spp.] in the southeastern USA, fish of the order Characiformes in the Neotropics, killifish [Aphyosemion spp.] in Central and West Africa, as well as Australian native fish of the genera Galaxias, Melanotaenia, and Pseudomugil. Naturally occurring fish predation has been witnessed in more than a dozen spider species from the superfamily Lycosoidea (families Pisauridae, Trechaleidae, and Lycosidae, in two species of the superfamily Ctenoidea (family Ctenidae, and in one species of the superfamily Corinnoidea (family Liocranidae. The majority of reports on fish predation by spiders referred to pisaurid spiders of the genera Dolomedes and Nilus (>75% of observed incidences. There is laboratory evidence that spiders from several more families (e.g., the water spider Argyroneta aquatica [Cybaeidae], the intertidal spider Desis marina [Desidae], and the 'swimming' huntsman spider Heteropoda natans [Sparassidae] predate fish as well. Our finding of such a large diversity of spider families being engaged in fish predation is novel. Semi-aquatic spiders captured fish whose body length exceeded the spiders' body length (the captured fish being, on average, 2.2 times as long as the spiders. Evidence suggests that fish prey might be an occasional prey item of substantial nutritional importance.

  6. Fish predation by semi-aquatic spiders: a global pattern. (United States)

    Nyffeler, Martin; Pusey, Bradley J


    More than 80 incidences of fish predation by semi-aquatic spiders--observed at the fringes of shallow freshwater streams, rivers, lakes, ponds, swamps, and fens--are reviewed. We provide evidence that fish predation by semi-aquatic spiders is geographically widespread, occurring on all continents except Antarctica. Fish predation by spiders appears to be more common in warmer areas between 40° S and 40° N. The fish captured by spiders, usually ranging from 2-6 cm in length, are among the most common fish taxa occurring in their respective geographic area (e.g., mosquitofish [Gambusia spp.] in the southeastern USA, fish of the order Characiformes in the Neotropics, killifish [Aphyosemion spp.] in Central and West Africa, as well as Australian native fish of the genera Galaxias, Melanotaenia, and Pseudomugil). Naturally occurring fish predation has been witnessed in more than a dozen spider species from the superfamily Lycosoidea (families Pisauridae, Trechaleidae, and Lycosidae), in two species of the superfamily Ctenoidea (family Ctenidae), and in one species of the superfamily Corinnoidea (family Liocranidae). The majority of reports on fish predation by spiders referred to pisaurid spiders of the genera Dolomedes and Nilus (>75% of observed incidences). There is laboratory evidence that spiders from several more families (e.g., the water spider Argyroneta aquatica [Cybaeidae], the intertidal spider Desis marina [Desidae], and the 'swimming' huntsman spider Heteropoda natans [Sparassidae]) predate fish as well. Our finding of such a large diversity of spider families being engaged in fish predation is novel. Semi-aquatic spiders captured fish whose body length exceeded the spiders' body length (the captured fish being, on average, 2.2 times as long as the spiders). Evidence suggests that fish prey might be an occasional prey item of substantial nutritional importance.

  7. UV-green iridescence predicts male quality during jumping spider contests. (United States)

    Lim, Matthew L M; Li, Daiqin


    Animal colour signals used in intraspecies communications can generally be attributed to a composite effect of structural and pigmentary colours. Notably, the functional role of iridescent coloration that is 'purely' structural (i.e., absence of pigments) is poorly understood. Recent studies reveal that iridescent colorations can reliably indicate individual quality, but evidence of iridescence as a pure structural coloration indicative of male quality during contests and relating to an individual's resource-holding potential (RHP) is lacking. In age- and size-controlled pairwise male-male contests that escalate from visual displays of aggression to more costly physical fights, we demonstrate that the ultraviolet-green iridescence of Cosmophasis umbratica predicts individual persistence and relates to RHP. Contest initiating males exhibited significantly narrower carapace band separation (i.e., relative spectral positions of UV and green hues) than non-initiators. Asymmetries in carapace and abdomen brightness influenced overall contest duration and escalation. As losers retreated upon having reached their own persistence limits in contests that escalated to physical fights, losers with narrower carapace band separation were significantly more persistence. We propose that the carapace UV-green iridescence of C. umbratica predicts individual persistence and is indicative of a male's RHP. As the observed UV-green hues of C. umbratica are 'pure' optical products of a multilayer reflector system, we suggest that intrasexual variations in the optical properties of the scales' chitin-air-chitin microstructures are responsible for the observed differences in carapace band separations.

  8. UV-green iridescence predicts male quality during jumping spider contests.

    Directory of Open Access Journals (Sweden)

    Matthew L M Lim

    Full Text Available Animal colour signals used in intraspecies communications can generally be attributed to a composite effect of structural and pigmentary colours. Notably, the functional role of iridescent coloration that is 'purely' structural (i.e., absence of pigments is poorly understood. Recent studies reveal that iridescent colorations can reliably indicate individual quality, but evidence of iridescence as a pure structural coloration indicative of male quality during contests and relating to an individual's resource-holding potential (RHP is lacking. In age- and size-controlled pairwise male-male contests that escalate from visual displays of aggression to more costly physical fights, we demonstrate that the ultraviolet-green iridescence of Cosmophasis umbratica predicts individual persistence and relates to RHP. Contest initiating males exhibited significantly narrower carapace band separation (i.e., relative spectral positions of UV and green hues than non-initiators. Asymmetries in carapace and abdomen brightness influenced overall contest duration and escalation. As losers retreated upon having reached their own persistence limits in contests that escalated to physical fights, losers with narrower carapace band separation were significantly more persistence. We propose that the carapace UV-green iridescence of C. umbratica predicts individual persistence and is indicative of a male's RHP. As the observed UV-green hues of C. umbratica are 'pure' optical products of a multilayer reflector system, we suggest that intrasexual variations in the optical properties of the scales' chitin-air-chitin microstructures are responsible for the observed differences in carapace band separations.

  9. Inbreeding avoidance in spiders: evidence for rescue effect in fecundity of female spiders with outbreeding opportunity

    DEFF Research Database (Denmark)

    Bilde, T.; Maklakov, A.A.; Schilling, Nadia


    avoidance can be because of low risk of inbreeding, variation in tolerance to inbreeding or high costs of outbreeding. We examined the relationship between inbreeding depression and inbreeding avoidance adaptations under two levels of inbreeding in the spider Oedothorax apicatus, asking whether preference...... for unrelated sperm via pre- and/or post-copulatory mechanisms could restore female fitness when inbreeding depression increases. Using inbred isofemale lines we provided female spiders with one or two male spiders of different relatedness in five combinations: one male sib; one male nonsib; two male sibs; two...

  10. Optically probing torsional superelasticity in spider silks

    Energy Technology Data Exchange (ETDEWEB)

    Kumar, Bhupesh; Thakur, Ashish; Panda, Biswajit; Singh, Kamal P. [Department of Physical Sciences, IISER Mohali, Sector 81, Manauli, Mohali 140306 (India)


    We investigate torsion mechanics of various spider silks using a sensitive optical technique. We find that spider silks are torsionally superelastic in that they can reversibly withstand great torsion strains of over 10{sup 2−3} rotations per cm before failure. Among various silks from a spider, we find the failure twist-strain is greatest in the sticky capture silk followed by dragline and egg-case silk. Our in situ laser-diffraction measurements reveal that torsional strains on the silks induce a nano-scale transverse compression in its diameter that is linear and reversible. These unique torsional properties of the silks could find applications in silk-based materials and devices.

  11. SPIDER: A Framework for Understanding Driver Distraction. (United States)

    Strayer, David L; Fisher, Donald L


    The objective was to identify key cognitive processes that are impaired when drivers divert attention from driving. Driver distraction is increasingly recognized as a significant source of injuries and fatalities on the roadway. A "SPIDER" model is developed that identifies key cognitive processes that are impaired when drivers divert attention from driving. SPIDER is an acronym standing for scanning, predicting, identifying, decision making, and executing a response. When drivers engage in secondary activities unrelated to the task of driving, SPIDER-related processes are impaired, situation awareness is degraded, and the ability to safely operate a motor vehicle may be compromised. The pattern of interference helps to illuminate the sources of driver distraction and may help guide the integration of new technology into the automobile. © 2015, Human Factors and Ergonomics Society.

  12. Optically probing torsional superelasticity in spider silks

    International Nuclear Information System (INIS)

    Kumar, Bhupesh; Thakur, Ashish; Panda, Biswajit; Singh, Kamal P.


    We investigate torsion mechanics of various spider silks using a sensitive optical technique. We find that spider silks are torsionally superelastic in that they can reversibly withstand great torsion strains of over 10 2−3 rotations per cm before failure. Among various silks from a spider, we find the failure twist-strain is greatest in the sticky capture silk followed by dragline and egg-case silk. Our in situ laser-diffraction measurements reveal that torsional strains on the silks induce a nano-scale transverse compression in its diameter that is linear and reversible. These unique torsional properties of the silks could find applications in silk-based materials and devices

  13. Edge effect on weevils and spiders

    Directory of Open Access Journals (Sweden)

    R. Horváth


    Full Text Available The edge effect on weevils and spiders was tested along oak forest – meadow transects using sweep-net samples at the Síkfökút Project in Hungary. For spiders the species richness was significantly higher in the forest edge than either in the meadow or the forest interior. For weevils the species richness of the forest edge was higher than that of the meadow, but the difference was not statistically significant whereas the species richness of the forest interior was significantly lower than that of the forest edge and the meadow. The composition of the spider assemblage of the edge was more similar to the forest, while the composition of weevils in the edge was more similar to the meadow. Our results based on two invertebrate groups operating on different trophic levels suggest that there is a significant edge effect for the studied taxa resulting in higher species richness in the edge.

  14. Aquatic subsidies transport anthropogenic nitrogen to riparian spiders

    Energy Technology Data Exchange (ETDEWEB)

    Akamatsu, Fumikazu, E-mail: [Department of Environmental Sciences, Shinshu University, 3-1-1 Asahi, Matsumoto, Nagano 390-8621 (Japan); Toda, Hideshige [Department of Environmental Sciences, Shinshu University, 3-1-1 Asahi, Matsumoto, Nagano 390-8621 (Japan)


    Stable nitrogen isotopic composition ({delta}{sup 15}N) of aquatic biota increases with anthropogenic N inputs such as sewage and livestock waste downstream. Increase in {delta}{sup 15}N of riparian spiders downstream may reflect the anthropogenic pollution exposure through predation on aquatic insects. A two-source mixing model based on stable carbon isotopic composition showed the greatest dependence on aquatic insects (84%) by horizontal web-building spiders, followed by intermediate (48%) and low (31%) dependence by cursorial and vertical web-building spiders, respectively. The spider body size was negatively correlated with the dietary proportion of aquatic insects and spider {delta}{sup 15}N. The aquatic subsidies transported anthropogenic N to smaller riparian spiders downstream. This transport of anthropogenic N was regulated by spider's guild designation and body size. - Highlights: > {delta}{sup 15}N of aquatic insects increases downstream with anthropogenic nitrogen inputs. > {delta}{sup 15}N of riparian spiders increases with a high dietary proportion of aquatic insects and smaller spider body size. > The aquatic subsidies transport anthropogenic nitrogen to smaller riparian spiders downstream. - Smaller spiders assimilate anthropogenic nitrogen through the predation on aquatic subsides.

  15. Aquatic subsidies transport anthropogenic nitrogen to riparian spiders

    International Nuclear Information System (INIS)

    Akamatsu, Fumikazu; Toda, Hideshige


    Stable nitrogen isotopic composition (δ 15 N) of aquatic biota increases with anthropogenic N inputs such as sewage and livestock waste downstream. Increase in δ 15 N of riparian spiders downstream may reflect the anthropogenic pollution exposure through predation on aquatic insects. A two-source mixing model based on stable carbon isotopic composition showed the greatest dependence on aquatic insects (84%) by horizontal web-building spiders, followed by intermediate (48%) and low (31%) dependence by cursorial and vertical web-building spiders, respectively. The spider body size was negatively correlated with the dietary proportion of aquatic insects and spider δ 15 N. The aquatic subsidies transported anthropogenic N to smaller riparian spiders downstream. This transport of anthropogenic N was regulated by spider's guild designation and body size. - Highlights: → δ 15 N of aquatic insects increases downstream with anthropogenic nitrogen inputs. → δ 15 N of riparian spiders increases with a high dietary proportion of aquatic insects and smaller spider body size. → The aquatic subsidies transport anthropogenic nitrogen to smaller riparian spiders downstream. - Smaller spiders assimilate anthropogenic nitrogen through the predation on aquatic subsides.

  16. Disentangling the phylogenetic and ecological components of spider phenotypic variation. (United States)

    Gonçalves-Souza, Thiago; Diniz-Filho, José Alexandre Felizola; Romero, Gustavo Quevedo


    An understanding of how the degree of phylogenetic relatedness influences the ecological similarity among species is crucial to inferring the mechanisms governing the assembly of communities. We evaluated the relative importance of spider phylogenetic relationships and ecological niche (plant morphological variables) to the variation in spider body size and shape by comparing spiders at different scales: (i) between bromeliads and dicot plants (i.e., habitat scale) and (ii) among bromeliads with distinct architectural features (i.e., microhabitat scale). We partitioned the interspecific variation in body size and shape into phylogenetic (that express trait values as expected by phylogenetic relationships among species) and ecological components (that express trait values independent of phylogenetic relationships). At the habitat scale, bromeliad spiders were larger and flatter than spiders associated with the surrounding dicots. At this scale, plant morphology sorted out close related spiders. Our results showed that spider flatness is phylogenetically clustered at the habitat scale, whereas it is phylogenetically overdispersed at the microhabitat scale, although phylogenic signal is present in both scales. Taken together, these results suggest that whereas at the habitat scale selective colonization affect spider body size and shape, at fine scales both selective colonization and adaptive evolution determine spider body shape. By partitioning the phylogenetic and ecological components of phenotypic variation, we were able to disentangle the evolutionary history of distinct spider traits and show that plant architecture plays a role in the evolution of spider body size and shape. We also discussed the relevance in considering multiple scales when studying phylogenetic community structure.

  17. Uncovering the structure-function relationship in spider silk (United States)

    Yarger, Jeffery L.; Cherry, Brian R.; van der Vaart, Arjan


    All spiders produce protein-based biopolymer fibres that we call silk. The most studied of these silks is spider dragline silk, which is very tough and relatively abundant compared with other types of spider silks. Considerable research has been devoted to understanding the relationship between the molecular structure and mechanical properties of spider dragline silks. In this Review, we overview experimental and computational studies that have provided a wealth of detail at the molecular level on the highly conserved repetitive core and terminal regions of spider dragline silk. We also discuss the role of the nanocrystalline β-sheets and amorphous regions in determining the properties of spider silk fibres, endowing them with strength and elasticity. Additionally, we outline imaging techniques and modelling studies that elucidate the importance of the hierarchical structure of silk fibres at the molecular level. These insights into structure-function relationships can guide the reverse engineering of spider silk to enable the production of superior synthetic fibres.

  18. Checklist of spider fauna of FR Peshawar, FATA, Pakistan

    Directory of Open Access Journals (Sweden)

    F. Perveen


    Full Text Available The spiders are known as poisonous arthropods, but they also act as the predator or biological pests control agent. Their 23 species belonging to 15 genera and 09 families were reported during 2009-2010 from FR Peshawar, FATA, Pakistan. The reported families Clubionidae, Scytodidae and Sprassidae covered each 4%, Araneidae, Gnaphosidae, Pholicidae and Salticidae each 9%, Thomisidae 13% and Lycosidae 43% biodiversity of spiders of FATA. However, the largest spider collected was huntsman, Isopoda tuhodnigra (Barrion with total body length 15.80+-0.83 mm. Moreover, the smallest spider was wolf spider, Pardosa birmanica (Simon with total body length 4.20+-1.30 mm. Further, the crab spiders, Thomisus pugilis (Stoliczka, T. spectabilis (Doleschall and Diaea evanida (Thorell were the most colorful species belonging to family Thomisidae. A detail study is required for further exploration of spider fauna of FATA.

  19. Recombinant DNA production of spider silk proteins. (United States)

    Tokareva, Olena; Michalczechen-Lacerda, Valquíria A; Rech, Elíbio L; Kaplan, David L


    Spider dragline silk is considered to be the toughest biopolymer on Earth due to an extraordinary combination of strength and elasticity. Moreover, silks are biocompatible and biodegradable protein-based materials. Recent advances in genetic engineering make it possible to produce recombinant silks in heterologous hosts, opening up opportunities for large-scale production of recombinant silks for various biomedical and material science applications. We review the current strategies to produce recombinant spider silks. © 2013 The Authors. Microbial Biotechnology published by John Wiley & Sons Ltd and Society for Applied Microbiology.

  20. Programming spiders, bots, and aggregators in Java

    CERN Document Server

    Heaton, Jeff


    The content and services available on the web continue to be accessed mostly through direct human control. But this is changing. Increasingly, users rely on automated agents that save them time and effort by programmatically retrieving content, performing complex interactions, and aggregating data from diverse sources. Programming Spiders, Bots, and Aggregators in Java teaches you how to build and deploy a wide variety of these agents-from single-purpose bots to exploratory spiders to aggregators that present a unified view of information from multiple user accounts. You will quickly build on

  1. Psychophysiological response in parachute jumps, the effect of experience and type of jump. (United States)

    Clemente-Suárez, Vicente Javier; Robles-Pérez, José Juan; Fernández-Lucas, Jesús


    We aimed to analyse the effect of experience and type of parachute jump on the psychophysiological responses of jumpers. We analysed blood oxygen saturation, heart rate, blood glucose, lactate and creatinkinase, leg strength, isometric hand strength, cortical arousal, specific fine motor skills, self-confidence and cognition, and somatic and state anxiety, before and after four different parachute jumps: a sport parachute jump, a manual tactical parachute jump, tandem pilots, and tandem passengers. Independently of the parachute jump, the psychophysiological responses of experienced paratroopers were not affected by the jumps, except for an increase in anaerobic metabolism. Novice parachute jumpers presented a higher psychophysiological stress response than the experienced jumpers, together with a large anticipatory anxiety response before the jump; however, this decreased after the jump, although the high physiological activation was maintained. This information could be used by civil and military paratroopers' instructors to improve their training programmes. Copyright © 2017 Elsevier Inc. All rights reserved.

  2. Dynamic jump intensities and risk premiums

    DEFF Research Database (Denmark)

    Christoffersen, Peter; Ornthanalai, Chayawat; Jacobs, Kris


    We build a new class of discrete-time models that are relatively easy to estimate using returns and/or options. The distribution of returns is driven by two factors: dynamic volatility and dynamic jump intensity. Each factor has its own risk premium. The models significantly outperform standard...... models without jumps when estimated on S&P500 returns. We find very strong support for time-varying jump intensities. Compared to the risk premium on dynamic volatility, the risk premium on the dynamic jump intensity has a much larger impact on option prices. We confirm these findings using joint...

  3. Characteristics of Air Entrainment in Hydraulic Jump (United States)

    Albarkani, M. S. S.; Tan, L. W.; Al-Gheethi, A.


    The characteristics of hydraulic jump, especially the air entrainment within jump is still not properly understood. Therefore, the current work aimed to determine the size and number of air entrainment formed in hydraulic jump at three different Froude numbers and to obtain the relationship between Froude number with the size and number of air entrainment in hydraulic jump. Experiments of hydraulic jump were conducted in a 10 m long and 0.3 m wide Armfield S6MKII glass-sided tilting flume. Hydraulic jumps were produced by flow under sluice gate with varying Froude number. The air entrainment of the hydraulic jump was captured with a Canon Power Shot SX40 HS digital camera in video format at 24 frames per second. Three discharges have been considered, i.e. 0.010 m3/s, 0.011 m3/s, and 0.013 m3/s. For hydraulic jump formed in each discharge, 32 frames were selected for the purpose of analysing the size and number of air entrainment in hydraulic jump. The results revealed that that there is a tendency to have greater range in sizes of air bubbles as Fr1 increases. Experiments with Fr1 = 7.547. 7.707, and 7.924 shown that the number of air bubbles increases exponentially with Fr1 at a relationship of N = 1.3814 e 0.9795Fr1.

  4. Improved safety in ski jumping. (United States)

    Wester, K


    Among approximately 2,600 licensed Norwegian ski jumpers, only three injuries that caused a permanent medical disability of at least 10% were incurred during the 5 year period from 1982 through 1986. When compared to the previous 5 year period (1977 to 1981), a dramatic improvement in safety is seen, as both number and severity of such injuries were markedly reduced. There are several probable reasons for this improved safety record: better preparation of the jumps, the return to using only one standard heel block, and the fact that coaches are being more responsible, especially with younger jumpers.

  5. A tale of quantum jumps

    International Nuclear Information System (INIS)

    Carmichael, H.J.


    This paper cannot provide anything like a complete overview of quantum optics in New Zealand. The scope over 40 years is far too broad and the number of players far too large. Nevertheless, the story of quantum jumps, from the days of the Old Quantum Theory up to the present, serves to highlight some small part of the New Zealand experience. It also offers an encounter with the oddities of light as a quantum mechanical 'something', oddities that the gallant proposers of technologies for the future aim to exploit. (author).

  6. Characterization of a Gene Coding for the Complement System Component FB from Loxosceles laeta Spider Venom Glands. (United States)

    Myamoto, Daniela Tiemi; Pidde-Queiroz, Giselle; Gonçalves-de-Andrade, Rute Maria; Pedroso, Aurélio; van den Berg, Carmen W; Tambourgi, Denise V


    The human complement system is composed of more than 30 proteins and many of these have conserved domains that allow tracing the phylogenetic evolution. The complement system seems to be initiated with the appearance of C3 and factor B (FB), the only components found in some protostomes and cnidarians, suggesting that the alternative pathway is the most ancient. Here, we present the characterization of an arachnid homologue of the human complement component FB from the spider Loxosceles laeta. This homologue, named Lox-FB, was identified from a total RNA L. laeta spider venom gland library and was amplified using RACE-PCR techniques and specific primers. Analysis of the deduced amino acid sequence and the domain structure showed significant similarity to the vertebrate and invertebrate FB/C2 family proteins. Lox-FB has a classical domain organization composed of a control complement protein domain (CCP), a von Willebrand Factor domain (vWFA), and a serine protease domain (SP). The amino acids involved in Mg2+ metal ion dependent adhesion site (MIDAS) found in the vWFA domain in the vertebrate C2/FB proteins are well conserved; however, the classic catalytic triad present in the serine protease domain is not conserved in Lox-FB. Similarity and phylogenetic analyses indicated that Lox-FB shares a major identity (43%) and has a close evolutionary relationship with the third isoform of FB-like protein (FB-3) from the jumping spider Hasarius adansoni belonging to the Family Salcitidae.

  7. Characterization of a Gene Coding for the Complement System Component FB from Loxosceles laeta Spider Venom Glands.

    Directory of Open Access Journals (Sweden)

    Daniela Tiemi Myamoto

    Full Text Available The human complement system is composed of more than 30 proteins and many of these have conserved domains that allow tracing the phylogenetic evolution. The complement system seems to be initiated with the appearance of C3 and factor B (FB, the only components found in some protostomes and cnidarians, suggesting that the alternative pathway is the most ancient. Here, we present the characterization of an arachnid homologue of the human complement component FB from the spider Loxosceles laeta. This homologue, named Lox-FB, was identified from a total RNA L. laeta spider venom gland library and was amplified using RACE-PCR techniques and specific primers. Analysis of the deduced amino acid sequence and the domain structure showed significant similarity to the vertebrate and invertebrate FB/C2 family proteins. Lox-FB has a classical domain organization composed of a control complement protein domain (CCP, a von Willebrand Factor domain (vWFA, and a serine protease domain (SP. The amino acids involved in Mg2+ metal ion dependent adhesion site (MIDAS found in the vWFA domain in the vertebrate C2/FB proteins are well conserved; however, the classic catalytic triad present in the serine protease domain is not conserved in Lox-FB. Similarity and phylogenetic analyses indicated that Lox-FB shares a major identity (43% and has a close evolutionary relationship with the third isoform of FB-like protein (FB-3 from the jumping spider Hasarius adansoni belonging to the Family Salcitidae.

  8. Scavenging by spiders (Araneae) and its relationship to pest management of the brown recluse spider. (United States)

    Vetter, Richard S


    Experiments reported in Sandidge (2003; Nature 426: 30) indicated that the brown recluse spider, Loxosceles reclusa Gertsch & Mulaik, preferred to scavenge dead prey over live prey and that the spiders were not detrimentally affected when fed insecticide-killed crickets. Extrapolations made in subsequent media coverage disseminating the results of this research made counter-intuitive statements that pesticide treatment in houses would increase brown recluse populations in homes. This information was presented as if the scavenging behavior was specialized in the brown recluse; however, it was more likely that this behavior has not been well studied in other species. To provide a comparison, the current laboratory study examined the likelihood of non-Loxosceles spiders to scavenge dead prey. Of 100 non-Loxosceles spiders that were tested (from 11 families, 24 genera, and at least 29 species from a variety of spider hunting guilds), 99 scavenged dead crickets when offered in petri dishes. Some of the spiders were webspinners in which real-world scavenging of dead prey is virtually impossible, yet they scavenge when given the opportunity. Therefore, scavenging is a flexible opportunistic predatory behavior that is spread across a variety of taxa and is not a unique behavior in brown recluses. These findings are discussed in relation to pest management practices.

  9. Kinematics and Kinetics of Squats, Drop Jumps and Imitation Jumps of Ski Jumpers. (United States)

    Pauli, Carole A; Keller, Melanie; Ammann, Fabian; Hübner, Klaus; Lindorfer, Julia; Taylor, William R; Lorenzetti, Silvio


    Squats, drop jumps, and imitation jumps are commonly used training exercises in ski jumping to enhance maximum force, explosive force, and sport-specific skills. The purpose of this study was to evaluate the kinetics and kinematics of training exercises in ski jumping and to find objective parameters in training exercises that most correlate with the competition performance of ski jumpers. To this end, barbell squats, drop jumps, and imitation jumps were measured in a laboratory environment for 10 elite ski jumpers. Force and motion data were captured, and the influence of maximum vertical force, force difference, vertical take-off velocity, knee moments, knee joint power, and a knee valgus/varus index was evaluated and correlated with their season jump performance. The results indicate that, especially for the imitation jumps, a good correlation exists between the vertical take-off velocity and the personal jump performance on the hill (R = 0.718). Importantly, however, the more the athletes tended toward a valgus knee alignment during the measured movements, the worse their performance (R = 0.729 imitation jumps; R = 0.685 squats). Although an evaluation of the athletes' lower limb alignment during competitive jumping on the hill is still required, these preliminary data suggest that performance training should additionally concentrate on improving knee alignment to increase ski jumping performance.

  10. Spider and burnable poison rod combinations

    International Nuclear Information System (INIS)

    Walton, L.A.


    A description is given of an improved design of burnable poison rods and their associated spiders used in the fuel assemblies of pressurized water power reactor cores which allows the rods to be installed and removed more quickly, simply and gently than in previously described systems. (U.K.)

  11. Silk Spinning in Silkworms and Spiders. (United States)

    Andersson, Marlene; Johansson, Jan; Rising, Anna


    Spiders and silkworms spin silks that outcompete the toughness of all natural and manmade fibers. Herein, we compare and contrast the spinning of silk in silkworms and spiders, with the aim of identifying features that are important for fiber formation. Although spiders and silkworms are very distantly related, some features of spinning silk seem to be universal. Both spiders and silkworms produce large silk proteins that are highly repetitive and extremely soluble at high pH, likely due to the globular terminal domains that flank an intermediate repetitive region. The silk proteins are produced and stored at a very high concentration in glands, and then transported along a narrowing tube in which they change conformation in response primarily to a pH gradient generated by carbonic anhydrase and proton pumps, as well as to ions and shear forces. The silk proteins thereby convert from random coil and alpha helical soluble conformations to beta sheet fibers. We suggest that factors that need to be optimized for successful production of artificial silk proteins capable of forming tough fibers include protein solubility, pH sensitivity, and preservation of natively folded proteins throughout the purification and initial spinning processes.

  12. The aerodynamic signature of running spiders.

    Directory of Open Access Journals (Sweden)

    Jérôme Casas

    Full Text Available Many predators display two foraging modes, an ambush strategy and a cruising mode. These foraging strategies have been classically studied in energetic, biomechanical and ecological terms, without considering the role of signals produced by predators and perceived by prey. Wolf spiders are a typical example; they hunt in leaf litter either using an ambush strategy or by moving at high speed, taking over unwary prey. Air flow upstream of running spiders is a source of information for escaping prey, such as crickets and cockroaches. However, air displacement by running arthropods has not been previously examined. Here we show, using digital particle image velocimetry, that running spiders are highly conspicuous aerodynamically, due to substantial air displacement detectable up to several centimetres in front of them. This study explains the bimodal distribution of spider's foraging modes in terms of sensory ecology and is consistent with the escape distances and speeds of cricket prey. These findings may be relevant to the large and diverse array of arthropod prey-predator interactions in leaf litter.

  13. SPiDer: Smart Pill Dispenser


    Moreno Vázquez, Jonatan


    Aquest projecte proposa el sistema SPiDer el qual te l'objectiu d'assistir a la gent gran en el procés de medicar-se evitant els problemes associats amb la baixa adherència existent actualment amb els calendaris farmacològics receptats pels doctors.

  14. Status of the CNESM diagnostic for SPIDER

    International Nuclear Information System (INIS)

    Muraro, A.; Croci, G.; Albani, G.; Cazzaniga, C.; Claps, G.; Cavenago, M.; Grosso, G.; Palma, M. Dalla; Fincato, M.; Murtas, F.; Pasqualotto, R.; Cippo, E. Perelli; Rebai, M.; Tollin, M.; Tardocchi, M.; Gorini, G.


    Highlights: • We have finished the design of the detector box of the CNESM diagnostic for SPIDER. • We have constructed the GEM detector of the CNESM detector for SPIDER. • We have tested the detector under fast neutron irradiation. - Abstract: The ITER neutral beam test facility under construction in Padova will host two experimental devices: SPIDER, a 100 kV negative H/D RF source, and MITICA, a full scale, 1 MeV deuterium beam injector. A detection system called close-contact neutron emission surface mapping (CNESM) is under development with the aim to resolve the horizontal beam intensity profile in MITICA and one of the eight beamlet groups in SPIDER, with a spatial resolution of 1.5 and 2.5 cm respectively. This is achieved by the evaluation of the map of the neutron emission due to interaction of the deuterium beam with the deuterons implanted in the beam dump surface. CNESM uses nGEM detectors, i.e. GEM detectors equipped with a cathode that also serves as neutron–proton converter foil. The diagnostic will be placed right behind the SPIDER and MITICA beam dump, i.e. in an UHV environment, but the nGEM detectors need to operate at atmospheric pressure: in order to maintain the detector at atmospheric pressure, a vacuum sealed box, that will be mounted inside the vacuum, has been designed. The box design was driven by the need to minimize the neutron attenuation and the distance between the beam dump surface and the detector active area. This paper presents the status of the CNESM diagnostic describing the design of the detector, the design of the sealed box and reporting the results obtained with the first full-size prototype under fast neutron irradiation.

  15. Separation and pattern formation in hydraulic jumps

    DEFF Research Database (Denmark)

    Bohr, Tomas; Ellegaard, C.; Hansen, A. Espe


    We present theory and experiments on the circular hydraulic jump in the stationary regime. The theory can handle the situation in which the fluid flows over an edge far away from the jump. In the experiments the external height is controlled, and a series of transitions in the flow structure appe...

  16. Biomechanical analysis of drop and countermovement jumps

    NARCIS (Netherlands)

    Bobbert, M. F.; Mackay, M.T.; Schinkelshoek, D.; Huijing, P. A.; van Ingen Schenau, G. J.

    For 13 subjects the performance of drop jumps from a height of 40 cm (DJ) and of countermovement jumps (CMJ) was analysed and compared. From force plate and cine data biomechanical variables including forces, moments, power output and amount of work done were calculated for hip, knee and ankle

  17. Jump Detection in the Danish Stock Market

    DEFF Research Database (Denmark)

    Høg, Esben


    It is well known in financial economics that stock market return data are often modelled by a diffusion process with some regular drift function. Occasionally, however, sudden changes or jumps occur in the return data. Wavelet scaling methods are used to detect jumps and cusps in stock market...

  18. You Say Jump, I Say How High?

    DEFF Research Database (Denmark)

    Fasterhold, Martin; Pichlmair, Martin; Holmgård, Christoffer

    This paper explores the design of jumping in 2D platform games. Through creating a method for measuring existing games, applying this method to a selection of different platformer games, and analysing the results, the paper arrives at a comprehensive data model for jumping. The model supports the...

  19. Usefulness of the jump-and-reach test in assessment of vertical jump performance. (United States)

    Menzel, Hans-Joachim; Chagas, Mauro H; Szmuchrowski, Leszek A; Araujo, Silvia R; Campos, Carlos E; Giannetti, Marcus R


    The objective was to estimate the reliability and criterion-related validity of the Jump-and-Reach Test for the assessment of squat, countermovement, and drop jump performance of 32 male Brazilian professional volleyball players. Performance of squat, countermovement, and drop jumps with different dropping heights was assessed on the Jump-and-Reach Test and the measurement of flight time, then compared across different jump trials. The very high reliability coefficients of both assessment methods and the lower correlation coefficients between scores on the assessments indicate a very high consistency of each method but only moderate covariation, which means that they measure partly different items. As a consequence, the Jump-and-Reach Test has good ecological validity in situations when reaching height during the flight phase is critical for performance (e.g., basketball and volleyball) but only limited accuracy for the assessment of vertical impulse production with different jump techniques and conditions.

  20. A review on the basketball jump shot. (United States)

    Okazaki, Victor H A; Rodacki, André L F; Satern, Miriam N


    The ability to shoot an effective jump shot in the sport of basketball is critical to a player's success. In an attempt to better understand the aspects related to expert performance, researchers have investigated successful free throws and jump shots of various basketball players and identified movement variables that contribute to their success. The purpose of this study was to complete a systematic review of the scientific literature on the basketball free throw and jump shot for the purpose of revealing the critical components of shooting that coaches, teachers, and players should focus on when teaching, learning, practising, and performing a jump shot. The results of this review are presented in three sections: (a) variables that affect ball trajectory, (b) phases of the jump shot, and (c) additional variables that influence shooting.

  1. Theory of boiling-up jump

    International Nuclear Information System (INIS)

    Labuntsov, D.A.; Avdeev, A.A.


    Concept of boiling-up jump representing a zone of intense volume boiling-up separating overtaking flow of overheated metastable liquid from an area of equilibrium flow located below along the flow is introduced. It is shown that boiling-up jump is a shock wave of rarefaction. It is concluded that entropy increment occurs on the jump. Characteristics of adiabatic shock wave curve of boiling- up in ''pressure-specific volume'' coordinates have been found and its form has been investigated. Stability of boiling-up jump has been analyzed as well. On the basis of approach developed analysis is carried out on the shock adiobatic curve of condensation. Concept of boiling-up jump may be applied to the analysis of boiling-up processes when flowing liquid through packings during emergency pressure drop etc [ru

  2. Kinematics and Kinetics of Squats, Drop Jumps and Imitation Jumps of Ski Jumpers (United States)

    Pauli, Carole A.; Keller, Melanie; Ammann, Fabian; Hübner, Klaus; Lindorfer, Julia; Taylor, William R.


    Abstract Pauli, CA, Keller, M, Ammann, F, Hübner, K, Lindorfer, J, Taylor, WR, and Lorenzetti, S. Kinematics and kinetics of squats, drop jumps and imitation jumps of ski jumpers. J Strength Cond Res 30(3): 643–652, 2016—Squats, drop jumps, and imitation jumps are commonly used training exercises in ski jumping to enhance maximum force, explosive force, and sport-specific skills. The purpose of this study was to evaluate the kinetics and kinematics of training exercises in ski jumping and to find objective parameters in training exercises that most correlate with the competition performance of ski jumpers. To this end, barbell squats, drop jumps, and imitation jumps were measured in a laboratory environment for 10 elite ski jumpers. Force and motion data were captured, and the influence of maximum vertical force, force difference, vertical take-off velocity, knee moments, knee joint power, and a knee valgus/varus index was evaluated and correlated with their season jump performance. The results indicate that, especially for the imitation jumps, a good correlation exists between the vertical take-off velocity and the personal jump performance on the hill (R = 0.718). Importantly, however, the more the athletes tended toward a valgus knee alignment during the measured movements, the worse their performance (R = 0.729 imitation jumps; R = 0.685 squats). Although an evaluation of the athletes' lower limb alignment during competitive jumping on the hill is still required, these preliminary data suggest that performance training should additionally concentrate on improving knee alignment to increase ski jumping performance. PMID:26418370

  3. Mobile Jump Assessment (mJump): A Descriptive and Inferential Study. (United States)

    Mateos-Angulo, Alvaro; Galán-Mercant, Alejandro; Cuesta-Vargas, Antonio


    Vertical jump tests are used in athletics and rehabilitation to measure physical performance in people of different age ranges and fitness. Jumping ability can be analyzed through different variables, and the most commonly used are fly time and jump height. They can be obtained by a variety of measuring devices, but most are limited to laboratory use only. The current generation of smartphones contains inertial sensors that are able to record kinematic variables for human motion analysis, since they are tools for easy access and portability for clinical use. The aim of this study was to describe and analyze the kinematics characteristics using the inertial sensor incorporated in the iPhone 4S, the lower limbs strength through a manual dynamometer, and the jump variables obtained with a contact mat in the squat jump and countermovement jump tests (fly time and jump height) from a cohort of healthy people. A cross sectional study was conducted on a population of healthy young adults. Twenty-seven participants performed three trials (n=81 jumps) of squat jump and countermovement jump tests. Acceleration variables were measured through a smartphone's inertial sensor. Additionally, jump variables from a contact mat and lower limbs dynamometry were collected. In the present study, the kinematic variables derived from acceleration through the inertial sensor of a smartphone iPhone 4S, dynamometry of lower limbs with a handheld dynamometer, and the height and flight time with a contact mat have been described in vertical jump tests from a cohort of young healthy subjects. The development of the execution has been described, examined and identified in a squat jump test and countermovement jump test under acceleration variables that were obtained with the smartphone. The built-in iPhone 4S inertial sensor is able to measure acceleration variables while performing vertical jump tests for the squat jump and countermovement jump in healthy young adults. The acceleration

  4. A novel neurotoxin from venom of the spider, Brachypelma albopilosum.

    Directory of Open Access Journals (Sweden)

    Yunhua Zhong

    Full Text Available Spiders have evolved highly selective toxins for insects. There are many insecticidal neurotoxins in spider venoms. Although a large amount of work has been done to focus on neurotoxicity of spider components, little information, which is related with effects of spider toxins on tumor cell proliferation and cytotoxicity, is available for Brachypelma albopilosum venom. In this work, a novel spider neurotoxin (brachyin was identified and characterized from venoms of the spider, Brachypelma albopilosum. Brachyin is composed of 41 amino acid residues with the sequence of CLGENVPCDKDRPNCCSRYECLEPTGYGWWYASYYCYKKRS. There are six cysteines in this sequence, which form three disulfided bridges. The serine residue at the C-terminus is amidated. Brachyin showed strong lethal effects on American cockroaches (Periplaneta americana and Tenebrio molitor (common mealbeetle. This neurotoxin also showed significant analgesic effects in mice models including abdominal writhing induced by acetic acid and formalin-induced paw licking tests. It was interesting that brachyin exerted marked inhibition on tumor cell proliferation.

  5. Attention and amygdala activity: an fMRI study with spider pictures in spider phobia. (United States)

    Alpers, Georg W; Gerdes, Antje B M; Lagarie, Bernadette; Tabbert, Katharina; Vaitl, Dieter; Stark, Rudolf


    Facilitated detection of threatening visual cues is thought to be adaptive. In theory, detection of threat cues should activate the amygdala independently from allocation of attention. However, previous studies using emotional facial expressions as well as phobic cues yielded contradictory results. We used fMRI to examine whether the allocation of attention to components of superimposed spider and bird displays modulates amygdala activation. Nineteen spider-phobic women were instructed to identify either a moving or a stationary animal in briefly presented double-exposure displays. Amygdala activation followed a dose-response relationship: Compared to congruent neutral displays (two birds), amygdala activation was most pronounced in response to congruent phobic displays (two spiders) and less but still significant in response to mixed displays (spider and bird) when attention was focused on the phobic component. When attention was focused on the neutral component, mixed displays did not result in significant amygdala activation. This was confirmed in a significant parametric graduation of the amygdala activation in the order of congruent phobic displays, mixed displays with attention focus on the spider, mixed displays with focus on the bird and congruent neutral displays. These results challenge the notion that amygdala activation in response to briefly presented phobic cues is independent from attention.

  6. What you fear will appear: detection of schematic spiders in spider fear. (United States)

    Peira, Nathalie; Golkar, Armita; Larsson, Maria; Wiens, Stefan


    Various experimental tasks suggest that fear guides attention. However, because these tasks often lack ecological validity, it is unclear to what extent results from these tasks can be generalized to real-life situations. In change detection tasks, a brief interruption of the visual input (i.e., a blank interval or a scene cut) often results in undetected changes in the scene. This setup resembles real-life viewing behavior and is used here to increase ecological validity of the attentional task without compromising control over the stimuli presented. Spider-fearful and nonfearful women detected schematic spiders and flowers that were added to one of two identical background pictures that alternated with a brief blank in between them (i.e., flicker paradigm). Results showed that spider-fearful women detected spiders (but not flowers) faster than did nonfearful women. Because spiders and flowers had similar low-level features, these findings suggest that fear guides attention on the basis of object features rather than simple low-level features.

  7. Learning to avoid spiders: fear predicts performance, not competence. (United States)

    Luo, Xijia; Becker, Eni S; Rinck, Mike


    We used an immersive virtual environment to examine avoidance learning in spider-fearful participants. In 3 experiments, participants were asked to repeatedly lift one of 3 virtual boxes, under which either a toy car or a spider appeared and then approached the participant. Participants were not told that the probability of encountering a spider differed across boxes. When the difference was large (Exps. 1 and 2), spider-fearfuls learned to avoid spiders by lifting the few-spiders-box more often and the many-spiders-box less often than non-fearful controls did. However, they hardly managed to do so when the probability differences were small (Exp. 3), and they did not escape from threat more quickly (Exp. 2). In contrast to the observed performance differences, spider-fearfuls and non-fearfuls showed equal competence, that is comparable post-experimental knowledge about the probability to encounter spiders under the 3 boxes. The limitations and implications of the present study are discussed.

  8. Sex-specific kleptoparasitic foraging in ant-eating spiders

    DEFF Research Database (Denmark)

    Martisová, Martina; Bilde, T.; Pekar, Stano


    . To investigate this hypothesis, we studied the effect of sex and life history stage on the frequency of kleptoparasitism in ant-eating spiders of the genus Zodarion in the field. These spiders use a special capture technique involving a quick attack on an ant that is left unguarded by spiders for several minutes......, providing ample opportunities for kleptoparasitism. We found that adult females consistently hunted actively, while adult males ceased active prey capture and instead engaged in kleptoparasitism. Juvenile spiders were active hunters irrespective of sex. Consistent with an ontogenetic shift in foraging...

  9. Second-order nonlinear optical microscopy of spider silk (United States)

    Zhao, Yue; Hien, Khuat Thi Thu; Mizutani, Goro; Rutt, Harvey N.


    Asymmetric β-sheet protein structures in spider silk should induce nonlinear optical interaction such as second harmonic generation (SHG) which is experimentally observed for a radial line and dragline spider silk using an imaging femtosecond laser SHG microscope. By comparing different spider silks, we found that the SHG signal correlates with the existence of the protein β-sheets. Measurements of the polarization dependence of SHG from the dragline indicated that the β-sheet has a nonlinear response depending on the direction of the incident electric field. We propose a model of what orientation the β-sheet takes in spider silk.

  10. Active signal conduction through the sensory dendrite of a spider mechanoreceptor neuron. (United States)

    Gingl, Ewald; French, Andrew S


    Rapid responses to sensory stimulation are crucial for survival. This must be especially true for mechanical stimuli containing temporal information, such as vibration. Sensory transduction occurs at the tips of relatively long sensory dendrites in many mechanoreceptors of both vertebrates and invertebrates, but little is known about the electrical properties of these crucial links between transduction and action potential generation. The VS-3 slit-sense organ of the spider Cupiennius salei contains bipolar mechanosensory neurons that allow voltage-clamp recording from the somata, whereas mechanotransduction occurs at the tips of 100- to 200-microm-long sensory dendrites. We studied the properties of VS-3 sensory dendrites using three approaches. Voltage-jump experiments measured the spread of voltage outward from the soma by observing total mechanically transduced charge recovered at the soma as a function of time after a voltage jump. Frequency-response measurements between pseudorandom mechanical stimulation and somatic membrane potential estimated the passive cable properties of the dendrite for voltage spread in the opposite direction. Both of these sets of data indicated that the dendritic cable would significantly attenuate and retard a passively propagated receptor potential. Finally, current-clamp observations of receptor potentials and action potentials indicated that action potentials normally start at the distal dendrites and propagate regeneratively to the soma, reducing the temporal delay of passive conduction.

  11. Realized Jump Risk and Equity Return in China

    Directory of Open Access Journals (Sweden)

    Guojin Chen


    Full Text Available We utilize the realized jump components to explore a new jump (including nonsystematic jump and systematic jump risk factor model. After estimating daily realized jumps from high-frequency transaction data of the Chinese A-share stocks, we calculate monthly jump size, monthly jump standard deviation, and monthly jump arrival rate and then use those monthly jump factors to explain the return of the following month. Our empirical results show that the jump tail risk can explain the equity return. For the large capital-size stocks, large cap stock portfolios, and index, one-month lagged jump risk factor significantly explains the asset return variation. Our results remain the same even when we add the size and value factors in the robustness tests.

  12. The effect of assisted jumping on vertical jump height in high-performance volleyball players. (United States)

    Sheppard, Jeremy M; Dingley, Andrew A; Janssen, Ina; Spratford, Wayne; Chapman, Dale W; Newton, Robert U


    Assisted jumping may be useful in training higher concentric movement speed in jumping, thereby potentially increasing the jumping abilities of athletes. The purpose of this study was to evaluate the effects of assisted jump training on counter-movement vertical jump (CMVJ) and spike jump (SPJ) ability in a group of elite male volleyball players. Seven junior national team volleyball players (18.0±1.0 yrs, 200.4±6.7 cm, and 84.0±7.2 kg) participated in this within-subjects cross-over counter-balanced training study. Assisted training involved 3 sessions per week of CMVJ training with 10 kg of assistance, applied through use of a bungee system, whilst normal jump training involved equated volume of unassisted counter-movement vertical jumps. Training periods were 5 weeks duration, with a 3-week wash-out separating them. Prior to and at the conclusion of each training period jump testing for CMVJ and SPJ height was conducted. Assisted jump training resulted in gains of 2.7±0.7 cm (pSports Medicine Australia. All rights reserved.

  13. Strength Determinants of Jump Height in the Jump Throw Movement in Women Handball Players. (United States)

    McGhie, David; Østerås, Sindre; Ettema, Gertjan; Paulsen, Gøran; Sandbakk, Øyvind


    McGhie, D, Østerås, S, Ettema, G, Paulsen, G, and Sandbakk, Ø. Strength determinants of jump height in the jump throw movement in women handball players. J Strength Cond Res XX(X): 000-000, 2018-The purpose of the study was to improve the understanding of the strength demands of a handball-specific jump through examining the associations between jump height in a jump throw jump (JTJ) and measures of lower-body maximum strength and impulse in handball players. For comparison, whether the associations between jump height and strength differed between the JTJ and the customarily used countermovement jump (CMJ) was also examined. Twenty women handball players from a Norwegian top division club participated in the study. Jump height was measured in the JTJ and in unilateral and bilateral CMJ. Lower-body strength (maximum isometric force, one-repetition maximum [1RM], impulse at ∼60% and ∼35% 1RM) was measured in seated leg press. The associations between jump height and strength were assessed with correlation analyses and t-tests of dependent r's were performed to determine if correlations differed between jump tests. Only impulse at ∼35% 1RM correlated significantly with JTJ height (p jump height and strength were significantly weaker in the JTJ than in both CMJ tests for all strength measures (p = 0.001-0.044) except one. Maximum strength and impulse at ∼60% 1RM did not seem to sufficiently capture the capabilities associated with JTJ height, highlighting the importance of employing tests targeting performance-relevant neuromuscular characteristics when assessing jump-related strength in handball players. Further, CMJ height seemed to represent a wider range of strength capabilities and care should be taken when using it as a proxy for handball-specific movements.

  14. Recent advances in the understanding of brown spider venoms: From the biology of spiders to the molecular mechanisms of toxins. (United States)

    Gremski, Luiza Helena; Trevisan-Silva, Dilza; Ferrer, Valéria Pereira; Matsubara, Fernando Hitomi; Meissner, Gabriel Otto; Wille, Ana Carolina Martins; Vuitika, Larissa; Dias-Lopes, Camila; Ullah, Anwar; de Moraes, Fábio Rogério; Chávez-Olórtegui, Carlos; Barbaro, Katia Cristina; Murakami, Mario Tyago; Arni, Raghuvir Krishnaswamy; Senff-Ribeiro, Andrea; Chaim, Olga Meiri; Veiga, Silvio Sanches


    The Loxosceles genus spiders (the brown spiders) are encountered in all the continents, and the clinical manifestations following spider bites include skin necrosis with gravitational lesion spreading and occasional systemic manifestations, such as intravascular hemolysis, thrombocytopenia and acute renal failure. Brown spider venoms are complex mixtures of toxins especially enriched in three molecular families: the phospholipases D, astacin-like metalloproteases and Inhibitor Cystine Knot (ICK) peptides. Other toxins with low level of expression also present in the venom include the serine proteases, serine protease inhibitors, hyaluronidases, allergen factors and translationally controlled tumor protein (TCTP). The mechanisms by which the Loxosceles venoms act and exert their noxious effects are not fully understood. Except for the brown spider venom phospholipase D, which causes dermonecrosis, hemolysis, thrombocytopenia and renal failure, the pathological activities of the other venom toxins remain unclear. The objective of the present review is to provide insights into the brown spider venoms and loxoscelism based on recent results. These insights include the biology of brown spiders, the clinical features of loxoscelism and the diagnosis and therapy of brown spider bites. Regarding the brown spider venom, this review includes a description of the novel toxins revealed by molecular biology and proteomics techniques, the data regarding three-dimensional toxin structures, and the mechanism of action of these molecules. Finally, the biotechnological applications of the venom components, especially for those toxins reported as recombinant molecules, and the challenges for future study are discussed. Copyright © 2014 Elsevier Ltd. All rights reserved.

  15. The AGS γt-jump system

    International Nuclear Information System (INIS)

    Syphers, M.J.; Ahrens, L.; van Asselt, W.; Brennan, J.M.


    In an attempt to generate a lossless crossing of an accelerator's transition energy, one procedure is to alter the transition energy of the accelerator quickly as the beam passes through this energy region by changing the optics of the lattice -- a so-called ''transition jump,'' or '' γt -jump'' scheme. Such a system was first implemented at CERN and later adopted at other accelerator laboratories. A scheme for the AGS was developed in 1986. A description of the AGS γt -jump system, and recent results from its commissioning are presented in this report

  16. Predicting vertical jump height from bar velocity. (United States)

    García-Ramos, Amador; Štirn, Igor; Padial, Paulino; Argüelles-Cienfuegos, Javier; De la Fuente, Blanca; Strojnik, Vojko; Feriche, Belén


    The objective of the study was to assess the use of maximum (Vmax) and final propulsive phase (FPV) bar velocity to predict jump height in the weighted jump squat. FPV was defined as the velocity reached just before bar acceleration was lower than gravity (-9.81 m·s(-2)). Vertical jump height was calculated from the take-off velocity (Vtake-off) provided by a force platform. Thirty swimmers belonging to the National Slovenian swimming team performed a jump squat incremental loading test, lifting 25%, 50%, 75% and 100% of body weight in a Smith machine. Jump performance was simultaneously monitored using an AMTI portable force platform and a linear velocity transducer attached to the barbell. Simple linear regression was used to estimate jump height from the Vmax and FPV recorded by the linear velocity transducer. Vmax (y = 16.577x - 16.384) was able to explain 93% of jump height variance with a standard error of the estimate of 1.47 cm. FPV (y = 12.828x - 6.504) was able to explain 91% of jump height variance with a standard error of the estimate of 1.66 cm. Despite that both variables resulted to be good predictors, heteroscedasticity in the differences between FPV and Vtake-off was observed (r(2) = 0.307), while the differences between Vmax and Vtake-off were homogenously distributed (r(2) = 0.071). These results suggest that Vmax is a valid tool for estimating vertical jump height in a loaded jump squat test performed in a Smith machine. Key pointsVertical jump height in the loaded jump squat can be estimated with acceptable precision from the maximum bar velocity recorded by a linear velocity transducer.The relationship between the point at which bar acceleration is less than -9.81 m·s(-2) and the real take-off is affected by the velocity of movement.Mean propulsive velocity recorded by a linear velocity transducer does not appear to be optimal to monitor ballistic exercise performance.

  17. Araneae Sloveniae: a national spider species checklist. (United States)

    Kostanjšek, Rok; Kuntner, Matjaž


    The research of the spider fauna of Slovenia dates back to the very beginning of binomial nomenclature, and has gone through more and less prolific phases with authors concentrating on taxonomy, faunistics, ecology and zoogeographic reviews. Although the body of published works is remarkable for a small nation, the faunistic data has remained too scattered for a thorough understanding of regional biotic diversity, for comparative and ecological research, and for informed conservation purposes. A national checklist is long overdue. Here, a critical review of all published records in any language is provided. The species list currently comprises 738 species, is published online at under the title Araneae Sloveniae, and will be updated in due course. This tool will fill the void in cataloguing regional spider faunas and will facilitate further araneological research in central and southern Europe.

  18. Logic circuits based on molecular spider systems. (United States)

    Mo, Dandan; Lakin, Matthew R; Stefanovic, Darko


    Spatial locality brings the advantages of computation speed-up and sequence reuse to molecular computing. In particular, molecular walkers that undergo localized reactions are of interest for implementing logic computations at the nanoscale. We use molecular spider walkers to implement logic circuits. We develop an extended multi-spider model with a dynamic environment wherein signal transmission is triggered via localized reactions, and use this model to implement three basic gates (AND, OR, NOT) and a cascading mechanism. We develop an algorithm to automatically generate the layout of the circuit. We use a kinetic Monte Carlo algorithm to simulate circuit computations, and we analyze circuit complexity: our design scales linearly with formula size and has a logarithmic time complexity. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.

  19. Araneae Sloveniae: a national spider species checklist

    Directory of Open Access Journals (Sweden)

    Rok Kostanjšek


    Full Text Available The research of the spider fauna of Slovenia dates back to the very beginning of binomial nomenclature, and has gone through more and less prolific phases with authors concentrating on taxonomy, faunistics, ecology and zoogeographic reviews. Although the body of published works is remarkable for a small nation, the faunistic data has remained too scattered for a thorough understanding of regional biotic diversity, for comparative and ecological research, and for informed conservation purposes. A national checklist is long overdue. Here, a critical review of all published records in any language is provided. The species list currently comprises 738 species, is published online at under the title Araneae Sloveniae, and will be updated in due course. This tool will fill the void in cataloguing regional spider faunas and will facilitate further araneological research in central and southern Europe.

  20. Measurements of K shell absorption jump factors and jump ratios using EDXRF technique (United States)

    Kacal, Mustafa Recep; Han, İbrahim; Akman, Ferdi


    In the present work, the K-shell absorption jump factors and jump ratios for 30 elements between Ti ( Z = 22) and Er ( Z = 68) were measured by energy dispersive X-ray fluorescence (EDXRF) technique. The jump factors and jump ratios for these elements were determined by measuring the K shell fluorescence parameters such as the Kα X-ray production cross-sections, K shell fluorescence yields, Kβ-to- Kα X-rays intensity ratios, total atomic absorption cross sections and mass attenuation coefficients. The measurements were performed using an Am-241 radioactive point source and a Si (Li) detector in direct excitation and transmission experimental geometry. The results for jump factors and jump ratios were compared with theoretically calculated and the ones available in the literature.

  1. The Effects of Aquatic Plyometric Training on Repeated Jumps, Drop Jumps and Muscle Damage. (United States)

    Jurado-Lavanant, A; Alvero-Cruz, J R; Pareja-Blanco, F; Melero-Romero, C; Rodríguez-Rosell, D; Fernandez-Garcia, J C


    The purpose of this study was to compare the effects of land- vs. aquatic based plyometric training programs on the drop jump, repeated jump performance and muscle damage. Sixty-five male students were randomly assigned to one of 3 groups: aquatic plyometric training group (APT), plyometric training group (PT) and control group (CG). Both experimental groups trained twice a week for 10 weeks performing the same number of sets and total jumps. The following variables were measured prior to, halfway through and after the training programs: creatine kinase (CK) concentration, maximal height during a drop jump from the height of 30 (DJ30) and 50 cm (DJ50), and mean height during a repeated vertical jump test (RJ). The training program resulted in a significant increase (Pplyometric training, PT produced greater gains on reactive jumps performance than APT. © Georg Thieme Verlag KG Stuttgart · New York.

  2. Nanofibre production in spiders without electric charge. (United States)

    Joel, Anna-Christin; Baumgartner, Werner


    Technical nanofibre production is linked to high voltage, because nanofibres are typically produced by electrospinning. In contrast, spiders have evolved a way to produce nanofibres without high voltage. These spiders are called cribellate spiders and produce nanofibres within their capture thread production. It is suggested that their nanofibres become frictionally charged when brushed over a continuous area on the calamistrum, a comb-like structure at the metatarsus of the fourth leg. Although there are indications that electrostatic charges are involved in the formation of the thread structure, final proof is missing. We proposed three requirements to validate this hypothesis: (1) the removal of any charge during or after thread production has an influence on the structure of the thread; (2) the characteristic structure of the thread can be regenerated by charging; and (3) the thread is attracted to or repelled from differently charged objects. None of these three requirements were proven true. Furthermore, mathematical calculations reveal that even at low charges, the calculated structural assembly of the thread does not match the observed reality. Electrostatic forces are therefore not involved in the production of cribellate capture threads. © 2017. Published by The Company of Biologists Ltd.

  3. Progress on development of SPIDER diagnostics (United States)

    Pasqualotto, R.; Agostini, M.; Barbisan, M.; Bernardi, M.; Brombin, M.; Cavazzana, R.; Croci, G.; Palma, M. Dalla; Delogu, R. S.; Gorini, G.; Lotto, L.; Muraro, A.; Peruzzo, S.; Pimazzoni, A.; Pomaro, N.; Rizzolo, A.; Serianni, G.; Spolaore, M.; Tardocchi, M.; Zaniol, B.; Zaupa, M.


    SPIDER experiment, the full size prototype of the beam source for the ITER heating neutral beam injector, has to demonstrate extraction and acceleration to 100 kV of a large negative ion hydrogen or deuterium beam with co-extracted electron fraction e-/D- SPIDER plant systems are being installed, the different diagnostic systems are in the procurement phase. Their final design is described here with a focus on some key solutions and most original and cost effective implementations. Thermocouples used to measure the power load distribution in the source and over the beam dump front surface will be efficiently fixed with proven technique and acquired through commercial and custom electronics. Spectroscopy needs to use well collimated lines of sight and will employ novel design spectrometers with higher efficiency and resolution and filtered detectors with custom built amplifiers. The electrostatic probes will be operated through electronics specifically developed to cope with the challenging environment of the RF source. The instrumented calorimeter STRIKE will use new CFC tiles, still under development. Two linear cameras, one built in house, have been tested as suitable for optical beam tomography. Some diagnostic components are off the shelf, others are custom developed: some of these are being prototyped or are under test before final production and installation, which will be completed before start of SPIDER operation.

  4. Option Panels in Pure-Jump Settings

    DEFF Research Database (Denmark)

    Andersen, Torben Gustav; Fusari, Nicola; Todorov, Viktor

    We develop parametric inference procedures for large panels of noisy option data in the setting where the underlying process is of pure-jump type, i.e., evolve only through a sequence of jumps. The panel consists of options written on the underlying asset with a (different) set of strikes...... specification for the risk-neutral asset return dynamics, the option prices are nonlinear functions of a time-invariant parameter vector and a time-varying latent state vector (or factors). Furthermore, no-arbitrage restrictions impose a direct link between some of the quantities that may be identified from...... the return and option data. These include the so-called jump activity index as well as the time-varying jump intensity. We propose penalized least squares estimation in which we minimize L_2 distance between observed and model-implied options and further penalize for the deviation of model-implied quantities...

  5. Microscopic models of quantum-jump superoperators

    International Nuclear Information System (INIS)

    Dodonov, A.V.; Mizrahi, S.S.; Dodonov, V.V.


    We discuss the quantum-jump operation in an open system and show that jump superoperators related to a system under measurement can be derived from the interaction of that system with a quantum measurement apparatus. We give two examples for the interaction of a monochromatic electromagnetic field in a cavity (the system) with two-level atoms and with a harmonic oscillator (representing two different kinds of detectors). We show that the derived quantum-jump superoperators have a 'nonlinear' form Jρ=γ diag[F(n)aρa † F(n)], where the concrete form of the function F(n) depends on assumptions made about the interaction between the system and detector. Under certain conditions the asymptotical power-law dependence F(n)=(n+1) -β is obtained. A continuous transition to the standard Srinivas-Davies form of the quantum-jump superoperator (corresponding to β=0) is shown

  6. Human Long Jump — A Deductive Approach

    Directory of Open Access Journals (Sweden)

    Miloš Jovanović


    Full Text Available This paper presents a useful application of a generalized approach to the modelling of human and humanoid motion using the deductive approach. It starts with formulating a completely general problem and deriving different real situations as special cases. The concept and the software realization are verified by comparing the results with the ones obtained using “classical” software for one well-known particular problem – biped walking. New applicability and potentials of the proposed method are demonstrated by simulation of a selected example – the long jump. The simulated motion included jumping and landing on the feet (after a jump. Additional analysis is done in the paper regarding the joint torque and joint angle during the jumping. Separate stages of the simulation are defined and explained.

  7. Volatility jumps and their economic determinants

    DEFF Research Database (Denmark)

    Caporin, Massimiliano; Rossi, Eduardo; Santucci de Magistris, Paolo

    that there is a positive probability of jumps in volatility. A common factor in the volatility jumps is shown to be related to a set of financial covariates (such as variance risk premium, S&P500 volume, credit-default swap, and federal fund rates). The credit-default swap on US banks and variance risk premium have...... predictive power on expected jump moves, thus confirming the common interpretation that sudden and large increases in equity volatility can be anticipated by credit deterioration of the US bank sector as well as changes in the market expectations of future risks. Finally, the model is extended to incorporate...... the credit-default swap and the variance risk premium in the dynamics of the jump size and intensity....

  8. A simple strategy for jumping straight up. (United States)

    Hemami, Hooshang; Wyman, Bostwick F


    Jumping from a stationary standing position into the air is a transition from a constrained motion in contact with the ground to an unconstrained system not in contact with the ground. A simple case of the jump, as it applies to humans, robots and humanoids, is studied in this paper. The dynamics of the constrained rigid body are expanded to define a larger system that accommodates the jump. The formulation is applied to a four-link, three-dimensional system in order to articulate the ballistic motion involved. The activity of the muscular system and the role of the major sagittal muscle groups are demonstrated. The control strategy, involving state feedback and central feed forward signals, is formulated and computer simulations are presented to assess the feasibility of the formulations, the strategy and the jump. Copyright © 2012 Elsevier Inc. All rights reserved.

  9. How quick is a quantum jump?

    International Nuclear Information System (INIS)

    Schulman, L.S.


    Although the only time scale one ordinarily associates with a quantum transition is its lifetime, observations of ''quantum jumps'' in recent years show that the actual transition time is much shorter. I define a ''jump time'' as the time scale such that perturbations occurring at intervals of this duration affect the decay. In terms of the ''Zeno time'' (related to the second moment of the Hamiltonian) the jump time is τ J is identical to τ 2 Z /τ L . Corroboration is given. I also show that observing the ''jumping'' will not seriously affect the system lifetime, but will affect the linewidth. This is consistent with Bohr's ideas on measurement as well as with a heuristic time-energy uncertainty principle. (author)

  10. A Correction Equation for Jump Height Measured Using the Just Jump System. (United States)

    McMahon, John J; Jones, Paul A; Comfort, Paul


    To determine the concurrent validity and reliability of the popular Just Jump system (JJS) for determining jump height and, if necessary, provide a correction equation for future reference. Eighteen male college athletes performed 3 bilateral countermovement jumps (CMJs) on 2 JJSs (alternative method) that were placed on top of a force platform (criterion method). Two JJSs were used to establish consistency between systems. Jump height was calculated from flight time obtained from the JJS and force platform. Intraclass correlation coefficients (ICCs) demonstrated excellent within-session reliability of the CMJ height measurement derived from both the JJS (ICC = .96, P jump height (0.46 ± 0.09 m vs 0.33 ± 0.08 m) than the force platform (P jump height = (0.8747 × alternative jump height) - 0.0666. The JJS provides a reliable but overestimated measure of jump height. It is suggested, therefore, that practitioners who use the JJS as part of future work apply the correction equation presented in this study to resultant jump-height values.

  11. Jump Horse Safety: Reconciling Public Debate and Australian Thoroughbred Jump Racing Data, 2012–2014

    Directory of Open Access Journals (Sweden)

    Karen Ruse


    Full Text Available Thoroughbred jump racing sits in the spotlight of contemporary welfare and ethical debates about horse racing. In Australia, jump racing comprises hurdle and steeplechase races and has ceased in all but two states, Victoria and South Australia. This paper documents the size, geography, composition, and dynamics of Australian jump racing for the 2012, 2013, and 2014 seasons with a focus on debate about risks to horses. We found that the majority of Australian jump racing is regional, based in Victoria, and involves a small group of experienced trainers and jockeys. Australian jump horses are on average 6.4 years of age. The jump career of the majority of horses involves participating in three or less hurdle races and over one season. Almost one quarter of Australian jump horses race only once. There were ten horse fatalities in races over the study period, with an overall fatality rate of 5.1 fatalities per 1000 horses starting in a jump race (0.51%. There was significant disparity between the fatality rate for hurdles, 0.75 fatalities per 1000 starts (0.075% and steeplechases, 14 fatalities per 1000 starts (1.4%. Safety initiatives introduced by regulators in 2010 appear to have significantly decreased risks to horses in hurdles but have had little or no effect in steeplechases. Our discussion considers these Animals 2015, 5 1073 data in light of public controversy, political debate, and industry regulation related to jump horse safety.

  12. Jump Horse Safety: Reconciling Public Debate and Australian Thoroughbred Jump Racing Data, 2012-2014. (United States)

    Ruse, Karen; Davison, Aidan; Bridle, Kerry


    Thoroughbred jump racing sits in the spotlight of contemporary welfare and ethical debates about horse racing. In Australia, jump racing comprises hurdle and steeplechase races and has ceased in all but two states, Victoria and South Australia. This paper documents the size, geography, composition, and dynamics of Australian jump racing for the 2012, 2013, and 2014 seasons with a focus on debate about risks to horses. We found that the majority of Australian jump racing is regional, based in Victoria, and involves a small group of experienced trainers and jockeys. Australian jump horses are on average 6.4 years of age. The jump career of the majority of horses involves participating in three or less hurdle races and over one season. Almost one quarter of Australian jump horses race only once. There were ten horse fatalities in races over the study period, with an overall fatality rate of 5.1 fatalities per 1000 horses starting in a jump race (0.51%). There was significant disparity between the fatality rate for hurdles, 0.75 fatalities per 1000 starts (0.075%) and steeplechases, 14 fatalities per 1000 starts (1.4%). Safety initiatives introduced by regulators in 2010 appear to have significantly decreased risks to horses in hurdles but have had little or no effect in steeplechases. Our discussion considers these Animals 2015, 5 1073 data in light of public controversy, political debate, and industry regulation related to jump horse safety.

  13. Jump spillover between oil prices and exchange rates (United States)

    Li, Xiao-Ping; Zhou, Chun-Yang; Wu, Chong-Feng


    In this paper, we investigate the jump spillover effects between oil prices and exchange rates. To identify the latent historical jumps for exchange rates and oil prices, we use a Bayesian MCMC approach to estimate the stochastic volatility model with correlated jumps in both returns and volatilities for each. We examine the simultaneous jump intensities and the conditional jump spillover probabilities between oil prices and exchange rates, finding strong evidence of jump spillover effects. Further analysis shows that the jump spillovers are mainly due to exogenous events such as financial crises and geopolitical events. Thus, the findings have important implications for financial risk management.

  14. A multiplicity jump trigger using silicon planes

    International Nuclear Information System (INIS)

    Alexopoulos, T.; Erwin, A.R.


    Since silicon tracking planes are already present in a B decay experiment, it is an attractive idea to use these as part of a multiplicity jump detector. Two average B decays would produce a multiplicity jump of around 10 in the final state. Such a trigger has been tried for a fixed target Charm experiment with disappointing success. The failure was attributed to the difficulty in adequately controlling the gains of a large number of microstrip amplifies

  15. Portfolio Selection with Jumps under Regime Switching

    Directory of Open Access Journals (Sweden)

    Lin Zhao


    Full Text Available We investigate a continuous-time version of the mean-variance portfolio selection model with jumps under regime switching. The portfolio selection is proposed and analyzed for a market consisting of one bank account and multiple stocks. The random regime switching is assumed to be independent of the underlying Brownian motion and jump processes. A Markov chain modulated diffusion formulation is employed to model the problem.

  16. Jumps in binomial AR(1) processes


    Weiß , Christian H.


    Abstract We consider the binomial AR(1) model for serially dependent processes of binomial counts. After a review of its definition and known properties, we investigate marginal and serial properties of jumps in such processes. Based on these results, we propose the jumps control chart for monitoring a binomial AR(1) process. We show how to evaluate the performance of this control chart and give design recommendations. correspondance: Tel.: +49 931 31 84968; ...

  17. Structure–Activity Relationship Study of Spider Polyamine Toxins as Inhibitors of Ionotropic Glutamate Receptors

    DEFF Research Database (Denmark)

    Xiong, Xiaofeng; Poulsen, Mette H; Hussein, Rama A


    The spider polyamine toxins Joro spider toxin-3 (JSTX-3) and Nephila polyamine toxins-1 and -8 (NPTX-1 and NPTX-8) are isolated from the venom of the orb-weaver spider Nephila clavata (Joro spider). They share a high degree of structural resemblance, their aromatic head groups being the only...

  18. Who is afraid of a black Spider(-Man)?


    Ora C. McWilliams


    An Internet post asking about Spider-Man's race in a film turned into an Internet campaign about an actor that led fans to interact with each other as well as with the actor, which in turn led to the attention of media producers, which resulted in a change in Spider-Man's race in a print comic book.

  19. Who is afraid of a black Spider(-Man?

    Directory of Open Access Journals (Sweden)

    Ora C. McWilliams


    Full Text Available An Internet post asking about Spider-Man's race in a film turned into an Internet campaign about an actor that led fans to interact with each other as well as with the actor, which in turn led to the attention of media producers, which resulted in a change in Spider-Man's race in a print comic book.

  20. Spider diversity in relation to habitat heterogeneity and an altitudinal ...

    African Journals Online (AJOL)

    Using pitfall traps, wandering spiders (Arachnida: Araneae) were sampled in a nested design from three different localities in the mountainous arid ecosystem of South Sinai at low, middle, and high altitudes. Habitat type and altitude were clearly different among the three localities. Spider diversity per trap varied spatially ...

  1. Time-dependent motor properties of multipedal molecular spiders. (United States)

    Samii, Laleh; Blab, Gerhard A; Bromley, Elizabeth H C; Linke, Heiner; Curmi, Paul M G; Zuckermann, Martin J; Forde, Nancy R


    Molecular spiders are synthetic biomolecular walkers that use the asymmetry resulting from cleavage of their tracks to bias the direction of their stepping motion. Using Monte Carlo simulations that implement the Gillespie algorithm, we investigate the dependence of the biased motion of molecular spiders, along with binding time and processivity, on tunable experimental parameters, such as number of legs, span between the legs, and unbinding rate of a leg from a substrate site. We find that an increase in the number of legs increases the spiders' processivity and binding time but not their mean velocity. However, we can increase the mean velocity of spiders with simultaneous tuning of the span and the unbinding rate of a spider leg from a substrate site. To study the efficiency of molecular spiders, we introduce a time-dependent expression for the thermodynamic efficiency of a molecular motor, allowing us to account for the behavior of spider populations as a function of time. Based on this definition, we find that spiders exhibit transient motor function over time scales of many hours and have a maximum efficiency on the order of 1%, weak compared to other types of molecular motors.

  2. Evidence for competition between carnivorous plants and spiders. (United States)

    Jennings, David E; Krupa, James J; Raffel, Thomas R; Rohr, Jason R


    Several studies have demonstrated that competition between disparate taxa can be important in determining community structure, yet surprisingly, to our knowledge, no quantitative studies have been conducted on competition between carnivorous plants and animals. To examine potential competition between these taxa, we studied dietary and microhabitat overlap between pink sundews (Drosera capillaris) and wolf spiders (Lycosidae) in the field, and conducted a laboratory experiment examining the effects of wolf spiders on sundew fitness. In the field, we found that sundews and spiders had a high dietary overlap with each other and with the available arthropod prey. Associations between sundews and spiders depended on spatial scale: both sundews and spiders were found more frequently in quadrats with more abundant prey, but within quadrats, spiders constructed larger webs and located them further away from sundews as the total sundew trapping area increased, presumably to reduce competition. Spiders also constructed larger webs when fewer prey were available. In the laboratory, our experiment revealed that spiders can significantly reduce sundew fitness. Our findings suggest that members of the plant and animal kingdoms can and do compete.

  3. Are temperate canopy spiders tree-species specific? (United States)

    Mupepele, Anne-Christine; Müller, Tobias; Dittrich, Marcus; Floren, Andreas


    Arboreal spiders in deciduous and coniferous trees were investigated on their distribution and diversity. Insecticidal knock-down was used to comprehensively sample spiders from 175 trees from 2001 to 2003 in the Białowieża forest and three remote forests in Poland. We identified 140 species from 9273 adult spiders. Spider communities were distinguished between deciduous and coniferous trees. The richest fauna was collected from Quercus where beta diversity was also highest. A tree-species-specific pattern was clearly observed for Alnus, Carpinus, Picea and Pinus trees and also for those tree species that were fogged in only four or three replicates, namely Betula and Populus. This hitherto unrecognised association was mainly due to the community composition of common species identified in a Dufrene-Legendre indicator species analysis. It was not caused by spatial or temporal autocorrelation. Explaining tree-species specificity for generalist predators like spiders is difficult and has to involve physical and ecological tree parameters like linkage with the abundance of prey species. However, neither did we find a consistent correlation of prey group abundances with spiders nor could differences in spider guild composition explain the observed pattern. Our results hint towards the importance of deterministic mechanisms structuring communities of generalist canopy spiders although the casual relationship is not yet understood.

  4. Camel spider (Solifugae) use of prairie dog colonies (United States)

    Solifugids (camel spiders) are widespread throughout arid regions of western North America and are thought to be important in structuring desert arthropod communities. Despite the ubiquity of camel spiders, little is known about their ecology. Black-tailed prairie dogs (Cynomys ludovicianus) are als...

  5. Brain systems underlying encounter expectancy bias in spider phobia. (United States)

    Aue, Tatjana; Hoeppli, Marie-Eve; Piguet, Camille; Hofstetter, Christoph; Rieger, Sebastian W; Vuilleumier, Patrik


    Spider-phobic individuals are characterized by exaggerated expectancies to be faced with spiders (so-called encounter expectancy bias). Whereas phobic responses have been linked to brain systems mediating fear, little is known about how the recruitment of these systems relates to exaggerated expectancies of threat. We used fMRI to examine spider-phobic and control participants while they imagined visiting different locations in a forest after having received background information about the likelihood of encountering different animals (spiders, snakes, and birds) at these locations. Critically, imagined encounter expectancies modulated brain responses differently in phobics as compared with controls. Phobics displayed stronger negative modulation of activity in the lateral prefrontal cortex, precuneus, and visual cortex by encounter expectancies for spiders, relative to snakes or birds (within-participants analysis); these effects were not seen in controls. Between-participants correlation analyses within the phobic group further corroborated the hypothesis that these phobia-specific modulations may underlie irrationality in encounter expectancies (deviations of encounter expectancies from objective background information) in spider phobia; the greater the negative modulation a phobic participant displayed in the lateral prefrontal cortex, precuneus, and visual cortex, the stronger was her bias in encounter expectancies for spiders. Interestingly, irrationality in expectancies reflected in frontal areas relied on right rather than left hemispheric deactivations. Our data accord with the idea that expectancy biases in spider phobia may reflect deficiencies in cognitive control and contextual integration that are mediated by right frontal and parietal areas.

  6. Spider mite control and resistance management: does a genome help?

    NARCIS (Netherlands)

    Van Leeuwen, T.; Dermauw, W.; Grbic, M.; Tirry, L.; Feyereisen, R.


    The complete genome of the two-spotted spider mite, Tetranychus urticae, has been reported. This is the first sequenced genome of a highly polyphagous and resistant agricultural pest. The question as to what the genome offers the community working on spider mite control is addressed.

  7. Three newly recorded Linyphiid spiders (Araneae: Linyphiidae from Korea

    Directory of Open Access Journals (Sweden)

    Sue Yeon Lee


    Full Text Available Three Linyphiid spiders, Caviphantes pseudosaxetorum Wunderlich, 1979, Erigone edentata Saito and Ono, 2001, and Savignia kawachiensis Oi, 1960, are reported for the first time from Korea with taxonomic illustrations and redescription. In this study, the genus Caviphantes Oi, 1960 is also newly recorded to Korean spider fauna.

  8. Tests for nonrandomness in quantum jumps

    International Nuclear Information System (INIS)

    Berkeland, D.J.; Raymondson, D.A.; Tassin, V.M.


    In a fundamental test of quantum mechanics, we have observed 228 000 quantum jumps of a single trapped and laser cooled 88 Sr + ion. This represents a statistical increase of two orders of magnitude over previous similar analyses of quantum jumps. Compared to other searches for nonrandomness in quantum-mechanical processes, using quantum jumps simplifies the interpretation of data by eliminated multiparticle effects and providing near-unit detection efficiency of transitions. We measure the fractional reduction in the entropy of information to be -4 when the value of any interval between quantum jumps is known. We also find that the number of runs of successively increasing or decreasing interval times agrees with the theoretically expected values. Furthermore, we analyze 238 000 quantum jumps from two simultaneously confined ions and find that the number of apparently coincidental transitions is as expected. Finally, we observe 8400 spontaneous decays of two simultaneously trapped ions and find that the number of apparently coincidental decays from the metastable state agrees with the expected value. We find no evidence for short- or long-term correlations in the intervals of the quantum jumps or in the decay of the quantum states, in agreement with quantum theory

  9. Hydrodynamics of vertical jumping in Archer fish (United States)

    Techet, Alexandra H.; Mendelson, Leah


    Vertical jumping for aerial prey from an aquatic environment requires both propulsive power and precise aim to succeed. Rapid acceleration to a ballistic velocity sufficient for reaching the prey height occurs before the fish leaves the water completely and experiences a thousandfold drop in force-producing ability. In addition to speed, accuracy and stability are crucial for successful feeding by jumping. This talk examines the physics of jumping using the archer fish as a model. Better known for their spitting abilities, archer fish will jump multiple body lengths out of the water for prey capture, from a stationary position just below the free surface. Modulation of oscillatory body kinematics and use of multiple fins for force production are identified as methods through which the fish can meet requirements for both acceleration and stabilization in limited space. Quantitative 3D PIV wake measurements reveal how variations in tail kinematics relate to thrust production throughout the course of a jumping maneuver and over a range of jump heights. By performing measurements in 3D, the timing, interactions, and relative contributions to thrust and lateral forces from each fin can be evaluated, elucidating the complex hydrodynamics that enable archer fish water exit.

  10. Performance analysis of jump-gliding locomotion for miniature robotics. (United States)

    Vidyasagar, A; Zufferey, Jean-Christohphe; Floreano, Dario; Kovač, M


    Recent work suggests that jumping locomotion in combination with a gliding phase can be used as an effective mobility principle in robotics. Compared to pure jumping without a gliding phase, the potential benefits of hybrid jump-gliding locomotion includes the ability to extend the distance travelled and reduce the potentially damaging impact forces upon landing. This publication evaluates the performance of jump-gliding locomotion and provides models for the analysis of the relevant dynamics of flight. It also defines a jump-gliding envelope that encompasses the range that can be achieved with jump-gliding robots and that can be used to evaluate the performance and improvement potential of jump-gliding robots. We present first a planar dynamic model and then a simplified closed form model, which allow for quantification of the distance travelled and the impact energy on landing. In order to validate the prediction of these models, we validate the model with experiments using a novel jump-gliding robot, named the 'EPFL jump-glider'. It has a mass of 16.5 g and is able to perform jumps from elevated positions, perform steered gliding flight, land safely and traverse on the ground by repetitive jumping. The experiments indicate that the developed jump-gliding model fits very well with the measured flight data using the EPFL jump-glider, confirming the benefits of jump-gliding locomotion to mobile robotics. The jump-glide envelope considerations indicate that the EPFL jump-glider, when traversing from a 2 m height, reaches 74.3% of optimal jump-gliding distance compared to pure jumping without a gliding phase which only reaches 33.4% of the optimal jump-gliding distance. Methods of further improving flight performance based on the models and inspiration from biological systems are presented providing mechanical design pathways to future jump-gliding robot designs.

  11. SPIDER: CMB Polarimetry from the Edge of Space

    Energy Technology Data Exchange (ETDEWEB)

    Gualtieri, R.; et al.


    SPIDER is a balloon-borne instrument designed to map the polarization of the millimeter-wave sky at large angular scales. SPIDER targets the B-mode signature of primordial gravitational waves in the cosmic microwave background (CMB), with a focus on mapping a large sky area with high fidelity at multiple frequencies. SPIDER's first longduration balloon (LDB) flight in January 2015 deployed a total of 2400 antenna-coupled Transition Edge Sensors (TESs) at 90 GHz and 150 GHz. In this work we review the design and in-flight performance of the SPIDER instrument, with a particular focus on the measured performance of the detectors and instrument in a space-like loading and radiation environment. SPIDER's second flight in December 2018 will incorporate payload upgrades and new receivers to map the sky at 285 GHz, providing valuable information for cleaning polarized dust emission from CMB maps.

  12. Nutrient regulation in a predator, the wolf spider Pardosa prativaga

    DEFF Research Database (Denmark)

    Jensen, Kim; Mayntz, David; Toft, Søren


    Nutrient balancing is well known in herbivores and omnivores, but has only recently been demonstrated in predators. To test how a predator might regulate nutrients when the prey varies in nutrient composition, we restricted juvenile Pardosa prativaga wolf spiders to diets of one of six fruit fly......, Drosophila melanogaster, prey types varying in lipid:protein composition during their second instar. We collected all fly remnants to estimate food and nutrient intake over each meal. The spiders adjusted their capture rate and nutrient extraction in response to prey mass and nutrient composition...... irrespective of energy intake. Intake was initially regulated to a constant lipid plus protein mass, but later spiders fed on prey with high proportions of protein increased consumption relative to spiders fed on other prey types. This pattern indicates that the spiders were prepared to overconsume vast...

  13. Spiders of Kerala Agricultural University Campus, Thrissur, Kerala, India

    Directory of Open Access Journals (Sweden)

    C. K. Adarsh


    Full Text Available A total of 86 species of spiders belonging to 56 genera of 20 families have been recorded from the Kerala Agricultural University (KAU campus, Thrissur, Kerala, southern India.  This represents 5.1% of the total spiders’ species and 33.33% of the total families of spiders recorded in India.  The dominant spider family at KAU campus is Araneidae with 18 species of nine genera. Salticidae is represented by 14 species of 13 genera.  Out of 252 endemic spiders of India, 16 have been reported from KAU campus.  Guild structure analysis shows spiders belonging to seven types of feeding guilds present in KAU campus.  Orb-web builders are the dominant feeding guild accounting for 34%, followed by stalkers (22%, ground runners (20%, ambushers (8%, scattered line weavers (8%, foliage runners (7% and sheet-web builders (1%. 

  14. Jump Horse Safety: Reconciling Public Debate and Australian Thoroughbred Jump Racing Data, 2012–2014 (United States)

    Ruse, Karen; Davison, Aidan; Bridle, Kerry


    Simple Summary This paper documents the dynamics of Australian thoroughbred jump racing in the 2012, 2013, and 2014 seasons with the aim of informing debate about risks to horses and the future of this activity. We conclude that the safety of Australian jump racing has improved in recent years but that steeplechases are considerably riskier for horses than hurdle races. Abstract Thoroughbred jump racing sits in the spotlight of contemporary welfare and ethical debates about horse racing. In Australia, jump racing comprises hurdle and steeplechase races and has ceased in all but two states, Victoria and South Australia. This paper documents the size, geography, composition, and dynamics of Australian jump racing for the 2012, 2013, and 2014 seasons with a focus on debate about risks to horses. We found that the majority of Australian jump racing is regional, based in Victoria, and involves a small group of experienced trainers and jockeys. Australian jump horses are on average 6.4 years of age. The jump career of the majority of horses involves participating in three or less hurdle races and over one season. Almost one quarter of Australian jump horses race only once. There were ten horse fatalities in races over the study period, with an overall fatality rate of 5.1 fatalities per 1000 horses starting in a jump race (0.51%). There was significant disparity between the fatality rate for hurdles, 0.75 fatalities per 1000 starts (0.075%) and steeplechases, 14 fatalities per 1000 starts (1.4%). Safety initiatives introduced by regulators in 2010 appear to have significantly decreased risks to horses in hurdles but have had little or no effect in steeplechases. Our discussion considers these data in light of public controversy, political debate, and industry regulation related to jump horse safety. PMID:26506396

  15. Specific predictive power of automatic spider-related affective associations for controllable and uncontrollable fear responses toward spiders

    NARCIS (Netherlands)

    Huijdlng, J; de Jong, PJ; Huijding, J.

    This study examined the predictive power of automatically activated spider-related affective associations for automatic and controllable fear responses. The Extrinsic Affective Simon Task (EAST; De Houwer, 2003) was used to indirectly assess automatic spider fear-related associations. The EAST and

  16. And along Came a Spider: An Attentional Bias for the Detection of Spiders in Young Children and Adults (United States)

    LoBue, Vanessa


    Spiders are among the most common targets of fears and phobias in the world. In visual search tasks, adults detect their presence more rapidly than other kinds of stimuli. Reported here is an investigation of whether young children share this attentional bias for the detection of spiders. In a series of experiments, preschoolers and adults were…

  17. Jumping to conclusions in schizophrenia

    Directory of Open Access Journals (Sweden)

    Evans SL


    Full Text Available Simon L Evans,1 Bruno B Averbeck,2 Nicholas Furl31School of Psychology, University of Sussex, Brighton, East Sussex, UK; 2Laboratory of Neuropsychology, National Institute of Mental Health, National Institutes of Health, Bethesda, MD, USA; 3Department of Psychology, Royal Holloway, University of London, Egham, Surrey, UKAbstract: Schizophrenia is a mental disorder associated with a variety of symptoms, including hallucinations, delusions, social withdrawal, and cognitive dysfunction. Impairments on decision-making tasks are routinely reported: evidence points to a particular deficit in learning from and revising behavior following feedback. In addition, patients tend to make hasty decisions when probabilistic judgments are required. This is known as “jumping to conclusions” (JTC and has typically been demonstrated by presenting participants with colored beads drawn from one of two “urns” until they claim to be sure which urn the beads are being drawn from (the proportions of colors vary in each urn. Patients tend to make early decisions on this task, and there is evidence to suggest that a hasty decision-making style might be linked to delusion formation and thus be of clinical relevance. Various accounts have been proposed regarding what underlies this behavior. In this review, we briefly introduce the disorder and the decision-making deficits associated with it. We then explore the evidence for each account of JTC in the context of a wider decision-making deficit and then go on to summarize work exploring JTC in healthy controls using pharmacological manipulations and functional imaging. Finally, we assess whether JTC might have a role in therapy.Keywords: ketamine, decision making, delusions, fMRI, urn task

  18. The reliability of vertical jump tests between the Vertec and My Jump phone application. (United States)

    Yingling, Vanessa R; Castro, Dimitri A; Duong, Justin T; Malpartida, Fiorella J; Usher, Justin R; O, Jenny


    The vertical jump is used to estimate sports performance capabilities and physical fitness in children, elderly, non-athletic and injured individuals. Different jump techniques and measurement tools are available to assess vertical jump height and peak power; however, their use is limited by access to laboratory settings, excessive cost and/or time constraints thus making these tools oftentimes unsuitable for field assessment. A popular field test uses the Vertec and the Sargent vertical jump with countermovement; however, new low cost, easy to use tools are becoming available, including the My Jump iOS mobile application (app). The purpose of this study was to assess the reliability of the My Jump relative to values obtained by the Vertec for the Sargent stand and reach vertical jump (VJ) test. One hundred and thirty-five healthy participants aged 18-39 years (94 males, 41 females) completed three maximal Sargent VJ with countermovement that were simultaneously measured using the Vertec and the My Jump . Jump heights were quantified for each jump and peak power was calculated using the Sayers equation. Four separate ICC estimates and their 95% confidence intervals were used to assess reliability. Two analyses (with jump height and calculated peak power as the dependent variables, respectively) were based on a single rater, consistency, two-way mixed-effects model, while two others (with jump height and calculated peak power as the dependent variables, respectively) were based on a single rater, absolute agreement, two-way mixed-effects model. Moderate to excellent reliability relative to the degree of consistency between the Vertec and My Jump values was found for jump height (ICC = 0.813; 95% CI [0.747-0.863]) and calculated peak power (ICC = 0.926; 95% CI [0.897-0.947]). However, poor to good reliability relative to absolute agreement for VJ height (ICC = 0.665; 95% CI [0.050-0.859]) and poor to excellent reliability relative to absolute agreement for peak power

  19. Solubilization of spider silk proteins and its structural analysis using Fourier transform infrared spectroscopy (United States)

    Osbin, K.; Jayan, Manuel; Bhadrakumari, S.; Predeep, P.


    This study investigates the presence of various amide bands present in different spider silk species, which provides extraordinary physical properties. Three different spider silks were collected from Western Ghats region. The collected spider silks samples belonging to the spider Heteropoda venatoria (species 1), Hersilia savignyi (species 2) and Pholcus phalangioides (species 3). Fourier transform infrared (FTIR) spectra reveals the protein peaks in the amide I, II, and III regions in all the three types of spider silk species.

  20. Jump locations of jump-diffusion processes with state-dependent rates

    International Nuclear Information System (INIS)

    Miles, Christopher E; Keener, James P


    We propose a general framework for studying statistics of jump-diffusion systems driven by both Brownian noise (diffusion) and a jump process with state-dependent intensity. Of particular natural interest in many physical systems are the jump locations: the system evaluated at the jump times. As an example, this could be the voltage at which a neuron fires, or the so-called ‘threshold voltage’. However, the state-dependence of the jump rate provides direct coupling between the diffusion and jump components, making it difficult to disentangle the two to study individually. In this work, we provide an iterative map formulation of the sequence of distributions of jump locations. The distributions computed by this map can be used to elucidate other interesting quantities about the process, including statistics of the interjump times. Ultimately, the limit of the map reveals that knowledge of the stationary distribution of the full process is sufficient to recover (but not necessarily equal to) the distribution of jump locations. We propose two biophysical examples to illustrate the use of this framework to provide insight about a system. We find that a sharp threshold voltage emerges robustly in a simple stochastic integrate-and-fire neuronal model. The interplay between the two sources of noise is also investigated in a stepping model of molecular motor in intracellular transport pulling a diffusive cargo. (paper)

  1. Experimental study of the hydraulic jump in a hydraulic jump in a ...

    African Journals Online (AJOL)

    The hydraulic jump in a sloped rectangular channel is theoretically and experimentally examined. The study aims to determine the effect of the channel's slope on the sequent depth ratio of the jump. A theoretical relation is proposed for the inflow Froude number as function of the sequent depth ratio and the channel slope.

  2. Drop jumping. II. The influence of dropping height on the biomechanics of drop jumping

    NARCIS (Netherlands)

    Bobbert, M F; Huijing, P A; van Ingen Schenau, G J

    In the literature, athletes preparing for explosive activities are recommended to include drop jumping in their training programs. For the execution of drop jumps, different techniques and different dropping heights can be used. This study was designed to investigate for the performance of bounce

  3. Increase in Jumping Height Associated with Maximal Effort Vertical Depth Jumps. (United States)

    Bedi, John F.; And Others


    In order to assess if there existed a statistically significant increase in jumping performance when dropping from different heights, 32 males, aged 19 to 26, performed a series of maximal effort vertical jumps after dropping from eight heights onto a force plate. Results are analyzed. (Author/MT)

  4. The effect of wind on jumping distance in ski jumping--fairness assessed. (United States)

    Virmavirta, Mikko; Kivekäs, Juha


    The special wind compensation system recently adopted by Fédération Internationale de Ski (FIS; International Ski Federation) to consider the effects of changing wind conditions has caused some controversy. Here, the effect of wind on jumping distance in ski jumping was studied by means of computer simulation and compared with the wind compensation factors used by FIS during the World Cup season 2009/2010. The results showed clearly that the effect of increasing head/tail wind on jumping distance is not linear: +17.4 m/-29.1 m, respectively, for a wind speed of 3 m/s. The linear formula used in the trial period of the wind compensation system was found to be appropriate only for a limited range of jumping distances as the gradient of the landing slope slows down the rate of distance change in long jumps.

  5. Filtering and control of stochastic jump hybrid systems

    CERN Document Server

    Yao, Xiuming; Zheng, Wei Xing


    This book presents recent research work on stochastic jump hybrid systems. Specifically, the considered stochastic jump hybrid systems include Markovian jump Ito stochastic systems, Markovian jump linear-parameter-varying (LPV) systems, Markovian jump singular systems, Markovian jump two-dimensional (2-D) systems, and Markovian jump repeated scalar nonlinear systems. Some sufficient conditions are first established respectively for the stability and performances of those kinds of stochastic jump hybrid systems in terms of solution of linear matrix inequalities (LMIs). Based on the derived analysis conditions, the filtering and control problems are addressed. The book presents up-to-date research developments and novel methodologies on stochastic jump hybrid systems. The contents can be divided into two parts: the first part is focused on robust filter design problem, while the second part is put the emphasis on robust control problem. These methodologies provide a framework for stability and performance analy...

  6. The Transmission Line for the SPIDER experiment

    International Nuclear Information System (INIS)

    Boldrin, Marco; De Lorenzi, Antonio; Recchia, Mauro; Toigo, Vanni; Bonicelli, Tullio; Simon, Muriel


    The 100 keV Ion Source Test facility - Source for the Production of Ions of Deuterium Extracted from RF plasma (SPIDER) - is aimed to test the full scale prototype of the Ion Source for the ITER 1 MeV Neutral Beam Injector (NBI). The SPIDER facility requires the construction of a High Voltage Deck (HVD) and of a High Voltage Transmission Line (TL) respectively to host the Ion Source Power Supplies system polarized at 100 kV and to carry the power and signal conductors to the beam accelerator. In already existing NBI systems with beam energy above 100 keV, the TL is realized with the SF 6 Gas Insulated Line technology. In the SPIDER TL case, the presence of a large inner conductor (half meter diameter), would make the pressurized TL a complex and costly component; therefore a free air insulated solution has been proposed. The paper focuses on the design of this TL, which has to host inside the complex high potential (100 kV) inner electrode a number of power and measuring conductors and has to minimize the Electro Magnetic Interferences (EMI) produced by the frequent grids breakdowns. Finite Element (FE) analyses have been performed to verify the configuration from the electrostatic point of view, to evaluate EMI screening effectiveness and to assess the impact of the relatively high thermal dissipation of power conductors located inside the high potential electrode. Moreover, an experimental test campaign has been carried out on a TL mockup to validate the TL electrostatic configuration under DC voltage. Finally, the paper reports on the status of procurement activities for the Transmission Line.

  7. Determinants of the abilities to jump higher and shorten the contact time in a running 1-legged vertical jump in basketball. (United States)

    Miura, Ken; Yamamoto, Masayoshi; Tamaki, Hiroyuki; Zushi, Koji


    This study was conducted to obtain useful information for developing training techniques for the running 1-legged vertical jump in basketball (lay-up shot jump). The ability to perform the lay-up shot jump and various basic jumps was measured by testing 19 male basketball players. The basic jumps consisted of the 1-legged repeated rebound jump, the 2-legged repeated rebound jump, and the countermovement jump. Jumping height, contact time, and jumping index (jumping height/contact time) were measured and calculated using a contact mat/computer system that recorded the contact and air times. The jumping index indicates power. No significant correlation existed between the jumping height and contact time of the lay-up shot jump, the 2 components of the lay-up shot jump index. As a result, jumping height and contact time were found to be mutually independent abilities. The relationships in contact time between the lay-up shot jump to the 1-legged repeated rebound jump and the 2-legged repeated rebound jump were correlated on the same significance levels (p jumping height existed between the 1-legged repeated rebound jump and the lay-up shot jump (p jumping height between the lay-up shot jump and both the 2-legged repeated rebound jump and countermovement jump. The lay-up shot index correlated more strongly to the 1-legged repeated rebound jump index (p jump index (p jump is effective in improving both contact time and jumping height in the lay-up shot jump.

  8. Brown spider dermonecrotic toxin directly induces nephrotoxicity

    International Nuclear Information System (INIS)

    Chaim, Olga Meiri; Sade, Youssef Bacila; Bertoni da Silveira, Rafael; Toma, Leny; Kalapothakis, Evanguedes; Chavez-Olortegui, Carlos; Mangili, Oldemir Carlos; Gremski, Waldemiro; Dietrich, Carl Peter von; Nader, Helena B.; Sanches Veiga, Silvio


    Brown spider (Loxosceles genus) venom can induce dermonecrotic lesions at the bite site and systemic manifestations including fever, vomiting, convulsions, disseminated intravascular coagulation, hemolytic anemia and acute renal failure. The venom is composed of a mixture of proteins with several molecules biochemically and biologically well characterized. The mechanism by which the venom induces renal damage is unknown. By using mice exposed to Loxosceles intermedia recombinant dermonecrotic toxin (LiRecDT), we showed direct induction of renal injuries. Microscopic analysis of renal biopsies from dermonecrotic toxin-treated mice showed histological alterations including glomerular edema and tubular necrosis. Hyalinization of tubules with deposition of proteinaceous material in the tubule lumen, tubule epithelial cell vacuoles, tubular edema and epithelial cell lysis was also observed. Leukocytic infiltration was neither observed in the glomerulus nor the tubules. Renal vessels showed no sign of inflammatory response. Additionally, biochemical analyses showed such toxin-induced changes in renal function as urine alkalinization, hematuria and azotemia with elevation of blood urea nitrogen levels. Immunofluorescence with dermonecrotic toxin antibodies and confocal microscopy analysis showed deposition and direct binding of this toxin to renal intrinsic structures. By immunoblotting with a hyperimmune dermonecrotic toxin antiserum on renal lysates from toxin-treated mice, we detected a positive signal at the region of 33-35 kDa, which strengthens the idea that renal failure is directly induced by dermonecrotic toxin. Immunofluorescence reaction with dermonecrotic toxin antibodies revealed deposition and binding of this toxin directly in MDCK epithelial cells in culture. Similarly, dermonecrotic toxin treatment caused morphological alterations of MDCK cells including cytoplasmic vacuoles, blebs, evoked impaired spreading and detached cells from each other and from

  9. Temperature jump boundary conditions in radiation diffusion

    International Nuclear Information System (INIS)

    Alonso, C.T.


    The radiation diffusion approximation greatly simplifies radiation transport problems. Yet the application of this method has often been unnecessarily restricted to optically thick regions, or has been extended through the use of such ad hoc devices as flux limiters. The purpose of this paper is to review and draw attention to the use of the more physically appropriate temperature jump boundary conditions for extending the range of validity of the diffusion approximation. Pioneering work has shown that temperature jump boundary conditions remove the singularity in flux that occurs in ordinary diffusion at small optical thicknesses. In this review paper Deissler's equations for frequency-dependent jump boundary conditions are presented and specific geometric examples are calculated analytically for steady state radiation transfer. When jump boundary conditions are applied to radiation diffusion, they yield exact solutions which are naturally flux- limited and geometry-corrected. We believe that the presence of temperature jumps on source boundaries is probably responsible in some cases for the past need for imposing ad hoc flux-limiting constraints on pure diffusion solutions. The solution for transfer between plane slabs, which is exact to all orders of optical thickness, also provides a useful tool for studying the accuracy of computer codes

  10. Scaling the viscous circular hydraulic jump (United States)

    Argentina, Mederic; Cerda, Enrique; Duchesne, Alexis; Limat, Laurent


    The formation mechanism of hydraulic jumps has been proposed by Belanger in 1828 and rationalised by Lord Rayleigh in 1914. As the Froude number becomes higher than one, the flow super criticality induces an instability which yields the emergence of a steep structure at the fluid surface. Strongly deformed liquid-air interface can be observed as a jet of viscous fluid impinges a flat boundary at high enough velocity. In this experimental setup, the location of the jump depends on the viscosity of the liquid, as shown by T. Bohr et al. in 1997. In 2014, A. Duchesne et al. have established the constancy of the Froude number at jump. Hence, it remains a contradiction, in which the radial hydraulic jump location might be explained through inviscid theory, but is also viscosity dependent. We present a model based on the 2011 Rojas et al. PRL, which solves this paradox. The agreement with experimental measurements is excellent not only for the prediction of the position of the hydraulic jump, but also for the determination of the fluid thickness profile. We predict theoretically the critical value of the Froude number, which matches perfectly to that measured by Duchesne et al. We acknowledge the support of the CNRS and the Universit Cte d'Azur, through the IDEX funding.

  11. A locust-inspired miniature jumping robot. (United States)

    Zaitsev, Valentin; Gvirsman, Omer; Ben Hanan, Uri; Weiss, Avi; Ayali, Amir; Kosa, Gabor


    Unmanned ground vehicles are mostly wheeled, tracked, or legged. These locomotion mechanisms have a limited ability to traverse rough terrain and obstacles that are higher than the robot's center of mass. In order to improve the mobility of small robots it is necessary to expand the variety of their motion gaits. Jumping is one of nature's solutions to the challenge of mobility in difficult terrain. The desert locust is the model for the presented bio-inspired design of a jumping mechanism for a small mobile robot. The basic mechanism is similar to that of the semilunar process in the hind legs of the locust, and is based on the cocking of a torsional spring by wrapping a tendon-like wire around the shaft of a miniature motor. In this study we present the jumping mechanism design, and the manufacturing and performance analysis of two demonstrator prototypes. The most advanced jumping robot demonstrator is power autonomous, weighs 23 gr, and is capable of jumping to a height of 3.35 m, covering a distance of 1.37 m.

  12. Biomechanics of stair walking and jumping. (United States)

    Loy, D J; Voloshin, A S


    Physical activities such as stair walking and jumping result in increased dynamic loading on the human musculoskeletal system. Use of light weight, externally attached accelerometers allows for in-vivo monitoring of the shock waves invading the human musculoskeletal system during those activities. Shock waves were measured in four subjects performing stair walking up and down, jumping in place and jumping off a fixed elevation. The results obtained show that walking down a staircase induced shock waves with amplitude of 130% of that observed in walking up stairs and 250% of the shock waves experienced in level gait. The jumping test revealed levels of the shock waves nearly eight times higher than that in level walking. It was also shown that the shock waves invading the human musculoskeletal system may be generated not only by the heel strike, but also by the metatarsal strike. To moderate the risk of degenerative joint disorders four types of viscoelastic insoles were utilized to reduce the impact generated shock waves. The insoles investigated were able to reduce the amplitude of the shock wave by between 9% and 41% depending on the insole type and particular physical activity. The insoles were more effective in the reduction of the heel strike impacts than in the reduction of the metatarsal strike impacts. In all instances, the shock attenuation capacities of the insoles tested were greater in the jumping trials than in the stair walking studies. The insoles were ranked in three groups on the basis of their shock absorbing capacity.

  13. Assassin bug uses aggressive mimicry to lure spider prey. (United States)

    Wignall, Anne E; Taylor, Phillip W


    Assassin bugs (Stenolemus bituberus) hunt web-building spiders by invading the web and plucking the silk to generate vibrations that lure the resident spider into striking range. To test whether vibrations generated by bugs aggressively mimic the vibrations generated by insect prey, we compared the responses of spiders to bugs with how they responded to prey, courting male spiders and leaves falling into the web. We also analysed the associated vibrations. Similar spider orientation and approach behaviours were observed in response to vibrations from bugs and prey, whereas different behaviours were observed in response to vibrations from male spiders and leaves. Peak frequency and duration of vibrations generated by bugs were similar to those generated by prey and courting males. Further, vibrations from bugs had a temporal structure and amplitude that were similar to vibrations generated by leg and body movements of prey and distinctly different to vibrations from courting males or leaves, or prey beating their wings. To be an effective predator, bugs do not need to mimic the full range of prey vibrations. Instead bugs are general mimics of a subset of prey vibrations that fall within the range of vibrations classified by spiders as 'prey'.

  14. Cuticular antifungals in spiders: density- and condition dependence.

    Directory of Open Access Journals (Sweden)

    Daniel González-Tokman

    Full Text Available Animals living in groups face a high risk of disease contagion. In many arthropod species, cuticular antimicrobials constitute the first protective barrier that prevents infections. Here we report that group-living spiders produce cuticular chemicals which inhibit fungal growth. Given that cuticular antifungals may be costly to produce, we explored whether they can be modulated according to the risk of contagion (i.e. under high densities. For this purpose, we quantified cuticular antifungal activity in the subsocial crab spider Diaea ergandros in both natural nests and experimentally manipulated nests of varying density. We quantified the body-condition of spiders to test whether antifungal activity is condition dependent, as well as the effect of spider density on body-condition. We predicted cuticular antifungal activity to increase and body-condition to decrease with high spider densities, and that antifungal activity would be inversely related to body-condition. Contrary to our predictions, antifungal activity was neither density- nor condition-dependent. However, body-condition decreased with density in natural nests, but increased in experimental nests. We suggest that pathogen pressure is so important in nature that it maintains high levels of cuticular antifungal activity in spiders, impacting negatively on individual energetic condition. Future studies should identify the chemical structure of the isolated antifungal compounds in order to understand the physiological basis of a trade-off between disease prevention and energetic condition caused by group living, and its consequences in the evolution of sociality in spiders.

  15. Silk elasticity as a potential constraint on spider body size. (United States)

    Rodríguez-Gironés, Miguel A; Corcobado, Guadalupe; Moya-Laraño, Jordi


    Silk is known for its strength and extensibility and has played a key role in the radiation of spiders. Individual spiders use different glands to produce silk types with unique sets of proteins. Most research has studied the properties of major ampullate and capture spiral silks and their ecological implications, while little is known about minor ampullate silk, the type used by those spider species studied to date for bridging displacements. A biomechanical model parameterised with available data shows that the minimum radius of silk filaments required for efficient bridging grows with the square root of the spider's body mass, faster than the radius of minor ampullate silk filaments actually produced by spiders. Because the morphology of spiders adapted to walking along or under silk threads is ill suited for moving on a solid surface, for these species there is a negative relationship between body mass and displacement ability. As it stands, the model suggests that spiders that use silk for their displacements are prevented from attaining a large body size if they must track their resources in space. In particular, silk elasticity would favour sexual size dimorphism because males that must use bridging lines to search for females cannot grow large. 2010 Elsevier Ltd. All rights reserved.

  16. Cuticular antifungals in spiders: density- and condition dependence. (United States)

    González-Tokman, Daniel; Ruch, Jasmin; Pulpitel, Tamara; Ponton, Fleur


    Animals living in groups face a high risk of disease contagion. In many arthropod species, cuticular antimicrobials constitute the first protective barrier that prevents infections. Here we report that group-living spiders produce cuticular chemicals which inhibit fungal growth. Given that cuticular antifungals may be costly to produce, we explored whether they can be modulated according to the risk of contagion (i.e. under high densities). For this purpose, we quantified cuticular antifungal activity in the subsocial crab spider Diaea ergandros in both natural nests and experimentally manipulated nests of varying density. We quantified the body-condition of spiders to test whether antifungal activity is condition dependent, as well as the effect of spider density on body-condition. We predicted cuticular antifungal activity to increase and body-condition to decrease with high spider densities, and that antifungal activity would be inversely related to body-condition. Contrary to our predictions, antifungal activity was neither density- nor condition-dependent. However, body-condition decreased with density in natural nests, but increased in experimental nests. We suggest that pathogen pressure is so important in nature that it maintains high levels of cuticular antifungal activity in spiders, impacting negatively on individual energetic condition. Future studies should identify the chemical structure of the isolated antifungal compounds in order to understand the physiological basis of a trade-off between disease prevention and energetic condition caused by group living, and its consequences in the evolution of sociality in spiders.

  17. First report of clinical presentation of a bite by a running spider, Philodromus sp. (Araneae: Philodromidae), with recommendations for spider bite management. (United States)

    Coetzee, Maureen; Dippenaar, Ansie; Frean, John; Hunt, Richard H


    This article describes the clinical progression of symptoms over a period of 5 days of a bite inflicted by a Philodromus sp. spider. Commonly known as 'running spiders', these are not considered to be harmful to humans. This report, however, is the first description of an actual bite by a member of this group of spiders showing cytotoxic envenomation. Management of the bites should be as recommended for other cytotoxic spider bites.

  18. The complete mitochondrial genome sequence of the spider habronattus oregonensis reveals rearranged and extremely truncated tRNAs

    International Nuclear Information System (INIS)

    Masta, Susan E.; Boore, Jeffrey L.


    We sequenced the entire mitochondrial genome of the jumping spider Habronattus oregonensis of the arachnid order Araneae (Arthropoda: Chelicerata). A number of unusual features distinguish this genome from other chelicerate and arthropod mitochondrial genomes. Most of the transfer RNA gene sequences are greatly reduced in size and cannot be folded into typical cloverleaf-shaped secondary structures. At least nine of the tRNA sequences lack the potential to form TYC arm stem pairings, and instead are inferred to have TV-replacement loops. Furthermore, sequences that could encode the 3' aminoacyl acceptor stems in at least 10 tRNAs appear to be lacking, because fully paired acceptor stems are not possible and because the downstream sequences instead encode adjacent genes. Hence, these appear to be among the smallest known tRNA genes. We postulate that an RNA editing mechanism must exist to restore the 3' aminoacyl acceptor stems in order to allow the tRNAs to function. At least seven tRN As are rearranged with respect to the chelicerate Limulus polyphemus, although the arrangement of the protein-coding genes is identical. Most mitochondrial protein-coding genes of H. oregonensis have ATN as initiation codons, as commonly found in arthropod mtDNAs, but cytochrome oxidase subunit 2 and 3 genes apparently use UUG as an initiation codon. Finally, many of the gene sequences overlap one another and are truncated. This 14,381 bp genome, the first mitochondrial genome of a spider yet sequenced, is one of the smallest arthropod mitochondrial genomes known. We suggest that post transcriptional RNA editing can likely maintain function of the tRNAs while permitting the accumulation of mutations that would otherwise be deleterious. Such mechanisms may have allowed for the minimization of the spider mitochondrial genome

  19. Serious ski jumping injuries in Norway. (United States)

    Wester, K


    Injuries caused by ski jumping have been poorly investigated. Among approximately 2,200 licensed jumpers in Norway, there occurred at least 12 injuries with a permanent medical disability of greater than or equal to 10%. The risk of being seriously injured is approximately 5% in a 5 year period (1977 to 1981); it is higher in the age group 15 to 17 years. Seven injuries were very serious [four central nervous system (CNS) lesions, two leg amputations, and one blindness of one eye], and five were less serious (sequelae to fractures of the lower extremities). The first jump of the day is particularly dangerous, and so is the beginning and end of the season. It seems dangerous to use more than one standard heel block. Poor preparation of the jump may have contributed to the accidents. Based on the findings, several prophylactic measures are suggested.

  20. Structure-function-property-design interplay in biopolymers: spider silk. (United States)

    Tokareva, Olena; Jacobsen, Matthew; Buehler, Markus; Wong, Joyce; Kaplan, David L


    Spider silks have been a focus of research for almost two decades due to their outstanding mechanical and biophysical properties. Recent advances in genetic engineering have led to the synthesis of recombinant spider silks, thus helping to unravel a fundamental understanding of structure-function-property relationships. The relationships between molecular composition, secondary structures and mechanical properties found in different types of spider silks are described, along with a discussion of artificial spinning of these proteins and their bioapplications, including the role of silks in biomineralization and fabrication of biomaterials with controlled properties. Copyright © 2013 Acta Materialia Inc. Published by Elsevier Ltd. All rights reserved.

  1. Inhibition of the spider heartbeat by gravity and vibration (United States)

    Finck, A.


    The rate and vigor of the spider heartbeat is controlled by an external pacemaker. A mechanical feature of the spider cardio-vascular system is the production of high serum pressure in the prosoma and the legs. This appears to be the source for leg extension. The lyriform organ on the patella of the leg is sensitive to vibratory and kinesthetic stimuli. This sensitivity depends upon the degree of leg extension. Thus the activity of the heart and the response characteristics of the sense receptor are related. The effect of a supra-threshold vibratory or gravitational stimulus is to produce an inhibition and a tachycardia of the spider heartbeat.

  2. Spider silk reinforced by graphene or carbon nanotubes (United States)

    Lepore, Emiliano; Bosia, Federico; Bonaccorso, Francesco; Bruna, Matteo; Taioli, Simone; Garberoglio, Giovanni; Ferrari, Andrea C.; Pugno, Nicola Maria


    Spider silk has promising mechanical properties, since it conjugates high strength (~1.5 GPa) and toughness (~150 J g-1). Here, we report the production of silk incorporating graphene and carbon nanotubes by spider spinning, after feeding spiders with the corresponding aqueous dispersions. We observe an increment of the mechanical properties with respect to pristine silk, up to a fracture strength ~5.4 GPa and a toughness modulus ~1570 J g-1. This approach could be extended to other biological systems and lead to a new class of artificially modified biological, or ‘bionic’, materials.

  3. Colonization of subterranean habitats by spiders in Central Europe

    Directory of Open Access Journals (Sweden)

    Vlastimil Růžička


    Full Text Available Using data from the Czech Republic, we studied the distribution of spiders in soils, crevice systems, scree and caves, i.e. subterranean habitats at depths spanning from 10 cm to 100 m. In total, we found 161 species. The number of species declines with increasing habitat depth, with a major drop in species richness at the depth of 10 meters. Thirteen species exhibit morphological adaptations to life in subterranean habitats. At depths greater than 10 meters, spider assemblages are almost exclusively composed of troglomorphic species. We propose a hypothesis of evolution of troglomorphisms at spiders during Quaternary climatic cycles.

  4. Recent Advancements in Lightning Jump Algorithm Work (United States)

    Schultz, Christopher J.; Petersen, Walter A.; Carey, Lawrence D.


    In the past year, the primary objectives were to show the usefulness of total lightning as compared to traditional cloud-to-ground (CG) networks, test the lightning jump algorithm configurations in other regions of the country, increase the number of thunderstorms within our thunderstorm database, and to pinpoint environments that could prove difficult for any lightning jump configuration. A total of 561 thunderstorms have been examined in the past year (409 non-severe, 152 severe) from four regions of the country (North Alabama, Washington D.C., High Plains of CO/KS, and Oklahoma). Results continue to indicate that the 2 lightning jump algorithm configuration holds the most promise in terms of prospective operational lightning jump algorithms, with a probability of detection (POD) at 81%, a false alarm rate (FAR) of 45%, a critical success index (CSI) of 49% and a Heidke Skill Score (HSS) of 0.66. The second best performing algorithm configuration was the Threshold 4 algorithm, which had a POD of 72%, FAR of 51%, a CSI of 41% and an HSS of 0.58. Because a more complex algorithm configuration shows the most promise in terms of prospective operational lightning jump algorithms, accurate thunderstorm cell tracking work must be undertaken to track lightning trends on an individual thunderstorm basis over time. While these numbers for the 2 configuration are impressive, the algorithm does have its weaknesses. Specifically, low-topped and tropical cyclone thunderstorm environments are present issues for the 2 lightning jump algorithm, because of the suppressed vertical depth impact on overall flash counts (i.e., a relative dearth in lightning). For example, in a sample of 120 thunderstorms from northern Alabama that contained 72 missed events by the 2 algorithm 36% of the misses were associated with these two environments (17 storms).

  5. Validity of a Jump Mat for assessing Countermovement Jump Performance in Elite Rugby Players. (United States)

    Dobbin, Nick; Hunwicks, Richard; Highton, Jamie; Twist, Craig


    This study determined the validity of the Just Jump System ® (JJS) for measuring flight time, jump height and peak power output (PPO) in elite rugby league players. 37 elite rugby league players performed 6 countermovement jumps (CMJ; 3 with and 3 without arms) on a jump mat and force platform. A sub-sample (n=28) was used to cross-validate the equations for flight time, jump height and PPO. The JJS systematically overestimated flight time and jump height compared to the force platform (Pjump height ( with R 2 =0.945; without R 2 =0.987). Our equations revealed no systematic difference between corrected and force platform scores and an improved the agreement for flight time (Ratio limits of agreement: with 1.00 vs. 1.36; without 1.00 vs. 1.16) and jump height ( with 1.01 vs. 1.34; without 1.01 vs. 1.15), meaning that our equations can be used to correct JJS scores for elite rugby players. While our equation improved the estimation of PPO ( with 1.02; without 1.01) compared to existing equations (Harman: 1.20; Sayers: 1.04), this only accounted for 64 and 69% of PPO. © Georg Thieme Verlag KG Stuttgart · New York.

  6. Venomous snake bites, scorpions, and spiders. (United States)

    Kularatne, S A M; Senanayake, Nimal


    Neurologic dysfunction due to natural neurotoxins is an important, but neglected, public health hazard in many parts of the world, particularly in the tropics. These toxins are produced by or found among a variety of live forms that include venomous snakes, arthropods such as scorpions, spiders, centipedes, stinging insects (Hymenoptera), ticks, certain poisonous fish, shellfish, crabs, cone shells, skin secretions of dart-poison frogs, and bacterial poisons such as botulinum toxin. These toxins commonly act on neuromuscular transmission at the neuromuscular junction where acetylcholine is the neurotransmitter, but in certain situations the toxins interfere with neurotransmitters such as GABA, noradrenaline, adrenaline, dopamine, and γ-aminobutyrate. Of the toxins, α-toxins and κ-toxins (e.g., Chinese krait, Bungarus multicinctus) act on the postsynaptic membrane, blocking the receptors, whilst β-toxin (e.g., common krait, B. caeruleus) acts on the presynaptic membrane, causing impairment of acetylcholine release. Conversely, dendrotoxins of the African mamba enhance acetylcholine release. The toxins of scorpions and spiders commonly interfere with voltage-gated ion channels. Clinically, the cardinal manifestation is muscle paralysis. In severe cases respiratory paralysis could be fatal. Effective antivenoms are the mainstay of treatment of envenoming, but their lack of availability is the major concern in the regions of the globe where they are desperately needed. Interestingly, some toxins have proved to be valuable pharmaceutical agents, while some others are widely exploited to study neuromuscular physiology and pathology. © 2014 Elsevier B.V. All rights reserved.

  7. Free amino acids in spider hemolymph. (United States)

    Tillinghast, Edward K; Townley, Mark A


    We examined the free amino acid composition of hemolymph from representatives of five spider families with an interest in knowing if the amino acid profile in the hemolymph of orb-web-building spiders reflects the high demands for small organic compounds in the sticky droplets of their webs. In nearly all analyses, on both orb and non-orb builders, glutamine was the most abundant free amino acid. Glycine, taurine, proline, histidine, and alanine also tended to be well-represented in orb and non-orb builders. While indications of taxon-specific differences in amino acid composition were observed, it was not apparent that two presumptive precursors (glutamine, taurine) of orb web sticky droplet compounds were uniquely enriched in araneids (orb builders). However, total amino acid concentrations were invariably highest in the araneids and especially so in overwintering juveniles, even as several of the essential amino acids declined during this winter diapause. Comparing the data from this study with those from earlier studies revealed a number of discrepancies. The possible origins of these differences are discussed.

  8. Intracellular recording from a spider vibration receptor. (United States)

    Gingl, Ewald; Burger, Anna-M; Barth, Friedrich G


    The present study introduces a new preparation of a spider vibration receptor that allows intracellular recording of responses to natural mechanical or electrical stimulation of the associated mechanoreceptor cells. The spider vibration receptor is a lyriform slit sense organ made up of 21 cuticular slits located on the distal end of the metatarsus of each walking leg. The organ is stimulated when the tarsus receives substrate vibrations, which it transmits to the organ's cuticular structures, reducing the displacement to about one tenth due to geometrical reasons. Current clamp recording was used to record action potentials generated by electrical or mechanical stimuli. Square pulse stimulation identified two groups of sensory cells, the first being single-spike cells which generated only one or two action potentials and the second being multi-spike cells which produced bursts of action potentials. When the more natural mechanical sinusoidal stimulation was applied, differences in adaptation rate between the two cell types remained. In agreement with prior extracellular recordings, both cell types showed a decrease in the threshold tarsus deflection with increasing stimulus frequency. Off-responses to mechanical stimuli have also been seen in the metatarsal organ for the first time.

  9. Spectral sensitivity of a colour changing spider. (United States)

    Defrize, Jérémy; Lazzari, Claudio R; Warrant, Eric J; Casas, Jérôme


    Vision plays a paramount role in some spider families such as the Salticidae, Lycosidae and Thomisidae, as it is involved in prey hunting, orientation or choice of substrate. In the thomisid Misumena vatia, for which the substrate colour affects the body colour, vision seems to mediate morphological colour changes. However, nothing is known about which component of visual signals from the substrate might be perceived, nor whether M. vatia possesses the physiological basis for colour vision. The aim of this study is thus to investigate the vision of this spider species by measuring the spectral sensitivities of the different pairs of eyes using electrophysiological methods. Extra- and intracellular electrophysiological recordings combined with selective adaptation revealed the presence of two classes of photoreceptor cells, one sensitive in the UV region of the spectrum (around 340 nm) and one sensitive in the green (around 520 nm) regions in the four pairs of eyes. We conclude that M. vatia possesses the physiological potential to perceive both chromatic and achromatic components of the environment. Copyright © 2011 Elsevier Ltd. All rights reserved.



    ヤマモト, リョウザブロウ; イワシマ, タツヤ; ホシアイ, マコト; Ryozaburo, YAMAMOTO; Tatsuya, IWASHIMA; Makoto, HOSHIAI


    From the analysis of the climatic elements over Japan, we can detect the "climatic jumps" around the years 1920 and 1950,which is a new concept in the climatic diagnosis proposed by the present authors (R. YAMAMOTO et al. : J. Meteorol. Soc. Jpn., 63,1157,1985,64,273,1986). Taking account of several results which show the simultaneous occurrence of the climatic jumps of the surface air temperature, precipitation, etc., in the other regions by the other investigators, we may infer the "climati...

  11. Does trampoline or hard surface jumping influence lower extremity alignment? (United States)

    Akasaka, Kiyokazu; Tamura, Akihiro; Katsuta, Aoi; Sagawa, Ayako; Otsudo, Takahiro; Okubo, Yu; Sawada, Yutaka; Hall, Toby


    [Purpose] To determine whether repetitive trampoline or hard surface jumping affects lower extremity alignment on jump landing. [Subjects and Methods] Twenty healthy females participated in this study. All subjects performed a drop vertical jump before and after repeated maximum effort trampoline or hard surface jumping. A three-dimensional motion analysis system and two force plates were used to record lower extremity angles, moments, and vertical ground reaction force during drop vertical jumps. [Results] Knee extensor moment after trampoline jumping was greater than that after hard surface jumping. There were no significant differences between trials in vertical ground reaction force and lower extremity joint angles following each form of exercise. Repeated jumping on a trampoline increased peak vertical ground reaction force, hip extensor, knee extensor moments, and hip adduction angle, while decreasing hip flexion angle during drop vertical jumps. In contrast, repeated jumping on a hard surface increased peak vertical ground reaction force, ankle dorsiflexion angle, and hip extensor moment during drop vertical jumps. [Conclusion] Repeated jumping on the trampoline compared to jumping on a hard surface has different effects on lower limb kinetics and kinematics. Knowledge of these effects may be useful in designing exercise programs for different clinical presentations.

  12. Spiders (Araneae) Found in Bananas and Other International Cargo Submitted to North American Arachnologists for Identification. (United States)

    Vetter, Richard S; Crawford, Rodney L; Buckle, Donald J


    Spiders found in international cargo brought into North America are sometimes submitted to arachnologists for identification. Often, these spiders are presumed to be of medical importance because of size or a submitter's familiarity with a toxic spider genus from the continent of origin. Starting in 2006, requests were made for spiders found in international cargo brought into North America, in addition to the specimens from similar cargo shipments already in our museum collections. This was an ad hoc study that allowed us to focus on spiders of concern to the discoverer. We identified 135 spiders found in international cargo. A key for the most common species is provided. The most frequently submitted spiders were the pantropical huntsman spider, Heteropoda venatoria (L.) (Sparassidae), and the redfaced banana spider, Cupiennius chiapanensis Medina Soriano (Ctenidae). Spiders of medical importance were rare. The most common cargo from which spiders were submitted was bananas with most specimens coming from Central America, Ecuador, or Colombia. Lack of experience with nonnative fauna caused several experienced American arachnologists to misidentify harmless ctenid spiders (C. chiapanensis, spotlegged banana spider, Cupiennius getazi Simon) as highly toxic Phoneutria spiders. These misidentifications could have led to costly, unwarranted prophylactic eradication measures, unnecessary employee health education, heightened employee anxiety and spoilage when perishable goods are left unloaded due to safety concerns. © 2014 Entomological Society of America.

  13. Phylogenomics resolves a spider backbone phylogeny and rejects a prevailing paradigm for orb web evolution. (United States)

    Bond, Jason E; Garrison, Nicole L; Hamilton, Chris A; Godwin, Rebecca L; Hedin, Marshal; Agnarsson, Ingi


    Spiders represent an ancient predatory lineage known for their extraordinary biomaterials, including venoms and silks. These adaptations make spiders key arthropod predators in most terrestrial ecosystems. Despite ecological, biomedical, and biomaterial importance, relationships among major spider lineages remain unresolved or poorly supported. Current working hypotheses for a spider "backbone" phylogeny are largely based on morphological evidence, as most molecular markers currently employed are generally inadequate for resolving deeper-level relationships. We present here a phylogenomic analysis of spiders including taxa representing all major spider lineages. Our robust phylogenetic hypothesis recovers some fundamental and uncontroversial spider clades, but rejects the prevailing paradigm of a monophyletic Orbiculariae, the most diverse lineage, containing orb-weaving spiders. Based on our results, the orb web either evolved much earlier than previously hypothesized and is ancestral for a majority of spiders or else it has multiple independent origins, as hypothesized by precladistic authors. Cribellate deinopoid orb weavers that use mechanically adhesive silk are more closely related to a diverse clade of mostly webless spiders than to the araneoid orb-weaving spiders that use adhesive droplet silks. The fundamental shift in our understanding of spider phylogeny proposed here has broad implications for interpreting the evolution of spiders, their remarkable biomaterials, and a key extended phenotype--the spider web. Copyright © 2014 Elsevier Ltd. All rights reserved.

  14. Test-retest reliability of jump execution variables using mechanography: a comparison of jump protocols. (United States)

    Fitzgerald, John S; Johnson, LuAnn; Tomkinson, Grant; Stein, Jesse; Roemmich, James N


    Mechanography during the vertical jump may enhance screening and determining mechanistic causes underlying physical performance changes. Utility of jump mechanography for evaluation is limited by scant test-retest reliability data on force-time variables. This study examined the test-retest reliability of eight jump execution variables assessed from mechanography. Thirty-two women (mean±SD: age 20.8 ± 1.3 yr) and 16 men (age 22.1 ± 1.9 yr) attended a familiarization session and two testing sessions, all one week apart. Participants performed two variations of the squat jump with squat depth self-selected and controlled using a goniometer to 80º knee flexion. Test-retest reliability was quantified as the systematic error (using effect size between jumps), random error (using coefficients of variation), and test-retest correlations (using intra-class correlation coefficients). Overall, jump execution variables demonstrated acceptable reliability, evidenced by small systematic errors (mean±95%CI: 0.2 ± 0.07), moderate random errors (mean±95%CI: 17.8 ± 3.7%), and very strong test-retest correlations (range: 0.73-0.97). Differences in random errors between controlled and self-selected protocols were negligible (mean±95%CI: 1.3 ± 2.3%). Jump execution variables demonstrated acceptable reliability, with no meaningful differences between the controlled and self-selected jump protocols. To simplify testing, a self-selected jump protocol can be used to assess force-time variables with negligible impact on measurement error.

  15. Influence of Knee-to-Feet Jump Training on Vertical Jump and Hang Clean Performance. (United States)

    Stark, Laura; Pickett, Karla; Bird, Michael; King, Adam C


    Stark, L, Pickett, K, Bird, M, and King, AC. Influence of knee-to-feet jump training on vertical jump and hang clean performance. J Strength Cond Res 30(11): 3084-3089, 2016-From a motor learning perspective, the practice/training environment can result in positive, negative, or neutral transfer to the testing conditions. The purpose of this study was to examine the training effect of a novel movement (knee-to-feet [K2F] jumps) and whether a 6-week training program induced a positive transfer effect to other power-related movements (vertical jump and hang clean [HC]). Twenty-six intercollegiate athletes from power-emphasized sports were paired and counter-balanced into a control (i.e., maintained their respective sport-specific lifting regimen) or an experimental group (i.e., completed a 6-week progressive training program of K2F jumps in addition to respective lifting regimen). A pre- and posttest design was used to investigate the effect of training on K2F jump height and transfer effect to vertical jump height (VJH) and 2-repetition maximum (RM) HC performance. A significant increase in K2F jump height was found for the experimental group. Vertical jump height significantly increased from pre- to posttest but no group or interaction (group × time) effect was found, and there were nonsignificant differences for HC. Posttest data showed significant correlations between all pairs of the selected exercises with the highest correlation between K2F jump height and VJ H (R = 0.40) followed by VJH and 2RM HC (R = 0.38) and 2RM HC and K2F jump height (R = 0.23). The results suggest that K2F jump training induced the desired learning effect but was specific to the movement in that no effect of transfer occurred to the other power-related movements. This finding is value for strength and condition professionals who design training programs to enhance athletic performance.

  16. Filtering of a Markov Jump Process with Counting Observations

    International Nuclear Information System (INIS)

    Ceci, C.; Gerardi, A.


    This paper concerns the filtering of an R d -valued Markov pure jump process when only the total number of jumps are observed. Strong and weak uniqueness for the solutions of the filtering equations are discussed

  17. Vision in the nocturnal wandering spider Leucorchestris arenicola (Araneae: Sparassidae)

    DEFF Research Database (Denmark)

    Nørgaard, Thomas; Nilsson, Dan-Eric; Henschel, Joh R


    At night the Namib Desert spider Leucorchestris arenicola performs long-distance homing across its sand dune habitat. By disabling all or pairs of the spiders' eight eyes we found that homing ability was severely reduced when vision was fully abolished. Vision, therefore, seems to play a key role...... in the posterior and anteriomedian eyes, and at approximately 540 nm in the anteriolateral eyes. Theoretical calculations of photon catches showed that the eyes are likely to employ a combination of spatial and temporal pooling in order to function at night. Under starlit conditions, the raw spatial and temporal...... resolution of the eyes is insufficient for detecting any visual information on structures in the landscape, and bright stars would be the only objects visible to the spiders. However, by summation in space and time, the spiders can rescue enough vision to detect coarse landscape structures. We show that L...


    African Journals Online (AJOL)

    Spider webs were collected from the indoor and outdoor of 120 sampling sites of 10 zones of Kano ... diet, cobalt containing ceramic is administered into ... significant human and environmental health risk. ..... Evaluation of Health Workers.

  19. Genetic diversity analysis of various red spider mite- resistant ...

    African Journals Online (AJOL)



    May 2, 2011 ... 3Key Laboratory of Plant Breeding and Genetics, Sichuan Agricultural University, Ya'an, 625014, P. R. ... Random amplified polymorphic DNA (RAPD) is a DNA ..... spider mite-resistant, bumper, high-quality and disease-.

  20. Optical surface profiling of orb-web spider capture silks

    Energy Technology Data Exchange (ETDEWEB)

    Kane, D M; Joyce, A M; Staib, G R [Department of Physics, Macquarie University, Sydney, NSW 2109 (Australia); Herberstein, M E, E-mail: [Department of Biological Sciences, Macquarie University, Sydney, NSW 2109 (Australia)


    Much spider silk research to date has focused on its mechanical properties. However, the webs of many orb-web spiders have evolved for over 136 million years to evade visual detection by insect prey. It is therefore a photonic device in addition to being a mechanical device. Herein we use optical surface profiling of capture silks from the webs of adult female St Andrews cross spiders (Argiope keyserlingi) to successfully measure the geometry of adhesive silk droplets and to show a bowing in the aqueous layer on the spider capture silk between adhesive droplets. Optical surface profiling shows geometric features of the capture silk that have not been previously measured and contributes to understanding the links between the physical form and biological function. The research also demonstrates non-standard use of an optical surface profiler to measure the maximum width of a transparent micro-sized droplet (microlens).

  1. Biotechnological Trends in Spider and Scorpion Antivenom Development

    DEFF Research Database (Denmark)

    Laustsen, Andreas Hougaard; Solà, Mireia; Jappe, Emma Christine


    in using bioactive toxins from spiders and scorpions for drug discovery purposes and for solving crystal structures of membrane-embedded receptors. Additionally, the identification and isolation of a myriad of spider and scorpion toxins has allowed research within next generation antivenoms to progress...... at an increasingly faster pace. In this review, the current knowledge of spider and scorpion venoms is presented, followed by a discussion of all published biotechnological efforts within development of spider and scorpion antitoxins based on small molecules, antibodies and fragments thereof, and next generation...... immunization strategies. The increasing number of discovery and development efforts within this field may point towards an upcoming transition from serum-based antivenoms towards therapeutic solutions based on modern biotechnology....

  2. Biomimetic calcium phosphate coatings on recombinant spider silk fibres

    NARCIS (Netherlands)

    Yang, Liang; Hedhammar, My; Blom, Tobias; Leifer, Klaus; Johansson, Jan; Habibovic, Pamela; van Blitterswijk, Clemens


    Calcium phosphate ceramic coatings, applied on surfaces of metallic and polymeric biomaterials, can improve their performance in bone repair and regeneration. Spider silk is biocompatible, strong and elastic, and hence an attractive biomaterial for applications in connective tissue repair. Recently,

  3. Peculiar torsion dynamical response of spider dragline silk (United States)

    Liu, Dabiao; Yu, Longteng; He, Yuming; Peng, Kai; Liu, Jie; Guan, Juan; Dunstan, D. J.


    The torsional properties of spider dragline silks from Nephila edulis and Nephila pilipes spiders are investigated by using a torsion pendulum technique. A permanent torsional deformation is observed after even small torsional strain. This behaviour is quite different from that of the other materials tested here, i.e., carbon fiber, thin metallic wires, Kevlar fiber, and human hair. The spider dragline thus displays a strong energy dissipation upon the initial excitation (around 75% for small strains and more for a larger strain), which correspondingly reduces the amplitude of subsequent oscillations around the new equilibrium position. The variation of torsional stiffness in relaxation dynamics of spider draglines for different excitations is also determined. The experimental result is interpreted in the light of the hierarchical structure of dragline silk.

  4. Optical surface profiling of orb-web spider capture silks

    International Nuclear Information System (INIS)

    Kane, D M; Joyce, A M; Staib, G R; Herberstein, M E


    Much spider silk research to date has focused on its mechanical properties. However, the webs of many orb-web spiders have evolved for over 136 million years to evade visual detection by insect prey. It is therefore a photonic device in addition to being a mechanical device. Herein we use optical surface profiling of capture silks from the webs of adult female St Andrews cross spiders (Argiope keyserlingi) to successfully measure the geometry of adhesive silk droplets and to show a bowing in the aqueous layer on the spider capture silk between adhesive droplets. Optical surface profiling shows geometric features of the capture silk that have not been previously measured and contributes to understanding the links between the physical form and biological function. The research also demonstrates non-standard use of an optical surface profiler to measure the maximum width of a transparent micro-sized droplet (microlens).

  5. SPIDER: Probing the dawn of time from above the clouds (United States)

    Moncelsi, Lorenzo; Spider Collaboration


    SPIDER is a balloon-borne microwave polarimeter designed to measure cosmological B-modes on degree angular scales in the presence of Galactic foregrounds. With six independent telescopes housing a total of 2000 detectors in the 90 GHz and 150 GHz frequency bands, SPIDER is the most instantaneously-sensitive CMB polarimeter deployed on the sky to date. SPIDER was successfully launched from McMurdo Station, Antarctica in January 2015 and acquired science data for 16 days. We cover the in-flight performance and present highlights from the ongoing data-analysis. After a successful recovery, the SPIDER team is planning the next flight, featuring one foreground-optimized channel at 280GHz, which will allow us constrain the primordial tensor-mode amplitude at the level of r < 0.03 (99% CL), in the presence of foregrounds.

  6. Evolution of stenophagy in spiders (Araneae): evidence based on the comparative analysis of spider diets. (United States)

    Pekár, Stano; Coddington, Jonathan A; Blackledge, Todd A


    Stenophagy (narrow diet breadth) represents an extreme of trophic specialization in carnivores, but little is known about the forces driving its evolution. We used spiders, the most diversified group of terrestrial predators, to investigate whether stenophagy (1) promoted diversification; (2) was phylogenetically conserved and evolutionarily derived state; and (3) was determined either by geographical distribution and foraging guild. We used published data on the prey of almost 600 species. Six categories of stenophagy were found: myrmecophagy, araneophagy, lepidopterophagy, termitophagy, dipterophagy, and crustaceophagy. We found that the species diversity of euryphagous genera and families was similar to stenophagous genera and families. At the family level, stenophagy evolved repeatedly and independently. Within families, the basal condition was oligophagy or euryphagy. Most types of stenophagy were clearly derived: myrmecophagy in Zodariidae; lepidopterophagy in Araneidae; dipterophagy in Theridiidae. In contrast, araneophagy was confined to basal and intermediate lineages, suggesting its ancestral condition. The diet breadth of species from the tropics and subtropics was less diverse than species from the temperate zone. Diet breadth was lower in cursorial spiders compared to web-building species. Thus, the evolution of stenophagy in spiders appears to be complex and governed by phylogeny as well as by ecological determinants. © 2011 The Author(s). Evolution© 2011 The Society for the Study of Evolution.

  7. Jumping on the Social Media Bandwagon (United States)

    Blakeslee, Lori


    Should a school district jump on the social media bandwagon? Yes! Social media provide a low-cost way to communicate school district priorities, influence decision makers, and tell its story without filters. Equally important, social media are where constituents are spending a lot of their time. With more than 800 million members, Facebook is an…

  8. Thin Film Assembly of Spider Silk-like Block Copolymers (United States)


    Shipley, N. H.; Lewis, R. V. Int. J. Biol.Macromol. 1999, 24, 271. (c) Thiel, B. L.; Guess, K. B.; Viney, C. Biopolymers 1997, 41, 703. (13) Silk ...Film Assembly of Spider Silk -like Block Copolymers Sreevidhya T. Krishnaji,†,‡ Wenwen Huang,§ Olena Rabotyagova,†,‡ Eugenia Kharlampieva, ) Ikjun Choi...Received November 26, 2010 We report the self-assembly of monolayers of spider silk -like block copolymers. Langmuir isotherms were obtained for a series of

  9. Early events in the evolution of spider silk genes.

    Directory of Open Access Journals (Sweden)

    James Starrett

    Full Text Available Silk spinning is essential to spider ecology and has had a key role in the expansive diversification of spiders. Silk is composed primarily of proteins called spidroins, which are encoded by a multi-gene family. Spidroins have been studied extensively in the derived clade, Orbiculariae (orb-weavers, from the suborder Araneomorphae ('true spiders'. Orbicularians produce a suite of different silks, and underlying this repertoire is a history of duplication and spidroin gene divergence. A second class of silk proteins, Egg Case Proteins (ECPs, is known only from the orbicularian species, Lactrodectus hesperus (Western black widow. In L. hesperus, ECPs bond with tubuliform spidroins to form egg case silk fibers. Because most of the phylogenetic diversity of spiders has not been sampled for their silk genes, there is limited understanding of spidroin gene family history and the prevalence of ECPs. Silk genes have not been reported from the suborder Mesothelae (segmented spiders, which diverged from all other spiders >380 million years ago, and sampling from Mygalomorphae (tarantulas, trapdoor spiders and basal araneomorph lineages is sparse. In comparison to orbicularians, mesotheles and mygalomorphs have a simpler silk biology and thus are hypothesized to have less diversity of silk genes. Here, we present cDNAs synthesized from the silk glands of six mygalomorph species, a mesothele, and a non-orbicularian araneomorph, and uncover a surprisingly rich silk gene diversity. In particular, we find ECP homologs in the mesothele, suggesting that ECPs were present in the common ancestor of extant spiders, and originally were not specialized to complex with tubuliform spidroins. Furthermore, gene-tree/species-tree reconciliation analysis reveals that numerous spidroin gene duplications occurred after the split between Mesothelae and Opisthothelae (Mygalomorphae plus Araneomorphae. We use the spidroin gene tree to reconstruct the evolution of amino acid

  10. Jump as Far as You Can [Problem Solvers: Problem (United States)

    Bofferding, Laura; Yigit, Melike


    The standing long jump was an Olympic event until 1912. In 1904, Ray Ewry set the world record for the longest standing long jump, which was about 11.5 feet, or 138 inches. Although the standing long jump is no longer an Olympic event, the Norwegians still include it in their National Competition, and Arne Tvervaag set a new world record at about…

  11. Thomson's Jumping Ring over a Long Coil (United States)

    Jeffery, Rondo N.; Amiri, Farhang


    The classic jumping ring apparatus consists of a coil with an iron core that extends out of the coil. A copper or aluminum ring placed over the iron core jumps upward when AC power is applied to the coil. In this paper we will examine a modified design of the jumping ring apparatus, called the "long-coil design." It allows the ring to…

  12. Vorticity determination in a hydraulic jump by application of method ...

    African Journals Online (AJOL)

    The method of characteristics for solving systems of partial differential equations coupled with jump conditions is used in analysing flow downstream of a hydraulic jump instead of the normal analytical approach adopted in Hornung [1]. It is shown that the method of characteristics together with the jump conditions can ...

  13. Scaling and jumping: Gravity loses grip on small jumpers

    NARCIS (Netherlands)

    Scholz, M.N.; Bobbert, M.F.; van Soest, A.J.


    There are several ways to quantify jumping performance, a common definition being the height gained by the body's centre of mass (CM) in the airborne phase. Under this definition, jump height is determined by take-off velocity. According to the existing literature on jumping and scaling, take-off

  14. Effect of early training on the jumping technique of horses

    NARCIS (Netherlands)

    Santamaría, Susana; Bobbert, Maarten F.; Back, Willem; Barneveld, Ab; van Weeren, P. Rene

    Objective - To investigate the effects of early training for jumping by comparing the jumping technique of horses that had received early training with that of horses raised conventionally. Animals - 40 Dutch Warmblood horses. Procedure - The horses were analyzed kinematically during free jumping at

  15. Deriving appropriate boundary conditions, and accelerating position-jump simulations, of diffusion using non-local jumping

    International Nuclear Information System (INIS)

    Taylor, P R; Baker, R E; Yates, C A


    In this paper we explore lattice-based position-jump models of diffusion, and the implications of introducing non-local jumping; particles can jump to a range of nearby boxes rather than only to their nearest neighbours. We begin by deriving conditions for equivalence with traditional local jumping models in the continuum limit. We then generalize a previously postulated implementation of the Robin boundary condition for a non-local process of arbitrary maximum jump length, and present a novel implementation of flux boundary conditions, again generalized for a non-local process of arbitrary maximum jump length. In both these cases we validate our results using stochastic simulation. We then proceed to consider two variations on the basic diffusion model: a hybrid local/non-local scheme suitable for models involving sharp concentration gradients, and the implementation of biased jumping. In all cases we show that non-local jumping can deliver substantial time savings for stochastic simulations. (paper)

  16. Early Cretaceous greenhouse pumped higher taxa diversification in spiders. (United States)

    Shao, Lili; Li, Shuqiang


    The Cretaceous experienced one of the most remarkable greenhouse periods in geological history. During this time, ecosystem reorganizations significantly impacted the diversification of many groups of organisms. The rise of angiosperms marked a major biome turnover. Notwithstanding, relatively little remains known about how the Cretaceous global ecosystem impacted the evolution of spiders, which constitute one of the most abundant groups of predators. Herein, we evaluate the transcriptomes of 91 taxa representing more than half of the spider families. We add 23 newly sequenced taxa to the existing database to obtain a robust phylogenomic assessment. Phylogenetic reconstructions using different datasets and methods obtain novel placements of some groups, especially in the Synspermiata and the group having a retrolateral tibial apophysis (RTA). Molecular analyses indicate an expansion of the RTA clade at the Early Cretaceous with a hunting predatory strategy shift. Fossil analyses show a 7-fold increase of diversification rate at the same period, but this likely owes to the first occurrences spider in amber deposits. Additional analyses of fossil abundance show an accumulation of spider lineages in the Early Cretaceous. We speculate that the establishment of a warm greenhouse climate pumped the diversification of spiders, in particular among webless forms tracking the abundance of insect prey. Our study offers a new pathway for future investigations of spider phylogeny and diversification. Copyright © 2018. Published by Elsevier Inc.

  17. Impact of prescribed burning on a heathland inhabiting spider community

    Directory of Open Access Journals (Sweden)

    Krause, Rolf Harald


    Full Text Available Heathlands can provide refuge for many stenotopic and endangered arthropods, if habitat management practices are applied. A management measure that is rarely being used today, but which has the potential to support diversity of arthropod communities, is prescribed burning. In this study we investigated the effects of prescribed burning on spider assemblages on a burned site with Calluna vulgaris in the nature reserve Lueneburg Heath, northwest Germany. We used pitfall trapping with a sampling design of 39 traps over a period of one year and 17 sampling intervals on a burned and a control site. We compared overall species richness, activity abundance patterns and community composition of the two sites, with a particular focus on stenotopic and endangered species. We collected 5116 adult spiders and 99 species altogether in a relatively small sampling area. This number of species represents nearly one third of the regional species pool of heathland spider species. Twelve species occurred exclusively on the burned site in contrast to 28 species exclusively found on the unburned site. Although we found more than twice as many spider individuals and higher mean species richness on the control site than on the burned site, the species richness of red-listed spiders was higher on the burned site. Especially the fact that we found 24 endangered species on the burned site and only 20 on the control site indicates that the applied measure of prescribed burning can foster certain endangered spider species and contribute to preserving the overall biodiversity of heathland ecosystems.

  18. Nutrient Deprivation Induces Property Variations in Spider Gluey Silk (United States)

    Blamires, Sean J.; Sahni, Vasav; Dhinojwala, Ali; Blackledge, Todd A.; Tso, I-Min


    Understanding the mechanisms facilitating property variability in biological adhesives may promote biomimetic innovations. Spider gluey silks such as the spiral threads in orb webs and the gumfoot threads in cobwebs, both of which comprise of an axial thread coated by glue, are biological adhesives that have variable physical and chemical properties. Studies show that the physical and chemical properties of orb web gluey threads change when spiders are deprived of food. It is, however, unknown whether gumfoot threads undergo similar property variations when under nutritional stress. Here we tested whether protein deprivation induces similar variations in spiral and gumfoot thread morphology and stickiness. We manipulated protein intake for the orb web spider Nephila clavipes and the cobweb spider Latrodectus hesperus and measured the diameter, glue droplet volume, number of droplets per mm, axial thread width, thread stickiness and adhesive energy of their gluey silks. We found that the gluey silks of both species were stickier when the spiders were deprived of protein than when the spiders were fed protein. In N. clavipes a concomitant increase in glue droplet volume was found. Load-extension curves showed that protein deprivation induced glue property variations independent of the axial thread extensions in both species. We predicted that changes in salt composition of the glues were primarily responsible for the changes in stickiness of the silks, although changes in axial thread properties might also contribute. We, additionally, showed that N. clavipes' glue changes color under protein deprivation, probably as a consequence of changes to its biochemical composition. PMID:24523902

  19. Phobic spider fear is associated with enhanced attentional capture by spider pictures: a rapid serial presentation event-related potential study. (United States)

    Van Strien, Jan W; Franken, Ingmar H A; Huijding, Jorg


    The early posterior negativity (EPN) reflects early selective visual processing of emotionally significant information. This study explored the association between fear of spiders and the EPN for spider pictures. Fifty women completed a Spider Phobia Questionnaire and watched the random rapid serial presentation of 600 neutral, 600 negatively valenced emotional, and 600 spider pictures (three pictures per second). The EPN was scored as the mean activity in the 225-300-ms time window at lateral occipital electrodes. Participants with higher scores on the phobia questionnaire showed larger (i.e. more negative) EPN amplitudes in response to spider pictures. The results suggest that the attentional capture of spider-related stimuli is an automatic response, which is modulated by the extent of spider fear.

  20. Atomistic model of the spider silk nanostructure (United States)

    Keten, Sinan; Buehler, Markus J.


    Spider silk is an ultrastrong and extensible self-assembling biopolymer that outperforms the mechanical characteristics of many synthetic materials including steel. Here we report atomic-level structures that represent aggregates of MaSp1 proteins from the N. Clavipes silk sequence based on a bottom-up computational approach using replica exchange molecular dynamics. We discover that poly-alanine regions predominantly form distinct and orderly beta-sheet crystal domains while disorderly structures are formed by poly-glycine repeats, resembling 31-helices. These could be the molecular source of the large semicrystalline fraction observed in silks, and also form the basis of the so-called "prestretched" molecular configuration. Our structures are validated against experimental data based on dihedral angle pair calculations presented in Ramachandran plots, alpha-carbon atomic distances, as well as secondary structure content.

  1. The phylogeny of fossil whip spiders. (United States)

    Garwood, Russell J; Dunlop, Jason A; Knecht, Brian J; Hegna, Thomas A


    Arachnids are a highly successful group of land-dwelling arthropods. They are major contributors to modern terrestrial ecosystems, and have a deep evolutionary history. Whip spiders (Arachnida, Amblypygi), are one of the smaller arachnid orders with ca. 190 living species. Here we restudy one of the oldest fossil representatives of the group, Graeophonus anglicus Pocock, 1911 from the Late Carboniferous (Duckmantian, ca. 315 Ma) British Middle Coal Measures of the West Midlands, UK. Using X-ray microtomography, our principal aim was to resolve details of the limbs and mouthparts which would allow us to test whether this fossil belongs in the extant, relict family Paracharontidae; represented today by a single, blind species Paracharon caecus Hansen, 1921. Tomography reveals several novel and significant character states for G. anglicus; most notably in the chelicerae, pedipalps and walking legs. These allowed it to be scored into a phylogenetic analysis together with the recently described Paracharonopsis cambayensis Engel & Grimaldi, 2014 from the Eocene (ca. 52 Ma) Cambay amber, and Kronocharon prendinii Engel & Grimaldi, 2014 from Cretaceous (ca. 99 Ma) Burmese amber. We recovered relationships of the form ((Graeophonus (Paracharonopsis + Paracharon)) + (Charinus (Stygophrynus (Kronocharon (Charon (Musicodamon + Paraphrynus)))))). This tree largely reflects Peter Weygoldt's 1996 classification with its basic split into Paleoamblypygi and Euamblypygi lineages; we were able to score several of his characters for the first time in fossils. Our analysis draws into question the monophyly of the family Charontidae. Our data suggest that Graeophonus is a crown group amblypygid, and falls within a monophyletic Paleoamblypgi clade, but outside the family Paracharontidae (= Paracharonopsis + Paracharon). Our results also suggest a new placement for the Burmese amber genus Kronocharon, a node further down from its original position. Overall, we offer a

  2. Option Valuation with Observable Volatility and Jump Dynamics

    DEFF Research Database (Denmark)

    Christoffersen, Peter; Feunoua, Bruno; Jeon, Yoontae

    Under very general conditions, the total quadratic variation of a jump-diffusion process can be decomposed into diffusive volatility and squared jump variation. We use this result to develop a new option valuation model in which the underlying asset price exhibits volatility and jump intensity...... dynamics. The volatility and jump intensity dynamics in the model are directly driven by model-free empirical measures of diffusive volatility and jump variation. Because the empirical measures are observed in discrete intervals, our option valuation model is cast in discrete time, allowing...

  3. Option Valuation with Observable Volatility and Jump Dynamics

    DEFF Research Database (Denmark)

    Christoffersen, Peter; Feunoua, Bruno; Jeon, Yoontae


    Under very general conditions, the total quadratic variation of a jump-diffusion process can be decomposed into diffusive volatility and squared jump variation. We use this result to develop a new option valuation model in which the underlying asset price exhibits volatility and jump intensity...... dynamics. The volatility and jump intensity dynamics in the model are directly driven by model-free empirical measures of diffusive volatility and jump variation. Because the empirical measures are observed in discrete intervals, our option valuation model is cast in discrete time, allowing...


    International Nuclear Information System (INIS)



    During transition crossing in the .Relativistic Heavy Ion Collider (RHIC), chromaticities have to change sign. This sign change is partially accomplished by the γ t quadrupole jump; however, the resulting chromaticity jump is only Δξ x = 2.1 in the horizontal and Δξ y = 2.4 in the vertical plane. To increase the jump height, a dedicated chromaticity jump scheme has been designed, consisting of fast power supplies connected to six sextupoles per ring, which is capable of providing a chromaticity jump of Δξ = 6

  5. Riparian spiders as sentinels of PCB contamination across heterogeneous aquatic ecosystems (United States)

    Riparian spiders are being used increasingly to track spatial patterns of contaminants in and fluxing from aquatic ecosystems. However, our understanding of the circumstances under which spiders are effective sentinels of aquatic pollution is limited. The present study tests the ...

  6. Biomechanical Analysis of the Jump Shot in Basketball

    Directory of Open Access Journals (Sweden)

    Struzik Artur


    Full Text Available Basketball players usually score points during the game using the jump shot. For this reason, the jump shot is considered to be the most important element of technique in basketball and requires a high level of performance. The aim of this study was to compare the biomechanical characteristics of the lower limbs during a jump shot without the ball and a countermovement jump without an arm swing. The differences between variables provide information about the potential that an athlete can utilise during a game when performing a jump shot. The study was conducted among 20 second-league basketball players by means of a Kistler force plate and the BTS SMART system for motion analysis. The variables measured included the take-off time, mean power, peak power, relative mean power, jump height, maximum landing force and calculated impact ratio. Surprisingly, more advantageous variables were found for the jump shot. This finding suggests a very high performance level in the jump shot in the studied group and a maximum utilisation of their motor abilities. Both types of jumps were characterised by high mean and peak power values and average heights. The high forces at landing, which result in considerable impact ratios, may have prompted the studied group to land softly. Use of the countermovement jump without an arm swing is recommended to assess and predict the progression of player’s jumping ability

  7. Validity of Hip-worn Inertial Measurement Unit Compared to Jump Mat for Jump Height Measurement in Adolescents. (United States)

    Rantalainen, T; Hesketh, K D; Rodda, C; Duckham, R L


    Jump tests assess lower body power production capacity, and can be used to evaluate athletic ability and development during growth. Wearable inertial measurement units (IMU) seem to offer a feasible alternative to laboratory-based equipment for jump height assessments. Concurrent validity of these devices for jump height assessments has only been established in adults. Therefore, the purpose of this study was to evaluate the concurrent validity of IMU-based jump height estimate compared to contact mat-based jump height estimate in adolescents. Ninety-five adolescents (10-13 years-of-age; girls N=41, height = 154 (SD 9) cm, weight = 44 (11) kg; boys N=54, height=156 (10) cm, weight = 46 (13) kg) completed three counter-movement jumps for maximal jump height on a contact mat. Inertial recordings (accelerations, rotations) were concurrently recorded with a hip-worn IMU (sampling at 256 Hz). Jump height was evaluated based on flight time. The mean IMU-derived jump height was 27.1 (SD 3.8) cm, and the corresponding mean jump-mat-derived value was 21.5 (3.4) cm. While a significant 26% mean difference was observed between the methods (5.5 [95% limits of agreement 2.2 to 8.9] cm, p = 0.006), the correspondence between methods was excellent (ICC = 0.89). The difference between methods was weakly positively associated with jump height (r = 0.28, P = 0.007). Take-off velocity derived jump height was also explored but produced only fair congruence. In conclusion, IMU-derived jump height exhibited excellent congruence to contact mat-based jump height and therefore presents a feasible alternative for jump height assessments in adolescents. This article is protected by copyright. All rights reserved. This article is protected by copyright. All rights reserved.

  8. A Jump Diffusion Model for Volatility and Duration

    DEFF Research Database (Denmark)

    Wei, Wei; Pelletier, Denis

    by the market microstructure theory. Traditional measures of volatility do not utilize durations. I adopt a jump diffusion process to model the persistence of intraday volatility and conditional duration, and their interdependence. The jump component is disentangled from the continuous part of the price......, volatility and conditional duration process. I develop a MCMC algorithm for the inference of irregularly spaced multivariate process with jumps. The algorithm provides smoothed estimates of the latent variables such as spot volatility, jump times and jump sizes. I apply this model to IBM data and I find...... meaningful relationship between volatility and conditional duration. Also, jumps play an important role in the total variation, but the jump variation is smaller than traditional measures that use returns sampled at lower frequency....

  9. Propulsion efficiency and imposed flow fields of a copepod jump

    DEFF Research Database (Denmark)

    Jiang, H.; Kiørboe, Thomas


    Pelagic copepods jump to relocate, to attack prey and to escape predators. However, there is a price to be paid for these jumps in terms of their energy costs and the hydrodynamic signals they generate to rheotactic predators. Using observed kinematics of various types of jumps, we computed...... the imposed flow fields and associated energetics of jumps by means of computational fluid dynamics simulations by modeling the copepod as a self-propelled body. The computational fluid dynamics simulation was validated by particle image velocimetry data. The flow field generated by a repositioning jump...... the flow structure. The flow field associated with an escape jump sequence also includes two dominant vortex structures: one leading wake vortex generated as a result of the first jump and one around the body, but between these two vortex structures is an elongated, long-lasting flow trail with flow...

  10. Research on Artificial Spider Web Model for Farmland Wireless Sensor Network


    Jun Wang; Song Gao; Shimin Zhao; Guang Hu; Xiaoli Zhang; Guowang Xie


    Through systematic analysis of the structural characteristics and invulnerability of spider web, this paper explores the possibility of combining the advantages of spider web such as network robustness and invulnerability with farmland wireless sensor network. A universally applicable definition and mathematical model of artificial spider web structure are established. The comparison between artificial spider web and traditional networks is discussed in detail. The simulation result shows tha...

  11. Science 101: Why Don't Spiders Stick to Their Own Webs? (United States)

    Robertson, Bill


    This article explains why spiders don't stick to their webs. Spiders don't get stuck in their own webs (and they aren't immune to their own glue) because they use a combination of sticky and nonsticky threads (different glands for producing those), and the glue is in droplets that the spider can avoid but the prey can't. The spider's nervous…

  12. Ineffective crypsis in a crab spider: a prey community perspective. (United States)

    Brechbühl, Rolf; Casas, Jérôme; Bacher, Sven


    Cryptic coloration is assumed to be beneficial to predators because of an increased encounter rate with unwary prey. This hypothesis is, however, very rarely, if ever, studied in the field. The aim of this study was to quantify the encounter rate and capture success of an ambush predator, in the field, as a function of its level of colour-matching with the background. We used the crab spider Misumena vatia, which varies its body colour and can thereby match the colour of the flower it hunts upon. We carried out a manipulative field experiment using a complete factorial design resulting in six different colour combinations of crab spiders and flowers differing in their degree of colour-matching. A rich and diverse set of naturally occurring insects visited the flowers while we continuously video-recorded the spider's foraging activity. This enabled us to test the crypsis, the spider avoidance and the flower visitor attraction hypotheses, all three supported by previous studies. Flower visitors of different groups either avoided crab spiders independent of colour-matching, such as solitary bees and syrphid flies, or ignored them, such as bumble-bees and honeybees. Moreover, colour-matched spiders did not have a higher encounter rate and capture success compared to the visually apparent ones. Thus, our results support the spider avoidance hypothesis, reject the two other hypotheses and uncovered a fourth behaviour: indifference to predators. Because flower visitors reacted differently, a community approach is mandatory in order to understand the function of background colour-matching in generalist predators. We discuss our results in relation to the size and sociality of the prey and in relation to the functional significance of colour change in this predator.

  13. Molecular Evolution of Spider Vision: New Opportunities, Familiar Players. (United States)

    Morehouse, Nathan I; Buschbeck, Elke K; Zurek, Daniel B; Steck, Mireille; Porter, Megan L


    Spiders are among the world's most species-rich animal lineages, and their visual systems are likewise highly diverse. These modular visual systems, composed of four pairs of image-forming "camera" eyes, have taken on a huge variety of forms, exhibiting variation in eye size, eye placement, image resolution, and field of view, as well as sensitivity to color, polarization, light levels, and motion cues. However, despite this conspicuous diversity, our understanding of the genetic underpinnings of these visual systems remains shallow. Here, we review the current literature, analyze publicly available transcriptomic data, and discuss hypotheses about the origins and development of spider eyes. Our efforts highlight that there are many new things to discover from spider eyes, and yet these opportunities are set against a backdrop of deep homology with other arthropod lineages. For example, many (but not all) of the genes that appear important for early eye development in spiders are familiar players known from the developmental networks of other model systems (e.g., Drosophila). Similarly, our analyses of opsins and related phototransduction genes suggest that spider photoreceptors employ many of the same genes and molecular mechanisms known from other arthropods, with a hypothesized ancestral spider set of four visual and four nonvisual opsins. This deep homology provides a number of useful footholds into new work on spider vision and the molecular basis of its extant variety. We therefore discuss what some of these first steps might be in the hopes of convincing others to join us in studying the vision of these fascinating creatures.

  14. Gamma Transition Jump for PS2

    CERN Document Server

    Bartmann, W; Métral, E; Möhl, D; Peggs, S


    The PS2, which is proposed as a replacement for the existing ~50-year old PS accelerator, is presently considered to be a normal conducting synchrotron with an injection kinetic energy of 4 GeV and a maximum energy of 50 GeV. One of the possible lattices (FODO option) foresees crossing of transition energy near 10 GeV. Since the phase-slip-factor $\\eta$ becomes very small near transition energy, many intensity dependent effects can take place in both longitudinal and transverse planes. The aim of the present paper is on the one hand to scale the gamma transition jump, used since 1973 in the PS, to the projected PS2 and on the other hand based on these results the analysis of the implementation and feasibility of a gamma transition jump scheme in a conventional FODO lattice.

  15. Testing jumps via false discovery rate control. (United States)

    Yen, Yu-Min


    Many recently developed nonparametric jump tests can be viewed as multiple hypothesis testing problems. For such multiple hypothesis tests, it is well known that controlling type I error often makes a large proportion of erroneous rejections, and such situation becomes even worse when the jump occurrence is a rare event. To obtain more reliable results, we aim to control the false discovery rate (FDR), an efficient compound error measure for erroneous rejections in multiple testing problems. We perform the test via the Barndorff-Nielsen and Shephard (BNS) test statistic, and control the FDR with the Benjamini and Hochberg (BH) procedure. We provide asymptotic results for the FDR control. From simulations, we examine relevant theoretical results and demonstrate the advantages of controlling the FDR. The hybrid approach is then applied to empirical analysis on two benchmark stock indices with high frequency data.

  16. Testing jumps via false discovery rate control.

    Directory of Open Access Journals (Sweden)

    Yu-Min Yen

    Full Text Available Many recently developed nonparametric jump tests can be viewed as multiple hypothesis testing problems. For such multiple hypothesis tests, it is well known that controlling type I error often makes a large proportion of erroneous rejections, and such situation becomes even worse when the jump occurrence is a rare event. To obtain more reliable results, we aim to control the false discovery rate (FDR, an efficient compound error measure for erroneous rejections in multiple testing problems. We perform the test via the Barndorff-Nielsen and Shephard (BNS test statistic, and control the FDR with the Benjamini and Hochberg (BH procedure. We provide asymptotic results for the FDR control. From simulations, we examine relevant theoretical results and demonstrate the advantages of controlling the FDR. The hybrid approach is then applied to empirical analysis on two benchmark stock indices with high frequency data.

  17. First report of clinical presentation of a bite by a running spider ...

    African Journals Online (AJOL)

    This article describes the clinical progression of symptoms over a period of 5 days of a bite inflicted by a Philodromus sp. spider. Commonly known as 'running spiders', these are not considered to be harmful to humans. This report, however, is the first description of an actual bite by a member of this group of spiders ...

  18. High School Students' Attitudes towards Spiders: A Cross-Cultural Comparison (United States)

    Prokop, Pavol; Tolarovicova, Andrea; Camerik, Anne M.; Peterkova, Viera


    Spiders are traditionally considered to be among the least popular of animals. Current evidence suggests that a negative attitude towards spiders could be influenced by both cultural and evolutionary pressures. Some researchers suggest that science education activities could positively influence students' perceptions of spiders. Their evidence is,…

  19. Entropy jump across an inviscid shock wave (United States)

    Salas, Manuel D.; Iollo, Angelo


    The shock jump conditions for the Euler equations in their primitive form are derived by using generalized functions. The shock profiles for specific volume, speed, and pressure are shown to be the same, however density has a different shock profile. Careful study of the equations that govern the entropy shows that the inviscid entropy profile has a local maximum within the shock layer. We demonstrate that because of this phenomenon, the entropy, propagation equation cannot be used as a conservation law.

  20. Price jumps on European stock markets

    Czech Academy of Sciences Publication Activity Database

    Hanousek, Jan; Kočenda, Evžen; Novotný, Jan


    Roč. 14, č. 1 (2014), s. 10-22 ISSN 2214-8450 R&D Projects: GA ČR(CZ) GAP403/11/0020; GA ČR(CZ) GBP402/12/G097 Grant - others:UK(CZ) UNCE 204005/2012 Institutional support: PRVOUK-P23 Keywords : stock markets * price jump indicators * non-parametric testing Subject RIV: AH - Economics

  1. Take-off aerodynamics in ski jumping. (United States)

    Virmavirta, M; Kivekäs, J; Komi, P V


    The effect of aerodynamic forces on the force-time characteristics of the simulated ski jumping take-off was examined in a wind tunnel. Vertical and horizontal ground reaction forces were recorded with a force plate installed under the wind tunnel floor. The jumpers performed take-offs in non-wind conditions and in various wind conditions (21-33 m s(-1)). EMGs of the important take-off muscles were recorded from one jumper. The dramatic decrease in take-off time found in all jumpers can be considered as the result of the influence of aerodynamic lift. The loss in impulse due to the shorter force production time with the same take-off force is compensated with the increase in lift force, resulting in a higher vertical velocity (V(v)) than is expected from the conventional calculation of V(v) from the force impulse. The wind conditions emphasized the explosiveness of the ski jumping take-off. The aerodynamic lift and drag forces which characterize the aerodynamic quality of the initial take-off position (static in-run position) varied widely even between the examined elite ski jumpers. According to the computer simulation these differences can decisively affect jumping distance. The proper utilization of the prevailing aerodynamic forces before and during take-off is a very important prerequisite for achieving a good flight position.

  2. Hydraulic jumps in ''viscous'' accretion disks

    International Nuclear Information System (INIS)

    Michel, F.C.


    We propose that the dissipative process necessary for rapid accretion disk evolution is driven by hydraulic jump waves on the surface of the disk. These waves are excited by the asymmetric nature of the central rotator (e.g., neutron star magnetosphere) and spiral out into the disk to form a pattern corotating with the central object. Disk matter in turn is slowed slightly at each encounter with the jump and spirals inward. In this process, the disk is heated by true turbulence produced in the jumps. Additional effects, such as a systematic misalignment of the magnetic moment of the neutron star until it is nearly orthogonal, and systematic distortion of the magnetosphere in such a way as to form an even more asymmetric central ''paddle wheel'' may enhance the interaction with inflowing matter. The application to X-ray sources corresponds to the ''slow'' solutions of Ghosh and Lamb, and therefore to rms magnetic fields of about 4 x 10 10 gauss. Analogous phenomena have been proposed to act in the formation of galactic spiral structure

  3. Sex Differences in Countermovement Jump Phase Characteristics

    Directory of Open Access Journals (Sweden)

    John J. McMahon


    Full Text Available The countermovement jump (CMJ is commonly used to explore sex differences in neuromuscular function, but previous studies have only reported gross CMJ measures or have partly examined CMJ phase characteristics. The purpose of this study was to explore differences in CMJ phase characteristics between male and female athletes by comparing the force-, power-, velocity-, and displacement-time curves throughout the entire CMJ, in addition to gross measures. Fourteen men and fourteen women performed three CMJs on a force platform from which a range of kinetic and kinematic variables were calculated via forward dynamics. Jump height (JH, reactive strength index modified, relative peak concentric power, and eccentric and concentric displacement, velocity, and relative impulse were all greater for men (g = 0.58–1.79. Relative force-time curves were similar between sexes, but relative power-, velocity-, and displacement-time curves were greater for men at 90%–95% (immediately before and after peak power, 47%–54% (start of eccentric phase and 85%–100% (latter half of concentric phase, and 65%–87% (bottom of countermovement and initial concentric phase of normalized jump time, respectively. The CMJ distinguished between sexes, with men demonstrating greater JH through applying a larger concentric impulse and, thus, achieving greater velocity throughout most of the concentric phase, including take-off.

  4. Jump Squat is More Related to Sprinting and Jumping Abilities than Olympic Push Press. (United States)

    Loturco, I; Kobal, R; Maldonado, T; Piazzi, A F; Bottino, A; Kitamura, K; Abad, C C C; Pereira, L A; Nakamura, F Y


    The aim of this study was to test the relationships between jump squat (JS) and Olympic push press (OPP) power outputs and performance in sprint, squat jump (SJ), countermovement jump (CMJ) and change of direction (COD) speed tests in elite soccer players. 27 athletes performed a maximum power load test to determine their bar mean propulsive power (MPP) and bar mean propulsive velocity (MPV) in the JS and OPP exercises. Magnitude-based inference was used to compare the exercises. The MPV was almost certainly higher in the OPP than in the JS. The MPP relative to body mass (MPP REL) was possibly higher in the OPP. Only the JS MPP REL presented very large correlations with linear speed ( r> 0.7, for speed in 5, 10, 20 and 30 m) and vertical jumping abilities ( r> 0.8, for SJ and CMJ), and moderate correlation with COD speed ( r= 0.45). Although significant (except for COD), the associations between OPP outcomes and field-based measurements (speed, SJ and CMJ) were all moderate, ranging from 0.40 to 0.48. In a group composed of elite soccer players, the JS exercise is more associated with jumping and sprinting abilities than the OPP. Longitudinal studies are needed to confirm if these strong relationships imply superior training effects in favor of the JS exercise. © Georg Thieme Verlag KG Stuttgart · New York.

  5. An efficient interpolation technique for jump proposals in reversible-jump Markov chain Monte Carlo calculations (United States)

    Farr, W. M.; Mandel, I.; Stevens, D.


    Selection among alternative theoretical models given an observed dataset is an important challenge in many areas of physics and astronomy. Reversible-jump Markov chain Monte Carlo (RJMCMC) is an extremely powerful technique for performing Bayesian model selection, but it suffers from a fundamental difficulty and it requires jumps between model parameter spaces, but cannot efficiently explore both parameter spaces at once. Thus, a naive jump between parameter spaces is unlikely to be accepted in the Markov chain Monte Carlo (MCMC) algorithm and convergence is correspondingly slow. Here, we demonstrate an interpolation technique that uses samples from single-model MCMCs to propose intermodel jumps from an approximation to the single-model posterior of the target parameter space. The interpolation technique, based on a kD-tree data structure, is adaptive and efficient in modest dimensionality. We show that our technique leads to improved convergence over naive jumps in an RJMCMC, and compare it to other proposals in the literature to improve the convergence of RJMCMCs. We also demonstrate the use of the same interpolation technique as a way to construct efficient ‘global’ proposal distributions for single-model MCMCs without prior knowledge of the structure of the posterior distribution, and discuss improvements that permit the method to be used in higher dimensional spaces efficiently. PMID:26543580

  6. Force generation and temperature-jump and length-jump tension transients in muscle fibers. (United States)

    Davis, J S; Rodgers, M E


    Muscle tension rises with increasing temperature. The kinetics that govern the tension rise of maximally Ca(2+)-activated, skinned rabbit psoas fibers over a temperature range of 0-30 degrees C was characterized in laser temperature-jump experiments. The kinetic response is simple and can be readily interpreted in terms of a basic three-step mechanism of contraction, which includes a temperature-sensitive rapid preequilibrium(a) linked to a temperature-insensitive rate-limiting step and followed by a temperature-sensitive tension-generating step. These data and mechanism are compared and contrasted with the more complex length-jump Huxley-Simmons phases in which all states that generate tension or bear tension are perturbed. The rate of the Huxley-Simmons phase 4 is temperature sensitive at low temperatures but plateaus at high temperatures, indicating a change in rate-limiting step from a temperature-sensitive (phase 4a) to a temperature-insensitive reaction (phase 4b); the latter appears to correlate with the slow, temperature-insensitive temperature-jump relaxation. Phase 3 is absent in the temperature-jump, which excludes it from tension generation. We confirm that de novo tension generation occurs as an order-disorder transition during phase 2slow and the equivalent, temperature-sensitive temperature-jump relaxation. PMID:7612845

  7. Do Bilateral Vertical Jumps With Reactive Jump Landings Achieve Osteogenic Thresholds With and Without Instruction in Premenopausal Women? (United States)

    Clissold, Tracey L; Winwood, Paul W; Cronin, John B; De Souza, Mary Jane


    Jumps have been investigated as a stimulus for bone development; however, effects of instruction, jump type, and jump-landing techniques need investigation. This study sought to identify whether ground reaction forces (GRFs) for bilateral vertical jumps (countermovement jumps and drop jumps) with reactive jump-landings (ie, jumping immediately after initial jump-landing), with instruction and with instruction withdrawn, achieve magnitudes and rates of strain previously shown to improve bone mass among premenopausal women. Twenty-one women (Mean ± SD: 43.3 ± 5.9 y; 69.4 ± 9.6 kg; 167 ± 5.5 cm; 27.5 ± 8.7% body fat) performed a testing session 'with instruction' followed by a testing session performed 1 week later with 'instruction withdrawn.' The magnitudes (4.59 to 5.49 body weight [BW]) and rates of strain (263 to 359 BW·s -1 ) for the jump-landings, performed on an AMTI force plate, exceeded previously determined thresholds (>3 BWs and >43 BW·s -1 ). Interestingly, significantly larger peak resultant forces, (↑10%; P = .002) and peak rates of force development (↑20%; P jump-landing (postreactive jump). Small increases (ES = 0.22-0.42) in all landing forces were observed in the second jump-landing with 'instruction withdrawn.' These jumps represent a unique training stimulus for premenopausal women and achieve osteogenic thresholds thought prerequisite for bone growth.

  8. Jump Shrug Height and Landing Forces Across Various Loads. (United States)

    Suchomel, Timothy J; Taber, Christopher B; Wright, Glenn A


    The purpose of this study was to examine the effect that load has on the mechanics of the jump shrug. Fifteen track and field and club/intramural athletes (age 21.7 ± 1.3 y, height 180.9 ± 6.6 cm, body mass 84.7 ± 13.2 kg, 1-repetition-maximum (1RM) hang power clean 109.1 ± 17.2 kg) performed repetitions of the jump shrug at 30%, 45%, 65%, and 80% of their 1RM hang power clean. Jump height, peak landing force, and potential energy of the system at jump-shrug apex were compared between loads using a series of 1-way repeated-measures ANOVAs. Statistical differences in jump height (P .05). The greatest magnitudes of jump height, peak landing force, and potential energy of the system at the apex of the jump shrug occurred at 30% 1RM hang power clean and decreased as the external load increased from 45% to 80% 1RM hang power clean. Relationships between peak landing force and potential energy of the system at jump-shrug apex indicate that the landing forces produced during the jump shrug may be due to the landing strategy used by the athletes, especially at lighter loads. Practitioners may prescribe heavier loads during the jump-shrug exercise without viewing landing force as a potential limitation.

  9. Jumping robots: a biomimetic solution to locomotion across rough terrain. (United States)

    Armour, Rhodri; Paskins, Keith; Bowyer, Adrian; Vincent, Julian; Megill, William; Bomphrey, Richard


    This paper introduces jumping robots as a means to traverse rough terrain; such terrain can pose problems for traditional wheeled, tracked and legged designs. The diversity of jumping mechanisms found in nature is explored to support the theory that jumping is a desirable ability for a robot locomotion system to incorporate, and then the size-related constraints are determined from first principles. A series of existing jumping robots are presented and their performance summarized. The authors present two new biologically inspired jumping robots, Jollbot and Glumper, both of which incorporate additional locomotion techniques of rolling and gliding respectively. Jollbot consists of metal hoop springs forming a 300 mm diameter sphere, and when jumping it raises its centre of gravity by 0.22 m and clears a height of 0.18 m. Glumper is of octahedral shape, with four 'legs' that each comprise two 500 mm lengths of CFRP tube articulating around torsion spring 'knees'. It is able to raise its centre of gravity by 1.60 m and clears a height of 1.17 m. The jumping performance of the jumping robot designs presented is discussed and compared against some specialized jumping animals. Specific power output is thought to be the performance-limiting factor for a jumping robot, which requires the maximization of the amount of energy that can be stored together with a minimization of mass. It is demonstrated that this can be achieved through optimization and careful materials selection.

  10. SPIDER: Probing the Early Universe with a Suborbital Polarimeter (United States)

    Fraisse, Aurélien A.; SPIDER Collaboration


    SPIDER is a balloon-borne polarimeter designed to detect a divergence-free polarization pattern ("B-modes") in the Cosmic Microwave Background (CMB). In the inflationary scenario, the spectrum of the tensor perturbations that generate this signal is proportional to that of the primordial scalar perturbations through the tensor-to-scalar ratio r. The expected level of systematic error in the SPIDER instrument is significantly below the amplitude of an interesting cosmological B-mode signal with r=0.03. An optimized scanning strategy enables us to minimize uncertainty in the reconstruction of the Stokes parameters used to characterize the CMB, while providing access to a relatively wide range of angular scales. In the SPIDER field, the polarized emission from interstellar dust is as bright or brighter than the cosmological r=0.03 B-mode signal at all SPIDER frequencies (90, 150, and 280 GHz), a situation similar to that found in the "Southern Hole." Despite this foreground contamination, two 20-day flights of the SPIDER instrument will constrain the amplitude of the B-mode signal to rAPRA-NNX07AL64G), the National Science Foundation (ANT-1043515), the Gordon and Betty Moore Foundation, and the David and Lucile Packard Foundation. Support in Canada is provided by NSERC, the Canadian Space Agency, the Canada Foundation for Innovation, and CIFAR.

  11. Spider Silk as Guiding Biomaterial for Human Model Neurons

    Directory of Open Access Journals (Sweden)

    Frank Roloff


    Full Text Available Over the last years, a number of therapeutic strategies have emerged to promote axonal regeneration. An attractive strategy is the implantation of biodegradable and nonimmunogenic artificial scaffolds into injured peripheral nerves. In previous studies, transplantation of decellularized veins filled with spider silk for bridging critical size nerve defects resulted in axonal regeneration and remyelination by invading endogenous Schwann cells. Detailed interaction of elongating neurons and the spider silk as guidance material is unknown. To visualize direct cellular interactions between spider silk and neurons in vitro, we developed an in vitro crossed silk fiber array. Here, we describe in detail for the first time that human (NT2 model neurons attach to silk scaffolds. Extending neurites can bridge gaps between single silk fibers and elongate afterwards on the neighboring fiber. Culturing human neurons on the silk arrays led to an increasing migration and adhesion of neuronal cell bodies to the spider silk fibers. Within three to four weeks, clustered somata and extending neurites formed ganglion-like cell structures. Microscopic imaging of human neurons on the crossed fiber arrays in vitro will allow for a more efficient development of methods to maximize cell adhesion and neurite growth on spider silk prior to transplantation studies.

  12. Biomimetic calcium phosphate coatings on recombinant spider silk fibres

    Energy Technology Data Exchange (ETDEWEB)

    Yang Liang; Habibovic, Pamela; Van Blitterswijk, Clemens A [Department of Tissue Regeneration, University of Twente, PO Box 217, 7500 AE Enschede (Netherlands); Hedhammar, My; Johansson, Jan [Department of Anatomy, Physiology and Biochemistry, Swedish University of Agricultural Sciences, the Biomedical Centre, Box 575, 751 23 Uppsala (Sweden); Blom, Tobias; Leifer, Klaus [Department of Engineering Sciences, Uppsala University, Box 534, S-751 21 Uppsala (Sweden)


    Calcium phosphate ceramic coatings, applied on surfaces of metallic and polymeric biomaterials, can improve their performance in bone repair and regeneration. Spider silk is biocompatible, strong and elastic, and hence an attractive biomaterial for applications in connective tissue repair. Recently, artificial spider silk, with mechanical and structural characteristics similar to those of native spider silk, has been produced from recombinant minispidroins. In the present study, supersaturated simulated body fluid was used to deposit calcium phosphate coatings on recombinant spider silk fibres. The mineralization process was followed in time using scanning electron microscopy equipped with an energy dispersive x-ray (EDX) detector and Raman spectroscope. Focused ion beam technology was used to produce a cross section of a coated fibre, which was further analysed by EDX. Preliminary in vitro experiments using a culture of bone marrow-derived human mesenchymal stem cells (hMSCs) on coated fibres were also performed. This study showed that recombinant spider silk fibres were successfully coated with a homogeneous and thick crystalline calcium phosphate layer. In the course of the mineralization process from modified simulated body fluid, sodium chloride crystals were first deposited on the silk surface, followed by the deposition of a calcium phosphate layer. The coated silk fibres supported the attachment and growth of hMSCs.

  13. Biomimetic calcium phosphate coatings on recombinant spider silk fibres

    International Nuclear Information System (INIS)

    Yang Liang; Habibovic, Pamela; Van Blitterswijk, Clemens A; Hedhammar, My; Johansson, Jan; Blom, Tobias; Leifer, Klaus


    Calcium phosphate ceramic coatings, applied on surfaces of metallic and polymeric biomaterials, can improve their performance in bone repair and regeneration. Spider silk is biocompatible, strong and elastic, and hence an attractive biomaterial for applications in connective tissue repair. Recently, artificial spider silk, with mechanical and structural characteristics similar to those of native spider silk, has been produced from recombinant minispidroins. In the present study, supersaturated simulated body fluid was used to deposit calcium phosphate coatings on recombinant spider silk fibres. The mineralization process was followed in time using scanning electron microscopy equipped with an energy dispersive x-ray (EDX) detector and Raman spectroscope. Focused ion beam technology was used to produce a cross section of a coated fibre, which was further analysed by EDX. Preliminary in vitro experiments using a culture of bone marrow-derived human mesenchymal stem cells (hMSCs) on coated fibres were also performed. This study showed that recombinant spider silk fibres were successfully coated with a homogeneous and thick crystalline calcium phosphate layer. In the course of the mineralization process from modified simulated body fluid, sodium chloride crystals were first deposited on the silk surface, followed by the deposition of a calcium phosphate layer. The coated silk fibres supported the attachment and growth of hMSCs.

  14. Detection and phylogenetic analysis of bacteriophage WO in spiders (Araneae). (United States)

    Yan, Qian; Qiao, Huping; Gao, Jin; Yun, Yueli; Liu, Fengxiang; Peng, Yu


    Phage WO is a bacteriophage found in Wolbachia. Herein, we represent the first phylogenetic study of WOs that infect spiders (Araneae). Seven species of spiders (Araneus alternidens, Nephila clavata, Hylyphantes graminicola, Prosoponoides sinensis, Pholcus crypticolens, Coleosoma octomaculatum, and Nurscia albofasciata) from six families were infected by Wolbachia and WO, followed by comprehensive sequence analysis. Interestingly, WO could be only detected Wolbachia-infected spiders. The relative infection rates of those seven species of spiders were 75, 100, 88.9, 100, 62.5, 72.7, and 100 %, respectively. Our results indicated that both Wolbachia and WO were found in three different body parts of N. clavata, and WO could be passed to the next generation of H. graminicola by vertical transmission. There were three different sequences for WO infected in A. alternidens and two different WO sequences from C. octomaculatum. Only one sequence of WO was found for the other five species of spiders. The discovered sequence of WO ranged from 239 to 311 bp. Phylogenetic tree was generated using maximum likelihood (ML) based on the orf7 gene sequences. According to the phylogenetic tree, WOs in N. clavata and H. graminicola were clustered in the same group. WOs from A. alternidens (WAlt1) and C. octomaculatum (WOct2) were closely related to another clade, whereas WO in P. sinensis was classified as a sole cluster.

  15. Endemic harvestmen and spiders of Austria (Arachnida: Opiliones, Araneae

    Directory of Open Access Journals (Sweden)

    Komposch, Christian


    Full Text Available A comprehensive overview of plant, fungus and animal species of Austria revealed a total of 748 endemic and subendemic species, including, 11 harvestman and 46 spider species. Altogether two endemic harvestmen (Nemastoma bidentatum relictum, Nemastoma schuelleri and 8 endemic spiders (Abacoproeces molestus, Collinsia (caliginosa nemenziana, Mughiphantes severus, Mughiphantes styriacus, Pelecopsis alpica, Scotophaeus nanus, Troglohyphantes novicordis, Troglohyphantes tauriscus, beside 9 subendemic harvestman and 38 subendemic spider species have been recorded from Austria. Hot-spots of endemism in the Eastern Alps are the north-eastern (Ennstaler Alps and southern Calcareous Alps (Karawanken, Karnische Alps and the Central Alps (Hohe Tauern, Gurktaler Alps, Ötztaler and Stubaier Alps. Most of the endemic arachnid species occur from the nival down to the montane zone. Important habitats are rocky areas, caves and woodlands. High absolute numbers and percentages of endemics can be found within the harvestman families Cladonychiidae, Ischyropsalididae and Nemastomatidae and in the spider genera Lepthyphantes s. l. and Troglohyphantes. The conservation status of these highly endangered taxa – 85 % of the spider species and 100 % of the harvestman taxa are endangered in Austria – is poor.

  16. Radiation Safety System for SPIDER Neutral Beam Accelerator

    International Nuclear Information System (INIS)

    Sandri, S.; Poggi, C.; Coniglio, A.; D'Arienzo, M.


    SPIDER (Source for Production of Ion of Deuterium Extracted from RF Plasma only) and MITICA (Megavolt ITER Injector Concept Advanced) are the ITER neutral beam injector (NBI) testing facilities of the PRIMA (Padova Research Injector Megavolt Accelerated) Center. Both injectors accelerate negative deuterium ions with a maximum energy of 1 MeV for MITICA and 100 keV for SPIDER with a maximum beam current of 40 A for both experiments. The SPIDER facility is classified in Italy as a particle accelerator. At present, the design of the radiation safety system for the facility has been completed and the relevant reports have been presented to the Italian regulatory authorities. Before SPIDER can operate, approval must be obtained from the Italian Regulatory Authority Board (IRAB) following a detailed licensing process. In the present work, the main project information and criteria for the SPIDER injector source are reported together with the analysis of hypothetical accidental situations and safety issues considerations. Neutron and photon nuclear analysis is presented, along with special shielding solutions designed to meet Italian regulatory dose limits. The contribution of activated corrosion products (ACP) to external exposure of workers has also been assessed. Nuclear analysis indicates that the photon contribution to worker external exposure is negligible, and the neutron dose can be considered by far the main radiation protection issue. Our results confirm that the injector has no important radiological impact on the population living around the facility.

  17. Neuromuscular function during drop jumps in young and elderly males. (United States)

    Piirainen, Jarmo M; Linnamo, Vesa; Sippola, Niina; Avela, Janne


    The Hoffman reflex (H-reflex), indicating alpha-motoneuron pool activity, has been shown to be task - and in resting conditions - age dependent. How aging affects H-reflex activity during explosive movements is not clear at present. The purpose of this study was to examine the effects of aging on H-reflexes during drop jumps, and its possible role in drop jump performance. Ten young (26.8 ± 2.7 years) and twenty elderly (64.2 ± 2.7 years) subjects participated in the study. Maximal drop jump performance and soleus H-reflex response (H/M jump) 20 ms after ground contact were measured in a sledge ergometer. Maximal H-reflex, maximal M-wave, Hmax/Mmax-ratio and H-reflex excitability curves were measured during standing rest. Although in young the H-reflex response (Hmax/Mmax) was 6.5% higher during relaxed standing and 19.7% higher during drop jumps (H jump/M jump) than in the elderly group, these differences were not statistically significant. In drop jumps, the elderly subjects had lower jumping height (30.4%, p push-off force (18.0%, p push-off time (31.0% p push-off force (r = 0.833, p push-off time (r = -0.857, p < 0.01) in young but not in the elderly. Correlations between H-reflex response and jumping parameters in young may indicate different jumping and activation strategies in drop jumps. However, it does not fully explain age related differences in jumping performance, since age related differences in H-reflex activity were non-significant. Copyright © 2012 Elsevier Ltd. All rights reserved.

  18. Ski jumping boots limit effective take-off in ski jumping. (United States)

    Virmavirta, M; Komi, P V


    In this study, we measured the vertical and horizontal take-off forces, plantar pressures and activation patterns of four muscles (vastus lateralis, gluteus maximus, tibialis anterior, gastrocnemius) in 10 ski jumpers in simulated laboratory conditions when wearing either training shoes or ski jumping boots. We found significant differences in vertical (P boots condition resulted in a smaller displacement in the final position of the following joint angles: ankle angle (P knee angle (P boots condition, significantly more pressure was recorded under the heel (P knee and hip extensors when wearing jumping boots. We conclude that the stiffness of the structure of the jumping boots may result in a forward shift of pressure, thus limiting the effective vertical force. To avoid this pressure shift, the pattern of movement of simulated take-offs should be carefully controlled, particularly when wearing training shoes.

  19. Effects of attention manipulations on motivated attention to feared and nonfeared negative distracters in spider fear. (United States)

    Norberg, Joakim; Wiens, Stefan


    When people view emotional and neutral pictures, the emotional pictures capture more attention than do neutral pictures. In support, studies with event-related potentials have shown that the early posterior negativity (EPN) and the late positive potential (LPP) to emotional versus neutral pictures are enhanced when pictures are attended. However, this motivated attention decreases when voluntary attention is directed away from the pictures. Most previous studies included only generally emotional pictures of either negative or positive valence. Because people with spider fear report intense fear of spiders, we examined whether directing attention away from emotional pictures at fixation decreases motivated attention less strongly for spiders than for generally negative distracters. We recorded event-related potentials from 128 channels to study whether manipulations of attention (i.e., spatial attention and perceptual load) decrease the EPN and the LPP to emotional distracters less strongly for spiders than for fear-irrelevant negative pictures in people with spider fear. Results confirmed that the EPN and the LPP to spiders (vs. neutral pictures) were particularly enhanced in participants with spider fear compared to participants without spider fear. When attention was directed away from the pictures, the EPN and the LPP to spiders (vs. neutral pictures) decreased similarly in fearful and nonfearful participants. Further, in fearful participants, the decrease in the EPN and the LPP was similar for spiders and for fear-irrelevant negative pictures. Our findings suggest that for people with spider fear, directing attention away from emotional pictures at fixation decreases motivated attention to these distracters similarly for spiders as for fear-irrelevant negative pictures. These findings imply that attention to spiders in spider fear does not exceed the level of attention expected from the spider pictures' high arousal and negative valence (i.e., their intrinsic

  20. Subsocial behaviour and brood adoption in mixed-species colonies of two theridiid spiders

    DEFF Research Database (Denmark)

    Grinsted, Lena; Agnarsson, Ingi; Bilde, Trine


    Cooperation and group living often evolves through kin selection. However, associations between unrelated organisms, such as different species, can evolve if both parties benefit from the interaction. Group living is rare in spiders, but occurs in cooperative, permanently social spiders, as well...... as in territorial, colonial spiders. Mixed species spider colonies, involving closely related species, have rarely been documented. We examined social interactions in newly discovered mixed-species colonies of theridiid spiders on Bali, Indonesia. Our aim was to test the degree of intra- and interspecific tolerance...

  1. Influence of spider silk on refugia preferences of the recluse spiders Loxosceles reclusa and Loxosceles laeta (Araneae: Sicariidae). (United States)

    Vetter, Richard S; Rust, Michael K


    In a previous experimental study, recluse spiders Loxosceles reclusa Gertsch and Mulaik and Loxosceles laeta (Nicolet) (Araneae: Sicariidae) preferred small cardboard refugia covered with conspecific silk compared with never-occupied refugia. Herein, we investigated some factors that might be responsible for this preference using similar cardboard refugia. When the two Loxosceles species were given choices between refugia previously occupied by their own and by the congeneric species, neither showed a species-specific preference; however, each chose refugia coated with conspecific silk rather than those previously inhabited by a distantly related cribellate spider, Metaltella simoni (Keyserling). When L. laeta spiders were offered refugia that were freshly removed from silk donors compared with heated, aged refugia from the same silk donor, older refugia were preferred. Solvent extracts of L. laeta silk were chosen approximately as often as control refugia when a range of solvents (methylene chloride:methanol, water, and hexane) were used. However, when acetone was used on similar silk, there was a statistical preference for the control, indicating that there might be a mildly repellent aspect to acetone-washed silk. Considering the inability to show attraction to chemical aspects of fresh silk, it seems that physical attributes may be more important for selection and that there might be repellency to silk of a recently vacated spider. These findings are discussed in regard to pest management strategies to control recluse spiders.

  2. Prey interception drives web invasion and spider size determines successful web takeover in nocturnal orb-web spiders. (United States)

    Gan, Wenjin; Liu, Shengjie; Yang, Xiaodong; Li, Daiqin; Lei, Chaoliang


    A striking feature of web-building spiders is the use of silk to make webs, mainly for prey capture. However, building a web is energetically expensive and increases the risk of predation. To reduce such costs and still have access to abundant prey, some web-building spiders have evolved web invasion behaviour. In general, no consistent patterns of web invasion have emerged and the factors determining web invasion remain largely unexplored. Here we report web invasion among conspecifics in seven nocturnal species of orb-web spiders, and examined the factors determining the probability of webs that could be invaded and taken over by conspecifics. About 36% of webs were invaded by conspecifics, and 25% of invaded webs were taken over by the invaders. A web that was built higher and intercepted more prey was more likely to be invaded. Once a web was invaded, the smaller the size of the resident spider, the more likely its web would be taken over by the invader. This study suggests that web invasion, as a possible way of reducing costs, may be widespread in nocturnal orb-web spiders. © 2015. Published by The Company of Biologists Ltd.

  3. Prey interception drives web invasion and spider size determines successful web takeover in nocturnal orb-web spiders

    Directory of Open Access Journals (Sweden)

    Wenjin Gan


    Full Text Available A striking feature of web-building spiders is the use of silk to make webs, mainly for prey capture. However, building a web is energetically expensive and increases the risk of predation. To reduce such costs and still have access to abundant prey, some web-building spiders have evolved web invasion behaviour. In general, no consistent patterns of web invasion have emerged and the factors determining web invasion remain largely unexplored. Here we report web invasion among conspecifics in seven nocturnal species of orb-web spiders, and examined the factors determining the probability of webs that could be invaded and taken over by conspecifics. About 36% of webs were invaded by conspecifics, and 25% of invaded webs were taken over by the invaders. A web that was built higher and intercepted more prey was more likely to be invaded. Once a web was invaded, the smaller the size of the resident spider, the more likely its web would be taken over by the invader. This study suggests that web invasion, as a possible way of reducing costs, may be widespread in nocturnal orb-web spiders.

  4. Multivariable control of a rolling spider drone (United States)

    Lyu, Haifeng

    The research and application of Unmanned Aerial Vehicles (UAVs) has been a hot topic recently. A UAV is dened as an aircraft which is designed not to carry a human pilot or operated with remote electronic input by the flight controller. In this thesis, the design of a control system for a quadcopter named Rolling Spider Drone is conducted. The thesis work presents the design of two kinds of controllers that can control the Drone to keep it balanced and track different kinds of input trajectories. The nonlinear mathematical model for the Drone is derived by the Newton-Euler method. The rotational subsystem and translational system are derived to describe the attitude and position motion of Drone. Techniques from linear control theory are employed to linearize the highly coupled and nonlinear quadcopter plant around equilibrium points and apply the linear feedback controller to stabilize the system. The controller is a digital tracking system that deploys LQR for system stability design. Fixed gain and adaptive gain scheduled controllers are developed and compared with different LQR weights. Step references and reference trajectories involving signicant variation for the yaw angle in the xy-plane and three-dimensional spaces are tracked in the simulation. The physical implementation and an output feedback controller are considered for future work.

  5. Efficient Journaling for the Spider Storage System

    Energy Technology Data Exchange (ETDEWEB)

    Oral, H Sarp [ORNL; Wang, Feiyi [ORNL; Shipman, Galen M [ORNL; Dillow, David A [ORNL; Miller, Ross G [ORNL; Drokin, Oleg [ORNL


    Journaling is a widely used technique to increase file system robustness against meta data and/or data corruptions. While the overhead of journaling can be negligible for small-scale file systems, we found that two aspects of local back-end file system journaling significantly lower the overall performance of a large-scale parallel file system such as Lustre: extra head seeks and serialization of incoming client requests. Journal transactions reside on a separate area of the disk that the file data, and each commit of the journal requires a head seek. Incoming client requests become serialized and take a latency hit by waiting for a commit to occur before the reply is sent. In this paper we present two different approaches to increase the local back-end file system journaling efficiency, thus increasing the overall aggregate parallel file system efficiency. First, we present a hardware-based solution where a solid-state device is used as an external journaling device to minimize the disk head seek. Second, we introduce a software-based optimization to allow asynchronously commit multiple journal transactions on the local back-end file system to minimize the penalty of serialization. Both our solutions are experimentally tested on Oak Ridge National Laboratory's large-scale Spider storage system and our tests show that both methods nearly double the overall parallel write performance.

  6. Recombinant Spider Silks—Biopolymers with Potential for Future Applications

    Directory of Open Access Journals (Sweden)

    Thomas Scheibel


    Full Text Available Nature has evolved a range of materials that compete with man-made materials in physical properties; one of these is spider silk. Silk is a fibrous material that exhibits extremely high strength and toughness with regard to its low density. In this review we discuss the molecular structure of spider silk and how this understanding has allowed the development of recombinant silk proteins that mimic the properties of natural spider silks. Additionally, we will explore the material morphologies and the applications of these proteins. Finally, we will look at attempts to combine the silk structure with chemical polymers and how the structure of silk has inspired the engineering of novel polymers.

  7. Synthetic Adhesive Attachment Discs based on Spider Pyriform Silk Architecture (United States)

    Jain, Dharamdeep; Sahni, Vasav; Dhinojwala, Ali


    Among the variety of silks produced by spiders, pyriform silk is used in conjunction with the dragline silk to attach webs to different surfaces. Cob weaver spiders employ different architectural patterns to utilize the pyriform silk and form attachment joints with each pattern having a characteristic adhesive performance. The staple pin architecture is a one of the strongest attachment designs employed by spiders to attach their webs. Here we use a synthetic approach to create the a similar patterned architecture attachment discs on aluminum substrate using thermoplastic polyurethane. Measurable pull off forces are generated when the synthetic discs are peeled off a surface. This innovative adhesive strategy can be a source of design in various biomedical applications. Financial Support from National Science Foundation.

  8. Final design of thermal diagnostic system in SPIDER ion source

    Energy Technology Data Exchange (ETDEWEB)

    Brombin, M., E-mail:; Dalla Palma, M.; Pasqualotto, R.; Pomaro, N. [Consorzio RFX, Corso Stati Uniti 4, I-35127 Padova (Italy)


    The prototype radio frequency source of the ITER heating neutral beams will be first tested in SPIDER test facility to optimize H{sup −} production, cesium dynamics, and overall plasma characteristics. Several diagnostics will allow to fully characterise the beam in terms of uniformity and divergence and the source, besides supporting a safe and controlled operation. In particular, thermal measurements will be used for beam monitoring and system protection. SPIDER will be instrumented with mineral insulated cable thermocouples, both on the grids, on other components of the beam source, and on the rear side of the beam dump water cooled elements. This paper deals with the final design and the technical specification of the thermal sensor diagnostic for SPIDER. In particular the layout of the diagnostic, together with the sensors distribution in the different components, the cables routing and the conditioning and acquisition cubicles are described.

  9. Small Molecules from Spiders Used as Chemical Probes

    DEFF Research Database (Denmark)

    Olsen, Christian Adam; Kristensen, Anders S.; Strømgaard, Kristian


    Spiders are important species in ecological systems and as major predators of insects they are endowed with a plethora of low‐molecular‐weight natural products having intriguing biological activities. The isolation and biological characterization of these entities are well established, however......, only very recently have these compounds been used as templates for the design, synthesis, and biological evaluation of synthetic analogues. In contrast, the investigation of compounds responsible for chemical communication between spiders is far less developed, but recently new light has been shed onto...... the area of pheromones and allomones from spiders. Herein, we recapitulate these recent results, put them into perspective with previous findings, and provide an outlook for future studies of these chemotypes....

  10. Spider Silk Processing for Spidroin Recovery from Crossopriza Lyoni Web (United States)

    Mohtar, J. A.; Ooi, W. L.; Yusuf, F.


    Spider silk is a potential biomaterial that can be used in various applications for its outstanding physicomechanical properties attributed by the spidroin composition. Efforts for commercializing spider silks have been mainly focused on the characterization of spidroins from the Entelegyne spiders for exceptional fibre construction. Hence, studies on silk proteins from the Haplogyne species remain neglected. The aim of this study is to isolate spidroin from Crossopriza lyoni web. Silk processing involved the pretreatment of fibres for the shell layer removal from the surface. A screening study was conducted to analyze the effect of temperature, incubation time and agitation speed on spidroin extraction using Ajisawa’s reagent by OFAT analysis followed by statistical optimization of the extraction process via RSM for maximal protein recovery. All parameters exerted significant effect on spidroin recovery (pspider silk to meet the demand for a variety of silk-based products in the near future.

  11. Final design of thermal diagnostic system in SPIDER ion source

    International Nuclear Information System (INIS)

    Brombin, M.; Dalla Palma, M.; Pasqualotto, R.; Pomaro, N.


    The prototype radio frequency source of the ITER heating neutral beams will be first tested in SPIDER test facility to optimize H"− production, cesium dynamics, and overall plasma characteristics. Several diagnostics will allow to fully characterise the beam in terms of uniformity and divergence and the source, besides supporting a safe and controlled operation. In particular, thermal measurements will be used for beam monitoring and system protection. SPIDER will be instrumented with mineral insulated cable thermocouples, both on the grids, on other components of the beam source, and on the rear side of the beam dump water cooled elements. This paper deals with the final design and the technical specification of the thermal sensor diagnostic for SPIDER. In particular the layout of the diagnostic, together with the sensors distribution in the different components, the cables routing and the conditioning and acquisition cubicles are described.

  12. Analysis for the brazing deformation of AFA3G spider

    International Nuclear Information System (INIS)

    Lin Feng


    Spider, the key component of the AFA3G cluster control assemblies (RCCA), is brazed with body, vanes and fingers. Vacuum brazing is crucial in the spider process and it is directly relevant to the final product quality. This paper analyze the deformation of the AFA3G spider in vacuum brazing procedure based on a large amount of data. The results indicate that the parallelism of the finger is most affected by the brazing and its deformation has obvious regularity. Deformation is mainly caused by the different contraction directions of components along with the interactions among them during cooling process. An optimized design of the brazing fixture based on the regularity and the value of the deformation greatly improves the parallelism of the fingers. Besides, the vacuum brazing procedure also affects the hole diameter of the finger, however, we could reduce the deformation by using columnar pin on the brazing fixture. (author)

  13. Jump Tails, Extreme Dependencies, and the Distribution of Stock Returns

    DEFF Research Database (Denmark)

    Bollerslev, Tim; Todorov, Viktor

    We provide a new framework for estimating the systematic and idiosyncratic jump tail risks in financial asset prices. The theory underlying our estimates are based on in-fill asymptotic arguments for directly identifying the systematic and idiosyncratic jumps, together with conventional long...... market portfolio, we find that the distributions of the systematic and idiosyncratic jumps are both generally heavy-tailed and not necessarily symmetric. Our estimates also point to the existence of strong dependencies between the market-wide jumps and the corresponding systematic jump tails for all...... of the stocks in the sample. We also show how the jump tail dependencies deduced from the high-frequency data together with the day-to-day temporal variation in the volatility are able to explain the “extreme” dependencies vis-a-vis the market portfolio....

  14. Spider fauna of semiarid eastern Colorado agroecosystems: diversity, abundance, and effects of crop intensification. (United States)

    Kerzicnik, Lauren M; Peairs, Frank B; Cushing, Paula E; Draney, Michael L; Merrill, Scott C


    Spiders are critical predators in agroecosystems. Crop management practices can influence predator density and diversity, which, in turn, can influence pest management strategies. Crop intensification is a sustainable agricultural technique that can enhance crop production although optimizing soil moisture. To date, there is no information on how crop intensification affects natural enemy populations, particularly spiders. This study had two objectives: to characterize the abundance and diversity of spiders in eastern Colorado agroecosystems, and to test the hypothesis that spider diversity and density would be higher in wheat (Triticum aestivum L.) in crop-intensified rotations compared with wheat in conventional rotations. We collected spiders through pitfall, vacuum, and lookdown sampling from 2002 to 2007 to test these objectives. Over 11,000 spiders in 19 families from 119 species were captured from all sampling techniques. Interestingly, the hunting spider guild represented 89% of the spider fauna captured from all sites with the families Gnaphosidae and Lycosidae representing 75% of these spiders. Compared with European agroecosystems, these agroecosystems had greater diversity, which can be beneficial for the biological control of pests. Overall, spider densities were low in these semiarid cropping systems, and crop intensification effects on spider densities were not evident at this scale.

  15. Influence of magnetic history on flux jump fields

    International Nuclear Information System (INIS)

    Sosnowski, J.


    A formalism describing the fields at which flux jumps occur in hard superconductors has been confirmed by the description of an experimentally observed shift of flux jump fields in the second hysteresis loop of a Nb 3 Al superconducting sample. By fitting the theoretical model to experimental data, values of the proportionality parameter between the stability limit and the flux jump field, the first stability limit, and the first penetration field have been estimated

  16. Dynamics and stability of directional jumps in the desert locust. (United States)

    Gvirsman, Omer; Kosa, Gabor; Ayali, Amir


    Locusts are known for their ability to jump large distances to avoid predation. The jump also serves to launch the adult locust into the air in order to initiate flight. Various aspects of this important behavior have been studied extensively, from muscle physiology and biomechanics, to the energy storage systems involved in powering the jump, and more. Less well understood are the mechanisms participating in control of the jump trajectory. Here we utilise video monitoring and careful analysis of experimental directional jumps by adult desert locusts, together with dynamic computer simulation, in order to understand how the locusts control the direction and elevation of the jump, the residual angular velocities resulting from the jump and the timing of flapping-flight initiation. Our study confirms and expands early findings regarding the instrumental role of the initial body position and orientation. Both real-jump video analysis and simulations based on our expanded dynamical model demonstrate that the initial body coordinates of position (relative to the hind-legs ground-contact points) are dominant in predicting the jumps' azimuth and elevation angles. We also report a strong linear correlation between the jumps' pitch-angular-velocity and flight initiation timing, such that head downwards rotations lead to earlier wing opening. In addition to offering important insights into the bio-mechanical principles of locust jumping and flight initiation, the findings from this study will be used in designing future prototypes of a bio-inspired miniature jumping robot that will be employed in animal behaviour studies and environmental monitoring applications.

  17. An image filtering technique for SPIDER visible tomography

    Energy Technology Data Exchange (ETDEWEB)

    Fonnesu, N., E-mail:; Agostini, M.; Brombin, M.; Pasqualotto, R.; Serianni, G. [Consorzio RFX, Associazione EURATOM-ENEA sulla Fusione, Corso Stati Uniti 4, I-35127 Padova (Italy)


    The tomographic diagnostic developed for the beam generated in the SPIDER facility (100 keV, 50 A prototype negative ion source of ITER neutral beam injector) will characterize the two-dimensional particle density distribution of the beam. The simulations described in the paper show that instrumental noise has a large influence on the maximum achievable resolution of the diagnostic. To reduce its impact on beam pattern reconstruction, a filtering technique has been adapted and implemented in the tomography code. This technique is applied to the simulated tomographic reconstruction of the SPIDER beam, and the main results are reported.

  18. An image filtering technique for SPIDER visible tomography

    International Nuclear Information System (INIS)

    Fonnesu, N.; Agostini, M.; Brombin, M.; Pasqualotto, R.; Serianni, G.


    The tomographic diagnostic developed for the beam generated in the SPIDER facility (100 keV, 50 A prototype negative ion source of ITER neutral beam injector) will characterize the two-dimensional particle density distribution of the beam. The simulations described in the paper show that instrumental noise has a large influence on the maximum achievable resolution of the diagnostic. To reduce its impact on beam pattern reconstruction, a filtering technique has been adapted and implemented in the tomography code. This technique is applied to the simulated tomographic reconstruction of the SPIDER beam, and the main results are reported

  19. Biomechanics research in ski jumping, 1991-2006. (United States)

    Schwameder, Hermann


    In this paper, I review biomechanics research in ski jumping with a specific focus on publications presented between 1991 and 2006 on performance enhancement, limiting factors of the take-off, specific training and conditioning, aerodynamics, and safety. The first section presents a brief description of ski jumping phases (in-run, take-off, early flight, stable flight, and landing) regarding the biomechanical and functional fundamentals. The most important and frequently used biomechanical methods in ski jumping (kinematics, ground reaction force analyses, muscle activation patterns, aerodynamics) are summarized in the second section. The third section focuses on ski jumping articles and research findings published after the establishment of the V-technique in 1991, as the introduction of this technique has had a major influence on performance enhancement, ski jumping regulations, and the construction of hill profiles. The final section proposes topics for future research in the biomechanics of ski jumping, including: take-off and early flight and the relative roles of vertical velocity and forward somersaulting angular momentum; optimal jumping patterns utilizing the capabilities of individual athletes; development of kinematic and kinetic feedback systems for hill jumps; comparisons of simulated and hill jumps; effect of equipment modifications on performance and safety enhancement.

  20. Jump phenomena. [large amplitude responses of nonlinear systems (United States)

    Reiss, E. L.


    The paper considers jump phenomena composed of large amplitude responses of nonlinear systems caused by small amplitude disturbances. Physical problems where large jumps in the solution amplitude are important features of the response are described, including snap buckling of elastic shells, chemical reactions leading to combustion and explosion, and long-term climatic changes of the earth's atmosphere. A new method of rational functions was then developed which consists of representing the solutions of the jump problems as rational functions of the small disturbance parameter; this method can solve jump problems explicitly.

  1. Effect of drop jump technique on the reactive strength index. (United States)

    Struzik, Artur; Juras, Grzegorz; Pietraszewski, Bogdan; Rokita, Andrzej


    The basic drill of plyometric training aimed at improving lower limb power and jump height is a drop jump. This exercise can be performed using different techniques, which substantially affects jump variables. Therefore, the aim of this study was to compare the values of the reactive strength index (RSI) for countermovement drop jumps (CDJs) and bounce drop jumps (BDJs). The study was carried out in a group of 8 male youth basketball players. The tests were conducted using the AMTI BP600900 force plate to measure ground reaction forces and the Noraxon MyoMotion system to record kinematic data. Each player performed two CDJs and two BDJs from the height of 15, 30, 45 and 60 cm. The RSI was calculated as a ratio of jump height and contact time. Moreover, the RSI was determined for the amortization and take-off phases separately. Significant differences (p jumps from 30, 45 and 60 cm. Differences in RSI values for jumps from 15 cm were not significant. Furthermore, CDJ height values were significantly higher (p jump technique that is commonly performed by basketball players.

  2. Impact of wave phase jumps on stochastic heating

    International Nuclear Information System (INIS)

    Zasenko, V.I.; Zagorodny, A.G.; Cherniak, O.M.


    Interaction of charged particles with fields of random waves brings about known effects of stochastic acceleration and heating. Jumps of wave phases can increase the intensity of these processes substantially. Numerical simulation of particle heating and acceleration by waves with regular phases, waves with jumping phase and stochastic electric field impulses is performed. Comparison of the results shows that to some extent an impact of phase jumps is similar to the action of separate field impulses. Jumps of phase not only increase the intensity of resonant particle heating but involves in this process non-resonant particles from a wide range of initial velocities

  3. Jump Testing and the Speed of Market Adjustment

    DEFF Research Database (Denmark)

    Rasmussen, Torben B.

    Asymptotic properties of jump tests rely on the property that any jump occurs within a single time interval no matter what the observation frequency is. Market microstructure effects in relation to news-induced revaluation of the underlying variable is likely to make this an unrealistic assumption...... for high-frequency transaction data. To capture these microstructure effects, this paper suggests a model in which market prices adjust gradually to jumps in the underlying effcient price. A case study illustrates the empirical relevance of the model, and the performance of different jump tests...

  4. Development of a Minimally Actuated Jumping-Rolling Robot

    Directory of Open Access Journals (Sweden)

    Thanhtam Ho


    Full Text Available This paper presents development of a hybrid mobile robot in order to take advantage of both rolling and jumping locomotion on the ground. According to the unique design of the mechanism, the robot is able to execute both jumping and rolling skilfully by using only one DC motor. Changing the centre of gravity enables rolling of the robot and storage of energy is utilized for jumping. Mechanism design and control logic are validated by computer simulation. Simulation results show that the robot can jump nearly 1.3 times its diameter and roll at the speed of 3.3 times its diameter per second.

  5. Effect of drop jump technique on the reactive strength index

    Directory of Open Access Journals (Sweden)

    Struzik Artur


    Full Text Available The basic drill of plyometric training aimed at improving lower limb power and jump height is a drop jump. This exercise can be performed using different techniques, which substantially affects jump variables. Therefore, the aim of this study was to compare the values of the reactive strength index (RSI for countermovement drop jumps (CDJs and bounce drop jumps (BDJs. The study was carried out in a group of 8 male youth basketball players. The tests were conducted using the AMTI BP600900 force plate to measure ground reaction forces and the Noraxon MyoMotion system to record kinematic data. Each player performed two CDJs and two BDJs from the height of 15, 30, 45 and 60 cm. The RSI was calculated as a ratio of jump height and contact time. Moreover, the RSI was determined for the amortization and take-off phases separately. Significant differences (p < 0.05 between RSI values for CDJs and BDJs were recorded for jumps from 30, 45 and 60 cm. Differences in RSI values for jumps from 15 cm were not significant. Furthermore, CDJ height values were significantly higher (p < 0.05 than the values recorded for BDJs. Times of contact, amortization and take-off during BDJs were significantly shorter (p < 0.05 than the respective values obtained for CDJs. Therefore, the use of the RSI to monitor plyometric training should be based on the drop jump technique that is commonly performed by basketball players.

  6. Volatile compounds from leaves of the African spider plant (Gynandropsis gynandra) with bioactivity against spider mite (Tetranychus urticae)

    DEFF Research Database (Denmark)

    Nyalala, Samuel Odeyo; Petersen, Mikael Agerlin; Grout, Brian William Wilson


    Previous studies have demonstrated that Gynandropsis gynandra emits acetonitrile as a foliar volatile from intact plants and isolated leaves, and that this compound is an effective spider mite repellent. This study has used gas chromatography–mass spectrometry to investigate volatile compounds...... emitted from homogenised G. gynandra leaves to evaluate their tissue acetonitrile content and to look for other compounds that might be exploited for the management of spider mites. Acetonitrile was absent from the homogenised tissues of five lines of G. gynandra, studied over two seasons. Thirteen...... volatile compounds were emitted by G. gynandra at significantly higher levels than mite-susceptible pot roses, including isothiocyanates, aldehydes, esters, alcohols and terpenes. Six representative compounds were selected to assess bioactivity. Spider mite populations were completely inactive after a 2¿h...

  7. Measurement of K-shell absorption jump factors and jump ratios in some lanthanide elements using EDXRF technique

    International Nuclear Information System (INIS)

    Polat, Recep; İçelli, Orhan; Yalçın, Zeynel; Pesen, Erhan; Orak, Salim


    Highlights: ► Mass attenuation coefficients, jump factor and jump ratio for lanthanide elements are obtained. ► The method used in this experiment is combined both transmission and scattering geometry. ► Secondary gamma rays energy is 59.5 keV. ► Experimental values of jump factor and jump ratio for K shell are new. ► The experimental values are in good agreement with those calculated theoretically. - Abstract: 59.5 keV gamma rays scattered by an aluminum foil have been used as a radiation source to measure the absorption jump factor and jump ratios for absorbers Ce, Pr, Nd, Sm, Eu and Tb. The theoretical and experimental values are compared with the corresponding ones in the literature

  8. Locally Perturbed Random Walks with Unbounded Jumps


    Paulin, Daniel; Szász, Domokos


    In \\cite{SzT}, D. Sz\\'asz and A. Telcs have shown that for the diffusively scaled, simple symmetric random walk, weak convergence to the Brownian motion holds even in the case of local impurities if $d \\ge 2$. The extension of their result to finite range random walks is straightforward. Here, however, we are interested in the situation when the random walk has unbounded range. Concretely we generalize the statement of \\cite{SzT} to unbounded random walks whose jump distribution belongs to th...

  9. Multiobjective Optimization Methodology A Jumping Gene Approach

    CERN Document Server

    Tang, KS


    Complex design problems are often governed by a number of performance merits. These markers gauge how good the design is going to be, but can conflict with the performance requirements that must be met. The challenge is reconciling these two requirements. This book introduces a newly developed jumping gene algorithm, designed to address the multi-functional objectives problem and supplies a viably adequate solution in speed. The text presents various multi-objective optimization techniques and provides the technical know-how for obtaining trade-off solutions between solution spread and converg

  10. Determinant Factors of the Squat Jump in Sprinting and Jumping Athletes

    Directory of Open Access Journals (Sweden)

    González-Badillo Juan José


    Full Text Available The aim of this study was to assess the relationship between strength variables and maximum velocity (Vmax in the squat jump (SJ in sprinting and jumping athletes. Thirty-two sprinting and jumping athletes of national level (25.4 ± 4.5 years; 79.4 ± 6.9 kg and 180.4 ± 6.0 cm participated in the study. Vmax in the SJ showed significant relationships with peak force 1 (PF1 (r = 0.82, p ≤ 0.001, peak force 2 (PF2 (r = 0.68, p ≤ 0.001, PF2 by controlling for PF1 (r = 0.30, non-significant, the maximum rate of force development at peak force 1 (RFDmax1 (r = 0.62, p ≤ 0.001, mean RFD 1 (RFDmean1 (r = 0.48, p ≤ 0.01, mean RFD 2 (RFDmean2 (r = 0.70, p ≤ 0.001, force at RFDmax1 (r = 0.36, p ≤ 0.05, force at RFDmax2 (r = 0.83, p ≤ 0.001 and force at RFDmax2 by controlling for PF1 (r = 0.40, p ≤ 0.05. However, Vmax in the SJ was associated negatively with the ratio PF2/PF1 (r = -0.54, p ≤ 0.01, time at peak force 2 (Tp2 (r = -0.64, p ≤ 0.001 and maximum rate of force development at peak force 2 (RFDmax2 (r = -0.71, p ≤ 0.001. These findings indicate that the peak force achieved at the beginning of the movement (PF1 is the main predictor of performance in jumping, although the RFDmax values and the ratio PF2/PF1 are also variables to be taken into account when analyzing the determinant factors of vertical jumping.

  11. Variability of Plyometric and Ballistic Exercise Technique Maintains Jump Performance. (United States)

    Chandler, Phillip T; Greig, Matthew; Comfort, Paul; McMahon, John J


    Chandler, PT, Greig, M, Comfort, P, and McMahon, JJ. Variability of plyometric and ballistic exercise technique maintains jump performance. J Strength Cond Res 32(6): 1571-1582, 2018-The aim of this study was to investigate changes in vertical jump technique over the course of a training session. Twelve plyometric and ballistic exercise-trained male athletes (age = 23.4 ± 4.6 years, body mass = 78.7 ± 18.8 kg, height = 177.1 ± 9.0 cm) performed 3 sets of 10 repetitions of drop jump (DJ), rebound jump (RJ) and squat jump (SJ). Each exercise was analyzed from touchdown to peak joint flexion and peak joint flexion to take-off. Squat jump was analyzed from peak joint flexion to take-off only. Jump height, flexion and extension time and range of motion, and instantaneous angles of the ankle, knee, and hip joints were measured. Separate 1-way repeated analyses of variance compared vertical jump technique across exercise sets and repetitions. Exercise set analysis found that SJ had lower results than DJ and RJ for the angle at peak joint flexion for the hip, knee, and ankle joints and take-off angle of the hip joint. Exercise repetition analysis found that the ankle joint had variable differences for the angle at take-off, flexion, and extension time for RJ. The knee joint had variable differences for flexion time for DJ and angle at take-off and touchdown for RJ. There was no difference in jump height. Variation in measured parameters across repetitions highlights variable technique across plyometric and ballistic exercises. This did not affect jump performance, but likely maintained jump performance by overcoming constraints (e.g., level of rate coding).


    International Nuclear Information System (INIS)

    Nesvorný, David; Vokrouhlický, David; Morbidelli, Alessandro


    Jupiter Trojans are thought to be survivors of a much larger population of planetesimals that existed in the planetary region when planets formed. They can provide important constraints on the mass and properties of the planetesimal disk, and its dispersal during planet migration. Here, we tested a possibility that the Trojans were captured during the early dynamical instability among the outer planets (aka the Nice model), when the semimajor axis of Jupiter was changing as a result of scattering encounters with an ice giant. The capture occurs in this model when Jupiter's orbit and its Lagrange points become radially displaced in a scattering event and fall into a region populated by planetesimals (that previously evolved from their natal transplanetary disk to ∼5 AU during the instability). Our numerical simulations of the new capture model, hereafter jump capture, satisfactorily reproduce the orbital distribution of the Trojans and their total mass. The jump capture is potentially capable of explaining the observed asymmetry in the number of leading and trailing Trojans. We find that the capture probability is (6-8) × 10 –7 for each particle in the original transplanetary disk, implying that the disk contained (3-4) × 10 7 planetesimals with absolute magnitude H disk ∼ 14-28 M Earth , is consistent with the mass deduced from recent dynamical simulations of the planetary instability.

  13. variability in condensed tannins and bitterness in spider plant ...

    African Journals Online (AJOL)


    Spider plant (Cleome gynandra L.) contributes considerably to the nutrition and medicines of communities in southern Africa. However, its utilisation is limited by its bitterness caused by condensed tannins. Unfortunately, processing options that reduce the bitterness also remove nutritionally and medicinally useful ...

  14. Crab spiders (Araeneae: Philodromidae, Thomisidae) of Ramsey County, Minnesota. (United States)

    Daniel. T. Jennings; Bruce Cutler


    Crab spiders of 2 families, 10 genera, and 35 species were collected over a 31-year period in Ramsey County, Minnesota. Rarely collected species included Philodromus keyserlingi, Xysticus pellax, X. chippewa, X. banksi and X. alboniger. Identification source(s), season and collection frequency, and biology are summarized for each species.

  15. Biological control of fruit-tree red spider mite

    NARCIS (Netherlands)

    Rabbinge, R.


    During the last decade, integrated pest control systems have been developed for several crops. One of the main fields of research in integrated control has been the control of orchard pests. Experience with modified spraying programmes in apple orchards, the increasing resistance of spider

  16. Inactivation of complement by Loxosceles reclusa spider venom. (United States)

    Gebel, H M; Finke, J H; Elgert, K D; Cambell, B J; Barrett, J T


    Zymosan depletion of serum complement in guinea pigs rendered them highly resistant to lesion by Loxosceles reclusa spider venom. Guinea pigs deficient in C4 of the complement system are as sensitive to the venom as normal guinea pigs. The injection of 35 micrograms of whole recluse venom intradermally into guinea pigs lowered their complement level by 35.7%. Brown recluse spider venom in concentrations as slight as 0.02 micrograms protein/ml can totally inactivate one CH50 of guinea pig complement in vitro. Bee, scorpion, and other spider venoms had no influence on the hemolytic titer of complement. Fractionation of recluse spider venom by Sephadex G-200 filtration separated the complement-inactivating property of the venom into three major regions which could be distinguished on the basis of heat stability as well as size. None was neutralized by antivenom. Polyacrylamide gel electrophoresis of venom resolved the complement inactivators into five fractions. Complement inactivated by whole venom or the Sephadex fractions could be restored to hemolytic activity by supplements of fresh serum but not by heat-inactivated serum, pure C3, pure C5, or C3 and C5 in combination.

  17. Effects of Packaging and Storage Conditions on Quality of Spider ...

    African Journals Online (AJOL)

    African Journal of Food, Agriculture, Nutrition and Development ... However, quality of spider plant seed is affected by one or more factors that cause negative ... The purpose of this research was to increase insight into how the seed quality of ...

  18. Biotechnological Trends in Spider and Scorpion Antivenom Development

    DEFF Research Database (Denmark)

    Laustsen, Andreas Hougaard; Solà, Mireia; Jappe, Emma Christine


    Spiders and scorpions are notorious for their fearful dispositions and their ability to inject venom into prey and predators, causing symptoms such as necrosis, paralysis, and excruciating pain. Information on venom composition and the toxins present in these species is growing due to an interest...

  19. Spiders (Araneae) as polyphagous natural enemies in orchards

    NARCIS (Netherlands)

    Bogya, S.


    Spiders (Araneae) occur in high abundance in all terrestrial ecosystems including agro-ecosystems. They are a very heterogeneous group of animals with different hunting tactics and therefore they play very different ecological roles. At family level these tactics are rather similar thus

  20. Competition between introduced and native spiders (Araneae: Linyphiidae) (United States)

    Houser, J.D.; Ginsberg, Howard S.; Jakob, Elizabeth M.


    The European sheet-web spider Linyphia triangularis (Araneae: Linyphiidae) has become established in Maine, where it often reaches very high densities. Two lines of evidence from previous work suggest that L. triangularis affects populations of the native linyphiid spider Frontinella communis. First, F. communis individuals are relatively scarce in both forest and coastal habitat where L. triangularis is common, but more common where L. triangularis is at low density. Second, in field experiments, F. communis species are less likely to settle in experimental plots when L. triangularis is present, and F. communis disappears from study plots when L. triangularis is introduced. Here we test two mechanisms that may underlie these patterns. First, we tested whether L. triangularis invades and usurps the webs of F. communis. When spiders were released onto webs of heterospecifics, L. triangularis was more likely to take over or share webs of F. communis than the reverse. We also observed natural takeovers of F. communis webs. Second, we explored the hypothesis that L. triangularis reduces prey availability for native species. We sampled flying prey in areas with L. triangularis and those where it had been removed, and found no effect of spider presence on measured prey density. We also found no effect of prey supplementation on web tenacity in F. communis, suggesting that F. communis movements are not highly dependent on prey availability. We conclude that web takeover is likely more important than prey reduction in driving negative effects of L. triangularis on F. communis.

  1. Determination of PCDDs in spider webs: preliminary studies (United States)

    Rybak, Justyna; Rutkowski, Radosław


    The application of spider webs for determination of polichlorinated dibenzo-para-dioxins (PCDDs) has been studied for the first time. The aim of the studies was to find out if spider webs are suitable for such examinations as it was proved in the previous research they are excellent indicators of air pollutants. Spiders are ubiquitous, thus collection of samples is easy and non-invasive. Studies were conducted within the city of Wrocław and surroundings, one of the biggest and at the same time heaviest polluted city in Poland. Five research sites have been chosen, where spider webs were collected after 60 days of continuous exposure time. Webs belonging to two genera Tegenaria sylvestris and Tegenaria ferruginea (family Agelenidae) have been chosen as they are large and very dense, thus they are very suitable for such examinations. Webs were found to retain dioxins probably mainly by external exposure. These promising results should be continued and expanded in the future research.

  2. The ITER Neutral Beam Test Facility towards SPIDER operation (United States)

    Toigo, V.; Dal Bello, S.; Gaio, E.; Luchetta, A.; Pasqualotto, R.; Zaccaria, P.; Bigi, M.; Chitarin, G.; Marcuzzi, D.; Pomaro, N.; Serianni, G.; Agostinetti, P.; Agostini, M.; Antoni, V.; Aprile, D.; Baltador, C.; Barbisan, M.; Battistella, M.; Boldrin, M.; Brombin, M.; Dalla Palma, M.; De Lorenzi, A.; Delogu, R.; De Muri, M.; Fellin, F.; Ferro, A.; Gambetta, G.; Grando, L.; Jain, P.; Maistrello, A.; Manduchi, G.; Marconato, N.; Pavei, M.; Peruzzo, S.; Pilan, N.; Pimazzoni, A.; Piovan, R.; Recchia, M.; Rizzolo, A.; Sartori, E.; Siragusa, M.; Spada, E.; Spagnolo, S.; Spolaore, M.; Taliercio, C.; Valente, M.; Veltri, P.; Zamengo, A.; Zaniol, B.; Zanotto, L.; Zaupa, M.; Boilson, D.; Graceffa, J.; Svensson, L.; Schunke, B.; Decamps, H.; Urbani, M.; Kushwah, M.; Chareyre, J.; Singh, M.; Bonicelli, T.; Agarici, G.; Garbuglia, A.; Masiello, A.; Paolucci, F.; Simon, M.; Bailly-Maitre, L.; Bragulat, E.; Gomez, G.; Gutierrez, D.; Mico, G.; Moreno, J.-F.; Pilard, V.; Chakraborty, A.; Baruah, U.; Rotti, C.; Patel, H.; Nagaraju, M. V.; Singh, N. P.; Patel, A.; Dhola, H.; Raval, B.; Fantz, U.; Fröschle, M.; Heinemann, B.; Kraus, W.; Nocentini, R.; Riedl, R.; Schiesko, L.; Wimmer, C.; Wünderlich, D.; Cavenago, M.; Croci, G.; Gorini, G.; Rebai, M.; Muraro, A.; Tardocchi, M.; Hemsworth, R.


    SPIDER is one of two projects of the ITER Neutral Beam Test Facility under construction in Padova, Italy, at the Consorzio RFX premises. It will have a 100 keV beam source with a full-size prototype of the radiofrequency ion source for the ITER neutral beam injector (NBI) and also, similar to the ITER diagnostic neutral beam, it is designed to operate with a pulse length of up to 3600 s, featuring an ITER-like magnetic filter field configuration (for high extraction of negative ions) and caesium oven (for high production of negative ions) layout as well as a wide set of diagnostics. These features will allow a reproduction of the ion source operation in ITER, which cannot be done in any other existing test facility. SPIDER realization is well advanced and the first operation is expected at the beginning of 2018, with the mission of achieving the ITER heating and diagnostic NBI ion source requirements and of improving its performance in terms of reliability and availability. This paper mainly focuses on the preparation of the first SPIDER operations—integration and testing of SPIDER components, completion and implementation of diagnostics and control and formulation of operation and research plan, based on a staged strategy.

  3. Remote monitoring of vibrational information in spider webs (United States)

    Mortimer, B.; Soler, A.; Siviour, C. R.; Vollrath, F.


    Spiders are fascinating model species to study information-acquisition strategies, with the web acting as an extension of the animal's body. Here, we compare the strategies of two orb-weaving spiders that acquire information through vibrations transmitted and filtered in the web. Whereas Araneus diadematus monitors web vibration directly on the web, Zygiella x-notata uses a signal thread to remotely monitor web vibration from a retreat, which gives added protection. We assess the implications of these two information-acquisition strategies on the quality of vibration information transfer, using laser Doppler vibrometry to measure vibrations of real webs and finite element analysis in computer models of webs. We observed that the signal thread imposed no biologically relevant time penalty for vibration propagation. However, loss of energy (attenuation) was a cost associated with remote monitoring via a signal thread. The findings have implications for the biological use of vibrations by spiders, including the mechanisms to locate and discriminate between vibration sources. We show that orb-weaver spiders are fascinating examples of organisms that modify their physical environment to shape their information-acquisition strategy.

  4. Multiple origins of subsociality in crab spiders (Thomisidae). (United States)

    Ruch, Jasmin; Riehl, Torben; May-Collado, Laura J; Agnarsson, Ingi


    Determining factors that facilitate the transition from a solitary to a social lifestyle is a major challenge in evolutionary biology, especially in taxa that are usually aggressive towards conspecifics. Most spiders live solitarily and few species are known to be social. Nevertheless, sociality has evolved multiple times across several families and nearly all studied social lineages have originated from a periodically social (subsocial) ancestor. Group-living crab spiders (Thomisidae) are exclusively found in Australia and differ from most other social spiders because they lack a communal capture web. Three of the group-living species were placed in the genus Diaea and another in the genus Xysticus. Most Australian thomisids are, however, difficult to identify as most descriptions are old and of poor quality, and the genera Diaea and Xysticus may not correspond to monophyletic groups. Here, we clarify the phylogenetic relationships of the four group-living Australian thomisids and conclude that amongst these subsociality has evolved two to three times independently. The subsocial Xysticus bimaculatus is not closely related to any of the social Diaea and an independent origin of subsociality is likely in this case. The presented data indicates that within Diaea two origins of subsociality are possible. Our results help to understand the evolution of sociality in thomisids and support the hypothesis that permanent sociality in spiders has evolved multiple times relatively recently from subsocial ancestors. Copyright © 2014 Elsevier Inc. All rights reserved.

  5. Preservice Teachers' Conceptions about Animals and Particularly about Spiders (United States)

    Jambrina, Carmen Urones; Vacas, Jose Manuel; Sanchez-Barbudo, Miguel


    Introduction: This article explores the scientific ideas and alternative conceptions that pre-service teachers have regarding animal classification and spiders in particular. Method: The study involved 40 pre-service teachers of elementary education in Spain and the data was collected by means of questionnaires, descriptions and drawings. The…

  6. Untangling the web...spiders in Arizona fields (United States)

    Many kinds of arthropod natural enemies (predators and parasitoids) inhabit crop fields in Arizona and can have a large negative impact on several pest insect species that also infest these crops. Many different species of spiders are common in cotton, alfalfa and other crops in Arizona. Among the ...

  7. The sejugal furrow in camel spiders and acariform mites

    Directory of Open Access Journals (Sweden)

    Dunlop, Jason A.


    Full Text Available Camel spiders (Arachnida: Solifugae are one of the arachnid groups characterised by a prosomal dorsal shield composed of three distinct elements: the pro-, meso- and metapeltidium. These are associated respectively with prosomal appendages one to four, five, and six. What is less well known, although noted in the historical literature, is that the coxae of the 4th and 5th prosomal segments (i.e. walking legs 2 and 3 of camel spiders are also separated ventrally by a distinct membranous region, which is absent between the coxae of the other legs. We suggest that this essentially ventral division of the prosoma specifically between coxae 2 and 3 is homologous with the so-called sejugal furrow (the sejugal interval sensu van der Hammen. This division constitutes a fundamental part of the body plan in acariform mites (Arachnida: Acariformes. If homologous, this sejugal furrow could represent a further potential synapomorphy for (Solifugae + Acariformes; a relationship with increasing morphological and molecular support. Alternatively, outgroup comparison with sea spiders (Pycnogonida and certain early Palaeozoic fossils could imply that the sejugal furrow defines an older tagma, derived from a more basal grade of organisation. In this scenario the (still divided prosoma of acariform mites and camel spiders would be plesiomorphic. This interpretation challenges the textbook arachnid character of a peltidium (or ‘carapace’ covering an undivided prosoma.

  8. Taxonomic revision of the spider family Penestomidae (Araneae, Entelegynae)

    NARCIS (Netherlands)

    Miller, J.A.; Griswold, C.E.; Haddad, C.R.


    Conflicting character evidence and a scarcity of male specimens has historically made placement of the spider subfamily Penestominae Simon problematic. The Penestominae was recently removed from the family Eresidae and promoted to family rank based on the results of a molecular phylogenetic study; a


    International Nuclear Information System (INIS)

    O'Dea, D. T.; Clark, C. N.; Contaldi, C. R.; Ade, P. A. R.; Amiri, M.; Burger, B.; Davis, G.; Benton, S. J.; Bock, J. J.; Crill, B. P.; Dore, O.; Filippini, J. P.; Bond, J. R.; Farhang, M.; Bonetti, J. A.; Bryan, S.; Chiang, H. C.; Fraisse, A. A.; Fissel, L. M.; Gandilo, N. N.


    SPIDER is a balloon-borne instrument designed to map the polarization of the cosmic microwave background (CMB) with degree-scale resolution over a large fraction of the sky. SPIDER's main goal is to measure the amplitude of primordial gravitational waves through their imprint on the polarization of the CMB if the tensor-to-scalar ratio, r, is greater than 0.03. To achieve this goal, instrumental systematic errors must be controlled with unprecedented accuracy. Here, we build on previous work to use simulations of SPIDER observations to examine the impact of several systematic effects that have been characterized through testing and modeling of various instrument components. In particular, we investigate the impact of the non-ideal spectral response of the half-wave plates, coupling between focal-plane components and Earth's magnetic field, and beam mismatches and asymmetries. We also present a model of diffuse polarized foreground emission based on a three-dimensional model of the Galactic magnetic field and dust, and study the interaction of this foreground emission with our observation strategy and instrumental effects. We find that the expected level of foreground and systematic contamination is sufficiently low for SPIDER to achieve its science goals.

  10. Czech Republic – the type material of spiders (Araneae)

    Czech Academy of Sciences Publication Activity Database

    Růžička, Vlastimil; Kůrka, A.; Buchar, J.; Řezáč, M.


    Roč. 174, 1-4 (2005), s. 13-64 ISSN 0139-9543 R&D Projects: GA AV ČR(CZ) IAA6007401 Institutional research plan: CEZ:AV0Z50070508 Keywords : spider s * type material * Czech Republic Subject RIV: EG - Zoology

  11. On the Colours of Spider Orb-Webs (United States)

    Suhr, Wilfried; Schlichting, H. Joachim


    A sticky capture thread from the spiral element of spider orb-webs is formed of almost regularly spaced droplets that surround a supporting axial fibre. From the perspective of physical optics it represents a periodic linear array of scattering elements that acts as a diffraction grating. This is a novel aspect, which is of vital importance for…

  12. Central European habitats inhabited by spiders with disjunctive distributions

    Czech Academy of Sciences Publication Activity Database

    Růžička, Vlastimil


    Roč. 59, č. 2 (2011), s. 367-380 ISSN 1505-2249 Institutional research plan: CEZ:AV0Z50070508 Keywords : spider s * glacial relicts * boreomontane species Subject RIV: EH - Ecology, Behaviour Impact factor: 0.506, year: 2011

  13. Ballooning behavior in the golden orbweb spider Nephilapilipes (Araneae: Nephilidae

    Directory of Open Access Journals (Sweden)

    Vanessa M.J. Lee


    Full Text Available Ballooning, a mode of aerial dispersal in spiders, is an innate behavior that requires appropriate physiological and meteorological conditions. Although only rarely reported in the golden orbweb spiders, family Nephilidae, the large geographic distributions of most nephilids—in particular of Nephila species—would imply that these spiders likely routinely disperse by ballooning in spite of giant female sizes. Here we study ballooning behavior in the golden orbweb spider Nephila pilipes (Fabricius, 1793. Specifically, we test for the propensity of spiderlings to deploy ballooning as a dispersal mechanism. We subjected a total of 59 first-instar spiderlings to a wind experiment at two wind speeds (2.17 ± 0.02 m s-1 and 3.17 ± 0.02 m s-1 under laboratory conditions. Under an average wind speed of 3.17 m s-1, none of the spiderlings exhibited pre-ballooning or ballooning behavior. However, at an average wind speed of 2.17 m s-1, 53 (89.8% spiderlings showed pre-ballooning behavior, and 17 (32.1% of the pre-ballooners ultimately ballooned. Our results concur with prior reports on spiderlings of other families that pre-ballooning behavior is a requirement for ballooning to occur. Furthermore, although we cannot rule out other dispersal mechanisms such as synanthropic spread, our findings suggest that the widespread N. pilipes uses ballooning to colonize remote oceanic islands.

  14. Mating duration and sperm precedence in the spider Linyphia triangularis

    DEFF Research Database (Denmark)

    Weldingh, Ditte L.; Toft, Søren; Larsen, Ole Næsbye


    , especially the males, are able to influence the outcome of mating for their own benefit. We studied the linyphiid spider Linyphia triangularis in which mating follows a strict sequence during which the male inducts two droplets of sperm and transfers them to the female. We performed sperm competition...

  15. Spider diversity in coffee agroecosystems: the influence of agricultural intensification and aggressive ants. (United States)

    Marín, Linda; Perfecto, Ivette


    Spiders are a very diverse group of invertebrate predators found in agroecosystems and natural systems. However, spider distribution, abundance, and eventually their ecological function in ecosystems can be influenced by abiotic and biotic factors such as agricultural intensification and dominant ants. Here we explore the influence of both agricultural intensification and the dominant arboreal ant Azteca instabilis on the spider community in coffee agroecosystems in southern Mexico. To measure the influence of the arboreal ant Azteca instabilis (F. Smith) on the spider community inhabiting the coffee layer of coffee agroecosystems, spiders were collected from coffee plants that were and were not patrolled by the ant in sites differing in agricultural intensification. For 2008, generalized linear mixed models showed that spider diversity was affected positively by agricultural intensification but not by the ant. However, results suggested that some spider species were associated with A. instabilis. Therefore, in 2009 we concentrated our research on the effect of A. instabilis on spider diversity and composition. For 2009, generalized linear mixed models show that spider richness and abundance per plant were significantly higher in the presence of A. instabilis. In addition, analyses of visual counts of insects and sticky traps data show that more resources were present in plants patrolled by the ant. The positive effect of A. instabilis on spiders seems to be caused by at least two mechanisms: high abundance of insects and protection against predators.

  16. Characteristics of the first recorded spider (Arthropoda: Arachnida fauna from Sheringal, Khyber Pakhtunkhwa, Pakistan

    Directory of Open Access Journals (Sweden)

    Farzana Khan Perveen


    Full Text Available The spiders (order: Aranae are an important environmental indicator and play a significant role as predators in biological control of the most of the key insect pests. The present study was conducted to establish the characteristics of the first recorded spider fauna from Sheringal, Dir Upper (DU, Khyber Pakhtunkhwa (KP, Pakistan during June 2013-July 2014. Their 10 species belong to 7 families, and 10 genera (nt=123: total; ni=77: identified; nui=46: unidentified were recorded in the 6 quadrates, i.e., Daramdala, Doki, Guryaal, Samang, Shahoor and Sia-Sheringal of Sheringal. The largest family was Lycosidae (wolf spiders with respect to size and numbers of specimens collected (n=20, which contained Arctosa littorali Simon, 1897; Hippasa partita Takidar, 1970; Pardosa distincta Backwall, 1867, while the smallest family was Gnphosidae (ground spiders (n=3 with Gnaphosa eucalyptus Ghafoor and Beg, 2002; while other families Sparassidae (huntsman spiders (n=19 Halconia insignis Thorell, 1836, and Isopeda tuhogniga Barrion and Litsinger, 1995, Opilionidae (harvestmen spiders (n=12 Hadrobunus grandis Sundevall, 1833; Pholcidae (cellar spider (n=10 have Crossopriza lyoni Blackwall, 1867; Hersiliidae (two-tailed spiders (n=6 is having Harsilia savignyi Lucas, 1836; (n=5 with Araneus diadematus Clerck, 1757 were recorded. It was concluded that 50% of the spiders collected from the study area were venomous. A detail study is required for further exploration of spider fauna of Sheringal, KP, Pakistan with special reference to their taxonomical, physiological and ecological characteristics.

  17. The world price of jump and volatility risk

    NARCIS (Netherlands)

    Driessen, J.; Maenhout, P.


    Jump and volatility risk are important for understanding equity returns, option pricing and asset allocation. This paper is the first to study international integration of markets for jump and volatility risk, using data on index options for each of the three main global markets: US S&P 500 index

  18. Asymptotic inference for jump diffusions with state-dependent intensity

    NARCIS (Netherlands)

    Becheri, Gaia; Drost, Feico; Werker, Bas


    We establish the local asymptotic normality property for a class of ergodic parametric jump-diffusion processes with state-dependent intensity and known volatility function sampled at high frequency. We prove that the inference problem about the drift and jump parameters is adaptive with respect to

  19. Long multiplication by instruction sequences with backward jump instructions

    NARCIS (Netherlands)

    Bergstra, J.A.; Middelburg, C.A.


    For each function on bit strings, its restriction to bit strings of any given length can be computed by a finite instruction sequence that contains only instructions to set and get the content of Boolean registers, forward jump instructions, and a termination instruction. Backward jump instructions

  20. Knee Muscular Control During Jump Landing in Multidirections. (United States)

    Sinsurin, Komsak; Vachalathiti, Roongtiwa; Jalayondeja, Wattana; Limroongreungrat, Weerawat


    Jump landing is a complex movement in sports. While competing and practicing, athletes frequently perform multi-planar jump landing. Anticipatory muscle activity could influence the amount of knee flexion and prepare the knee for dynamic weight bearing such as landing tasks. The aim of the present study was to examine knee muscle function and knee flexion excursion as athletes naturally performed multi-direction jump landing. Eighteen male athletes performed the jump-landing test in four directions: forward (0°), 30° diagonal, 60° diagonal, and lateral (90°). Muscles tested were vastus medialis (VM), vastus lateralis (VL), rectus femoris (RF), semitendinosus (ST), and biceps femoris (BF). A Vicon(TM) 612 workstation collected the kinematic data. An electromyography was synchronized with the Vicon(TM) Motion system to quantify dynamic muscle function. Repeated measure ANOVA was used to analyze the data. Jump-landing direction significantly influenced (P jump landing. A higher risk of knee injury might occur during lateral jump landing than forward and diagonal directions. Athletes should have more practice in jump landing in lateral direction to avoid injury. Landing technique with high knee flexion in multi-directions should be taught to jumpers for knee injury prevention.

  1. Immediate Effects of Different Trunk Exercise Programs on Jump Performance. (United States)

    Imai, A; Kaneoka, K; Okubo, Y; Shiraki, H


    The aim of this study was to investigate the immediate effects of trunk stabilization exercise (SE) and conventional trunk exercise (CE) programs on jump performance. 13 adolescent male soccer players performed 2 kinds of jump testing before and immediate after 3 experimental conditions: SE, CE, and non-exercise (NE). The SE program consisted of the elbow-toe, hand-knee, and back bridge, and the CE program consisted of the sit-up, sit-up with trunk rotation and back extension. Testing of a countermovement jump (CMJ) and rebound jump (RJ) were performed to assess jump performance. Jump height of the CMJ and RJ-index, contact time, and jump height of the RJ were analyzed. The RJ index was improved significantly only after SE (p=0.017). However, contact time and jump height did not improve significantly in the SE condition. Moreover, no significant interaction or main effects of time or group were observed in the CMJ. Consequently, this study showed the different immediate effect on the RJ between the SE and CE, and suggested the possibility that the SE used in this study is useful as a warm-up program to improve the explosive movements. © Georg Thieme Verlag KG Stuttgart · New York.

  2. A Jump-Diffusion Model with Stochastic Volatility and Durations

    DEFF Research Database (Denmark)

    Wei, Wei; Pelletier, Denis

    jumps in two ways: as exogenous sampling intervals, and through the interaction with volatility. We adopt a bivariate Ornstein-Ulenbeck process to model intraday volatility and conditional duration. We develop a MCMC algorithm for the inference on irregularly spaced multivariate processes with jumps...

  3. Dynamics of force and muscle stimulation in human vertical jumping

    NARCIS (Netherlands)

    Bobbert, M.F.; van Zandwijk, J.P.


    PURPOSE: The purpose of this study was to gain insight into the importance of stimulation dynamics for force development in human vertical jumping. METHODS: Maximum height squat jumps were performed by 21 male subjects. As a measure of signal dynamics, rise time (RT) was used, i.e., the time taken

  4. Role of the hamstrings in human vertical jumping

    NARCIS (Netherlands)

    Bobbert, Maarten F.


    In some human subjects performing maximum-height squat jumps, the EMG-pattern of semitendinosus is bi-phasic and that of biceps femoris is mono-phasic. The purpose of this study was to investigate the roles of biceps femoris and semitendinosus in squat jumping, and to explain why they are different.

  5. Forces exerted by jumping children: A pilot study

    NARCIS (Netherlands)

    Moes, C.C.M.; Bakker, H.E.


    This article reports on a pilot study of the loads exerted vertically by children when jumping. The subjects of the study were 17 children, aged from two to twelve years. Measurements were made using video recordings and a force-plate. The influence of the stiffness of the base and of jumping with

  6. On Pathos Adjacency Cut Vertex Jump Graph of a Tree


    Nagesh.H.M; R.Chandrasekhar


    In this paper the concept of pathos adjacency cut vertex jump graph PJC(T) of a tree T is introduced. We also present a characterization of graphs whose pathos adjacency cut vertex jump graphs are planar, outerplanar, minimally non-outerplanar, Eulerian and Hamiltonian.

  7. Teaching Jump Rope to Children with Visual Impairments (United States)

    Lieberman, Lauren J.; Schedlin, Haley; Pierce, Tristan


    This article presents strategies for jumping rope for children with visual impairments. Giving choices related to the types of rope and the use of mats is important. In addition, using appropriate instructional strategies and modifications will make jumping rope a skill that the children will enjoy and will lead to their involvement in other…

  8. The validity and reliability of the my jump 2 app for measuring the reactive strength index and drop jump performance. (United States)

    Haynes, Tom; Bishop, Chris; Antrobus, Mark; Brazier, Jon


    This is the first study to independently assess the concurrent validity and reliability of the My Jump 2 app for measuring drop jump performance. It is also the first to evaluate the app's ability to measure the reactive strength index (RSI). Fourteen male sport science students (age: 29.5 ± 9.9 years) performed three drop jumps from 20 cm and 40 cm (totalling 84 jumps), assessed via a force platform and the My Jump 2 app. Reported metrics included reactive strength index, jump height, ground contact time, and mean power. Measurements from both devices were compared using the intraclass correlation coefficient (ICC), Pearson product moment correlation coefficient (r), Cronbach's alpha (α), coefficient of variation (CV) and BlandAltman plots. Near perfect agreement was seen between devices at 20 cm for RSI (ICC = 0.95) and contact time (ICC = 0.99) and at 40 cm for RSI (ICC = 0.98), jump height (ICC = 0.96) and contact time (ICC = 0.92); with very strong agreement seen at 20 cm for jump height (ICC = 0.80). In comparison with the force plate the app showed good validity for RSI (20 cm: r = 0.94; 40 cm; r = 0.97), jump height (20 cm: r = 0.80; 40 cm; r = 0.96) and contact time (20 cm = 0.96; 40 cm; r = 0.98). The results of the present study show that the My Jump 2 app is a valid and reliable tool for assessing drop jump performance.

  9. Control strategy of maximum vertical jumps: The preferred countermovement depth may not be fully optimized for jump height

    Directory of Open Access Journals (Sweden)

    Mandic Radivoj


    Full Text Available The aim of the present study was to explore the control strategy of maximum countermovement jumps regarding the preferred countermovement depth preceding the concentric jump phase. Elite basketball players and physically active non-athletes were tested on the jumps performed with and without an arm swing, while the countermovement depth was varied within the interval of almost 30 cm around its preferred value. The results consistently revealed 5.1-11.2 cm smaller countermovement depth than the optimum one, but the same difference was more prominent in non-athletes. In addition, although the same differences revealed a marked effect on the recorded force and power output, they reduced jump height for only 0.1-1.2 cm. Therefore, the studied control strategy may not be based solely on the countermovement depth that maximizes jump height. In addition, the comparison of the two groups does not support the concept of a dual-task strategy based on the trade-off between maximizing jump height and minimizing the jumping quickness that should be more prominent in the athletes that routinely need to jump quickly. Further research could explore whether the observed phenomenon is based on other optimization principles, such as the minimization of effort and energy expenditure. Nevertheless, future routine testing procedures should take into account that the control strategy of maximum countermovement jumps is not fully based on maximizing the jump height, while the countermovement depth markedly confound the relationship between the jump height and the assessed force and power output of leg muscles.

  10. Control strategy of maximum vertical jumps: The preferred countermovement depth may not be fully optimized for jump height. (United States)

    Mandic, Radivoj; Knezevic, Olivera M; Mirkov, Dragan M; Jaric, Slobodan


    The aim of the present study was to explore the control strategy of maximum countermovement jumps regarding the preferred countermovement depth preceding the concentric jump phase. Elite basketball players and physically active non-athletes were tested on the jumps performed with and without an arm swing, while the countermovement depth was varied within the interval of almost 30 cm around its preferred value. The results consistently revealed 5.1-11.2 cm smaller countermovement depth than the optimum one, but the same difference was more prominent in non-athletes. In addition, although the same differences revealed a marked effect on the recorded force and power output, they reduced jump height for only 0.1-1.2 cm. Therefore, the studied control strategy may not be based solely on the countermovement depth that maximizes jump height. In addition, the comparison of the two groups does not support the concept of a dual-task strategy based on the trade-off between maximizing jump height and minimizing the jumping quickness that should be more prominent in the athletes that routinely need to jump quickly. Further research could explore whether the observed phenomenon is based on other optimization principles, such as the minimization of effort and energy expenditure. Nevertheless, future routine testing procedures should take into account that the control strategy of maximum countermovement jumps is not fully based on maximizing the jump height, while the countermovement depth markedly confound the relationship between the jump height and the assessed force and power output of leg muscles.

  11. Option Valuation with Observable Volatility and Jump Dynamics

    DEFF Research Database (Denmark)

    Christoffersen, Peter; Feunou, Bruno; Jeon, Yoontae

    Under very general conditions, the total quadratic variation of a jump-diffusion process can be decomposed into diffusive volatility and squared jump variation. We use this result to develop a new option valuation model in which the underlying asset price exhibits volatility and jump intensity...... dynamics. The volatility and jump intensity dynamics in the model are directly driven by model-free empirical measures of diffusive volatility and jump variation. Because the empirical measures are observed in discrete intervals, our option valuation model is cast in discrete time, allowing...... for straightforward filtering and estimation of the model. Our model belongs to the affine class enabling us to derive the conditional characteristic function so that option values can be computed rapidly without simulation. When estimated on S&P500 index options and returns the new model performs well compared...

  12. Nonstandard jump functions for radically symmetric shock waves

    International Nuclear Information System (INIS)

    Baty, Roy S.; Tucker, Don H.; Stanescu, Dan


    Nonstandard analysis is applied to derive generalized jump functions for radially symmetric, one-dimensional, magnetogasdynamic shock waves. It is assumed that the shock wave jumps occur on infinitesimal intervals and the jump functions for the physical parameters occur smoothly across these intervals. Locally integrable predistributions of the Heaviside function are used to model the flow variables across a shock wave. The equations of motion expressed in nonconservative form are then applied to derive unambiguous relationships between the jump functions for the physical parameters for two families of self-similar flows. It is shown that the microstructures for these families of radially symmetric, magnetogasdynamic shock waves coincide in a nonstandard sense for a specified density jump function.

  13. Study of brittle crack jump rate using acoustic emission method

    International Nuclear Information System (INIS)

    Yasnij, P.V.; Pokrovskij, V.V.; Strizhalo, V.A.; Dobrovol'skij, Yu.V.


    A new peocedure is elaborated to detect brittle jumps of small length (0.1...5mm) occuring both inside the specimen and along the crack front under static and cyclic loading using the phenomena of acoustic emission (AE). Recording of the crack start and stop moments with an AE sensor as well as evaluation of the brittle crack jump length by the after-failure specimen fracture make it possible to find the mean crack propagation rate. Experimental dependences are obtained for the crack propagation rate with a brittle crack jump in steel 15Kh2MFA (σ B =1157 MPa, σ 0.2 =100 MPa) at 293 K and under cyclic loading as a function of the jump length and also as a function of the critical stress intensity factor K jc i corresponding to the crack jump

  14. Approaching stationarity: competition between long jumps and long waiting times

    International Nuclear Information System (INIS)

    Dybiec, Bartłomiej


    Within the continuous-time random walk (CTRW) scenarios, properties of the overall motion are determined by the waiting time and the jump length distributions. In the decoupled case, with power-law distributed waiting times and jump lengths, the CTRW scenario is asymptotically described by the double (space and time) fractional Fokker–Planck equation. Properties of a system described by such an equation are determined by the subdiffusion parameter and the jump length exponent. Nevertheless, the stationary state is determined solely by the jump length distribution and the potential. The waiting time distribution determines only the rate of convergence to the stationary state. Here, we inspect the competition between long waiting times and long jumps and how this competition is reflected in the way in which a stationary state is reached. In particular, we show that the distance between a time-dependent and a stationary solution changes in time as a double power law

  15. The hydraulic jump and ripples in liquid helium

    International Nuclear Information System (INIS)

    Rolley, E.; Guthmann, C.; Pettersen, M.S.


    We have studied the characteristics of the circular hydraulic jump using liquid helium. Surprisingly, the radius of the jump does not change at the superfluid transition. We think that the flow is still dissipative below the lambda point because the velocity exceeds the critical one. The jump radius R j is compared with various models. In our parameter range, we find that the jump can be treated as a shock, and that capillary effects are important. Below the superfluid transition, we observed a standing capillary wave between the impact of the jet and the jump. Assuming that the superfluid flow can be described with an effective viscosity, we calculate the wave vector and thus obtain the value of the liquid thickness, which is in reasonable agreement with predictions. However, the spatial variation of the wave amplitude depends much more strongly on temperature than we calculate

  16. Ballistic Jumping Drops on Superhydrophobic Surfaces via Electrostatic Manipulation. (United States)

    Li, Ning; Wu, Lei; Yu, Cunlong; Dai, Haoyu; Wang, Ting; Dong, Zhichao; Jiang, Lei


    The ballistic ejection of liquid drops by electrostatic manipulating has both fundamental and practical implications, from raindrops in thunderclouds to self-cleaning, anti-icing, condensation, and heat transfer enhancements. In this paper, the ballistic jumping behavior of liquid drops from a superhydrophobic surface is investigated. Powered by the repulsion of the same kind of charges, water drops can jump from the surface. The electrostatic acting time for the jumping of a microliter supercooled drop only takes several milliseconds, even shorter than the time for icing. In addition, one can control the ballistic jumping direction precisely by the relative position above the electrostatic field. The approach offers a facile method that can be used to manipulate the ballistic drop jumping via an electrostatic field, opening the possibility of energy efficient drop detaching techniques in various applications. © 2018 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  17. Synthetic Spider Silk Production on a Laboratory Scale (United States)

    Hsia, Yang; Gnesa, Eric; Pacheco, Ryan; Kohler, Kristin; Jeffery, Felicia; Vierra, Craig


    As society progresses and resources become scarcer, it is becoming increasingly important to cultivate new technologies that engineer next generation biomaterials with high performance properties. The development of these new structural materials must be rapid, cost-efficient and involve processing methodologies and products that are environmentally friendly and sustainable. Spiders spin a multitude of different fiber types with diverse mechanical properties, offering a rich source of next generation engineering materials for biomimicry that rival the best manmade and natural materials. Since the collection of large quantities of natural spider silk is impractical, synthetic silk production has the ability to provide scientists with access to an unlimited supply of threads. Therefore, if the spinning process can be streamlined and perfected, artificial spider fibers have the potential use for a broad range of applications ranging from body armor, surgical sutures, ropes and cables, tires, strings for musical instruments, and composites for aviation and aerospace technology. In order to advance the synthetic silk production process and to yield fibers that display low variance in their material properties from spin to spin, we developed a wet-spinning protocol that integrates expression of recombinant spider silk proteins in bacteria, purification and concentration of the proteins, followed by fiber extrusion and a mechanical post-spin treatment. This is the first visual representation that reveals a step-by-step process to spin and analyze artificial silk fibers on a laboratory scale. It also provides details to minimize the introduction of variability among fibers spun from the same spinning dope. Collectively, these methods will propel the process of artificial silk production, leading to higher quality fibers that surpass natural spider silks. PMID:22847722

  18. Brown Spider (Loxosceles genus Venom Toxins: Tools for Biological Purposes

    Directory of Open Access Journals (Sweden)

    Andrea Senff-Ribeiro


    Full Text Available Venomous animals use their venoms as tools for defense or predation. These venoms are complex mixtures, mainly enriched of proteic toxins or peptides with several, and different, biological activities. In general, spider venom is rich in biologically active molecules that are useful in experimental protocols for pharmacology, biochemistry, cell biology and immunology, as well as putative tools for biotechnology and industries. Spider venoms have recently garnered much attention from several research groups worldwide. Brown spider (Loxosceles genus venom is enriched in low molecular mass proteins (5–40 kDa. Although their venom is produced in minute volumes (a few microliters, and contain only tens of micrograms of protein, the use of techniques based on molecular biology and proteomic analysis has afforded rational projects in the area and permitted the discovery and identification of a great number of novel toxins. The brown spider phospholipase-D family is undoubtedly the most investigated and characterized, although other important toxins, such as low molecular mass insecticidal peptides, metalloproteases and hyaluronidases have also been identified and featured in literature. The molecular pathways of the action of these toxins have been reported and brought new insights in the field of biotechnology. Herein, we shall see how recent reports describing discoveries in the area of brown spider venom have expanded biotechnological uses of molecules identified in these venoms, with special emphasis on the construction of a cDNA library for venom glands, transcriptome analysis, proteomic projects, recombinant expression of different proteic toxins, and finally structural descriptions based on crystallography of toxins.

  19. Global patterns of guild composition and functional diversity of spiders.

    Directory of Open Access Journals (Sweden)

    Pedro Cardoso

    Full Text Available The objectives of this work are: (1 to define spider guilds for all extant families worldwide; (2 test if guilds defined at family level are good surrogates of species guilds; (3 compare the taxonomic and guild composition of spider assemblages from different parts of the world; (4 compare the taxonomic and functional diversity of spider assemblages and; (5 relate functional diversity with habitat structure. Data on foraging strategy, prey range, vertical stratification and circadian activity was collected for 108 families. Spider guilds were defined by hierarchical clustering. We searched for inconsistencies between family guild placement and the known guild of each species. Richness and abundance per guild before and after correcting guild placement were compared, as were the proportions of each guild and family between all possible pairs of sites. Functional diversity per site was calculated based on hierarchical clustering. Eight guilds were discriminated: (1 sensing, (2 sheet, (3 space, and (4 orb web weavers; (5 specialists; (6 ambush, (7 ground, and (8 other hunters. Sixteen percent of the species richness corresponding to 11% of all captured individuals was incorrectly attributed to a guild by family surrogacy; however, the correlation of uncorrected vs. corrected guilds was invariably high. The correlation of guild richness or abundances was generally higher than the correlation of family richness or abundances. Functional diversity was not always higher in the tropics than in temperate regions. Families may potentially serve as ecological surrogates for species. Different families may present similar roles in the ecosystems, with replacement of some taxa by other within the same guild. Spiders in tropical regions seem to have higher redundancy of functional roles and/or finer resource partitioning than in temperate regions. Although species and family diversity were higher in the tropics, functional diversity seems to be also


    Directory of Open Access Journals (Sweden)

    Alexander V. Ponomarev


    Full Text Available Aim. Until recently, spider fauna of the Republic of South Ossetia has been the least studied among the regional araneofaunas of the Caucasus. According to the literature data, as little as 30 spider species have been known from the republic’s territory (Mkheidze, 1997, Mikhailov, 1990; Ponomarev, Dvadnenko, 2013; Trilicauscas, Komarov, 2014. Therefore, the aim of the present article is to summarize available data on the spider fauna of South Ossetia.Location. Republic of South Ossetia.Methods. The material was collected in various districts of South Ossetia in 2011-2014 by Yu.E. Komarov. Mainly, the collecting was performed in the city of Tskhinvali and its environs, and in the South Ossetian State Reserve. Spiders were sampled with pitfall traps and sweep netting. The time of traps’ exposure is April–December.Results and main conclusions. To date, the spider fauna of the Republic of South Ossetia includes 230 species from 29 families. 222 species were registered by the authors, eight species (Clubiona pseudosimilis, Gnaphosa lugubris, Linyphia hortensis, Neriene peltata, Geolycosa vultuosa, Pardosa azerifalcata, Ero aphana, and Philodromus rufus are known from the literature only. Seven species are new to the Caucasus (Clubiona pseudosimilis, Gnaphosa lugubris, Linyphia hortensis, Neriene peltata, Geolycosa vultuosa, Pardosa azerifalcata, Ero aphana, and Philodromus rufus. Of these, two species were known earlier only from Turkey (Pardosa consimilis, Ozyptila spirembolus, and one species (Tegenaria pseudolyncea only from Azerbaijan. Against the background of the widespread species predominance, the Caucasian element is small and presented by twelve species (Tegenaria pseudolyncea, Dysdera tkibuliensis, Haplodrassus caucasius, Zelotes khostensis, Mansuphantes ovalis, Sintula oseticus, Tenuiphantes teberdaensis, Pardosa azerifalcata, P. caucasica, Piratula hurkai, Trochosa cachetiensis, and Xysticus ukrainicus.

  1. Competitive interactions between a native spider (Frontinella communis, Araneae: Linyphiidae) and an invasive spider (Linyphia triangularis, Araneae: Linyphiidae) (United States)

    Bednarski, Julie V.; Ginsberg, Howard S.; Jakob, Elizabeth M.


    There are numerous reports of spiders that have become established outside of their native ranges, but few studies examine their impact on native spiders. We examined the effect of the European hammock spider Linyphia triangularis (Araneae, Linyphiidae) on the native bowl-and-doily spider Frontinella communis (Araneae, Linyphiidae) in Acadia National Park, Maine, USA. First, we added L. triangularis to established plots of F. communis. Significantly more F. communis abandoned their webs when L. triangularis were added compared to control plots. Second, we tested whether F. communis were deterred from building webs in areas where L. triangularis was established. Significantly fewer F. communis built webs on plots with L. triangularis than on control plots. In both experiments, L. triangularis sometimes took over webs of F. communis or incorporated F. communis webs into their own webs, but F. communisnever took over or incorporated L. triangularis webs. Competition between L. triangularis and F. communis for both webs and web sites may contribute to the decline of F. communis.

  2. Dynamics and stability of directional jumps in the desert locust

    Directory of Open Access Journals (Sweden)

    Omer Gvirsman


    Full Text Available Locusts are known for their ability to jump large distances to avoid predation. The jump also serves to launch the adult locust into the air in order to initiate flight. Various aspects of this important behavior have been studied extensively, from muscle physiology and biomechanics, to the energy storage systems involved in powering the jump, and more. Less well understood are the mechanisms participating in control of the jump trajectory. Here we utilise video monitoring and careful analysis of experimental directional jumps by adult desert locusts, together with dynamic computer simulation, in order to understand how the locusts control the direction and elevation of the jump, the residual angular velocities resulting from the jump and the timing of flapping-flight initiation. Our study confirms and expands early findings regarding the instrumental role of the initial body position and orientation. Both real-jump video analysis and simulations based on our expanded dynamical model demonstrate that the initial body coordinates of position (relative to the hind-legs ground-contact points are dominant in predicting the jumps’ azimuth and elevation angles. We also report a strong linear correlation between the jumps’ pitch-angular-velocity and flight initiation timing, such that head downwards rotations lead to earlier wing opening. In addition to offering important insights into the bio-mechanical principles of locust jumping and flight initiation, the findings from this study will be used in designing future prototypes of a bio-inspired miniature jumping robot that will be employed in animal behaviour studies and environmental monitoring applications.

  3. Effects of Isometric Scaling on Vertical Jumping Performance (United States)

    Bobbert, Maarten F.


    Jump height, defined as vertical displacement in the airborne phase, depends on vertical takeoff velocity. For centuries, researchers have speculated on how jump height is affected by body size and many have adhered to what has come to be known as Borelli’s law, which states that jump height does not depend on body size per se. The underlying assumption is that the amount of work produced per kg body mass during the push-off is independent of size. However, if a big body is isometrically downscaled to a small body, the latter requires higher joint angular velocities to achieve a given takeoff velocity and work production will be more impaired by the force-velocity relationship of muscle. In the present study, the effects of pure isometric scaling on vertical jumping performance were investigated using a biologically realistic model of the human musculoskeletal system. The input of the model, muscle stimulation over time, was optimized using jump height as criterion. It was found that when the human model was miniaturized to the size of a mouse lemur, with a mass of about one-thousandth that of a human, jump height dropped from 40 cm to only 6 cm, mainly because of the force-velocity relationship. In reality, mouse lemurs achieve jump heights of about 33 cm. By implication, the unfavourable effects of the small body size of mouse lemurs on jumping performance must be counteracted by favourable effects of morphological and physiological adaptations. The same holds true for other small jumping animals. The simulations for the first time expose and explain the sheer magnitude of the isolated effects of isometric downscaling on jumping performance, to be counteracted by morphological and physiological adaptations. PMID:23936494

  4. Effects of isometric scaling on vertical jumping performance.

    Directory of Open Access Journals (Sweden)

    Maarten F Bobbert

    Full Text Available Jump height, defined as vertical displacement in the airborne phase, depends on vertical takeoff velocity. For centuries, researchers have speculated on how jump height is affected by body size and many have adhered to what has come to be known as Borelli's law, which states that jump height does not depend on body size per se. The underlying assumption is that the amount of work produced per kg body mass during the push-off is independent of size. However, if a big body is isometrically downscaled to a small body, the latter requires higher joint angular velocities to achieve a given takeoff velocity and work production will be more impaired by the force-velocity relationship of muscle. In the present study, the effects of pure isometric scaling on vertical jumping performance were investigated using a biologically realistic model of the human musculoskeletal system. The input of the model, muscle stimulation over time, was optimized using jump height as criterion. It was found that when the human model was miniaturized to the size of a mouse lemur, with a mass of about one-thousandth that of a human, jump height dropped from 40 cm to only 6 cm, mainly because of the force-velocity relationship. In reality, mouse lemurs achieve jump heights of about 33 cm. By implication, the unfavourable effects of the small body size of mouse lemurs on jumping performance must be counteracted by favourable effects of morphological and physiological adaptations. The same holds true for other small jumping animals. The simulations for the first time expose and explain the sheer magnitude of the isolated effects of isometric downscaling on jumping performance, to be counteracted by morphological and physiological adaptations.

  5. Measurement of L3 subshell absorption jump ratios and jump factors for high Z elements using EDXRF technique

    International Nuclear Information System (INIS)

    Kaçal, M.R.


    Energy dispersive X-ray fluorescence technique (EDXRF) has been employed for measuring L 3 -subshell absorption jump ratios, r L 3 and jump factors, J L 3 for high Z elements. Jump factors and jump ratios for these elements have been determined by measuring L 3 subshell fluorescence parameters such as L 3 subshell X-ray production cross section σ L 3 , L 3 subshell fluorescence yield, ω L 3 , total L 3 subshell and higher subshells photoionization cross section σ L T . Measurements were performed using a Cd-109 radioactive point source and an Si(Li) detector in direct excitation experimental geometry. Measured values for jump factors and jump ratios have been compared with theoretically calculated and other experimental values. - Highlights: • This paper regards L 3 subshell absorption jump ratios and jump factors using the EDXRF method. • These parameters were measured using a new method. • This method is more useful than other methods which require much effort. • Results are in good agreement with theoretical and experimental values


    Directory of Open Access Journals (Sweden)

    Jorge Enrique Mayta Guillermo


    Full Text Available In this work we will analyze the stability of linear systems governed by a Markov chain, this family is known in the specialized literature as linear systems with Markov jumps or by its acronyms in English MJLS as it is denoted in [1]. Linear systems governed by a Markov chain are dynamic systems with abrupt changes. We give some denitions of stability for the MJLS system, where these types of stability are equivalent as long as the state space of the Markov chain is nite. Finally we present a theorem that characterizes the stochastic stability by means of an equation of the Lyapunov type. The result is a generalization of a theorem in classical theory.

  7. Seismic tomography with the reversible jump algorithm (United States)

    Bodin, Thomas; Sambridge, Malcolm


    The reversible jump algorithm is a statistical method for Bayesian inference with a variable number of unknowns. Here, we apply this method to the seismic tomography problem. The approach lets us consider the issue of model parametrization (i.e. the way of discretizing the velocity field) as part of the inversion process. The model is parametrized using Voronoi cells with mobile geometry and number. The size, position and shape of the cells defining the velocity model are directly determined by the data. The inverse problem is tackled within a Bayesian framework and explicit regularization of model parameters is not required. The mobile position and number of cells means that global damping procedures, controlled by an optimal regularization parameter, are avoided. Many velocity models with variable numbers of cells are generated via a transdimensional Markov chain and information is extracted from the ensemble as a whole. As an aid to interpretation we visualize the expected earth model that is obtained via Monte Carlo integration in a straightforward manner. The procedure is particularly adept at imaging rapid changes or discontinuities in wave speed. While each velocity model in the final ensemble consists of many discontinuities at cell boundaries, these are smoothed out in the averaged ensemble solution while those required by the data are reinforced. The ensemble of models can also be used to produce uncertainty estimates and experiments with synthetic data suggest that they represent actual uncertainty surprisingly well. We use the fast marching method in order to iteratively update the ray geometry and account for the non-linearity of the problem. The method is tested here with synthetic data in a 2-D application and compared with a subspace method that is a more standard matrix-based inversion scheme. Preliminary results illustrate the advantages of the reversible jump algorithm. A real data example is also shown where a tomographic image of Rayleigh wave

  8. Invited review current progress and limitations of spider silk for biomedical applications. (United States)

    Widhe, Mona; Johansson, Jan; Hedhammar, My; Rising, Anna


    Spider silk is a fascinating material combining remarkable mechanical properties with low density and biodegradability. Because of these properties and historical descriptions of medical applications, spider silk has been proposed to be the ideal biomaterial. However, overcoming the obstacles to produce spider silk in sufficient quantities and in a manner that meets regulatory demands has proven to be a difficult task. Also, there are relatively few studies of spider silk in biomedical applications available, and the methods and materials used vary a lot. Herein we summarize cell culture- and in vivo implantation studies of natural and synthetic spider silk, and also review the current status and future challenges in the quest for a large scale production of spider silk for medical applications. Copyright © 2011 Wiley Periodicals, Inc.

  9. Research on Artificial Spider Web Model for Farmland Wireless Sensor Network

    Directory of Open Access Journals (Sweden)

    Jun Wang


    Full Text Available Through systematic analysis of the structural characteristics and invulnerability of spider web, this paper explores the possibility of combining the advantages of spider web such as network robustness and invulnerability with farmland wireless sensor network. A universally applicable definition and mathematical model of artificial spider web structure are established. The comparison between artificial spider web and traditional networks is discussed in detail. The simulation result shows that the networking structure of artificial spider web is better than that of traditional networks in terms of improving the overall reliability and invulnerability of communication system. A comprehensive study on the advantage characteristics of spider web has important theoretical and practical significance for promoting the invulnerability research of farmland wireless sensor network.

  10. How informative are case studies of spider bites in the medical literature? (United States)

    Stuber, Marielle; Nentwig, Wolfgang


    We analyzed the reliability and information content of 134 medical case studies on spider bites, published in 91 journal articles. Overall, we found that only 22% of these studies fulfilled the criteria for a verified spider bite. This means that the majority of such case studies cannot be attributed to a given spider species and usually not even to a spider. Their scientific value is negligible, moreover, such publications are even dangerous because they suggest incorrect conclusions. Secondly, we found that such case studies usually do not follow an obvious structure and many details on the development of symptoms, therapy and healing process are widely lacking. So even for verified spider bites, the comparability of case studies is limited. We discuss the obvious failure of a reviewing process for case studies and give recommendations how to increase the currently low information content of medical case studies on spider bites. Copyright © 2016 Elsevier Ltd. All rights reserved.

  11. Plastic material investment in load-bearing silk attachments in spiders. (United States)

    Wolff, Jonas O; Jones, Braxton; Herberstein, Marie E


    The nature and size of attachments is a fundamental element of animal constructions. Presumably, these adhesive structures are plastically deployed to balance material investment and attachment strength. Here we studied plasticity in dragline anchorages of the golden orb web spider, Nephila plumipes. Specifically, we predict that spiders adjust the size and structure of dragline anchorages with load, i.e. spider mass. Mass was manipulated by attaching lead pieces to the spider's abdomen resulting in a 50 percent increase in mass. Loaded spiders spun larger but structurally similar thread anchorages than unloaded spiders. Thus, the spinning program that determines the overall anchor structure is highly stereotypic, and flexibility is introduced through varying the anchor size by increasing material investment. Our study showcases substrate attachments as suitable models to investigate the interplay between innate and changeable elements in the economy of building behaviours. Copyright © 2018 Elsevier GmbH. All rights reserved.

  12. Rapid visuomotor processing of phobic images in spider- and snake-fearful participants. (United States)

    Haberkamp, Anke; Schmidt, Filipp; Schmidt, Thomas


    This study investigates enhanced visuomotor processing of phobic compared to fear-relevant and neutral stimuli. We used a response priming design to measure rapid, automatic motor activation by natural images (spiders, snakes, mushrooms, and flowers) in spider-fearful, snake-fearful, and control participants. We found strong priming effects in all tasks and conditions; however, results showed marked differences between groups. Most importantly, in the group of spider-fearful individuals, spider pictures had a strong and specific influence on even the fastest motor responses: Phobic primes entailed the largest priming effects, and phobic targets accelerated responses, both effects indicating speeded response activation by phobic images. In snake-fearful participants, this processing enhancement for phobic material was less pronounced and extended to both snake and spider images. We conclude that spider phobia leads to enhanced processing capacity for phobic images. We argue that this is enabled by long-term perceptual learning processes. © 2013.

  13. Evolutionary morphology of the hemolymph vascular system of basal araneomorph spiders (Araneae: Araneomorphae). (United States)

    Huckstorf, Katarina; Michalik, Peter; Ramírez, Martín; Wirkner, Christian S


    The superfamily Austrochiloidea (Austrochilidae and Gradungulidae) take a pivotal position in araneomorph spider phylogeny. In this discussion crevice weaver spiders (Filistatidae) are of equal interest. Especially data from these phylogenetically uncertain yet basal off branching groups can enlighten our understanding on the evolution of organ systems. In the course of a survey on the evolutionary morphology of the circulatory system in spiders we therefore investigated the hemolymph vascular system in two austrochiloid and one filistatid species. Additionally some data on a hypochilid and a gradungulid species are included. Using up-to-date morphological methods, the vascular systems in these spiders are visualized three dimensionally. Ground pattern features of the circulatory systems in austrochiloid spiders are presented and the data discussed along recent lines of phylogenetic hypotheses. Special topics highlighted are the intraspecific variability of the origins of some prosomal arteries and the evolutionary correlation of respiratory and circulatory systems in spiders. Copyright © 2015 Elsevier Ltd. All rights reserved.

  14. Induction of direct and indirect plant responses by jasmonic acid, low spider mite densities, or a combination of jasmonic acid treatment and spider mite infestation. (United States)

    Gols, Rieta; Roosjen, Mara; Dijkman, Herman; Dicke, Marcel


    Jasmonic acid (JA) and the octadecanoid pathway are involved in both induced direct and induced indirect plant responses. In this study, the herbivorous mite, Tetranychus urticae, and its predator, Phytoseiulus persimilis, were given a choice between Lima bean plants induced by JA or spider mites and uninduced control plants. Infestation densities resulting in the induction of predator attractants were much lower than thus far assumed, i.e., predatory mites were significantly attracted to plants that were infested for 2 days with only one or four spider mites per plant. Phytoseiulus persimilis showed a density-dependent response to volatiles from plants that were infested with different numbers of spider mites. Similarly, treating plants with increasing concentrations of JA also led to increased attraction of P. persimilis. Moreover, the duration of spider mite infestation was positively correlated with the proportion of predators that were attracted to mite-infested plants. A pretreatment of the plants with JA followed by a spider mite infestation enhanced the attraction of P. persimilis to plant volatiles compared to attraction to volatiles from plants that were only infested with spider mites and did not receive a pretreatment with JA. The herbivore, T. urticae preferred leaf tissue that previously had been infested with conspecifics to uninfested leaf tissue. In the case of choice tests with JA-induced and control leaf tissue, spider mites slightly preferred control leaf tissue. When spider mites were given a choice between leaf discs induced by JA and leaf discs damaged by spider mite feeding, they preferred the latter. The presence of herbivore induced chemicals and/or spider mite products enhanced settlement of the mites, whereas treatment with JA seemed to impede settlement.

  15. Ontogenesis, gender, and molting influence the venom yield in the spider Coremiocnemis tropix (Araneae, Theraphosidae)


    Herzig, Volker


    The demand for spider venom increases along with the growing popularity of venoms-based research. A deeper understanding of factors that influence the venom yield in spiders would therefore be of interest to both commercial venom suppliers and research facilities. The present study addresses the influence of several factors on the venom yield by systematically analyzing the data obtained from 1773 electrical milkings of the Australian theraphosid spider Coremiocnemis tropix. Gender and ontoge...

  16. On the predation of fly, Chrysomya rufifacies (Macquart) by a spider, Oxyopes sp. Latreille (Oxyopidae). (United States)

    Heo, C C; Mohamad, A M; John, J; Baharudin, O


    During a forensic entomological study conducted in a palm oil plantation in Tg.Sepat, Selangor in September 2007, a spider (Arachnida), Oxyopes sp. (Oxyopidae) was found to predate on a calliphorid fly (Chrysomya rufifacies). The female spider laid a silk thread, or "drag line", behind it as it moved. This spider bites its prey by using a pairs of chelicerae, and injecting venom into the fly. The fly was moving its wing trying to escape, however, it succumbed to the deadly bite.

  17. Exploring of the first recorded spider (Arachenida: Aranae) species of Sheringal, Khyber Pakhtunkhwa, Pakistan


    Farzana Perveen; Numan Khan


    The spiders (Arthropoada: Arachenida) are one of the groups of grasping animals. Their carapaces are found on the dorsal side of the cephalothorax, which is an important characteristic of spiders. The present study was conducted to explore the first recorded spider species (nti=75) of Sheringal, Dir Upper (DU), Khyber Pakhtunkhwa (KP), Dir Upper, Khyber Pakhtunkhwa, Pakistan. The 10 genera with 10 species under 7 families were recorded from June 2013-July 2014. According to length of legs, th...

  18. Cuticular bacteria appear detrimental to social spiders in mixed but not monoculture exposure (United States)

    Keiser, Carl N.; Shearer, Taylor A.; DeMarco, Alexander E.; Brittingham, Hayley A.; Knutson, Karen A.; Kuo, Candice; Zhao, Katherine; Pruitt, Jonathan N.


    Abstract Much of an animal’s health status, life history, and behavior are dictated by interactions with its endogenous and exogenous bacterial communities. Unfortunately, interactions between hosts and members of their resident bacterial community are often ignored in animal behavior and behavioral ecology. Here, we aim to identify the nature of host–microbe interactions in a nonmodel organism, the African social spider Stegodyphus dumicola. We collected and identified bacteria from the cuticles of spiders in situ and then exposed spiders to bacterial monocultures cultures via topical application or injection. We also topically inoculated spiders with a concomitant “cocktail” of bacteria and measured the behavior of spiders daily for 24 days after inoculation. Lastly, we collected and identified bacteria from the cuticles of prey items in the capture webs of spiders, and then fed spiders domestic crickets which had been injected with these bacteria. We also injected 1 species of prey-borne bacteria into the hemolymph of spiders. Only Bacillus thuringiensis caused increased mortality when injected into the hemolymph of spiders, whereas no bacterial monocultures caused increased mortality when applied topically, relative to control solutions. However, a bacterial cocktail of cuticular bacteria caused weight loss and mortality when applied topically, yet did not detectibly alter spider behavior. Consuming prey injected with prey-borne bacteria was associated with an elongated lifespan in spiders. Thus, indirect evidence from multiple experiments suggests that the effects of these bacteria on spider survivorship appear contingent on their mode of colonization and whether they are applied in monoculture or within a mixed cocktail. We urge that follow-up studies should test these host–microbe interactions across different social contexts to determine the role that microbes play in colony performance. PMID:29491926

  19. Exploring of the first recorded spider (Arachenida: Aranae species of Sheringal, Khyber Pakhtunkhwa, Pakistan

    Directory of Open Access Journals (Sweden)

    Farzana Perveen


    Full Text Available The spiders (Arthropoada: Arachenida are one of the groups of grasping animals. Their carapaces are found on the dorsal side of the cephalothorax, which is an important characteristic of spiders. The present study was conducted to explore the first recorded spider species (nti=75 of Sheringal, Dir Upper (DU, Khyber Pakhtunkhwa (KP, Dir Upper, Khyber Pakhtunkhwa, Pakistan. The 10 genera with 10 species under 7 families were recorded from June 2013-July 2014. According to length of legs, the largest spider was the huntsman spider, Halconia insignis Thorell having length of the first leg was 1.9±0.20, however, the same of the last leg was 1.44±0.25 (n=9. In the same contest, the smallest spider was the ground spider, Gnaphosa eucalyptus Ghafoor and Beg having length of the first leg was 0.4±0.08, while the same of the last leg was 0.4±0.08 (n=3. According to length of cephalothorax and abdomen, the largest spider was the wolf spider, Hippasa partita Takidar having length of the cephalothorax was 1.1±0.01, however, the same of the abdomen was 0.7±0.1 (n=6. In the same contest, the smallest spider was the harvestmen, Hadrobunus grandis Sundevall having length of the cephalothorax was 0.1±0.04, while the same of the abdomen was 0.3±0.04 (n=12. During present research, 10 spider species of Sheringal with different sizes were explored. The present research will be useful to educate and create awareness about spiders in the people of Sheringal.

  20. Ecosystem services in the face of invasion: the persistence of native and nonnative spiders in an agricultural landscape. (United States)

    Hogg, Brian N; Daane, Kent M


    The presence of intact natural ecosystems in agricultural landscapes can mitigate losses in the diversity of natural enemies and enhance ecosystem services. However, native natural enemies may fail to persist in agroecosystems if invaders dominate species interactions. In this study, native and nonnative spiders were sampled along transects that extended from oak woodland and riparian zones into surrounding California vineyards, to assess the role of natural habitat as a source for spider biodiversity in the vineyard landscape, and to compare the dominance of exotic Cheiracanthium spiders between habitats. Many spider species were more abundant in natural habitat than in vineyards, and numbers of spiders and spider species within vineyards were higher at the vineyard edge adjacent to oak woodland. These results suggest that natural habitat is a key source for spiders in vineyards. The positive effect of oak woodland on the vineyard spider community extended only to the vineyard edge, however. Proportions of Cheiracanthium spiders increased dramatically in the vineyard, while numbers of native wandering spiders (the native ecological homologues of Cheiracanthium spiders) decreased. Dispersal limitation and strong habitat preferences may have prevented native wandering spiders from establishing far from the vineyard edge. Exotic Cheiracanthium spiders, in contrast, may possess specific adaptations to vineyards or to a wide range of habitats. Results suggest that the ecosystem services provided by intact natural habitat may be limited in agricultural landscapes that are dominated by invasive species.


    Directory of Open Access Journals (Sweden)

    William A. Sands


    Full Text Available Trends in pairs figure skating have shown that increasingly difficult jumps have become an essential aspect of high-level performance, especially in the latter part of a competitive program. We compared a repeated jump power index in a 60 s repeated jump test to determine the relationship of repeated jump test to competitive rank and to measure 2D hip, knee, and ankle angles and angular velocities at 0, 20, 40, and 60 s. Eighteen National Team Pairs Figure Skaters performed a 60 s repeated jump test on a large switch-mat with timing of flight and ground durations and digital video recording. Each 60-s period was divided into 6, 10-s intervals, with power indexes (W/kg calculated for each 10-s interval. Power index by 10-s interval repeated measures ANOVAs (RMANOVA showed that males exceeded females at all intervals, and the highest power index interval was during 10 to 20 s for both sexes. RMANOVAs of angles and angular velocities showed main effects for time only. Power index and jumping techniques among figure skaters showed rapid and steady declines over the test duration. Power index can predict approximately 50% of competitive rank variance, and sex differences in jumping technique were rare

  2. Validity of a jump training apparatus using Wii Balance Board. (United States)

    Yamamoto, Keizo; Matsuzawa, Mamoru


    The dynamic quantification of jump ability is useful for sports performance evaluation. We developed a force measurement system using the Wii Balance Board (WBB). This study was conducted to validate the system in comparison with a laboratory-grade force plate (FP). For a static validation, weights of 10-180kg were put progressively on the WBB put on the FP. The vertical component of the ground reaction force (vGRF) was measured using both devices and compared. For the dynamic validation, 10 subjects without lower limb pathology participated in the study and performed vertical jumping twice on the WBB on the FP. The range of analysis was set from the landing after the first jump to taking off of the second jump. The peak values during the landing phase and jumping phase were obtained and the force-time integral (force impulse) was measured. The relations of the values measured using each device were compared using Pearson's correlation coefficient test and Bland-Altman plots (BAP). Significant correlation (P<.01, r=.99) was found between the values of both devices in the static and the dynamic test. Examination of the BAP revealed a proportion error in the landing phase and showed no relation in the jumping phase between the difference and the mean in the dynamic test. The WBB detects the vGRF in the jumping phase with high precision. Copyright © 2012 Elsevier B.V. All rights reserved.

  3. Information processing biases in spider phobia: application of the Stroop and "White Noise" Paradigm. (United States)

    Olatunji, Bunmi O; Sawchuk, Craig N; Lee, Thomas C; Lohr, Jeffrey M; Tolin, David F


    The present study examines attentional and implicit memory biases in spider phobic and nonphobic participants. The results showed that spider phobics demonstrated increased interference for neutral, negative, and spider-relevant words on a computerized Stroop task. However, no group differences emerged when adjusting for differences in color-naming speed. Prior exposure to a dead spider did result in higher overall Stroop interference in spider phobics and this appeared to be mostly pronounced for spider-relevant words. Implicit memory bias for threat was examined with a noise judgment task. Participants first heard neutral and spider-relevant sentences and implicit memory for these sentences was evaluated by having participants rate the volume of noise accompanying the presentation of old sentences intermixed with new sentences. An implicit memory bias is indicated if participants rate noise accompanying old sentences as less loud than noise accompanying new sentences. No evidence was found for an implicit memory bias in spider phobics. These findings are discussed in relation to the role of information processing biases in spider phobia.

  4. Biased interpretation and memory in children with varying levels of spider fear. (United States)

    Klein, Anke M; Titulaer, Geraldine; Simons, Carlijn; Allart, Esther; de Gier, Erwin; Bögels, Susan M; Becker, Eni S; Rinck, Mike


    This study investigated multiple cognitive biases in children simultaneously, to investigate whether spider-fearful children display an interpretation bias, a recall bias, and source monitoring errors, and whether these biases are specific for spider-related materials. Furthermore, the independent ability of these biases to predict spider fear was investigated. A total of 121 children filled out the Spider Anxiety and Disgust Screening for Children (SADS-C), and they performed an interpretation task, a memory task, and a Behavioural Assessment Test (BAT). As expected, a specific interpretation bias was found: Spider-fearful children showed more negative interpretations of ambiguous spider-related scenarios, but not of other scenarios. We also found specific source monitoring errors: Spider-fearful children made more fear-related source monitoring errors for the spider-related scenarios, but not for the other scenarios. Only limited support was found for a recall bias. Finally, interpretation bias, recall bias, and source monitoring errors predicted unique variance components of spider fear.

  5. Body burdens of metals in spiders from the Lidice coal dump near Ostrava (Czech Republic)

    Energy Technology Data Exchange (ETDEWEB)

    Wilczek, G.; Babczynska, A.; Majkus, Z. [Silesian University, Katowice (Poland)


    Spiders' feeding behaviour and external digestion expose them to man-made pollutants, especially those easily transferred along the food chain. The problem for this study was whether the levels of heavy metals in selected species of spiders from the Lidice coal dump reflect adaptation to environmental pollutants. We used flameless and flame AAS to measure the whole-body concentrations of Cd, Pb, Cu, Zn, Fe, Ni and Mg in male and female spiders differing in their hunting strategies, type of web construction, prey, and taxonomic position (Araneidae, Agelenidae, Linyphiidae, Theridiidae, Tetragnathidae, Lycosidae, Salticidae, Pisauridae, Clubionidae, Philodromidae). The levels of metals found in the spiders were species-dependent, indicating differences related to the hunting strategy and type of prey. Accumulation of Pb, Cu and Zn was always higher in ground spiders than in web-constructing species. Sheet-web spiders Linyphia triangularis and wandering spiders Clubiona lutescens had the lowest Cd, Mg and Cu content of all the studied species. Web-building spiders of the Tetragnathidae family showed the highest Cd, Cu and Pb content, even in species with feeding behaviour similar to spiders of other families. There were no interspecific differences in accumulation only for Fe and Mg. The concentrations of Cd, Ni and Pb were lower in females than in males, irrespective of their taxonomic position and the intensity of their hunting activity. This may suggest that females have better metal-excretion ability than males.

  6. Methods of assembling and disassembling spider and burnable poison rod structures for nuclear reactors

    International Nuclear Information System (INIS)

    Edwards, G.T.; Schluderberg, D.C.


    A technique is provided for engaging and disengaging burnable poison rods from a spider in a nuclear reactor fuel assembly. A cap on the end of each of the burnable poison rods is provided with a shank or stem that is received in a respective bore formed in the spider. A frangible flange secures the shank and rod to the spider. Pressing the shank in the direction of the bore axis by means, e.g., of a plate ruptures the frangible flange to release the rod from the spider. (author)

  7. Spiders do not evoke greater early posterior negativity in the event-related potential as snakes. (United States)

    He, Hongshen; Kubo, Kenta; Kawai, Nobuyuki


    It has been long believed that both snakes and spiders are archetypal fear stimuli for humans. Furthermore, snakes have been assumed as stronger threat cues for nonhuman primates. However, it is still unclear whether spiders hold a special status in human perception. The current study explored to what extent spider pictures draw early visual attention [as assessed with early posterior negativity (EPN)] when compared with insects similar to spiders. To measure the EPN, participants watched a random rapid serial presentation of pictures, which consisted of two conditions: spider condition (spider, wasp, bumblebee, beetle) and snake condition (snake, bird). EPN amplitudes revealed no significant difference between spider, wasp, bumblebee, and beetle pictures, whereas EPN amplitudes were significantly larger for snake pictures relative to bird pictures. In addition, EPN amplitudes were significantly larger for snake pictures relative to spider pictures. These results suggest that the early visual attentional capture of animate objects is stronger for snakes, whereas spiders do not appear to hold special early attentional value.

  8. Risk of spider predation alters food web structure and reduces local herbivory in the field. (United States)

    Bucher, Roman; Menzel, Florian; Entling, Martin H


    Predators can indirectly enhance plant performance via herbivore suppression, with both prey consumption and changes in prey traits (e.g. changes in foraging behaviour) contributing to the reduction in herbivory. We performed a field experiment to determine the extent of such non-consumptive effects which consisted of repeatedly placing spiders (Pisaura mirabilis) on enclosed plants (Urtica dioica) for cue deposition. Control plants were enclosed in the same way but without spiders. After cue deposition, the enclosures were removed to allow arthropods to colonize the plants and feed on them. Arthropods were removed from the plants before the subsequent spider deposition or control enclosure. During six cycles of enclosure, we quantified leaf damage on the plants. After a seventh cycle, the colonizing arthropods were sampled to determine community composition in relation to the presence/absence of spider cues. We found that the presence of chemotactile spider cues reduced leaf damage by 50 %. In addition, spider cues led to changes in the arthropod community: smaller spiders avoided plants with spider cues. In contrast, the aphid-tending ant Myrmica rubra showed higher recruitment of workers on cue-bearing plants, possibly to protect aphids. Our results show that the risk of spider predation can reduce herbivory on wild plants and also demonstrate that non-consumptive effects can be particularly strong within the predator guild.

  9. Spider Transcriptomes Identify Ancient Large-Scale Gene Duplication Event Potentially Important in Silk Gland Evolution. (United States)

    Clarke, Thomas H; Garb, Jessica E; Hayashi, Cheryl Y; Arensburger, Peter; Ayoub, Nadia A


    The evolution of specialized tissues with novel functions, such as the silk synthesizing glands in spiders, is likely an influential driver of adaptive success. Large-scale gene duplication events and subsequent paralog divergence are thought to be required for generating evolutionary novelty. Such an event has been proposed for spiders, but not tested. We de novo assembled transcriptomes from three cobweb weaving spider species. Based on phylogenetic analyses of gene families with representatives from each of the three species, we found numerous duplication events indicative of a whole genome or segmental duplication. We estimated the age of the gene duplications relative to several speciation events within spiders and arachnids and found that the duplications likely occurred after the divergence of scorpions (order Scorpionida) and spiders (order Araneae), but before the divergence of the spider suborders Mygalomorphae and Araneomorphae, near the evolutionary origin of spider silk glands. Transcripts that are expressed exclusively or primarily within black widow silk glands are more likely to have a paralog descended from the ancient duplication event and have elevated amino acid replacement rates compared with other transcripts. Thus, an ancient large-scale gene duplication event within the spider lineage was likely an important source of molecular novelty during the evolution of silk gland-specific expression. This duplication event may have provided genetic material for subsequent silk gland diversification in the true spiders (Araneomorphae). © The Author(s) 2015. Published by Oxford University Press on behalf of the Society for Molecular Biology and Evolution.

  10. Spider (Araneae) predations on white-backed planthopper Sogatella furcifera in subtropical rice ecosystems, China. (United States)

    Wang, Xue-Qin; Wang, Guang-Hua; Zhu, Zeng-Rong; Tang, Qi-Yi; Hu, Yang; Qiao, Fei; Heong, Kong Luen; Cheng, Jia-An


    Spiders are effective biological control agents in rice ecosystems, but the comparative study of predations among main spider species under field conditions has not been fully explored owing to a lack of practical methodology. In this study, more than 6000 spiders of dominant species were collected from subtropical rice ecosystems to compare their predations on Sogatella furcifera (Horváth) (white-backed planthopper, WBPH) using DNA-based gut content analysis. The positive rates for all spider taxa were closely related to prey densities, as well as their behaviors and niches. The relationships of positive rates to prey planthopper densities for Pardosa pseudoannulata (Böes. et Str.), Coleosoma octomaculata (Böes. et Str.), Tetragnatha maxillosa Thorell and Ummeliata insecticeps (Böes. et Str.) under field conditions could be described using saturated response curves. Quantitative comparisons of predations among the four spider species confirmed that P. pseudoannulata and C. octomaculata were more rapacious than U. insecticeps and T. maxillosa under field conditions. A comparison of ratio of spiders to WBPH and positive rates between fields revealed that biological control by spiders could be effectively integrated with variety resistance. Generalist spiders could follow up WBPH population timely, and assemblages of spiders coupled with variety resistance could effectively suppress WBPH population. © 2016 Society of Chemical Industry. © 2016 Society of Chemical Industry.

  11. A comparison of spider communities in Bt and non-Bt rice fields. (United States)

    Lee, Sue Yeon; Kim, Seung Tae; Jung, Jong Kook; Lee, Joon-Ho


    To assess the potential adverse effects of a Bt rice line (Japonica rice cultivar, Nakdong) expressing a synthetic cry1Ac1 gene, C7-1-9-1-B, which was highly active against all larval stages of Cnaphalocrocis medinalis (Guenée) (Lepidoptera: Crambidae), we investigated the community structure of spiders in Bt and non-Bt rice fields during the rice-growing season in 2007 and 2008 in Chungcheongnam-do, Korea. Spiders were surveyed with a sweep net and suction device. Suction sampling captured more spiders, measured in terms of species level and abundance, than sweeping. Araneidae and Thomisidae were captured more by sweeping, and certain species were captured only by sweeping. These findings show that both suction and sweep sampling methods should be used because these methods are most likely complementary. In total, 29 species in 23 genera and nine families were identified from the 4,937 spiders collected, and both Bt and non-Bt rice fields showed a typical Korean spider assemblage. The temporal patterns of spider species richness and spider abundance were very similar between Bt and non-Bt rice, although significant differences in species richness were observed on a few occasions. Overall, spider community structure, including diversity, the dominant species, and abundance did not differ between Bt and non-Bt rice. The results of the study indicated that the transgenic Cry1Ac rice lines tested in this study had no adverse effects on the spider community structure of the rice fields.

  12. Functional Group of Spiders in Cultivated Landscape Dominated by Paddy Fields in West Java, Indonesia

    Directory of Open Access Journals (Sweden)



    Full Text Available Distribution of spiders in all colonized environments is limited by biotic and abiotic factors requiring adaptations with respect to, for example microhabitat choice and hunting behavior. These two factors were frequently used to group spiders into functional groups. In this study our objectives were to (i group of genera of spiders into functional group based on their microhabitat specificity, hunting behavior, and daily activity; and (ii compare the number and composition of functional group of spider at each habitat type and period of paddy growth. The study was conducted at a landscape dominated by paddy fields in Cianjur Watershed for a period of 9 months. Four different habitat types (paddy, vegetable, non-crop, and mixed garden, were sampled using five trapping techniques (pitfall traps, farmcop suction, sweep netting, yellow-pan traps, and sticky traps. The Unweighted Pair-Group Average and the Euclidean Distances were used to generate dendrogram of functional group of spider. We found 14 functional groups of spider at genus level. The number of functional group of spider at four habitat types was differing, but the composition was similar, because all habitats were closed to each other. Habitat structure diversity and disturbance level influenced the number of functional group of spider. Different architecture of vegetation and availability of differ prey during paddy growth, causing the composition of functional group of spider in each period of paddy growth was changed, although its number was unchanged.

  13. Optimizing the Distribution of Leg Muscles for Vertical Jumping.

    Directory of Open Access Journals (Sweden)

    Jeremy D Wong

    Full Text Available A goal of biomechanics and motor control is to understand the design of the human musculoskeletal system. Here we investigated human functional morphology by making predictions about the muscle volume distribution that is optimal for a specific motor task. We examined a well-studied and relatively simple human movement, vertical jumping. We investigated how high a human could jump if muscle volume were optimized for jumping, and determined how the optimal parameters improve performance. We used a four-link inverted pendulum model of human vertical jumping actuated by Hill-type muscles, that well-approximates skilled human performance. We optimized muscle volume by allowing the cross-sectional area and muscle fiber optimum length to be changed for each muscle, while maintaining constant total muscle volume. We observed, perhaps surprisingly, that the reference model, based on human anthropometric data, is relatively good for vertical jumping; it achieves 90% of the jump height predicted by a model with muscles designed specifically for jumping. Alteration of cross-sectional areas-which determine the maximum force deliverable by the muscles-constitutes the majority of improvement to jump height. The optimal distribution results in large vastus, gastrocnemius and hamstrings muscles that deliver more work, while producing a kinematic pattern essentially identical to the reference model. Work output is increased by removing muscle from rectus femoris, which cannot do work on the skeleton given its moment arm at the hip and the joint excursions during push-off. The gluteus composes a disproportionate amount of muscle volume and jump height is improved by moving it to other muscles. This approach represents a way to test hypotheses about optimal human functional morphology. Future studies may extend this approach to address other morphological questions in ethological tasks such as locomotion, and feature other sets of parameters such as properties of

  14. Optimizing the Distribution of Leg Muscles for Vertical Jumping (United States)

    Wong, Jeremy D.; Bobbert, Maarten F.; van Soest, Arthur J.; Gribble, Paul L.; Kistemaker, Dinant A.


    A goal of biomechanics and motor control is to understand the design of the human musculoskeletal system. Here we investigated human functional morphology by making predictions about the muscle volume distribution that is optimal for a specific motor task. We examined a well-studied and relatively simple human movement, vertical jumping. We investigated how high a human could jump if muscle volume were optimized for jumping, and determined how the optimal parameters improve performance. We used a four-link inverted pendulum model of human vertical jumping actuated by Hill-type muscles, that well-approximates skilled human performance. We optimized muscle volume by allowing the cross-sectional area and muscle fiber optimum length to be changed for each muscle, while maintaining constant total muscle volume. We observed, perhaps surprisingly, that the reference model, based on human anthropometric data, is relatively good for vertical jumping; it achieves 90% of the jump height predicted by a model with muscles designed specifically for jumping. Alteration of cross-sectional areas—which determine the maximum force deliverable by the muscles—constitutes the majority of improvement to jump height. The optimal distribution results in large vastus, gastrocnemius and hamstrings muscles that deliver more work, while producing a kinematic pattern essentially identical to the reference model. Work output is increased by removing muscle from rectus femoris, which cannot do work on the skeleton given its moment arm at the hip and the joint excursions during push-off. The gluteus composes a disproportionate amount of muscle volume and jump height is improved by moving it to other muscles. This approach represents a way to test hypotheses about optimal human functional morphology. Future studies may extend this approach to address other morphological questions in ethological tasks such as locomotion, and feature other sets of parameters such as properties of the skeletal

  15. Propulsion efficiency and imposed flow fields of a copepod jump. (United States)

    Jiang, Houshuo; Kiørboe, Thomas


    Pelagic copepods jump to relocate, to attack prey and to escape predators. However, there is a price to be paid for these jumps in terms of their energy costs and the hydrodynamic signals they generate to rheotactic predators. Using observed kinematics of various types of jumps, we computed the imposed flow fields and associated energetics of jumps by means of computational fluid dynamics simulations by modeling the copepod as a self-propelled body. The computational fluid dynamics simulation was validated by particle image velocimetry data. The flow field generated by a repositioning jump quickly evolves into two counter-rotating viscous vortex rings that are near mirror image of one another, one in the wake and one around the body of the copepod; this near symmetrical flow may provide hydrodynamic camouflage because it contains no information about the position of the copepod prey within the flow structure. The flow field associated with an escape jump sequence also includes two dominant vortex structures: one leading wake vortex generated as a result of the first jump and one around the body, but between these two vortex structures is an elongated, long-lasting flow trail with flow velocity vectors pointing towards the copepod; such a flow field may inform the predator of the whereabouts of the escaping copepod prey. High Froude propulsion efficiency (0.94-0.98) was obtained for individual power stroke durations of all simulated jumps. This is unusual for small aquatic organisms but is caused by the rapidity and impulsiveness of the jump that allows only a low-cost viscous wake vortex to travel backwards.

  16. Numerical simulations of katabatic jumps in coats land, Antartica (United States)

    Yu, Ye; Cai, Xiaoming; King, John C.; Renfrew, Ian A.

    A non-hydrostatic numerical model, the Regional Atmospheric Modeling System (RAMS), has been used to investigate the development of katabatic jumps in Coats Land, Antarctica. In the control run with a 5 m s-1downslope directed initial wind, a katabatic jump develops near the foot of the idealized slope. The jump is manifested as a rapid deceleration of the downslope flow and a change from supercritical to subcritical flow, in a hydraulic sense, i.e., the Froude number (Fr) of the flow changes from Fr > 1 to Fr> 1. Results from sensitivity experiments show that an increase in the upstream flow rate strengthens the jump, while an increase in the downstream inversion-layer depth results in a retreat of the jump. Hydraulic theory and Bernoulli''s theorem have been used to explain the surface pressure change across the jump. It is found that hydraulic theory always underestimates the surface pressure change, while Bernoulli''s theorem provides a satisfactory estimation. An analysis of the downs balance for the katabatic jump indicates that the important forces are those related to the pressure gradient, advection and, to a lesser extent, the turbulent momentum divergence. The development of katabatic jumps can be divided into two phases. In phase I, the t gradient force is nearly balanced by advection, while in phase II, the pressure gradient force is counterbalanced by turbulent momentum divergence. The upslope pressure gradient force associated with a pool of cold air over the ice shelf facilitates the formation of the katabatic jump.

  17. Jump-Down Performance Alterations after Space Flight (United States)

    Reschke, M. F.; Kofman, I. S.; Cerisano, J. M.; Fisher, E. A.; Peters, B. T.; Miller, C. A.; Harm, D. L.; Bloomberg, J. J.


    INTRODUCTION: Successful jump performance requires functional coordination of visual, vestibular, and somatosensory systems, which are affected by prolonged exposure to microgravity. Astronauts returning from space flight exhibit impaired ability to coordinate effective landing strategies when jumping from a platform to the ground. This study compares jump strategies used by astronauts before and after flight, changes to those strategies within a test session, and recoveries in jump-down performance parameters across several postflight test sessions. These data were obtained as part of an ongoing interdisciplinary study (Functional Task Test, FTT) designed to evaluate both astronaut postflight functional performance and related physiological changes. METHODS: Seven astronauts from short-duration (Shuttle) and three from long-duration (International Space Station) flights performed 3 two-footed jumps from a platform 30 cm high onto a force plate that measured the ground reaction forces and center-of-pressure displacement from the landings. Neuromuscular activation data were collected from the medial gastrocnemius and anterior tibialis of both legs using surface electromyography electrodes. Two load cells in the platform measured the load exerted by each foot during the takeoff phase of the jump. Data were collected in 2 preflight sessions, on landing day (Shuttle only), and 1, 6, and 30 days after flight. RESULTS: Postural settling time was significantly increased on the first postflight test session and many of the astronauts tested were unable to maintain balance on their first jump landing but recovered by the third jump, showing a learning progression in which performance improvements could be attributed to adjustments in takeoff or landing strategy. Jump strategy changes were evident in reduced air time (time between takeoff and landing) and also in increased asymmetry in foot latencies on takeoff. CONCLUSIONS: The test results revealed significant decrements

  18. Temperature Jump Pyrolysis Studies of RP 2 Fuel (United States)


    Briefing Charts 3. DATES COVERED (From - To) 15 December 2016 – 11 January 2017 4. TITLE AND SUBTITLE Temperature Jump Pyrolysis Studies of RP-2 Fuel...Rev. 8- 98) Prescribed by ANSI Std. 239.18 1 TEMPERATURE JUMP PYROLYSIS STUDIES OF RP-2 FUEL Owen Pryor1, Steven D. Chambreau2, Ghanshyam L...17026 7 Temperature Jump Pyrolysis at AFRL Edwards Rapid heating of a metal filament at a rate of 600 – 800 K/s, and the set temperature is held for

  19. Effects of kettlebell training on postural coordination and jump performance

    DEFF Research Database (Denmark)

    Jay, Kenneth; Jakobsen, Markus Due; Sundstrup, Emil


    ABSTRACT: The aim of this study was to investigate the effectiveness of a worksite intervention using kettlebell training to improve postural reactions to perturbation and jump performance.This single-blind randomized controlled trial involved 40 adults (n=40) from occupations with a high....... The outcome measures were postural reactions to sudden perturbation and maximal countermovement jump height.Compared to the control group, the training group significant decreased stopping time following perturbation (-109ms, 95% CI [-196:-21]). Jump height increased significantly in the training group (1.5cm...

  20. Diarylethene microcrystals make directional jumps upon ultraviolet irradiation

    International Nuclear Information System (INIS)

    Colombier, I.; Spagnoli, S.; Corval, A.; Baldeck, P. L.; Giraud, M.; Leaustic, A.; Yu, P.; Irie, M.


    Microcrystals of a diarylethene {1,2-bis[5 ' -methyl-2 ' -(2 '' -pyridyl)thiazolyl]perfluorocyclo-pentene } undergo jumps upon photoirradiation. These photochromic crystals present molecular structural changes upon irradiation with ultraviolet light because of reversible photocyclization reactions. When the energy absorbed by crystals reaches about 10 μJ, the uniaxial stress induced in the crystal lattice relaxes through directional jumps. If one prevents crystals from jumping, then parallel, equidistant cracks appear on crystal surfaces. These photomechanical effects could result from a Grinfeld surface instability

  1. Developing an Enhanced Lightning Jump Algorithm for Operational Use (United States)

    Schultz, Christopher J.; Petersen, Walter A.; Carey, Lawrence D.


    Overall Goals: 1. Build on the lightning jump framework set through previous studies. 2. Understand what typically occurs in nonsevere convection with respect to increases in lightning. 3. Ultimately develop a lightning jump algorithm for use on the Geostationary Lightning Mapper (GLM). 4 Lightning jump algorithm configurations were developed (2(sigma), 3(sigma), Threshold 10 and Threshold 8). 5 algorithms were tested on a population of 47 nonsevere and 38 severe thunderstorms. Results indicate that the 2(sigma) algorithm performed best over the entire thunderstorm sample set with a POD of 87%, a far of 35%, a CSI of 59% and a HSS of 75%.

  2. The Perpetual American Put Option for Jump-Diffusions


    Aase, Knut K.


    -This is the author's version of the article"The Perpetual American Put Option for Jump-Diffusions" Energy Systems pp 493-507. We solve a specific optimal stopping problem with an infinite time horizon, when the state variable follows a jump-diffusion. The novelty of the paper is related to the inclusion of a jump component in this stochastic process. Under certain conditions, our solution can be interpreted as the price of an American perpetual put option. We characterize the continuation...

  3. Mechanism design and optimization of a bionic kangaroo jumping robot (United States)

    Zhang, Y. H.; Zheng, L.; Ge, W. J.; Zou, Z. H.


    Hopping robots have broad application prospects in the fields of military reconnaissance, field search or life rescue. However, current hopping robots still face the problems of weak jumping ability and load bearing. Inspired by the jumping of kangaroo, we design a Kangaroo hopping robot “Zbot”, which has two degrees of freedom and three joints. The geared five-bar mechanism is used to decouple the knee and ankle joints of the robot. In order to get a bionic performance, the coupling mechanism parameters are optimized. The simulation and experiments show that the robot has an excellent jumping ability and load capacity.

  4. Jumps in the curve of creep of the stainless steel

    International Nuclear Information System (INIS)

    Silveira, T.L.; Monteiro, S.N.

    The discontinuous flow observed in creep for several stainless steels at certain streels conditions in the interval of temperatures from 550 to 800 0 C has been investigated. This phenomenon appears as repetitive jumps with strain and stress increments that could be evaluated and related to the tests variables. The stress increment increases, consistently, with the stress level at the jump. This Δo versus sigma relation is due to strain aging effects and is a consequence of the variation of the stain rate during the deformation band propagation which causes the jump [pt

  5. Rate Theory for Correlated Processes: Double Jumps in Adatom Diffusion

    DEFF Research Database (Denmark)

    Jacobsen, J.; Jacobsen, Karsten Wedel; Sethna, J.


    We study the rate of activated motion over multiple barriers, in particular the correlated double jump of an adatom diffusing on a missing-row reconstructed platinum (110) surface. We develop a transition path theory, showing that the activation energy is given by the minimum-energy trajectory...... which succeeds in the double jump. We explicitly calculate this trajectory within an effective-medium molecular dynamics simulation. A cusp in the acceptance region leads to a root T prefactor for the activated rate of double jumps. Theory and numerical results agree....

  6. Change in Counter movement Jump Strategy by Varying Jump Height Based on Simplified Framework for Center of Mass Mechanics

    International Nuclear Information System (INIS)

    Kim, Seyoung


    In this study, we investigated how a jumping strategy changes with an increase in the vertical jump height for a resultant ground reaction force (GRF) vector. We expected that the resultant force vector between two sequential motion phases (i.e., countermovement and push-off) of the counter movement jump would significantly change with the vertical jump height to take advantage of the resulting supportive force (i.e., an initial push-off force larger than the body weight) through the counter movement phase. Nine healthy young subjects were instructed to jump straight up to five different height levels ranging from 191 cm to 221 cm, and the kinematic and kinetic data were obtained in regular trials. The results showed that a lower center of mass position and larger resultant force vector were clearly observed in a higher jump, implying that the counter movement strategy changed with the vertical jump height to prepare for sufficient joint deviation and obtain a force advantage for larger push-off work.

  7. Change in Counter movement Jump Strategy by Varying Jump Height Based on Simplified Framework for Center of Mass Mechanics

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Seyoung [Korea Institute of Machinery and Materials(KIMM), Daejeon (Korea, Republic of)


    In this study, we investigated how a jumping strategy changes with an increase in the vertical jump height for a resultant ground reaction force (GRF) vector. We expected that the resultant force vector between two sequential motion phases (i.e., countermovement and push-off) of the counter movement jump would significantly change with the vertical jump height to take advantage of the resulting supportive force (i.e., an initial push-off force larger than the body weight) through the counter movement phase. Nine healthy young subjects were instructed to jump straight up to five different height levels ranging from 191 cm to 221 cm, and the kinematic and kinetic data were obtained in regular trials. The results showed that a lower center of mass position and larger resultant force vector were clearly observed in a higher jump, implying that the counter movement strategy changed with the vertical jump height to prepare for sufficient joint deviation and obtain a force advantage for larger push-off work.

  8. Spider-mediated flux of PCBs from contaminated sediments to terrestrial ecosystems and potential risks to arachnivorous birds (United States)

    We investigated aquatic insect utilization and PCB exposure in riparian spiders at the Lake Hartwell superfund site (Clemson, SC , USA). We sampled sediments, adult chironomids, terrestrial insects, riparian spiders (Tetragnathidae, Araneidae, and Mecynogea lemniscata), and upla...

  9. Predicting lower body power from vertical jump prediction equations for loaded jump squats at different intensities in men and women. (United States)

    Wright, Glenn A; Pustina, Andrew A; Mikat, Richard P; Kernozek, Thomas W


    The purpose of this study was to determine the efficacy of estimating peak lower body power from a maximal jump squat using 3 different vertical jump prediction equations. Sixty physically active college students (30 men, 30 women) performed jump squats with a weighted bar's applied load of 20, 40, and 60% of body mass across the shoulders. Each jump squat was simultaneously monitored using a force plate and a contact mat. Peak power (PP) was calculated using vertical ground reaction force from the force plate data. Commonly used equations requiring body mass and vertical jump height to estimate PP were applied such that the system mass (mass of body + applied load) was substituted for body mass. Jump height was determined from flight time as measured with a contact mat during a maximal jump squat. Estimations of PP (PP(est)) for each load and for each prediction equation were compared with criterion PP values from a force plate (PP(FP)). The PP(est) values had high test-retest reliability and were strongly correlated to PP(FP) in both men and women at all relative loads. However, only the Harman equation accurately predicted PP(FP) at all relative loads. It can therefore be concluded that the Harman equation may be used to estimate PP of a loaded jump squat knowing the system mass and peak jump height when more precise (and expensive) measurement equipment is unavailable. Further, high reliability and correlation with criterion values suggest that serial assessment of power production across training periods could be used for relative assessment of change by either of the prediction equations used in this study.

  10. Battre sa (super) coulpe : Spider-Man (1962)


    Tomasovic, Dick


    L’édification est l'une des grandes fonctions traditionnelles de la littérature de jeunesse. Spider-Man, héros populaire s'il en est, s'est révélé bien sûr l'ambassadeur de nombreuses valeurs sociétales américaines (le do it yourself, l'esprit d'entreprise et d'indépendance, la tolérance, la fidélité , la célébration du système éducationnel, la transmission et la solidarité intergénérationnelle, le sens des responsabilités, évidemment, etc.). Spider-Man se bat moins qu'il ne se débat. Il est ...

  11. A Spider That Lays Its Eggs in Rows

    Directory of Open Access Journals (Sweden)

    Robert L. Edwards


    Full Text Available The small (2.5-3.0 mm, colorful metine spider, Homalometa nigritarsis Simon 1897, Family Tetragnathidae, has previously been reported from northern Mexico, Panama and the southern islands of the Lesser Antilles (Levi 1986. In the rain forest of northeastern Puerto Rico it is most frequently found with webbing on the larger outer concave surfaces of pendulous leaves. H. nigritarsis typically makes a circular, relatively flat retreat within which the female deposits two parallel rows of naked eggs. The rows are produced at intervals; as one row hatches another replaces it shortly thereafter. Evidence of up to four generations of rows has been observed. Above the retreat, and closely aligned with it, the spider builds a nearly invisible, delicate orb web, typically from edge to edge of the leaf (Fig. 1a and b. While retaining the traditional orb-web, H. nigritarsis has adopted a unique habitat and set of life history features.

  12.  “Spiders and Webs in American Literature”

    Directory of Open Access Journals (Sweden)

    Vincent Dussol


    Full Text Available From Jonathan Edwards to Jorie Graham, spiders are strikingly present in American literature. The purpose of this article is first to show how that theme may have become something of a national tradition as very different writers, all of them careful observers of aranae, answered one another through the years. It is very likely that the attention paid to spiders by American authors was increased by those Native American myths in which spiders are a central figure. More than occasionally, on the female side of the American counter-culture, especially among its feminist and lesbian exponents, simple activists and creative writers have harnessed the symbolic power invested in the spider by Native Americans.There may be deeper reasons accounting for American authors’ fascination with spiders. The country’s phobia of disunion is one; a nation of settlers’ acute consciousness of the precariousness of its occupation of the territory is another. In demonstrating outstanding skills for adjustment to unknown places, spiders epitomize a form of identity permanence. The predominantly positive character of spider symbols in American literature will occasionally be inverted. Following the national logic of checks and balances, any web covering the whole of the United States will tend to come under suspicion.This study ends with an inventory of cultural productions linked with spiders and webs and whose Americanness is yet to be clearly determined.De Jonathan Edwards à Jorie Graham, l’araignée apparaît dans un nombre frappant de textes littéraires américains. On a d’abord voulu tenter de montrer comment a pu se construire cette tradition thématique et faire la preuve que différents écrivains, réunis par un souci de l’observation, se sont répondus à travers elle. L’attention prêtée à l’araignée s’est certainement trouvée renforcée par les récits mythologiques des peuples premiers américains qui font de l’araignée une

  13. Gravity Reception and Cardiac Function in the Spider (United States)

    Finck, A.


    The following features of the arachnid gravity system were studied. (1) the absolute threshold to hyper-gz is quite low indicating fine proprioreceptive properties of the lyriform organ, the Gz/vibration detector; (2) the neurogenic heart of the spider is a good dependent variable for assessing its behavior to Gz and other stimuli which produce mechanical effects on the exoskeleton; (3) Not only is the cardiac response useful but it is now understood to be an integral part of the system which compensates for the consequences of gravity in the spider (an hydraulic leg extension); and (4) a theoretical model was proposed in which a mechanical amplifier, the leg lever, converts a weak force (at the tarsus) to a strong force (at the patella), capable of compressing the exoskeleton and consequently the lyriform receptor.

  14. Environmental Engineering Approaches toward Sustainable Management of Spider Mites. (United States)

    Suzuki, Takeshi


    Integrated pest management (IPM), which combines physical, biological, and chemical control measures to complementary effect, is one of the most important approaches to environmentally friendly sustainable agriculture. To expand IPM, we need to develop new pest control measures, reinforce existing measures, and investigate interactions between measures. Continued progress in the development of environmental control technologies and consequent price drops have facilitated their integration into plant production and pest control. Here I describe environmental control technologies for the IPM of spider mites through: (1) the disturbance of photoperiod-dependent diapause by artificial light, which may lead to death in seasonal environments; (2) the use of ultraviolet radiation to kill or repel mites; and (3) the use of water vapor control for the long-term cold storage of commercially available natural enemies. Such environmental control technologies have great potential for the efficient control of spider mites through direct physical effects and indirect effects via natural enemies.

  15. Prey capture by the crab spider Misumena calycina (Araneae: Thomisidae). (United States)

    Morse, Douglass H


    Crab spiders Misumena calycina (L.) in pasture rose Rosa carolina flowers regularly attacked bumble bees, smaller bees, and syrphid flies that visited these flowers. Attacks reached a maximum rate of over 20/h during mid morning, but only 1.6% of the most important prey item, bumble bees, were captured. The next most important food source, the most frequently taken item, syrphid flies Toxomerus marginatus (Say), were captured in 39% of the attempts. Since these flies have a biomass only 1/60th that of bumble bees, they comprised a much less important food source than did bumble bees. Spiders would obtain over 7% more food by specializing on bumble bees than by attacking all insect visitors, and as much as 20% more food at certain times of the day. However, they did not show a tendency to specialize at any time.

  16. Spatial distribution of Madeira Island Laurisilva endemic spiders (Arachnida: Araneae) (United States)


    Abstract Madeira island presents a unique spider diversity with a high number of endemic species, many of which are still poorly known. A recent biodiversity survey on the terrestrial arthropods of the native forest, Laurisilva, provided a large set of standardized samples from various patches throughout the island. Out of the fifty two species recorded, approximately 33.3% are Madeiran endemics, many of which had not been collected since their original description. Two new species to science are reported – Ceratinopsis n. sp. and Theridion n. sp. – and the first records of Poeciloneta variegata (Blackwall, 1841) and Tetragnatha intermedia Kulczynski, 1891 are reported for the first time for Madeira island. Considerations on species richness and abundance from different Laurisilva locations are presented, together with distribution maps for endemic species. These results contribute to a better understanding of spider diversity patterns and endemic species distribution in the native forest of Madeira island. PMID:24855443

  17. Structure to function: Spider silk and human collagen (United States)

    Rabotyagova, Olena S.

    Nature has the ability to assemble a variety of simple molecules into complex functional structures with diverse properties. Collagens, silks and muscles fibers are some examples of fibrous proteins with self-assembling properties. One of the great challenges facing Science is to mimic these designs in Nature to find a way to construct molecules that are capable of organizing into functional supra-structures by self-assembly. In order to do so, a construction kit consisting of molecular building blocks along with a complete understanding on how to form functional materials is required. In this current research, the focus is on spider silk and collagen as fibrous protein-based biopolymers that can shed light on how to generate nanostructures through the complex process of self-assembly. Spider silk in fiber form offers a unique combination of high elasticity, toughness, and mechanical strength, along with biological compatibility and biodegrability. Spider silk is an example of a natural block copolymer, in which hydrophobic and hydrophilic blocks are linked together generating polymers that organize into functional materials with extraordinary properties. Since silks resemble synthetic block copolymer systems, we adopted the principles of block copolymer design from the synthetic polymer literature to build block copolymers based on spider silk sequences. Moreover, we consider spider silk to be an important model with which to study the relationships between structure and properties in our system. Thus, the first part of this work was dedicated to a novel family of spider silk block copolymers, where we generated a new family of functional spider silk-like block copolymers through recombinant DNA technology. To provide fundamental insight into relationships between peptide primary sequence, block composition, and block length and observed morphological and structural features, we used these bioengineered spider silk block copolymers to study secondary structure

  18. Hamiltonian Dynamics of Spider-Type Multirotor Rigid Bodies Systems

    International Nuclear Information System (INIS)

    Doroshin, Anton V.


    This paper sets out to develop a spider-type multiple-rotor system which can be used for attitude control of spacecraft. The multirotor system contains a large number of rotor-equipped rays, so it was called a 'Spider-type System', also it can be called 'Rotary Hedgehog'. These systems allow using spinups and captures of conjugate rotors to perform compound attitude motion of spacecraft. The paper describes a new method of spacecraft attitude reorientation and new mathematical model of motion in Hamilton form. Hamiltonian dynamics of the system is investigated with the help of Andoyer-Deprit canonical variables. These variables allow obtaining exact solution for hetero- and homoclinic orbits in phase space of the system motion, which are very important for qualitative analysis.

  19. VIPR III VADR SPIDER Structural Design and Analysis (United States)

    Li, Wesley; Chen, Tony


    In support of the National Aeronautics and Space Administration (NASA) Vehicle Integrated Propulsion Research (VIPR) Phase III team to evaluate the volcanic ash environment effects on the Pratt & Whitney F117-PW-100 turbofan engine, NASA Armstrong Flight Research Center has successfully performed structural design and analysis on the Volcanic Ash Distribution Rig (VADR) and the Structural Particulate Integration Device for Engine Research (SPIDER) for the ash ingestion test. Static and dynamic load analyses were performed to ensure no structural failure would occur during the test. Modal analysis was conducted, and the results were used to develop engine power setting avoidance zones. These engine power setting avoidance zones were defined to minimize the dwell time when the natural frequencies of the VADR/SPIDER system coincided with the excitation frequencies of the engine which was operating at various revolutions per minute. Vortex-induced vibration due to engine suction air flow during the ingestion test was also evaluated, but was not a concern.

  20. [Transcatheter embolization for huge pulmonary arteriovenous fistula using metallic "spider" and spring embolus--application of hand-made metallic "spider" using partial monorail technique]. (United States)

    Hirota, S; Sako, M; Fujita, Y; Hasegawa, Y; Sugimoto, K; Suzuki, Y; Kono, M


    We performed transcatheter embolization in two cases with huge pulmonary arteriovenous fistula (AVF) using a metallic "spider" and spring embolus. Conventional spring embolus or detachable balloon could not be used in these cases. Metallic spider was indicated for pulmonary AVF with a feeding artery diameter of more than 16 mm to prevent embolus passing through the AVF. In the first case, we used large handmade metallic spiders of 25 mm in diameter followed by embolization by numerous spring coils. At that time, a partial monorail technique was newly devised to carry the large metallic spider into the feeding artery, otherwise the spider could not pass into a 9F catheter. After embolization, symptoms and PaO2 in arterial blood improved remarkably in both cases. In the second case, a spring coil migrated into the normal pulmonary artery, but no infarction resulted. In conclusion, the metallic spider was very useful for embolization of hugee pulmonary AVF to avoid the embolus passing through and to tangle spring coils together with it. If commercially available "spiders" are too small, ones can be made easily.

  1. A troglomorphic spider from Java (Araneae, Ctenidae, Amauropelma) (United States)

    Miller, Jeremy; Rahmadi, Cahyo


    Abstract A new troglomorphic spider from caves in Central Java, Indonesia, is described and placed in the ctenid genus Amauropelma Raven, Stumkat & Gray, until now containing only species from Queensland, Australia. Only juveniles and mature females of the new species are known. We give our reasons for placing the new species in Amauropelma, discuss conflicting characters, and make predictions about the morphology of the as yet undiscovered male that will test our taxonomic hypothesis. The description includes DNA barcode sequence data. PMID:22303127

  2. Signal conflict in spider webs driven by predators and prey


    Blackledge, T. A.


    Variation in the sensory physiologies of organisms can bias the receptions of signals, driving the direction of signal evolution. Sensory drive in the evolution of signals may be particularly important for organisms that confront trade-offs in signal design between the need for conspicuousness to allow effective transfer of information and the need for crypsis of the signal to unintended receivers. Several genera of orb-weaving spiders include conspicuous silk designs, stabilimenta, in the ce...

  3. On the colours of spider orb-webs

    Energy Technology Data Exchange (ETDEWEB)

    Suhr, Wilfried; Schlichting, H Joachim, E-mail:, E-mail: [Institut fuer Didaktik der Physik, University of Muenster, 48149 Muenster (Germany)


    A sticky capture thread from the spiral element of spider orb-webs is formed of almost regularly spaced droplets that surround a supporting axial fibre. From the perspective of physical optics it represents a periodic linear array of scattering elements that acts as a diffraction grating. This is a novel aspect, which is of vital importance for the understanding of the overall scattering pattern. To demonstrate its significance, we present our experimental findings and compare them with results of a simplified model.

  4. The effect of age on encounters between male crab spiders


    Helen H. Hu; Douglass H. Morse


    In males that compete aggressively for females, size and age may determine which males obtain access to these females. In the present study, we use the crab spider, Misumena vatia, a species with males that do not grow after becoming sexually mature adults, to test the hypothesis that age affects the success of males competing for access to females. M. vatia is an excellent species to test this hypothesis because it is possible to disentangle age from size, characters that typically vary toge...

  5. Antenna-coupled TES bolometers for the SPIDER experiment

    Energy Technology Data Exchange (ETDEWEB)

    Kuo, C.L. [Jet Propulsion Laboratory, 4800 Oak Grove Drive, Pasadena, CA 91109 (United States)]|[California Institute of Technology, 1200 E California Boulevard, Pasadena, CA 91125 (United States)]. E-mail:; Ade, P. [University of Wales, Cardiff, 5 The Parade, Cardiff, CF24 3YB, Wales (United Kingdom); Bock, J.J. [Jet Propulsion Laboratory, 4800 Oak Grove Drive, Pasadena, CA 91109 (United States)]|[California Institute of Technology, 1200 E California Boulevard, Pasadena, CA 91125 (United States); Day, P. [Jet Propulsion Laboratory, 4800 Oak Grove Drive, Pasadena, CA 91109 (United States)]|[California Institute of Technology, 1200 E California Boulevard, Pasadena, CA 91125 (United States); Goldin, A.; Golwala, S.; Hristov, V.; Jones, W.C.; Lange, A.E.; Rossinot, P.; Vayonakis, A.; Wang, G. [California Institute of Technology, 1200 E California Boulevard, Pasadena, CA 91125 (United States); Halpern, M. [University of British Columbia, 2329 West Mall, Vancouver, BC, V6T 1Z4 (Canada); Hilton, G.; Irwin, K. [National Institute of Standards and Technology, 325 Broadway, Boulder, CO (United States); Holmes, W.; Kenyon, M.; LeDuc, H.G. [Jet Propulsion Laboratory, 4800 Oak Grove Drive, Pasadena, CA 91109 (United States); MacTavish, C. [University of Toronto, 60 St. George Street, Toronto, ON, M5S 1A7 (Canada); Montroy, T.; Ruhl, J. [Case Western Reserve University, 10900 Euclid Avenue, Cleveland, OH 44106 (United States); Netterfield, C.B. [University of Toronto, 60 St. George Street, Toronto, ON, M5S 1A7 (Canada); Yun, M. [Jet Propulsion Laboratory, 4800 Oak Grove Drive, Pasadena, CA 91109 (United States)]|[University of Pittsburgh, 348 Benedum Engineering Hall, Pittsburgh, PA 15261 (United States); Zmuidzinas, J. [Jet Propulsion Laboratory, 4800 Oak Grove Drive, Pasadena, CA 91109 (United States)]|[California Institute of Technology, 1200 E California Boulevard, Pasadena, CA 91125 (United States)


    SPIDER is a proposed balloon-borne experiment designed to search for the imprints of gravity waves on the polarization of the cosmic microwave background radiation. The required wide frequency coverage, large number of sensitive detectors, and the stringent power constraints on a balloon are made possible by antenna-coupled TES bolometers. Several prototype devices have been fabricated and optically characterized. Their spectral and angular responses agree well with the theoretical expectations.

  6. Reproductive Seasonality in Nesticus (Araneae: Nesticidae) Cave Spiders. (United States)

    Carver, Linnea M; Perlaky, Patricia; Cressler, Alan; Zigler, Kirk S


    Spiders of the family Nesticidae are members of cave communities around the world with cave-obligate (troglobiotic) species known from North America, Europe, Asia and the Indo-Pacific. A radiation of Nesticus (Araneae: Nesticidae) in the southern Appalachians includes ten troglobiotic species. Many of these species are of conservation interest due to their small ranges, with four species being single-cave endemics. Despite conservation concerns and their important role as predators in cave communities, we know little about reproduction and feeding in this group. We addressed this knowledge gap by examining populations of two species on a monthly basis for one year. We made further observations on several other species and populations, totaling 671 individual spider observations. This more than doubled the reported observations of reproduction and feeding in troglobiotic Nesticus. Female Nesticus carry egg sacs, facilitating the determination of the timing and frequency of reproduction. We found that Nesticus exhibit reproductive seasonality. Females carried egg sacs from May through October, with a peak in frequency in June. These spiders were rarely observed with prey; only 3.3% (22/671) of individuals were observed with prey items. The frequency at which prey items were observed did not vary by season. Common prey items were flies, beetles and millipedes. Troglobiotic species constituted approximately half of all prey items observed. This result represents a greater proportion of troglobiotic prey than has been reported for various troglophilic spiders. Although our findings shed light on the life history of troglobiotic Nesticus and on their role in cave ecosystems, further work is necessary to support effective conservation planning for many of these rare species.

  7. Spiders in mountain habitats of the Giant Mountains

    Czech Academy of Sciences Publication Activity Database

    Růžička, Vlastimil; Vaněk, J.; Šmilauer, P.


    Roč. 43, č. 4 (2012), s. 341-347 ISSN 1067-4136 Institutional research plan: CEZ:AV0Z50070508 Keywords : Giant Mountains (Krkonoše, Karkonosze) * spider s * anemo-orographic systems Subject RIV: EH - Ecology, Behaviour Impact factor: 0.236, year: 2012

  8. On the colours of spider orb-webs

    International Nuclear Information System (INIS)

    Suhr, Wilfried; Schlichting, H Joachim


    A sticky capture thread from the spiral element of spider orb-webs is formed of almost regularly spaced droplets that surround a supporting axial fibre. From the perspective of physical optics it represents a periodic linear array of scattering elements that acts as a diffraction grating. This is a novel aspect, which is of vital importance for the understanding of the overall scattering pattern. To demonstrate its significance, we present our experimental findings and compare them with results of a simplified model.

  9. Colonization of subterranean habitats by spiders in Central Europe

    Czech Academy of Sciences Publication Activity Database

    Růžička, Vlastimil; Šmilauer, P.; Mlejnek, R.


    Roč. 42, č. 2 (2013), s. 133-140 ISSN 0392-6672 Grant - others:GA JU(CZ) GAJU 04-142/2010/P Institutional support: RVO:60077344 Keywords : superficial and deep subterranean habitats * caves * spider s Subject RIV: EH - Ecology, Behaviour Impact factor: 1.275, year: 2013

  10. [Effects of Reactive Jump Training in Handball Players Regarding Jump Height and Power Development in the Triceps Surae Muscle]. (United States)

    Rensing, N; Westermann, A; Möller, D; von Piekartz, H


    Studies have shown changes in the technical and physical demands in modern handball. The game has increased considerably in speed, power and dynamics. Jump training has, therefore, become ever more important in the training of the athletes. These developments contribute to the fact that handball is now one of the most injury-prone types of sport, with the lower extremities being most frequently affected. Reactive jump training is not only used in training by now, but also increasingly in injury prevention. The aim of this study was to investigate the effectiveness of reactive jump training with handball players. 21 regional league handball players were randomly divided into an intervention group (n = 12) and a control group (n = 9). The intervention group completed a six-week reactive jump training programme while the control group went through a non-specific training programme. Jump height (squat and counter movement jump), isokinetic and isometric maximum power as well as muscle activity served as measuring parameters. A comparison of the intervention and control groups revealed that the reactive jump training led to significant improvements in jump height. The isometric and isokinetic maximum power measurements and the electromyographic activities of the triceps surae muscle demonstrated an improvement in the values within the intervention group. However, this improvement was not significant compared with the control group. Likewise both jumps correlated with the muscle activity of the soleus muscle as shown by electromyography. A moderate correlation was noticed between the isokinetic maximum power measurement and the electromyographic activity of the soleus and gastrocnemius medialis muscles. Furthermore, the correlations of the isometric and isokinetic maximum power meas-urements resulted in a strong correlation coefficient. This study revealed a significant increase in jump height after reactive jump training. There was no significant difference in

  11. Detection of Dew-Point by substantial Raman Band Frequency Jumps (A new Method)

    DEFF Research Database (Denmark)

    Hansen, Susanne Brunsgaard; Berg, Rolf W.; Stenby, Erling Halfdan

    Detection of Dew-Point by substantial Raman Band Frequency Jumps (A new Method). See poster at of Dew-Point by substantial Raman Band Frequency Jumps (A new Method). See poster at

  12. A New Limit on CMB Circular Polarization from SPIDER (United States)

    Nagy, J. M.; Ade, P. A. R.; Amiri, M.; Benton, S. J.; Bergman, A. S.; Bihary, R.; Bock, J. J.; Bond, J. R.; Bryan, S. A.; Chiang, H. C.; Contaldi, C. R.; Doré, O.; Duivenvoorden, A. J.; Eriksen, H. K.; Farhang, M.; Filippini, J. P.; Fissel, L. M.; Fraisse, A. A.; Freese, K.; Galloway, M.; Gambrel, A. E.; Gandilo, N. N.; Ganga, K.; Gudmundsson, J. E.; Halpern, M.; Hartley, J.; Hasselfield, M.; Hilton, G.; Holmes, W.; Hristov, V. V.; Huang, Z.; Irwin, K. D.; Jones, W. C.; Kuo, C. L.; Kermish, Z. D.; Li, S.; Mason, P. V.; Megerian, K.; Moncelsi, L.; Morford, T. A.; Netterfield, C. B.; Nolta, M.; Padilla, I. L.; Racine, B.; Rahlin, A. S.; Reintsema, C.; Ruhl, J. E.; Runyan, M. C.; Ruud, T. M.; Shariff, J. A.; Soler, J. D.; Song, X.; Trangsrud, A.; Tucker, C.; Tucker, R. S.; Turner, A. D.; Van Der List, J. F.; Weber, A. C.; Wehus, I. K.; Wiebe, D. V.; Young, E. Y.


    We present a new upper limit on cosmic microwave background (CMB) circular polarization from the 2015 flight of Spider, a balloon-borne telescope designed to search for B-mode linear polarization from cosmic inflation. Although the level of circular polarization in the CMB is predicted to be very small, experimental limits provide a valuable test of the underlying models. By exploiting the nonzero circular-to-linear polarization coupling of the half-wave plate polarization modulators, data from Spider's 2015 Antarctic flight provide a constraint on Stokes V at 95 and 150 GHz in the range 33< {\\ell }< 307. No other limits exist over this full range of angular scales, and Spider improves on the previous limit by several orders of magnitude, providing 95% C.L. constraints on {\\ell }({\\ell }+1){C}{\\ell }{VV}/(2π ) ranging from 141 to 255 μK2 at 150 GHz for a thermal CMB spectrum. As linear CMB polarization experiments become increasingly sensitive, the techniques described in this paper can be applied to obtain even stronger constraints on circular polarization.

  13. A New Limit on CMB Circular Polarization from SPIDER

    Energy Technology Data Exchange (ETDEWEB)

    Nagy, J. M.; Ade, P. A. R.; Amiri, M.; Benton, S. J.; Bergman, A. S.; Bihary, R.; Bock, J. J.; Bond, J. R.; Bryan, S. A.; Chiang, H. C.; Contaldi, C. R.; Doré, O.; Duivenvoorden, A. J.; Eriksen, H. K.; Farhang, M.; Filippini, J. P.; Fissel, L. M.; Fraisse, A. A.; Freese, K.; Galloway, M.; Gambrel, A. E.; Gandilo, N. N.; Ganga, K.; Gudmundsson, J. E.; Halpern, M.; Hartley, J.; Hasselfield, M.; Hilton, G.; Holmes, W.; Hristov, V. V.; Huang, Z.; Irwin, K. D.; Jones, W. C.; Kuo, C. L.; Kermish, Z. D.; Li, S.; Mason, P. V.; Megerian, K.; Moncelsi, L.; Morford, T. A.; Netterfield, C. B.; Nolta, M.; Padilla, I. L.; Racine, B.; Rahlin, A. S.; Reintsema, C.; Ruhl, J. E.; Runyan, M. C.; Ruud, T. M.; Shariff, J. A.; Soler, J. D.; Song, X.; Trangsrud, A.; Tucker, C.; Tucker, R. S.; Turner, A. D.; List, J. F. Van Der; Weber, A. C.; Wehus, I. K.; Wiebe, D. V.; Young, E. Y.


    We present a new upper limit on CMB circular polarization from the 2015 flight of SPIDER, a balloon-borne telescope designed to search for $B$-mode linear polarization from cosmic inflation. Although the level of circular polarization in the CMB is predicted to be very small, experimental limits provide a valuable test of the underlying models. By exploiting the non-zero circular-to-linear polarization coupling of the HWP polarization modulators, data from SPIDER's 2015 Antarctic flight provides a constraint on Stokes $V$ at 95 and 150 GHz from $33<\\ell<307$. No other limits exist over this full range of angular scales, and SPIDER improves upon the previous limit by several orders of magnitude, providing 95% C.L. constraints on $\\ell (\\ell+1)C_{\\ell}^{VV}/(2\\pi)$ ranging from 141 $\\mu K ^2$ to 203 $\\mu K ^2$ at 150 GHz for a thermal CMB spectrum. As linear CMB polarization experiments become increasingly sensitive, the techniques described in this paper can be applied to obtain stronger constraints on circular polarization.

  14. Detail design of the beam source for the SPIDER experiment

    International Nuclear Information System (INIS)

    Marcuzzi, D.; Agostinetti, P.; Dalla Palma, M.; Degli Agostini, F.; Pavei, M.; Rizzolo, A.; Tollin, M.; Trevisan, L.


    The ITER Neutral Beam Test Facility (PRIMA-Padova Research on Injector Megavolt Accelerated) is planned to be built at Consorzio RFX (Padova, Italy). PRIMA includes two experimental devices: a full size plasma source with low voltage extraction called SPIDER (Source for Production of Ion of Deuterium Extracted from RF plasma) and a full size neutral beam injector at full beam power called MITICA (Megavolt ITER Injector Concept Advancement). SPIDER is the first experimental device to be built and operated, aiming at testing the extraction of a negative ion beam (made of H - and in a later stage D - ions) from an ITER size ion source. The main requirements of this experiment are a H - /D - current of approximately 70 A/50 A and an energy of 100 keV. This paper presents an overview of the SPIDER beam source design, with a particular focus on the main design choices, aiming at reaching the best compromise between physics, optics, thermo-mechanical, cooling, assembly and electrical requirements.

  15. Jewelled spiders manipulate colour-lure geometry to deceive prey. (United States)

    White, Thomas E


    Selection is expected to favour the evolution of efficacy in visual communication. This extends to deceptive systems, and predicts functional links between the structure of visual signals and their behavioural presentation. Work to date has primarily focused on colour, however, thereby understating the multicomponent nature of visual signals. Here I examined the relationship between signal structure, presentation behaviour, and efficacy in the context of colour-based prey luring. I used the polymorphic orb-web spider Gasteracantha fornicata , whose yellow- or white-and-black striped dorsal colours have been broadly implicated in prey attraction. In a manipulative assay, I found that spiders actively control the orientation of their conspicuous banded signals in the web, with a distinct preference for near-diagonal bearings. Further field-based study identified a predictive relationship between pattern orientation and prey interception rates, with a local maximum at the spiders' preferred orientation. There were no morph-specific effects on capture success, either singularly or via an interaction with pattern orientation. These results reveal a dynamic element in a traditionally 'static' signalling context, and imply differential functions for chromatic and geometric signal components across visual contexts. More broadly, they underscore how multicomponent signal designs and display behaviours may coevolve to enhance efficacy in visual deception. © 2017 The Author(s).

  16. Epigeic spiders of the pastures of northern Wielkopolska

    Directory of Open Access Journals (Sweden)

    Woźny, Marek


    Full Text Available The fauna of epigeic spiders (Araneae occurring on three different types of pastures in northern Wielkopolska was analysed. Studies were conducted from May 1992 to October 1993. The 18,995 specimens collected were classified as belonging to 137 species and 17 families. The family Linyphiidae proved the richest in species while Lycosidae was the most abundantly in terms of number of specimens. Zoocenological analysis of spider communities showed their differentiation testifying to differences in the sites studied. The dominants were: 1 Osowo Stare (Site 1: Pardosa palustris, 2 Sycyn Dolny (Site 2: Xerolycosa miniata, P. palustris, Xysticus kochi, 3 Braczewo (Site 3: Erigone dentipalpis, P. palustris. Seasonal changes of dominance of the species at each site were established. A comparison of changes of the species’ dominances in the years 1992 and 1993 disclosed similar values of the individual dominance coefficient at the sites in Osowo Stare and Braczewo. This result indicates the occurrence of the process of stabilization of these biocenoses and a tendency to equilibrium in the environment. The least stable proved to be the site at Sycyn Dolny. Analysis of the seasonal dynamics of epigeic spider communities was also made by determining the mean number of species at each site in the two years of study. The highest number of species was noted in spring. It is interesting to note the appearance of species which are rare or very rare in Poland such as: Lepthyphantes insignis, Ostearius melanopygius, Enoplognatha mordax and Enoplognatha oelandica.

  17. Architecture of SPIDER control and data acquisition system

    International Nuclear Information System (INIS)

    Luchetta, A.; Manduchi, G.; Taliercio, C.; Soppelsa, A.; Barbalace, A.; Paolucci, F.; Sartori, F.; Barbato, P.; Breda, M.; Capobianco, R.; Molon, F.; Moressa, M.; Polato, S.; Simionato, P.; Zampiva, E.


    The ITER Heating Neutral Beam injectors will be implemented in three steps: development of the ion source prototype, development of the full injector prototype, and, finally, construction of up to three ITER injectors. The first two steps will be carried out in the ITER neutral beam test facility under construction in Italy. The ion source prototype, referred to as SPIDER, which is currently in the development phase, is a complex experiment involving more than 20 plant units and operating with beam-on pulses lasting up to 1 h. As for control and data acquisition it requires fast and slow control (cycle time around 0.1 ms and 10 ms, respectively), synchronization (10 ns resolution), and data acquisition for about 1000 channels (analogue and images) with sampling frequencies up to tens of MS/s, data throughput up to 200 MB/s, and data storage volume of up to tens of TB/year. The paper describes the architecture of the SPIDER control and data acquisition system, discussing the SPIDER requirements and the ITER CODAC interfaces and specifications for plant system instrumentation and control.

  18. Seasonal variation of ground spiders in a Brazilian Savanna

    Directory of Open Access Journals (Sweden)

    Marina Farcic Mineo


    Full Text Available The Brazilian Savanna Ecoregion (Cerrado is one of the richest biomes in the world, with a characteristic highly seasonal climate a dry season between May and September and a rainy season from October through April. Ground-dwelling spiders from three Cerrado phytophysiognomies, "campo cerrado", "cerrado" and "cerrad��o", were sampled using pitfall traps during two years, totaling 111 species and 3,529 individuals. The abundance of individuals and species richness was higher during the wet season. Fifty-eight species were captured exclusively during that period, whereas only nineteen were restricted to the dry season. Only two species were found in all samples. The number of juveniles was higher than the number of adults in all phytophysiognomies and in all species during both seasons. The highest abundance was registered in October and the lowest in April. Overall sex ratio was male-biased in all vegetation types sampled. Distinct climate variables affected the abundance of spiders depending on sex, age and vegetal physiognomy where they were sampled. This study involved the longest sampling of spider abundance and diversity on the ground of a Brazilian Savanna.

  19. Quantum jumps are more quantum than quantum diffusion

    International Nuclear Information System (INIS)

    Daryanoosh, Shakib; M Wiseman, Howard


    It was recently argued (Wiseman and Gambetta 2012 Phys. Rev. Lett. 108 220402) that the stochastic dynamics (jumps or diffusion) of an open quantum system are not inherent to the system, but rather depend on the existence and nature of a distant detector. The proposed experimental tests involved homodyne detection, giving rise to quantum diffusion, and required efficiencies η of well over 50%. Here we prove that this requirement (η>0.5) is universal for diffusive-type detection, even if the system is coupled to multiple baths. However, this no-go theorem does not apply to quantum jumps, and we propose a test involving a qubit with jump-type detectors, with a threshold efficiency of only 37%. That is, quantum jumps are ‘more quantum’, and open the way to practical experimental tests. Our scheme involves a novel sort of adaptive monitoring scheme on a system coupled to two baths. (paper)

  20. Hydraulic jump and Bernoulli equation in nonlinear shallow water model (United States)

    Sun, Wen-Yih


    A shallow water model was applied to study the hydraulic jump and Bernoulli equation across the jump. On a flat terrain, when a supercritical flow plunges into a subcritical flow, discontinuity develops on velocity and Bernoulli function across the jump. The shock generated by the obstacle may propagate downstream and upstream. The latter reflected from the inflow boundary, moves downstream and leaves the domain. Before the reflected wave reaching the obstacle, the short-term integration (i.e., quasi-steady) simulations agree with Houghton and Kasahara's results, which may have unphysical complex solutions. The quasi-steady flow is quickly disturbed by the reflected wave, finally, flow reaches steady and becomes critical without complex solutions. The results also indicate that Bernoulli function is discontinuous but the potential of mass flux remains constant across the jump. The latter can be used to predict velocity/height in a steady flow.

  1. A quasi-static treatment of multiple phase jumps

    International Nuclear Information System (INIS)

    Englman, R; Vertesi, T


    A quasi-static, WKB-type treatment accounts well for the surprising phase jumps that are odd multiples of π (1 + 2n)π, found as a molecular system journeys adiabatically in a configuration coordinate plane that contains several points of degeneracies. We show that the number n in the phase jump is an integer close to |n'| that appears in the expression for the complex wavefunction amplitude valid (approximately) for times close to when the phase jump occurs: -δT + 2πθ+πn'sinδT -i[1-πn'cosδT](δT is a shifted and rescaled trajectory-time parameter and θ is a numerical fraction (<1) which depends on the adiabaticity of the motion.) The central quantity n' is local, i.e., depends on the values of the parameters in the Hamiltonian only at the beginning of the trajectory and at the instant of the phase jump

  2. Trading price jump clusters in foreign exchange markets

    Czech Academy of Sciences Publication Activity Database

    Novotný, Jan; Petrov, D.; Urga, G.


    Roč. 24, June (2015), s. 66-92 ISSN 1386-4181 Institutional support: PRVOUK-P23 Keywords : price jumps * foreign exchange markets * trading Subject RIV: AH - Economics Impact factor: 1.726, year: 2015

  3. The fluid dynamics of swimming by jumping in copepods

    DEFF Research Database (Denmark)

    Jiang, Houshuo; Kiørboe, Thomas


    Copepods swim either continuously by vibrating their feeding appendages or erratically by repeatedly beating their swimming legs resulting in a series of small jumps. The two swimming modes generate different hydrodynamic disturbances and therefore expose the swimmers differently to rheotactic...... limited and temporally ephemeral owing to jump-impulsiveness and viscous decay. In contrast, continuous steady swimming generates two well-extended long-lasting momentum jets both in front of and behind the swimmer, as suggested by the well-known steady stresslet model. Based on the observed jump-swimming...... kinematics of a small copepod Oithona davisae, we further showed that jump-swimming produces a hydrodynamic disturbance with much smaller spatial extension and shorter temporal duration than that produced by a same-size copepod cruising steadily at the same average translating velocity. Hence, small copepods...

  4. Hiding information in open auctions with jump bids

    Czech Academy of Sciences Publication Activity Database

    Ettinger, D.; Michelucci, Fabio


    Roč. 126, č. 594 (2016), s. 1484-1502 ISSN 0013-0133 Institutional support: RVO:67985998 Keywords : hiding information * open auctions * jump bids Subject RIV: AH - Economics Impact factor: 2.608, year: 2016


    Directory of Open Access Journals (Sweden)

    Toplica Stojanović


    Full Text Available With goal to establish metric tests characteristics for estimating jumping for volleyball players, it was organized a pilot research on pattern of 23 volleyball players from cadet team and 23 students from high-school. For needs of this research four tests are valid for estimation, jump in block with left and right leg and jump in spike with left and right leg. Each test has been taken three times, so that we could with test-re test method determine their reliability, and with factor analysis their validity. Data were processed by multivariate analysis (item analysis, factor analysis from statistical package „Statistica 6.0 for windows“. On the results of research and discussion we can say that the tests had high coefficient of reliability, as well as factor validity, and these tests can be used to estimate jumping for volleyball players.

  6. Jump diffusion models and the evolution of financial prices

    International Nuclear Information System (INIS)

    Figueiredo, Annibal; Castro, Marcio T. de; Silva, Sergio da; Gleria, Iram


    We analyze a stochastic model to describe the evolution of financial prices. We consider the stochastic term as a sum of the Wiener noise and a jump process. We point to the effects of the jumps on the return time evolution, a central concern of the econophysics literature. The presence of jumps suggests that the process can be described by an infinitely divisible characteristic function belonging to the De Finetti class. We then extend the De Finetti functions to a generalized nonlinear model and show the model to be capable of explaining return behavior. -- Highlights: → We analyze a stochastic model to describe the evolution of financial prices. → The stochastic term is considered as a sum of the Wiener noise and a jump process. → The process can be described by an infinitely divisible characteristic function belonging to the De Finetti class. → We extend the De Finetti functions to a generalized nonlinear model.

  7. Hiding information in open auctions with jump bids

    Czech Academy of Sciences Publication Activity Database

    Ettinger, D.; Michelucci, Fabio


    Roč. 126, č. 594 (2016), s. 1484-1502 ISSN 0013-0133 Institutional support: PRVOUK-P23 Keywords : hiding information * open auctions * jump bids Subject RIV: AH - Economics Impact factor: 2.608, year: 2016

  8. The exit-time problem for a Markov jump process (United States)

    Burch, N.; D'Elia, M.; Lehoucq, R. B.


    The purpose of this paper is to consider the exit-time problem for a finite-range Markov jump process, i.e, the distance the particle can jump is bounded independent of its location. Such jump diffusions are expedient models for anomalous transport exhibiting super-diffusion or nonstandard normal diffusion. We refer to the associated deterministic equation as a volume-constrained nonlocal diffusion equation. The volume constraint is the nonlocal analogue of a boundary condition necessary to demonstrate that the nonlocal diffusion equation is well-posed and is consistent with the jump process. A critical aspect of the analysis is a variational formulation and a recently developed nonlocal vector calculus. This calculus allows us to pose nonlocal backward and forward Kolmogorov equations, the former equation granting the various moments of the exit-time distribution.

  9. Impulsive evolution inclusions with infinite delay and multivalued jumps

    Directory of Open Access Journals (Sweden)

    Mouffak Benchohra


    Full Text Available In this paper we prove the existence of a mild solution for a class of impulsive semilinear evolution differential inclusions with infinite delay and multivalued jumps in a Banach space.

  10. Swarm algorithms with chaotic jumps for optimization of multimodal functions (United States)

    Krohling, Renato A.; Mendel, Eduardo; Campos, Mauro


    In this article, the use of some well-known versions of particle swarm optimization (PSO) namely the canonical PSO, the bare bones PSO (BBPSO) and the fully informed particle swarm (FIPS) is investigated on multimodal optimization problems. A hybrid approach which consists of swarm algorithms combined with a jump strategy in order to escape from local optima is developed and tested. The jump strategy is based on the chaotic logistic map. The hybrid algorithm was tested for all three versions of PSO and simulation results show that the addition of the jump strategy improves the performance of swarm algorithms for most of the investigated optimization problems. Comparison with the off-the-shelf PSO with local topology (l best model) has also been performed and indicates the superior performance of the standard PSO with chaotic jump over the standard both using local topology (l best model).

  11. Spinal column damage from water ski jumping

    International Nuclear Information System (INIS)

    Horne, J.; Cockshott, W.P.; Shannon, H.S.


    We conducted a radiographic survey of 117 competitive water ski jumpers to determine whether this sport can cause spinal column damage and, if so, whether damage is more likely to occur in those who participate during the period of spinal growth and development (age 15 years or younger). We found a high prevalence of two types of abnormality: Scheuermann (adolescent) spondylodystrophy (present in 26% of the skiers) and vertebral body wedging (present in 34%). The prevalence of adolescent spondylodystrophy increased with the number of years of participation in the sport before age 15 years or less. Of those in this age group who had skied for 5 years or more, 57 showed adolescent spondylodystrophy; of those in the same age group who had skied for 9 years or more, 100% were affected. Wedged vertebrae increased as time of participation increased, regardless of the age at which exposure began. We conclude that competitive water ski jumping may damage the spinal column and that consideration should be given to regulating this sport, particularly for children. (orig.)

  12. Spinal column damage from water ski jumping. (United States)

    Horne, J; Cockshott, W P; Shannon, H S


    We conducted a radiographic survey of 117 competitive water ski jumpers to determine whether this sport can cause spinal column damage and, if so, whether damage is more likely to occur in those who participate during the period of spinal growth and development (age 15 years or younger). We found a high prevalence of two types of abnormality: Scheuermann (adolescent) spondylodystrophy (present in 26% of the skiers) and vertebral body wedging (present in 34%). The prevalence of adolescent spondylodystrophy increased with the number of years of participation in the sport before age 15 years or less. Of those in this age group who had skied for 5 years or more, 57 showed adolescent spondylodystrophy; of those in the same age group who had skied for 9 years or more, 100% were affected. Wedged vertebrae increased as time of participation increased, regardless of the age at which exposure began. We conclude that competitive water ski jumping may damage the spinal column and that consideration should be given to regulating this sport, particularly for children.

  13. Why do oil prices jump (or fall)?

    International Nuclear Information System (INIS)

    Wirl, Franz


    This paper discusses theories that can explain the zig-zags of oil prices in general and in particular the recent jump. More precisely, the following explanations are discussed: Homo oeconomicus (pure profit maximization if demand is dynamic and convex), price reaction function (price increases and respectively declines depend on capacity utilization), cartelization contingent on output or revenues of which the latter can lead to backward bending supply segments and multiple equilibria, statistical descriptions (mean reversion), homo politicus, i.e., arguments for price hikes that are rational (Public Choice) despite the (long-run) economic loss. Finally two approaches are presented that emphasize demand uncertainty: one extending the above-mentioned dynamic demand framework and the other considers a dynamic game of non-competitive suppliers with lumpy investments. Summing up, a demand shock seems to be the most suitable explanation of today's high prices (indeed a shock given that International Energy Agency (IEA) and Department of Energy (DoE) were promising just a couple of years ago that we are going to have lots of oil at low prices), while others and in particular politics have surprisingly little or no explanatory power. (author)

  14. Ethics in radiology: wait lists queue jumping. (United States)

    Cunningham, Natalie; Reid, Lynette; MacSwain, Sarah; Clarke, James R


    Education in ethics is a requirement for all Royal College residency training programs as laid out in the General Standards of Accreditation for residency programs in Canada. The ethical challenges that face radiologists in clinical practice are often different from those that face other physicians, because the nature of the physician-patient interaction is unlike that of many other specialties. Ethics education for radiologists and radiology residents will benefit from the development of teaching materials and resources that focus on the issues that are specific to the specialty. This article is intended to serve as an educational resource for radiology training programs to facilitate teaching ethics to residents and also as a continuing medical education resource for practicing radiologists. In an environment of limited health care resources, radiologists are frequently asked to expedite imaging studies for patients and, in some respects, act as gatekeepers for specialty care. The issues of wait lists, queue jumping, and balancing the needs of individuals and society are explored from the perspective of a radiologist. Copyright © 2013 Canadian Association of Radiologists. Published by Elsevier Inc. All rights reserved.

  15. Vortex jump behavior in coupled nanomagnetic heterostructures

    International Nuclear Information System (INIS)

    Zhang, S.; Phatak, C.; Petford-Long, A. K.; Heinonen, O.


    The spin configuration and magnetic behavior in patterned nanostructures can be controlled by manipulating the interplay between the competing energy terms. This in turn requires fundamental knowledge of the magnetic interactions at the local nanometer scale. Here, we report on the spin structure and magnetization behavior of patterned discs containing exchange coupled ferromagnetic layers with additional exchange bias to an antiferromagnetic layer. The magnetization reversal was explored by direct local visualization of the domain behavior using in-situ Lorentz transmission electron microscopy, from which quantitative magnetic induction maps were reconstructed. The roles of the main competing energy terms were elucidated and the reversal mechanism was identified as a coupled phenomenon of incoherent rotation in the exchange-biased layer and localized vortex nucleation and discontinuous propagation in the free layer, including an anomalous jump in the trajectory. The observations were supported by micromagnetic simulations and modeled phase shift simulations. The work presented here provides fundamental insights into opportunities for macroscopic control of the energy landscape of magnetic heterostructures for functional applications

  16. Spinal column damage from water ski jumping

    Energy Technology Data Exchange (ETDEWEB)

    Horne, J.; Cockshott, W.P.; Shannon, H.S.


    We conducted a radiographic survey of 117 competitive water ski jumpers to determine whether this sport can cause spinal column damage and, if so, whether damage is more likely to occur in those who participate during the period of spinal growth and development (age 15 years or younger). We found a high prevalence of two types of abnormality: Scheuermann (adolescent) spondylodystrophy (present in 26% of the skiers) and vertebral body wedging (present in 34%). The prevalence of adolescent spondylodystrophy increased with the number of years of participation in the sport before age 15 years or less. Of those in this age group who had skied for 5 years or more, 57 showed adolescent spondylodystrophy; of those in the same age group who had skied for 9 years or more, 100% were affected. Wedged vertebrae increased as time of participation increased, regardless of the age at which exposure began. We conclude that competitive water ski jumping may damage the spinal column and that consideration should be given to regulating this sport, particularly for children. (orig.)

  17. Vortex jump behavior in coupled nanomagnetic heterostructures

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, S.; Phatak, C., E-mail: [Materials Science Division, Argonne National Laboratory, 9700 S. Cass Avenue, Argonne, Illinois 60439 (United States); Petford-Long, A. K. [Materials Science Division, Argonne National Laboratory, 9700 S. Cass Avenue, Argonne, Illinois 60439 (United States); Department of Materials Science and Engineering, Northwestern University, 2220 Campus Drive, Evanston, Illinois 60208 (United States); Heinonen, O. [Materials Science Division, Argonne National Laboratory, 9700 S. Cass Avenue, Argonne, Illinois 60439 (United States); Department of Physics and Astronomy, Northwestern University, 2145 Sheridan Rd, Evanston, Illinois 60208-3112 (United States)


    The spin configuration and magnetic behavior in patterned nanostructures can be controlled by manipulating the interplay between the competing energy terms. This in turn requires fundamental knowledge of the magnetic interactions at the local nanometer scale. Here, we report on the spin structure and magnetization behavior of patterned discs containing exchange coupled ferromagnetic layers with additional exchange bias to an antiferromagnetic layer. The magnetization reversal was explored by direct local visualization of the domain behavior using in-situ Lorentz transmission electron microscopy, from which quantitative magnetic induction maps were reconstructed. The roles of the main competing energy terms were elucidated and the reversal mechanism was identified as a coupled phenomenon of incoherent rotation in the exchange-biased layer and localized vortex nucleation and discontinuous propagation in the free layer, including an anomalous jump in the trajectory. The observations were supported by micromagnetic simulations and modeled phase shift simulations. The work presented here provides fundamental insights into opportunities for macroscopic control of the energy landscape of magnetic heterostructures for functional applications.

  18. A jumping shape memory alloy under heat. (United States)

    Yang, Shuiyuan; Omori, Toshihiro; Wang, Cuiping; Liu, Yong; Nagasako, Makoto; Ruan, Jingjing; Kainuma, Ryosuke; Ishida, Kiyohito; Liu, Xingjun


    Shape memory alloys are typical temperature-sensitive metallic functional materials due to superelasticity and shape recovery characteristics. The conventional shape memory effect involves the formation and deformation of thermally induced martensite and its reverse transformation. The shape recovery process usually takes place over a temperature range, showing relatively low temperature-sensitivity. Here we report novel Cu-Al-Fe-Mn shape memory alloys. Their stress-strain and shape recovery behaviors are clearly different from the conventional shape memory alloys. In this study, although the Cu-12.2Al-4.3Fe-6.6Mn and Cu-12.9Al-3.8Fe-5.6Mn alloys possess predominantly L2(1) parent before deformation, the 2H martensite stress-induced from L2(1) parent could be retained after unloading. Furthermore, their shape recovery response is extremely temperature-sensitive, in which a giant residual strain of about 9% recovers instantly and completely during heating. At the same time, the phenomenon of the jumping of the sample occurs. It is originated from the instantaneous completion of the reverse transformation of the stabilized 2H martensite. This novel Cu-Al-Fe-Mn shape memory alloys have great potentials as new temperature-sensitive functional materials.



    I Gusti Ngurah Agung Cahya Prananta; N. Adiputra; I P G Adiatmika


    The effectiveness of  jump-shoot technique step jump shoot and still jump shoot in a game is still questionable,  because many different assumptions arise. One opinion stated that step jump shoot was more effective and the other stated that and still jump shoot was more efective. Therefore it is necessary to do research on the analysis of the results of step jump shoot and and still jump shoot to improve the accuracy of shooting in a basketball. The experimental research had been conducted on...

  20. Transition-energy crossing with a γt-jump

    International Nuclear Information System (INIS)

    Wei, Jie; Peggs, S.


    Expressions for the minimum size and speed of a transition-energy (γ t -) jump needed to diminish the chromatic non-linear effect, the self-field mismatch, and the microwave instabilities in the Relativistic Heavy Ion Collider (RHIC) are obtained. A γ t -jump of 0.8 units is needed to be performed within 60 ms in order to achieve a ''clean'' transition crossing