Frequent misdirected courtship in a natural community of colorful Habronattus jumping spiders.

Science.gov (United States)

Taylor, Lisa A; Powell, Erin C; McGraw, Kevin J

2017-01-01

Male courtship display is common in many animals; in some cases, males engage in courtship indiscriminately, spending significant time and energy courting heterospecifics with whom they have no chance of mating or producing viable offspring. Due to high costs and few if any benefits, we might expect mechanisms to evolve to reduce such misdirected courtship (or 'reproductive interference'). In Habronattus jumping spiders, males frequently court heterospecifics with whom they do not mate or hybridize; females are larger and are voracious predators, posing a severe risk to males who court indiscriminately. In this study, we examined patterns of misdirected courtship in a natural community of four sympatric Habronattus species (H. clypeatus, H. hallani, H. hirsutus, and H. pyrrithrix). We used direct field observations to weigh support for two hypotheses (differential microhabitat use and species recognition signaling) to explain how these species reduce the costs associated with misdirected courtship. We show that, while the four species of Habronattus do show some differences in microhabitat use, all four species still overlap substantially, and in three of the four species individuals equally encountered heterospecifics and conspecifics. Males courted females at every opportunity, regardless of species, and in some cases, this led to aggression and predation by the female. These results suggest that, while differences in microhabitat use might reduce misdirected courtship to some extent, co-existence of these four species may be possible due to complex communication (i.e. species-specific elements of a male's courtship display). This study is the first to examine misdirected courtship in jumping spiders. Studies of misdirected courtship and its consequences in the field are limited and may broaden our understanding of how biodiversity is maintained within a community.

Survival benefits select for group living in a social spider despite reproductive costs

DEFF Research Database (Denmark)

Bilde, T.; Coates, K.S.; Birkhofer, K.

2007-01-01

The evolution of cooperation requires benefits of group living to exceed costs. Hence, some components of fitness are expected to increase with increasing group size, whereas others may decrease because of competition among group members. The social spiders provide an excellent system to investig......The evolution of cooperation requires benefits of group living to exceed costs. Hence, some components of fitness are expected to increase with increasing group size, whereas others may decrease because of competition among group members. The social spiders provide an excellent system...... to investigate the costs and benefits of group living: they occur in groups of various sizes and individuals are relatively short-lived, therefore life history traits and Lifetime Reproductive Success (LRS) can be estimated as a function of group size. Sociality in spiders has originated repeatedly...... and survival in the social spider Stegodyphus dumicola in two populations in Namibia. In both populations, the major benefit of group living was improved survival of colonies and late-instar juveniles with increasing colony size. By contrast, female fecundity, female body size and early juvenile survival...

Jumping hoops on water

Science.gov (United States)

Yang, Eunjin; Kim, Ho-Young

2015-11-01

Small aquatic arthropods, such as water striders and fishing spiders, are able to jump off water to a height several times their body length. Inspired by the unique biological motility on water, we study a simple model using a flexible hoop to provide fundamental understanding and a mimicking principle of small jumpers on water. Behavior of a hoop on water, which is coated with superhydrophobic particles and initially bent into an ellipse from an equilibrium circular shape, is visualized with a high speed camera upon launching it into air by releasing its initial elastic strain energy. We observe that jumping of our hoops is dominated by the dynamic pressure of water rather than surface tension, and thus it corresponds to the dynamic condition experienced by fishing spiders. We calculate the reaction forces provided by water adopting the unsteady Bernoulli equation as well as the momentum loss into liquid inertia and viscous friction. Our analysis allows us to predict the jumping efficiency of the hoop on water in comparison to that on ground, and to discuss the evolutionary pressure rendering fishing spiders select such dynamic behavior.

Diversity and distribution of epiphytic bromeliads in a Brazilian subtropical mangrove.

Science.gov (United States)

Sousa, Mariana M DE; Colpo, Karine D

2017-01-01

It is not unusual to find epiphytic bromeliads in mangroves, but most studies on mangrove vegetation do not record their presence. This study aimed to evaluate the diversity and distribution of epiphytic bromeliads in a subtropical mangrove. The richness, abundance and life form (atmospheric and tank) of bromeliads were recorded and compared among host tree species and waterline proximity. The effects of diameter and height of host trees on the abundance of bromeliads were also assessed. The mangrove was composed of Avicennia schaueriana, Laguncularia racemosa and Rhizophora mangle. We recorded seven bromeliad species of the genera Tillandsia and Vriesea. The waterline proximity did not affect the abundance or diversity of bromeliads, but atmospheric forms were predominant near the waterline, whereas tank bromeliads were more frequent in the interior of the mangrove. The three mangrove species hosted bromeliads, but L. racemosa was the preferred host. The species composition showed that the distribution of bromeliads is more related to the host species than to the distance from the waterline. Bromeliad abundance increased with tree size. Bromeliads can be biological indicators of ecosystem health; therefore, inventories and host tree preferences are necessary knowledge for an adequate management of sensitive ecosystems as mangroves.

Diversity and distribution of epiphytic bromeliads in a Brazilian subtropical mangrove

Directory of Open Access Journals (Sweden)

MARIANA M. DE SOUSA

Full Text Available ABSTRACT It is not unusual to find epiphytic bromeliads in mangroves, but most studies on mangrove vegetation do not record their presence. This study aimed to evaluate the diversity and distribution of epiphytic bromeliads in a subtropical mangrove. The richness, abundance and life form (atmospheric and tank of bromeliads were recorded and compared among host tree species and waterline proximity. The effects of diameter and height of host trees on the abundance of bromeliads were also assessed. The mangrove was composed of Avicennia schaueriana, Laguncularia racemosa and Rhizophora mangle. We recorded seven bromeliad species of the genera Tillandsia and Vriesea. The waterline proximity did not affect the abundance or diversity of bromeliads, but atmospheric forms were predominant near the waterline, whereas tank bromeliads were more frequent in the interior of the mangrove. The three mangrove species hosted bromeliads, but L. racemosa was the preferred host. The species composition showed that the distribution of bromeliads is more related to the host species than to the distance from the waterline. Bromeliad abundance increased with tree size. Bromeliads can be biological indicators of ecosystem health; therefore, inventories and host tree preferences are necessary knowledge for an adequate management of sensitive ecosystems as mangroves.

Spider-Ant Associations: An Updated Review of Myrmecomorphy, Myrmecophily, and Myrmecophagy in Spiders

Directory of Open Access Journals (Sweden)

Paula E. Cushing

2012-01-01

Full Text Available This paper provides a summary of the extensive theoretical and empirical work that has been carried out in recent years testing the adaptational significance of various spider-ant associations. Hundreds of species of spiders have evolved close relationships with ants and can be classified as myrmecomorphs, myrmecophiles, or myrmecophages. Myrmecomorphs are Batesian mimics. Their close morphological and behavioral resemblance to ants confers strong survival advantages against visually hunting predators. Some species of spiders have become integrated into the ant society as myrmecophiles or symbionts. These spider myrmecophiles gain protection against their own predators, live in an environment with a stable climate, and are typically surrounded by abundant food resources. The adaptations by which this integration is made possible are poorly known, although it is hypothesized that most spider myrmecophiles are chemical mimics and some are even phoretic on their hosts. The third type of spider-ant association discussed is myrmecophagy—or predatory specialization on ants. A table of known spider myrmecophages is provided as is information on their biology and hunting strategies. Myrmecophagy provides these predators with an essentially unlimited food supply and may even confer other protections to the spiders.

Loss of phytotelmata due to an invasive bromeliad-eating weevil and its potential effects on faunal diversity and biogeochemical cycles

Science.gov (United States)

Cooper, Teresa M.; Frank, J. Howard; Cave, Ronald D.

2014-01-01

Epiphytic tank bromeliads are important ecosystem engineers because they form phytotelmata that create habitat, increase species richness and abundance, create water sources and nutrient reservoirs in the canopy, and collect and redirect nutrients in forest ecosystems. Native bromeliad populations have been devastated in Florida (USA) because an invasive bromeliad-eating weevil (Metamasius callizona) has been destroying the plants. Tillandsia utriculata is a tank bromeliad that was once widespread from central to south Florida. Its populations have been hit hard by the weevil and are declining rapidly. This study quantifies the mortality rate caused by the weevil in a population of T. utriculata at the Enchanted Forest Sanctuary in central Florida and estimates the associated loss of phytotelmata. Estimations of phytotelmata were calculated for the T. utriculata baseline population, the population at 6 months into the study when 87% of the population was destroyed, and at the end of the study when less than 3% of the bromeliad population remained (99% of all deaths were caused by the weevil). The baseline population contained 16,758 L of water. At six months, there were 3180 L, and at the end of the study, there were 408 L. The loss of phytotelmata results in the loss of habitat, a decrease in biological diversity, and altered water and nutrient cycles and availability.

Are algae relevant to the detritus-based food web in tank-bromeliads?

Directory of Open Access Journals (Sweden)

Olivier Brouard

Full Text Available We assessed the occurrence of algae in five species of tank-bromeliads found in contrasting environmental sites in a Neotropical, primary rainforest around the Nouragues Research Station, French Guiana. The distributions of both algal abundance and biomass were examined based on physical parameters, the morphological characteristics of bromeliad species and with regard to the structure of other aquatic microbial communities held in the tanks. Algae were retrieved in all of the bromeliad species with mean densities ranging from ∼10(2 to 10(4 cells/mL. Their biomass was positively correlated to light exposure and bacterial biomass. Algae represented a tiny component of the detrital food web in shaded bromeliads but accounted for up to 30 percent of the living microbial carbon in the tanks of Catopsis berteroniana, located in a highly exposed area. Thus, while nutrient supplies are believed to originate from wind-borne particles and trapped insects (i.e., allochtonous organic matter, our results indicate that primary producers (i.e., autochtonous organic matter are present in this insectivorous bromeliad. Using a 24-h incubation of size-fractionated and manipulated samples from this plant, we evaluated the impact of mosquito foraging on algae, other microorganisms and rotifers. The prey assemblages were greatly altered by the predation of mosquito larvae. Grazing losses indicated that the dominant algal taxon, Bumilleriopsis sp., like protozoa and rotifers, is a significant part of the diet of mosquito larvae. We conclude that algae are a relevant functional community of the aquatic food web in C. berteroniana and might form the basis of a complementary non-detrital food web.

Bromeliad Selection by Two Salamander Species in a Harsh Environment

Science.gov (United States)

Ruano-Fajardo, Gustavo; Rovito, Sean M.; Ladle, Richard J.

2014-01-01

Bromeliad phytotelmata are frequently used by several Neotropical amphibian taxa, possibly due to their high humidity, microclimatic stability, and role as a refuge from predators. Indeed, the ability of phytotelmata to buffer against adverse environmental conditions may be instrumental in allowing some amphibian species to survive during periods of environmental change or to colonize sub-optimal habitats. Association between bromeliad traits and salamanders has not been studied at a fine scale, despite the intimate association of many salamander species with bromeliads. Here, we identify microhabitat characteristics of epiphytic bromeliads used by two species of the Bolitoglossa morio group (B. morio and B. pacaya) in forest disturbed by volcanic activity in Guatemala. Specifically, we measured multiple variables for bromeliads (height and position in tree, phytotelma water temperature and pH, canopy cover, phytotelma size, leaf size, and tree diameter at breast height), as well as salamander size. We employed a DNA barcoding approach to identify salamanders. We found that B. morio and B. pacaya occurred in microsympatry in bromeliads and that phytotelmata size and temperature of bromeliad microhabitat were the most important factors associated with the presence of salamanders. Moreover, phytotelmata with higher pH contained larger salamanders, suggesting that larger salamanders or aggregated individuals might modify pH. These results show that bromeliad selection is nonrandom with respect to microhabitat characteristics, and provide insight into the relationship between salamanders and this unique arboreal environment. PMID:24892414

Bromeliad selection by two salamander species in a harsh environment.

Directory of Open Access Journals (Sweden)

Gustavo Ruano-Fajardo

Full Text Available Bromeliad phytotelmata are frequently used by several Neotropical amphibian taxa, possibly due to their high humidity, microclimatic stability, and role as a refuge from predators. Indeed, the ability of phytotelmata to buffer against adverse environmental conditions may be instrumental in allowing some amphibian species to survive during periods of environmental change or to colonize sub-optimal habitats. Association between bromeliad traits and salamanders has not been studied at a fine scale, despite the intimate association of many salamander species with bromeliads. Here, we identify microhabitat characteristics of epiphytic bromeliads used by two species of the Bolitoglossa morio group (B. morio and B. pacaya in forest disturbed by volcanic activity in Guatemala. Specifically, we measured multiple variables for bromeliads (height and position in tree, phytotelma water temperature and pH, canopy cover, phytotelma size, leaf size, and tree diameter at breast height, as well as salamander size. We employed a DNA barcoding approach to identify salamanders. We found that B. morio and B. pacaya occurred in microsympatry in bromeliads and that phytotelmata size and temperature of bromeliad microhabitat were the most important factors associated with the presence of salamanders. Moreover, phytotelmata with higher pH contained larger salamanders, suggesting that larger salamanders or aggregated individuals might modify pH. These results show that bromeliad selection is nonrandom with respect to microhabitat characteristics, and provide insight into the relationship between salamanders and this unique arboreal environment.

A new species of jumping spider Neonella Gertsch, with notes on the genus and male identification key (Araneae, Salticidae)

Science.gov (United States)

Rubio, Gonzalo D.; Argañaraz, Carina I.; Gleiser, Raquel M.

2015-01-01

Abstract The American genus Neonella Gertsch, 1936 consists of very small jumping spiders whose biology is not well known. The genus currently includes eleven valid species, of which eight are known from both sexes and two are only known from one sex. This paper describes and illustrates a new species Neonella acostae sp. n., demonstrates male palpal variation in Neonella montana Galiano, 1988, and provides some information on the ecology of three sympatric species. New records of Neonella montana and Neonella minuta Galiano, 1965 are reported. Because the previously described species of Neonella were well illustrated and diagnosed, a dichotomous key to males is given along with genital illustrations of both sexes for all known species. PMID:26692804

Molecular Characterization of Cultivated Bromeliad Accessions with Inter-Simple Sequence Repeat (ISSR Markers

Directory of Open Access Journals (Sweden)

Yongming Yu

2012-05-01

Full Text Available Bromeliads are of great economic importance in flower production; however little information is available with respect to genetic characterization of cultivated bromeliads thus far. In the present study, a selection of cultivated bromeliads was characterized via inter-simple sequence repeat (ISSR markers with an emphasis on genetic diversity and population structure. Twelve ISSR primers produced 342 bands, of which 287 (~84% were polymorphic, with polymorphic bands per primer ranging from 17 to 34. The Jaccard’s similarity ranged from 0.08 to 0.89 and averaged ~0.30 for the investigated bromeliads. The Bayesian-based approach, together with the un-weighted paired group method with arithmetic average (UPGMA-based clustering and the principal coordinate analysis (PCoA, distinctly grouped the bromeliads from Neoregelia, Guzmania, and Vriesea into three separately clusters, well corresponding with their botanical classifications; whereas the bromeliads of Aechmea other than the recently selected hybrids were not well assigned to a cluster. Additionally, ISSR marker was proven efficient for the identification of hybrids and bud sports of cultivated bromeliads. The findings achieved herein will further our knowledge about the genetic variability within cultivated bromeliads and therefore facilitate breeding for new varieties of cultivated bromeliads in future as well.

Species-Specific Effects of Ant Inhabitants on Bromeliad Nutrition.

Directory of Open Access Journals (Sweden)

Ana Z Gonçalves

Full Text Available Predator activities may lead to the accumulation of nutrients in specific areas of terrestrial habitats where they dispose of prey carcasses. In their feeding sites, predators may increase nutrient availability in the soil and favor plant nutrition and growth. However, the translocation of nutrients from one habitat to another may depend on predator identity and diet, as well as on the amount of prey intake. Here we used isotopic (15N and physiological methods in greenhouse experiments to evaluate the effects of the identity of predatory ants (i.e., the consumption of prey and nest sites on the nutrition and growth of the bromeliad Quesnelia arvensis. We showed that predatory ants with protein-based nutrition (i.e., Odontomachus hastatus, Gnamptogenys moelleri improved the performance of their host bromeliads (i.e., increased foliar N, production of soluble proteins and growth. On the other hand, the contribution of Camponotus crassus for the nutritional status of bromeliads did not differ from bromeliads without ants, possibly because this ant does not have arthropod prey as a preferred food source. Our results show, for the first time, that predatory ants can translocate nutrients from one habitat to another within forests, accumulating nutrients in their feeding sites that become available to bromeliads. Additionally, we highlight that ant contribution to plant nutrition may depend on predator identity and its dietary requirements. Nest debris may be especially important for epiphytic and terrestrial bromeliads in nutrient-poor environments.

Host trait combinations drive abundance and canopy distribution of atmospheric bromeliad assemblages.

Science.gov (United States)

Chaves, Cleber Juliano Neves; Dyonisio, Júlio César; Rossatto, Davi Rodrigo

2016-01-01

Epiphytes are strongly dependent on the conditions created by their host's traits and a certain degree of specificity is expected between them, even if these species are largely abundant in a series of tree hosts of a given environment, as in the case of atmospheric bromeliads. Despite their considerable abundance in these environments, we hypothesize that stochasticity alone cannot explain the presence and abundance of atmospheric bromeliads on host trees, since host traits could have a greater influence on the establishment of these bromeliads. We used secondary and reforested seasonal forests and three distinct silvicultures to test whether species richness, phylogenetic diversity and functional diversity of trees can predict the differential presence, abundance and distribution of atmospheric bromeliads on hosts. We compared the observed parameters of their assemblage with null models and performed successive variance hierarchic partitions of abundance and distribution of the assemblage to detect the influence of multiple traits of the tree hosts. Our results do not indicate direct relationships between the abundance of atmospheric bromeliads and phylogenetic or functional diversity of trees, but instead indicate that bromeliads occurred on fewer tree species than expected by chance. We distinguished functional tree patterns that can improve or reduce the abundance of atmospheric bromeliads, and change their distribution on branches and trunk. While individual tree traits are related to increased abundance, species traits are related to the canopy distribution of atmospheric bromeliad assemblages. A balance among these tree functional patterns drives the atmospheric bromeliad assemblage of the forest patches. Published by Oxford University Press on behalf of the Annals of Botany Company.

Plant structure predicts leaf litter capture in the tropical montane bromeliad Tillandsia turneri.

Science.gov (United States)

Ospina-Bautista, F; Estévez Varón, J V

2016-05-03

Leaves intercepted by bromeliads become an important energy and matter resource for invertebrate communities, bacteria, fungi, and the plant itself. The relationship between bromeliad structure, defined as its size and complexity, and accumulated leaf litter was studied in 55 bromeliads of Tillandsia turneri through multiple regression and the Akaike information criterion. Leaf litter accumulation in bromeliads was best explained by size and complexity variables such as plant cover, sheath length, and leaf number. In conclusion, plant structure determines the amount of litter that enters bromeliads, and changes in its structure could affect important processes within ecosystem functioning or species richness.

Rainfall changes affect the algae dominance in tank bromeliad ecosystems

Science.gov (United States)

Pires, Aliny Patricia Flauzino; Leal, Juliana da Silva; Peeters, Edwin T. H. M.

2017-01-01

Climate change and biodiversity loss have been reported as major disturbances in the biosphere which can trigger changes in the structure and functioning of natural ecosystems. Nonetheless, empirical studies demonstrating how both factors interact to affect shifts in aquatic ecosystems are still unexplored. Here, we experimentally test how changes in rainfall distribution and litter diversity affect the occurrence of the algae-dominated condition in tank bromeliad ecosystems. Tank bromeliads are miniature aquatic ecosystems shaped by the rainwater and allochthonous detritus accumulated in the bases of their leaves. Here, we demonstrated that changes in the rainfall distribution were able to reduce the chlorophyll-a concentration in the water of bromeliad tanks affecting significantly the occurrence of algae-dominated conditions. On the other hand, litter diversity did not affect the algae dominance irrespective to the rainfall scenario. We suggest that rainfall changes may compromise important self-reinforcing mechanisms responsible for maintaining high levels of algae on tank bromeliads ecosystems. We summarized these results into a theoretical model which suggests that tank bromeliads may show two different regimes, determined by the bromeliad ability in taking up nutrients from the water and by the total amount of light entering the tank. We concluded that predicted climate changes might promote regime shifts in tropical aquatic ecosystems by shaping their structure and the relative importance of other regulating factors. PMID:28422988

The choice of bromeliads as a microhabitat by Scinax argyreornatus (Anura, Hylidae).

Science.gov (United States)

Pederassi, J; Lima, M S C S; Peixoto, O L; Souza, C A S

2012-05-01

The association of anurans to bromeliads presents different degrees of interaction such as: eventual, obligatory and bromeligen. The frog species Scinax argyreornatus shows a regular association with these plants. The goal of this study is to characterise the degree of association between the frog S. argyreornatus to different species of bromeliads. We identified which species of bromeliad is regularly associated with S. argyreornatus and recognised which factors interfere with this association preference. We analysed the Concentration of Relative Dominance of frogs per bromeliad species. As possible criteria for frog association preference to different bromeliads species we established the analysis of leaves number, length and width, number of leaf axils, stored water in the axils, pH and relative humidity, among other organographic components. Our observations were analyzed by ANOVA followed by the Tukey test. We also evaluated the preference for association by the constancy of Bodenheimer. The correlation matrix indicated that the relative humidity is the factor responsible for the frog-bromeliads association, except for Aechmea sp.. However Aechmea sp. was the species with greater constancy of occupation followed by Quesnelia arvensis and Neoregelia johannis. According to our statistical results, Aechmea sp. and Q. arvensis are not different regarding organographic parameters, but differ from N. johannis. Our observations suggest that the bromeliads organographic structure and the relative humidity are key conditions which influence the preferences of S. argyreornatus to bromeliad species, while the other features showed no correlation.

Plant structure predicts leaf litter capture in the tropical montane bromeliad Tillandsia turneri

Directory of Open Access Journals (Sweden)

F. Ospina-Bautista

Full Text Available Abstract Leaves intercepted by bromeliads become an important energy and matter resource for invertebrate communities, bacteria, fungi, and the plant itself. The relationship between bromeliad structure, defined as its size and complexity, and accumulated leaf litter was studied in 55 bromeliads of Tillandsia turneri through multiple regression and the Akaike information criterion. Leaf litter accumulation in bromeliads was best explained by size and complexity variables such as plant cover, sheath length, and leaf number. In conclusion, plant structure determines the amount of litter that enters bromeliads, and changes in its structure could affect important processes within ecosystem functioning or species richness.

More than a safety line: jump-stabilizing silk of salticids.

Science.gov (United States)

Chen, Yung-Kang; Liao, Chen-Pan; Tsai, Feng-Yueh; Chi, Kai-Jung

2013-10-06

Salticids are diurnal hunters known for acute vision, remarkable predatory strategies and jumping ability. Like other jumpers, they strive for stability and smooth landings. Instead of using inertia from swinging appendages or aerodynamic forces by flapping wings as in other organisms, we show that salticids use a different mechanism for in-air stability by using dragline silk, which was previously believed to function solely as a safety line. Analyses from high-speed images of jumps by the salticid Hasarius adansoni demonstrate that despite being subject to rearward pitch at take-off, spiders with dragline silk can change body orientation in the air. Instantaneous drag and silk forces calculated from kinematic data further suggest a comparable contribution to deceleration and energy dissipation, and reveal that adjustments by the spider to the silk force can reverse its body pitch for a predictable and optimal landing. Without silk, upright-landing spiders would slip or even tumble, deferring completion of landing. Thus, for salticids, dragline silk is critical for dynamic stability and prey-capture efficiency. The dynamic functioning of dragline silk revealed in this study can advance the understanding of silk's physiological control over material properties and its significance to spider ecology and evolution, and also provide inspiration for future manoeuvrable robot designs.

Phylogeny with introgression in Habronattus jumping spiders (Araneae: Salticidae).

Science.gov (United States)

Leduc-Robert, Geneviève; Maddison, Wayne P

2018-02-22

Habronattus is a diverse clade of jumping spiders with complex courtship displays and repeated evolution of Y chromosomes. A well-resolved species phylogeny would provide an important framework to study these traits, but has not yet been achieved, in part because the few genes available in past studies gave conflicting signals. Such discordant gene trees could be the result of incomplete lineage sorting (ILS) in recently diverged parts of the phylogeny, but there are indications that introgression could be a source of conflict. To infer Habronattus phylogeny and investigate the cause of gene tree discordance, we assembled transcriptomes for 34 Habronattus species and 2 outgroups. The concatenated 2.41 Mb of nuclear data (1877 loci) resolved phylogeny by Maximum Likelihood (ML) with high bootstrap support (95-100%) at most nodes, with some uncertainty surrounding the relationships of H. icenoglei, H. cambridgei, H. oregonensis, and Pellenes canadensis. Species tree analyses by ASTRAL and SVDQuartets gave almost completely congruent results. Several nodes in the ML phylogeny from 12.33 kb of mitochondrial data are incongruent with the nuclear phylogeny and indicate possible mitochondrial introgression: the internal relationships of the americanus and the coecatus groups, the relationship between the altanus, decorus, banksi, and americanus group, and between H. clypeatus and the coecatus group. To determine the relative contributions of ILS and introgression, we analyzed gene tree discordance for nuclear loci longer than 1 kb using Bayesian Concordance Analysis (BCA) for the americanus group (679 loci) and the VCCR clade (viridipes/clypeatus/coecatus/roberti groups) (517 loci) and found signals of introgression in both. Finally, we tested specifically for introgression in the concatenated nuclear matrix with Patterson's D statistics and D FOIL . We found nuclear introgression resulting in substantial admixture between americanus group species, between H. roberti

Respiration in spiders (Araneae).

Science.gov (United States)

Schmitz, Anke

2016-05-01

Spiders (Araneae) are unique regarding their respiratory system: they are the only animal group that breathe simultaneously with lungs and tracheae. Looking at the physiology of respiration the existence of tracheae plays an important role in spiders with a well-developed tracheal system. Other factors as sex, life time, type of prey capture and the high ability to gain energy anaerobically influence the resting and the active metabolic rate intensely. Most spiders have metabolic rates that are much lower than expected from body mass; but especially those with two pairs of lungs. Males normally have higher resting rates than females; spiders that are less evolved and possess a cribellum have lower metabolic rates than higher evolved species. Freely hunting spiders show a higher energy turnover than spiders hunting with a web. Spiders that live longer than 1 year will have lower metabolic rates than those species that die after 1 year in which development and reproduction must be completed. Lower temperatures and starvation, which most spiders can cope with, will decrease the metabolic rate as well.

Bromeliad-inhabiting mosquitoes in an urban botanical garden of dengue endemic Rio de Janeiro. Are bromeliads productive habitats for the invasive vectors Aedes aegypti and Aedes albopictus?

Science.gov (United States)

Mocellin, Márcio Goulart; Simões, Taynãna César; do Nascimento, Teresa Fernandes Silva; Teixeira, Maria Lucia França; Lounibos, Leon Philip; de Oliveira, Ricardo Lourenço

2012-01-01

Immatures of both Aedes aegypti and Aedes albopictus have been found in water-holding bromeliad axils in Brazil. Removal of these plants or their treatment with insecticides in public and private gardens have been undertaken during dengue outbreaks in Brazil despite uncertainty as to their importance as productive habitats for dengue vectors. From March 2005-February 2006, we sampled 120 randomly selected bromeliads belonging to 10 species in a public garden less than 200 m from houses in a dengue-endemic neighborhood in Rio de Janeiro. A total of 2,816 mosquito larvae and pupae was collected, with an average of 5.87 immatures per plant per collection. Culex (Microculex) pleuristriatus and Culex spp of the Ocellatus Group were the most abundant culicid species, found in all species of bromeliads; next in relative abundance were species of the genus Wyeomyia. Only two individuals of Ae. aegypti (0.07%) and five of Ae. albopictus (0.18%) were collected from bromeliads. By contrast, immatures of Ae. aegypti were found in manmade containers in nearly 5% of nearby houses. These results demonstrate that bromeliads are not important producers of Ae. aegypti and Ae. albopictus and, hence, should not be a focus for dengue control. However, the results of this study of only one year in a single area may not represent outcomes in other urban localities where bromeliads, Ae. aegypti and dengue coincide in more disturbed habitats. PMID:20140379

Bromeliad-inhabiting mosquitoes in an urban botanical garden of dengue endemic Rio de Janeiro--are bromeliads productive habitats for the invasive vectors Aedes aegypti and Aedes albopictus?

Science.gov (United States)

Mocellin, Márcio Goulart; Simões, Taynãna César; Nascimento, Teresa Fernandes Silva do; Teixeira, Maria Lucia França; Lounibos, Leon Philip; Oliveira, Ricardo Lourenço de

2009-12-01

Immatures of both Aedes aegypti and Aedes albopictus have been found in water-holding bromeliad axils in Brazil. Removal of these plants or their treatment with insecticides in public and private gardens have been undertaken during dengue outbreaks in Brazil despite uncertainty as to their importance as productive habitats for dengue vectors. From March 2005-February 2006, we sampled 120 randomly selected bromeliads belonging to 10 species in a public garden less than 200 m from houses in a dengue-endemic neighborhood in Rio de Janeiro. A total of 2,816 mosquito larvae and pupae was collected, with an average of 5.87 immatures per plant per collection. Culex (Microculex) pleuristriatus and Culex spp of the Ocellatus Group were the most abundant culicid species, found in all species of bromeliads; next in relative abundance were species of the genus Wyeomyia. Only two individuals of Ae. aegypti (0.07%) and five of Ae. albopictus(0.18%) were collected from bromeliads. By contrast, immatures of Ae. aegypti were found in manmade containers in nearly 5% of nearby houses. These results demonstrate that bromeliads are not important producers of Ae. aegypti and Ae. albopictus and, hence, should not be a focus for dengue control. However, the results of this study of only one year in a single area may not represent outcomes in other urban localities where bromeliads, Ae. aegypti and dengue coincide in more disturbed habitats.

Bromeliad-inhabiting mosquitoes in an urban botanical garden of dengue endemic Rio de Janeiro - Are bromeliads productive habitats for the invasive vectors Aedes aegypti and Aedes albopictus?

Directory of Open Access Journals (Sweden)

Márcio Goulart Mocellin

2009-12-01

Full Text Available Immatures of both Aedes aegypti and Aedes albopictus have been found in water-holding bromeliad axils in Brazil. Removal of these plants or their treatment with insecticides in public and private gardens have been undertaken during dengue outbreaks in Brazil despite uncertainty as to their importance as productive habitats for dengue vectors. From March 2005-February 2006, we sampled 120 randomly selected bromeliads belonging to 10 species in a public garden less than 200 m from houses in a dengue-endemic neighborhood in Rio de Janeiro. A total of 2,816 mosquito larvae and pupae was collected, with an average of 5.87 immatures per plant per collection. Culex (Microculex pleuristriatus and Culex spp of the Ocellatus Group were the most abundant culicid species, found in all species of bromeliads; next in relative abundance were species of the genus Wyeomyia. Only two individuals of Ae. aegypti (0.07% and five of Ae. albopictus(0.18% were collected from bromeliads. By contrast, immatures of Ae. aegypti were found in manmade containers in nearly 5% of nearby houses. These results demonstrate that bromeliads are not important producers of Ae. aegypti and Ae. albopictus and, hence, should not be a focus for dengue control. However, the results of this study of only one year in a single area may not represent outcomes in other urban localities where bromeliads, Ae. aegypti and dengue coincide in more disturbed habitats.

Arachnid aloft: directed aerial descent in neotropical canopy spiders.

Science.gov (United States)

Yanoviak, Stephen P; Munk, Yonatan; Dudley, Robert

2015-09-06

The behaviour of directed aerial descent has been described for numerous taxa of wingless hexapods as they fall from the tropical rainforest canopy, but is not known in other terrestrial arthropods. Here, we describe similar controlled aerial behaviours for large arboreal spiders in the genus Selenops (Selenopidae). We dropped 59 such spiders from either canopy platforms or tree crowns in Panama and Peru; the majority (93%) directed their aerial trajectories towards and then landed upon nearby tree trunks. Following initial dorsoventral righting when necessary, falling spiders oriented themselves and then translated head-first towards targets; directional changes were correlated with bilaterally asymmetric motions of the anterolaterally extended forelegs. Aerial performance (i.e. the glide index) decreased with increasing body mass and wing loading, but not with projected surface area of the spider. Along with the occurrence of directed aerial descent in ants, jumping bristletails, and other wingless hexapods, this discovery of targeted gliding in selenopid spiders further indicates strong selective pressures against uncontrolled falls into the understory for arboreal taxa. © 2015 The Author(s).

Genera of euophryine jumping spiders (Araneae: Salticidae), with a combined molecular-morphological phylogeny.

Science.gov (United States)

Zhang, Junxia; Maddison, Wayne P

2015-03-27

Morphological traits of euophryine jumping spiders were studied to clarify generic limits in the Euophryinae and to permit phylogenetic classification of genera lacking molecular data. One hundred and eight genera are recognized within the subfamily. Euophryine generic groups and the delimitation of some genera are reviewed in detail. In order to explore the effect of adding formal morphological data to previous molecular phylogenetic studies, and to find morphological synapomorphies, eighty-two morphological characters were scored for 203 euophryine species and seven outgroup species. The morphological dataset does not perform as well as the molecular dataset (genes 28S, Actin 5C; 16S-ND1, COI) in resolving the phylogeny of Euophryinae, probably because of frequent convergence and reversal. The formal morphological data were mapped on the phylogeny in order to seek synapomorphies, in hopes of extending the phylogeny to include taxa for which molecular data are not available. Because of homoplasy, few globally-applicable morphological synapomorphies for euophryine clades were found. However, synapomorphies that are unique locally in subclades still help to delimit euophryine generic groups and genera. The following synonyms of euophryine genera are proposed: Maeotella with Anasaitis; Dinattus with Corythalia; Paradecta with Compsodecta; Cobanus, Chloridusa and Wallaba with Sidusa; Tariona with Mopiopia; Nebridia with Amphidraus; Asaphobelis and Siloca with Coryphasia; Ocnotelus with Semnolius; Palpelius with Pristobaeus; Junxattus with Laufeia; Donoessus with Colyttus; Nicylla, Pselcis and Thianitara with Thiania. The new genus Saphrys is erected for misplaced species from southern South America.

Tank bromeliad water: similar or distinct environments for research of bacterial bioactives?

Science.gov (United States)

Carmo, F L; Santos, H F; Peixoto, R S; Rosado, A S; Araujo, F V

2014-01-01

The Atlantic Rainforest does not have a uniform physiognomy, its relief determines different environmental conditions that define the composition of its flora and fauna. Within this ecosystem, bromeliads that form tanks with their leaves hold water reservoirs throughout the year, maintaining complex food chains, based mainly on autotrophic and heterotrophic bacteria. Some works concluded that the water held by tank bromeliads concentrate the microbial diversity of their ecosystem. To investigate the bacterial diversity and the potential biotechnology of these ecosystems, tank bromeliads of the Neoregelia cruenta species from the Atlantic Rainforest in Brazil were used as models for this research. Bacteria isolated from these models were tested for production of bioactive compounds. DGGE of the water held by tank bromeliads was performed in different seasons, locations and sun exposure to verify whether these environmental factors affect bacterial communities. The DGGE bands profile showed no grouping of bacterial community by the environmental factors tested. Most of the isolates demonstrated promising activities in the tests performed. Collectively, these results suggest that tank bromeliads of the N. cruenta species provide important habitats for a diverse microbial community, suggesting that each tank forms a distinct micro-habitat. These tanks can be considered excellent sources for the search for new enzymes and/or new bioactive composites of microbial origin.

Spatial heterogeneity and the distribution of bromeliad pollinators in the Atlantic Forest

Science.gov (United States)

Varassin, Isabela Galarda; Sazima, Marlies

2012-08-01

Interactions between plants and their pollinators are influenced by environmental heterogeneity, resulting in small-scale variations in interactions. This may influence pollinator co-existence and plant reproductive success. This study, conducted at the Estação Biológica de Santa Lúcia (EBSL), a remnant of the Atlantic Forest in southeastern Brazil, investigated the effect of small-scale spatial variations on the interactions between bromeliads and their pollinators. Overall, hummingbirds pollinated 19 of 23 bromeliad species, of which 11 were also pollinated by bees and/or butterflies. However, spatial heterogeneity unrelated to the spatial location of plots or bromeliad species abundance influenced the presence of pollinators. Hummingbirds were the most ubiquitous pollinators at the high-elevation transect, with insect participation clearly declining as transect elevation increased. In the redundancy analysis, the presence of the hummingbird species Phaethornis eurynome, Phaethornis squalidus, Ramphodon naevius, and Thalurania glaucopis, and the butterfly species Heliconius erato and Heliconius nattereri in each plot was correlated with environmental factors such as bromeliad and tree abundance, and was also correlated with horizontal diversity. Since plant-pollinator interactions varied within the environmental mosaics at the study site, this small-scale environmental heterogeneity may relax competition among pollinators, and may explain the high diversity of bromeliads and pollinators generally found in the Atlantic Forest.

Functional structure of the bromeliad tank microbiome is strongly shaped by local geochemical conditions.

Science.gov (United States)

Louca, Stilianos; Jacques, Saulo M S; Pires, Aliny P F; Leal, Juliana S; González, Angélica L; Doebeli, Michael; Farjalla, Vinicius F

2017-08-01

Phytotelmata in tank-forming Bromeliaceae plants are regarded as potential miniature models for aquatic ecology, but detailed investigations of their microbial communities are rare. Hence, the biogeochemistry in bromeliad tanks remains poorly understood. Here we investigate the structure of bacterial and archaeal communities inhabiting the detritus within the tanks of two bromeliad species, Aechmea nudicaulis and Neoregelia cruenta, from a Brazilian sand dune forest. We used metagenomic sequencing for functional community profiling and 16S sequencing for taxonomic profiling. We estimated the correlation between functional groups and various environmental variables, and compared communities between bromeliad species. In all bromeliads, microbial communities spanned a metabolic network adapted to oxygen-limited conditions, including all denitrification steps, ammonification, sulfate respiration, methanogenesis, reductive acetogenesis and anoxygenic phototrophy. Overall, CO2 reducers dominated in abundance over sulfate reducers, and anoxygenic phototrophs largely outnumbered oxygenic photoautotrophs. Functional community structure correlated strongly with environmental variables, between and within a single bromeliad species. Methanogens and reductive acetogens correlated with detrital volume and canopy coverage, and exhibited higher relative abundances in N. cruenta. A comparison of bromeliads to freshwater lake sediments and soil from around the world, revealed stark differences in terms of taxonomic as well as functional microbial community structure. © 2017 Society for Applied Microbiology and John Wiley & Sons Ltd.

Unraveling algae and cyanobacteria biodiversity in bromeliad phytotelmata in different vegetation formations in Bahia State, Northeastern Brazil

Directory of Open Access Journals (Sweden)

Geraldo José Peixoto Ramos

2018-06-01

Full Text Available ABSTRACT Knowledge of algal and cyanobacterial diversity of phytotelmata remains poorly-known, especially for bromeliads from different vegetation formations. We investigated the microalgae communities of four species of tank bromeliads from different vegetation formations in Bahia State, Northeast Brazil, highlighting the composition, richness and diversity of taxa. Sampling of water stored in bromeliads was carried out quarterly between 2014 and 2016, and abiotic variables and morphometric attributes of bromeliads were measured. A total of 89 taxa of algae and cyanobacteria were recorded for the four bromeliad species studied. The microalgae communities of the phytotelmata varied among vegetation formations, with one tank bromeliad, Alcantarea nahoumii, with more complex architecture (higher number of leaves and thus more cavities, being distinguished by its high species richness (73 taxa. The bromeliads exhibited little similarity in species composition, with only one species (Phacus polytrophos occurring in all four species. Throughout the entire sampling period, classes with higher species richness, especially due to A. nahoumii, were Zygnematophyceae, Cyanophyceae and Chlorophyceae, which accounted for about 80 % of all species inventoried. Our results contribute to the knowledge of microalga communities of bromeliad phytotelmata in Brazil with regard to species richness and composition, as well as significant environmental characteristics.

Bromeliads in Caatinga: an oasis for invertebrates

Directory of Open Access Journals (Sweden)

Priscila Islair

2015-02-01

Full Text Available The Bromeliaceae family exhibits several adaptations that allow the occurrence of its members in different physiognomies, including the Caatinga. The arrangement of leaves in rosette forms a cistern or tank, in which nutrient-rich water accumulates. This provides a microhabitat for reproduction, feeding, and larval development of many invertebrates. The aim of this study was to survey the bromeliad-associated invertebrate fauna to test the hypothesis of seasonal changes in community composition. We conducted two surveys in the rainy (February, 2011 and dry (August, 2012 seasons in the Floresta Nacional (Flona of Contendas do Sincorá, municipality of Contendas do Sincorá, Bahia state, Brazil. We delimited fifteen 5 m x 5 m sampling plots along a 355 m trail. Two terrestrial bromeliads (Aechmea bromeliifolia were collected per plot. Invertebrate fauna were identified and richness, abundance and composition were analyzed. The richness of taxa did not differ between seasons and was considered high for Caatinga. Abundance and composition differed between the rainy and dry seasons. The present study demonstrates the importance of bromeliads as available water resources for the local invertebrate community. Our findings also provide a framework for more in-depth studies on animal-plant interactions, and for the conservation of Caatinga animal and plant.

Bromeliad catchments as habitats for methanogenesis in tropical rainforest canopies

Directory of Open Access Journals (Sweden)

Shana K. Goffredi

2011-12-01

Full Text Available Tropical epiphytic plants within the family Bromeliaceae are unusual in that they possess foliage capable of retaining water and impounded material. This creates an acidic (pH 3.5-6.5 and anaerobic (< 1 ppm O2 environment suspended in the canopy. Results from a Costa Rican rainforest show that most bromeliads (n = 75/86 greater than ~20 cm in plant height or ~4-5 cm tank depth, showed presence of methanogens within the lower anoxic horizon of the tank. Archaea were dominated by methanogens (77-90% of recovered ribotypes and community structure, although variable, was generally comprised of a single type, closely related to either hydrogenotrophic Methanoregula or Methanocella, a specific clade of aceticlastic Methanosaeta, or Methanosarcina. Juvenile bromeliads, or those species, such as Guzmania, with shallow tanks, generally did not possess methanogens, as assayed by PCR specific for methanogen 16S rRNA genes, nor did artificial catchments (~ 100 ml volume, in place 6-12 months prior to sample collection. Methanogens were not detected in soil (n = 20, except in one case, in which the dominant ribotype was different from nearby bromeliads. Recovery of methyl coenzyme M reductase genes supported the occurrence of hydrogenotrophic and aceticlastic methanogens within bromeliad tanks, as well as the trend, via QPCR analysis of mcrA, of increased methanogenic capacity with increased plant height. Methane production rates of up to 300 nmol CH4 ml tank water -1 day-1 were measured in microcosm experiments. These results suggest that bromeliad-associated archaeal communities may play an important role in the cycling of carbon in neotropical forests.

FROG ASSEMBLAGE ASSOCIATED WITH BROMELIADS IN A SANDY COASTAL PLAIN IN THE STATE OF ESPÍRITO SANTO, SOUTHEASTERN BRAZIL

Directory of Open Access Journals (Sweden)

MARCIO MARQUES MAGESKI

Full Text Available ABSTRACT Amphibians may use bromeliads for reproduction (i.e., bromeligenous species or only for refuge and foraging (i.e., bromelicolous species. The partition of bromeliad resources is essential to maintain the coexistence of the associated assemblages. We sampled 913 bromeliads in a sandy coastal plain (i.e., restinga habitat in southeastern Brazil and found 234 frogs belonging to seven species. One of the frog species was bromeligenous and the other six were facultative bromelicolous. The bromeliads of the genus Aechmea were the most frequently used by frogs. The low degree of frog occupancy of bromeliads (26% suggests habitat segregation. Our study highlights the importance of maintenance of bromeliad species for conservation of the associated frog assemblages.

Almost a spider: a 305-million-year-old fossil arachnid and spider origins.

Science.gov (United States)

Garwood, Russell J; Dunlop, Jason A; Selden, Paul A; Spencer, Alan R T; Atwood, Robert C; Vo, Nghia T; Drakopoulos, Michael

2016-03-30

Spiders are an important animal group, with a long history. Details of their origins remain limited, with little knowledge of their stem group, and no insights into the sequence of character acquisition during spider evolution. We describe a new fossil arachnid, Idmonarachne brasierigen. et sp. nov. from the Late Carboniferous (Stephanian,ca 305-299 Ma) of Montceau-les-Mines, France. It is three-dimensionally preserved within a siderite concretion, allowing both laboratory- and synchrotron-based phase-contrast computed tomography reconstruction. The latter is a first for siderite-hosted fossils and has allowed us to investigate fine anatomical details. Although distinctly spider-like in habitus, this remarkable fossil lacks a key diagnostic character of Araneae: spinnerets on the underside of the opisthosoma. It also lacks a flagelliform telson found in the recently recognized, spider-related, Devonian-Permian Uraraneida. Cladistic analysis resolves our new fossil as sister group to the spiders: the spider stem-group comprises the uraraneids and I. brasieri While we are unable to demonstrate the presence of spigots in this fossil, the recovered phylogeny suggests the earliest character to evolve on the spider stem-group is the secretion of silk. This would have been followed by the loss of a flagelliform telson, and then the ability to spin silk using spinnerets. This last innovation defines the true spiders, significantly post-dates the origins of silk, and may be a key to the group's success. The Montceau-les-Mines locality has previously yielded a mesothele spider (with spinnerets). Evidently, Late Palaeozoic spiders lived alongside Palaeozoic arachnid grades which approached the spider condition, but did not express the full suite of crown-group autapomorphies. © 2016 The Authors.

Cuticular antifungals in spiders: density- and condition dependence.

Directory of Open Access Journals (Sweden)

Daniel González-Tokman

Full Text Available Animals living in groups face a high risk of disease contagion. In many arthropod species, cuticular antimicrobials constitute the first protective barrier that prevents infections. Here we report that group-living spiders produce cuticular chemicals which inhibit fungal growth. Given that cuticular antifungals may be costly to produce, we explored whether they can be modulated according to the risk of contagion (i.e. under high densities. For this purpose, we quantified cuticular antifungal activity in the subsocial crab spider Diaea ergandros in both natural nests and experimentally manipulated nests of varying density. We quantified the body-condition of spiders to test whether antifungal activity is condition dependent, as well as the effect of spider density on body-condition. We predicted cuticular antifungal activity to increase and body-condition to decrease with high spider densities, and that antifungal activity would be inversely related to body-condition. Contrary to our predictions, antifungal activity was neither density- nor condition-dependent. However, body-condition decreased with density in natural nests, but increased in experimental nests. We suggest that pathogen pressure is so important in nature that it maintains high levels of cuticular antifungal activity in spiders, impacting negatively on individual energetic condition. Future studies should identify the chemical structure of the isolated antifungal compounds in order to understand the physiological basis of a trade-off between disease prevention and energetic condition caused by group living, and its consequences in the evolution of sociality in spiders.

Cuticular antifungals in spiders: density- and condition dependence.

Science.gov (United States)

González-Tokman, Daniel; Ruch, Jasmin; Pulpitel, Tamara; Ponton, Fleur

2014-01-01

Animals living in groups face a high risk of disease contagion. In many arthropod species, cuticular antimicrobials constitute the first protective barrier that prevents infections. Here we report that group-living spiders produce cuticular chemicals which inhibit fungal growth. Given that cuticular antifungals may be costly to produce, we explored whether they can be modulated according to the risk of contagion (i.e. under high densities). For this purpose, we quantified cuticular antifungal activity in the subsocial crab spider Diaea ergandros in both natural nests and experimentally manipulated nests of varying density. We quantified the body-condition of spiders to test whether antifungal activity is condition dependent, as well as the effect of spider density on body-condition. We predicted cuticular antifungal activity to increase and body-condition to decrease with high spider densities, and that antifungal activity would be inversely related to body-condition. Contrary to our predictions, antifungal activity was neither density- nor condition-dependent. However, body-condition decreased with density in natural nests, but increased in experimental nests. We suggest that pathogen pressure is so important in nature that it maintains high levels of cuticular antifungal activity in spiders, impacting negatively on individual energetic condition. Future studies should identify the chemical structure of the isolated antifungal compounds in order to understand the physiological basis of a trade-off between disease prevention and energetic condition caused by group living, and its consequences in the evolution of sociality in spiders.

Native bromeliads as biomonitors of airborne chemical elements in a Brazilian restinga forest

Energy Technology Data Exchange (ETDEWEB)

Elias, C; Fernandes, E A.N.; Franca, E J; Bacchi, M A; Tagliaferro, F S [Centro de Energia Nuclear na Agricultura, Universidade de Sao Paulo, Piracicaba, SP (Brazil)

2008-11-15

Epiphytic bromeliads have been used as biomonitors of air pollution since they have specialized structures in leaves for absorbing humidity and nutrients available in the atmosphere. Leaves of five bromeliad species were collected in the conservation unit Parque Estadual Ilha do Cardoso, Sao Paulo State, Brazil, and analyzed by INAA. Vriesea carinata was the species showing most accumulation, with the highest mass fractions of K, Na, Rb and Zn. Similar results were previously found for the same species collected in the dense ombrophilous forest. Chemical composition of bromeliads provided an indication of the atmosphere status in the conservation unit. (author)

Native bromeliads as biomonitors of airborne chemical elements in a Brazilian restinga forest

International Nuclear Information System (INIS)

Elias, C.; Fernandes, E.A.N.; Franca, E.J.; Bacchi, M.A.; Tagliaferro, F.S.

2008-01-01

Epiphytic bromeliads have been used as biomonitors of air pollution since they have specialized structures in leaves for absorbing humidity and nutrients available in the atmosphere. Leaves of five bromeliad species were collected in the conservation unit Parque Estadual Ilha do Cardoso, Sao Paulo State, Brazil, and analyzed by INAA. Vriesea carinata was the species showing most accumulation, with the highest mass fractions of K, Na, Rb and Zn. Similar results were previously found for the same species collected in the dense ombrophilous forest. Chemical composition of bromeliads provided an indication of the atmosphere status in the conservation unit. (author)

Bromeliads in Caatinga: an oasis for invertebrates

Directory of Open Access Journals (Sweden)

Priscila Islair

2014-11-01

Full Text Available http://dx.doi.org/10.5007/2175-7925.2015v28n1p67 The Bromeliaceae family exhibits several adaptations that allow the occurrence of its members in different physiognomies, including the Caatinga. The arrangement of leaves in rosette forms a cistern or tank, in which nutrient-rich water accumulates. This provides a microhabitat for reproduction, feeding, and larval development of many invertebrates. The aim of this study was to survey the bromeliad-associated invertebrate fauna to test the hypothesis of seasonal changes in community composition. We conducted two surveys in the rainy (February, 2011 and dry (August, 2012 seasons in the Floresta Nacional (Flona of Contendas do Sincorá, municipality of Contendas do Sincorá, Bahia state, Brazil. We delimited fifteen 5 m x 5 m sampling plots along a 355 m trail. Two terrestrial bromeliads (Aechmea bromeliifolia were collected per plot. Invertebrate fauna were identified and richness, abundance and composition were analyzed. The richness of taxa did not differ between seasons and was considered high for Caatinga. Abundance and composition differed between the rainy and dry seasons. The present study demonstrates the importance of bromeliads as available water resources for the local invertebrate community. Our findings also provide a framework for more in-depth studies on animal-plant interactions, and for the conservation of Caatinga animals and plants.

Radiation effect onto biodiversity of spiders

International Nuclear Information System (INIS)

Mehrabova, M.A.; Naghiyev, J.A; Huseynov, N.I; Topchiyeva, Sh.A.; Hasanov, N.H.

2010-01-01

At present time spiders are one of the considerably diverse groups of living organisms in fauna of Azerbayjan Republic. They play an important in environmental chain, being the main group of wild arthropodas in most biocoenoses. Therefore, it's not surprised that recently an increased interest has being observed to the study of spiders as indicators of environmental conditions. Spiders have been collected in polluted areas, their identification and sampling of soil, water and plants has been conducted. The degree of radionuclides' impact on the number and distribution of spiders and their venom in the observed zones of Azerbaijan has been revealed and preliminarily predicted. The number of the collected spiders equals to 292 which has been determined later at an electronic identifier Spinnen Mitteleuropas. The radionuclides in spiders have been determined at Canberra facility. Different natural radioactive elements were revealed in the investigated samples.

Subsocial behaviour and brood adoption in mixed-species colonies of two theridiid spiders

DEFF Research Database (Denmark)

Grinsted, Lena; Agnarsson, Ingi; Bilde, Trine

2012-01-01

Cooperation and group living often evolves through kin selection. However, associations between unrelated organisms, such as different species, can evolve if both parties benefit from the interaction. Group living is rare in spiders, but occurs in cooperative, permanently social spiders, as well...... as in territorial, colonial spiders. Mixed species spider colonies, involving closely related species, have rarely been documented. We examined social interactions in newly discovered mixed-species colonies of theridiid spiders on Bali, Indonesia. Our aim was to test the degree of intra- and interspecific tolerance...

Spiders do have melanin after all.

Science.gov (United States)

Hsiung, Bor-Kai; Blackledge, Todd A; Shawkey, Matthew D

2015-11-01

Melanin pigments are broadly distributed in nature - from bacteria to fungi to plants and animals. However, many previous attempts to identify melanins in spiders were unsuccessful, suggesting that these otherwise ubiquitous pigments were lost during spider evolution. Yet, spiders exhibit many dark colours similar to those produced by melanins in other organisms, and the low solubility of melanins makes isolation and characterization difficult. Therefore, whether melanins are truly absent or have simply not yet been detected is an open question. Raman spectroscopy provides a reliable way to detect melanins in situ, without the need for isolation. In this study, we document the presence of eumelanin in diverse species of spiders using confocal Raman microspectroscopy. Comparisons of spectra with theoretically calculated data falsify the previous hypothesis that dark colours are produced solely by ommochromes in spiders. Our data indicate that melanins are present in spiders and further supporting that they are present in most living organisms. © 2015. Published by The Company of Biologists Ltd.

Multiple lines of evidence shed light on the occurrence of paramecium (ciliophora, oligohymenophorea) in bromeliad tank water.

Science.gov (United States)

Buosi, Paulo R B; Cabral, Adalgisa F; Simão, Taiz L L; Utz, Laura R P; Velho, Luiz F M

2014-01-01

Phytotelmata are vegetal structures that hold water from the rain, and organic matter from the forest and the soil, resulting in small, compartmentalized bodies of water, which provide an essential environment for the establishment and development of many organisms. These microenvironments generally harbor endemic species, but many organisms that are found in lakes and rivers, are also present. Here, we report, for the first time, the occurrence of the ciliate genus Paramecium in the tank of the bromeliad species Aechmaea distichantha. The identification of the Paramecium species was performed based on live observations, protargol impregnation, scanning electronic microscopy, and sequencing of the 18s rRNA. The absence of Paramecium from bromeliad tank water was highlighted in several earlier investigations, and may be due to the fact that this species is unable to make cysts. The occurrence of Paramecium multimicronucleatum in our samples may be explained by the proximity between the bromeliads and the river, a potential source of the species. Further, we also believe that the counting methodology used in our study provides a more accurate analysis of the species diversity, since we investigated all samples within a maximum period of 6 h after sampling, allowing minimum loss of specimens. © 2013 The Author(s) Journal of Eukaryotic Microbiology © 2013 International Society of Protistologists.

Microhabitat use and spatial distribution in Picado’s Bromeliad Treefrog, Isthmohyla picadoi (Anura, Hylidae

Directory of Open Access Journals (Sweden)

Adam M. M. Stuckert

2009-12-01

Full Text Available Isthmohyla picadoi is a Neotropical hylid frog found in upper humid montane forests of Costa Rica and Panama. The species is of particular interest because it continues to persist in an area in which the amphibian community has otherwise been decimated by the pathogenic fungus, Batrachochytrium dendrobatidis. Ground search, ladder climbing, and tree climbing techniques were used to locate 32 individuals; including adult males and females, juveniles, andmetamorphosing frogs. The majority of frogs were found in bromeliads, although some individuals were found on plants of the Euphorbiaceae, Musaceae, and Heliconiaceae families. Most frogs were found in larger bromeliads (45 cm or wider. There was a positive correlation between SUL and bromeliad width within the population but not within maturity classes (adult males, adult females, all adults, nonmetamorphosingjuveniles, suggesting that juvenile and adult frogs differ in bromeliad usage. Ranges of SUL and body weight in this particular population are much greater than those reported in previous species accounts.

Species Composition and Ecological Aspects of Immature Mosquitoes (Diptera: Culicidae in Bromeliads in Urban Parks in the City of São Paulo, Brazil

Directory of Open Access Journals (Sweden)

Walter Ceretti-Junior

2015-10-01

Full Text Available Background: Bromeliads can be epiphytic, terrestrial or saxicolous and use strategies to allow water to be re­tained in their leaf axils, where various arthropods can be found. These include mosquitoes, whose larvae are the most abundant and commonly found organisms in the leaf axils. The objective of this study was to look for im­mature forms of mosquitoes (the larval and pupal stages in bromeliads in municipal parks in São Paulo and to discuss the ecological and epidemiological importance of these insects.Methods: From October 2010 to July 2013, immature mosquitoes were collected from bromeliads in 65 munici­pal parks in the city of São Paulo, Brazil, using suction samplers. The immature forms were maintained until adult forms emerged, and these were then identified morphologically.Results: Two thousand forty-two immature-stage specimens belonging to the genera Aedes, Culex, Trichoprosopon, Toxorhynchites, Limatus and Wyeomyia were found in bromeliads in 15 of the 65 parks visited. Aedes albopictus was the most abundant species (660 specimens collected, followed by Culex quinquefasciatus (548 specimens and Cx. (Microculex imitator (444. The taxa with the most widespread distribution were Ae. aegypti and Toxorhynchites spp, followed by Ae. albopictus and Cx. quinquefasciatus.Conclusion: Bromeliads in urban parks are refuges for populations of native species of Culicidae and breeding sites for exotic species that are generally of epidemiological interest. Hence, administrators and surveillance and mosquito-control agencies must constantly monitor these microenvironments as the presence of these species endangers the health of park users and employees as well as people living near the parks. 

Bromeliad ornamental species: conservation issues and challenges related to commercialization - doi: 10.4025/actascibiolsci.v34i1.7314

Directory of Open Access Journals (Sweden)

Darcy Mitchell

2011-11-01

Full Text Available Bromeliads grow almost exclusively in the New World tropics and subtropics, mainly in South America in the Brazilian Atlantic Forest (ca. 1200 species. Within the last few decades, their beautiful shapes and colors, low maintenance and easy adaptability to small gardens have brought bromeliads into worldwide use as ornamental plants. While the ornamental bromeliad trade could make significant contributions to household economies in rural areas, the trade may represent a significant threat in some of the bromeliad biodiversity hotspot countries such as Brazil, Bolivia and Colombia. This paper presents an overview of production volumes, analysis of the Brazilian bromeliads trade chain – at the state, national and international levels – and recommendations to address development and conservation challenges.

Mosquito (Diptera: Culicidae assemblages associated with Nidularium and Vriesea bromeliads in Serra do Mar, Atlantic Forest, Brazil

Directory of Open Access Journals (Sweden)

Marques Tatiani C

2012-02-01

Full Text Available Abstract Background The most substantial and best preserved area of Atlantic Forest is within the biogeographical sub-region of Serra do Mar. The topographic complexity of the region creates a diverse array of microclimates, which can affect species distribution and diversity inside the forest. Given that Atlantic Forest includes highly heterogeneous environments, a diverse and medically important Culicidae assemblage, and possible species co-occurrence, we evaluated mosquito assemblages from bromeliad phytotelmata in Serra do Mar (southeastern Brazil. Methods Larvae and pupae were collected monthly from Nidularium and Vriesea bromeliads between July 2008 and June 2009. Collection sites were divided into landscape categories (lowland, hillslope and hilltop based on elevation and slope. Correlations between bromeliad mosquito assemblage and environmental variables were assessed using multivariate redundancy analysis. Differences in species diversity between bromeliads within each category of elevation were explored using the Renyi diversity index. Univariate binary logistic regression analyses were used to assess species co-occurrence. Results A total of 2,024 mosquitoes belonging to 22 species were collected. Landscape categories (pseudo-F value = 1.89, p = 0.04, bromeliad water volume (pseudo-F = 2.99, p = 0.03 and bromeliad fullness (Pseudo-F = 4.47, p An. homunculus was associated with Cx. ocellatus and the presence of An. cruzii was associated with Cx. neglectus, Cx. inimitabilis fuscatus and Cx. worontzowi. Anopheles cruzii and An. homunculus were taken from the same bromeliad, however, the co-occurrence between those two species was not statistically significant. Conclusions One of the main findings of our study was that differences in species among mosquito assemblages were influenced by landscape characteristics. The bromeliad factor that influenced mosquito abundance and assemblage structure was fullness. The findings of the current

Role of environmental exposure to spider mites in the sensitization and the clinical manifestation of asthma and rhinitis in children and adolescents living in rural and urban areas.

Science.gov (United States)

Kim, Y-K; Chang, Y-S; Lee, M-H; Hong, S-C; Bae, J-M; Jee, Y-K; Chun, B-R; Cho, S-H; Min, K-U; Kim, Y-Y

2002-09-01

Spider mites such as the citrus red mite and the two-spotted spider mite have been demonstrated to be important allergens for fruit cultivating farmers. To evaluate the role of environmental exposure to spider mites in the sensitization and the clinical manifestations of asthma and rhinitis in children and adolescents living in urban and rural areas. A total of 16,624 subjects (aged 7 to 18 years) living in urban (metropolitan and non-metropolitan) and rural areas (apple orchards and citrus orchards) in Korea were evaluated by questionnaire and skin prick test for 11 common aeroallergens, including citrus red mite (CRM) and two-spotted spider mite (TSM). The positive skin response rates to TSM were 4.2% of 1,563 metropolitan subjects, 3.8% of 5,568 non-metropolitan subjects and 6.5% of 1,464 subjects living nearby apple farms, and that to CRM 15.6% of 8,029 living nearby citrus farms. The prevalence of current wheeze and rhinitis as reported on a questionnaire was higher among those with a history of visiting fruit farms once or more per year than among those without it (10% vs. 7.1%, 32.8% vs. 26.7%, for wheezing and rhinitis, respectively). Among those with wheezing or rhinitis, the positive skin responses to TSM or CRM were also higher among those with a history of visiting fruit farms than among those without one (11.2% vs. 6.6%, 13.0% vs. 6.6%, respectively), although the positive skin responses to house dust mites were similar in the both groups. Spider mites are common sensitizing allergens in children and adolescents exposed to them, and environmental exposure to these mites may represent an important risk factor in the sensitization and the clinical manifestations of asthma and rhinitis in children and adolescents living in rural and urban areas.

Energetics, scaling and sexual size dimorphism of spiders.

Science.gov (United States)

Grossi, B; Canals, M

2015-03-01

The extreme sexual size dimorphism in spiders has motivated studies for many years. In many species the male can be very small relative to the female. There are several hypotheses trying to explain this fact, most of them emphasizing the role of energy in determining spider size. The aim of this paper is to review the role of energy in sexual size dimorphism of spiders, even for those spiders that do not necessarily live in high foliage, using physical and allometric principles. Here we propose that the cost of transport or equivalently energy expenditure and the speed are traits under selection pressure in male spiders, favoring those of smaller size to reduce travel costs. The morphology of the spiders responds to these selective forces depending upon the lifestyle of the spiders. Climbing and bridging spiders must overcome the force of gravity. If bridging allows faster dispersal, small males would have a selective advantage by enjoying more mating opportunities. In wandering spiders with low population density and as a consequence few male-male interactions, high speed and low energy expenditure or cost of transport should be favored by natural selection. Pendulum mechanics show the advantages of long legs in spiders and their relationship with high speed, even in climbing and bridging spiders. Thus small size, compensated by long legs should be the expected morphology for a fast and mobile male spider.

Scavenging by spiders (Araneae) and its relationship to pest management of the brown recluse spider.

Science.gov (United States)

Vetter, Richard S

2011-06-01

Experiments reported in Sandidge (2003; Nature 426: 30) indicated that the brown recluse spider, Loxosceles reclusa Gertsch & Mulaik, preferred to scavenge dead prey over live prey and that the spiders were not detrimentally affected when fed insecticide-killed crickets. Extrapolations made in subsequent media coverage disseminating the results of this research made counter-intuitive statements that pesticide treatment in houses would increase brown recluse populations in homes. This information was presented as if the scavenging behavior was specialized in the brown recluse; however, it was more likely that this behavior has not been well studied in other species. To provide a comparison, the current laboratory study examined the likelihood of non-Loxosceles spiders to scavenge dead prey. Of 100 non-Loxosceles spiders that were tested (from 11 families, 24 genera, and at least 29 species from a variety of spider hunting guilds), 99 scavenged dead crickets when offered in petri dishes. Some of the spiders were webspinners in which real-world scavenging of dead prey is virtually impossible, yet they scavenge when given the opportunity. Therefore, scavenging is a flexible opportunistic predatory behavior that is spread across a variety of taxa and is not a unique behavior in brown recluses. These findings are discussed in relation to pest management practices.

Environmental controls over methane emissions from bromeliad phytotelmata: The role of phosphorus and nitrogen availability, temperature, and water content

Science.gov (United States)

Kotowska, Martyna M.; Werner, Florian A.

2013-12-01

bromeliads are common epiphytic plants throughout neotropical forests that store significant amounts of water in phytotelmata (tanks) formed by highly modified leafs. Methanogenic archaea in these tanks have recently been identified as a significant source of atmospheric methane. We address the effects of environmental drivers (temperature, tank water content, sodium phosphate [P], and urea [N] addition) on methane production in anaerobically incubated bromeliad slurry and emissions from intact bromeliad tanks in montane Ecuador. N addition ≥ 1 mg g-1 had a significantly positive effect on headspace methane concentrations in incubation jars while P addition did not affect methane production at any dosage (≤ 1 mg g-1). Tank bromeliads (Tillandsia complanata) cultivated in situ showed significantly increased effluxes of methane in response to the addition of 26 mg N addition per tank but not to lower dosage of N or any dosage of P (≤ 5.2 mg plant-1). There was no significant interaction between N and P addition. The brevity of the stimulatory effect of N addition on plant methane effluxes (1-2 days) points at N competition by other microorganisms or bromeliads. Methane efflux from plants closely followed within-day temperature fluctuations over 24 h cycles, yet the dependency of temperature was not exponential as typical for terrestrial wetlands but instead linear. In simulated drought, methane emission from bromeliad tanks was maintained with minimum amounts of water and regained after a short lag phase of approximately 24 h. Our results suggest that methanogens in bromeliads are primarily limited by N and that direct effects of global change (increasing temperature and seasonality, remote fertilization) on bromeliad methane emissions are of moderate scale.

Tank bromeliads capture Saharan dust in El Yunque National Forest, Puerto Rico

Science.gov (United States)

Royer, Dana L.; Moynihan, Kylen M.; Ariori, Carolyn; Bodkin, Gavin; Doria, Gabriela; Enright, Katherine; Hatfield-Gardner, Rémy; Kravet, Emma; Nuttle, C. Miller; Shepard, Lisa; Ku, Timothy C. W.; O'Connell, Suzanne; Resor, Phillip G.

2018-01-01

Dust from Saharan Africa commonly blows across the Atlantic Ocean and into the Caribbean. Most methods for measuring this dust either are expensive if collected directly from the atmosphere, or depend on very small concentrations that may be chemically altered if collected from soil. Tank bromeliads in the dwarf forest of El Yunque National Forest, Puerto Rico, have a structure of overlapping leaves used to capture rainwater and other atmospheric inputs. Therefore, it is likely that these bromeliads are collecting in their tanks Saharan dust along with local inputs. Here we analyze the elemental chemistry, including rare earth elements (REEs), of tank contents in order to match their chemical fingerprint to a provenance of the Earth's crust. We find that the tank contents differ from the local soils and bedrock and are more similar to published values of Saharan dust. Our study confirms the feasibility of using bromeliad tanks to trace Saharan dust in the Caribbean.

Multiple origins of subsociality in crab spiders (Thomisidae).

Science.gov (United States)

Ruch, Jasmin; Riehl, Torben; May-Collado, Laura J; Agnarsson, Ingi

2015-01-01

Determining factors that facilitate the transition from a solitary to a social lifestyle is a major challenge in evolutionary biology, especially in taxa that are usually aggressive towards conspecifics. Most spiders live solitarily and few species are known to be social. Nevertheless, sociality has evolved multiple times across several families and nearly all studied social lineages have originated from a periodically social (subsocial) ancestor. Group-living crab spiders (Thomisidae) are exclusively found in Australia and differ from most other social spiders because they lack a communal capture web. Three of the group-living species were placed in the genus Diaea and another in the genus Xysticus. Most Australian thomisids are, however, difficult to identify as most descriptions are old and of poor quality, and the genera Diaea and Xysticus may not correspond to monophyletic groups. Here, we clarify the phylogenetic relationships of the four group-living Australian thomisids and conclude that amongst these subsociality has evolved two to three times independently. The subsocial Xysticus bimaculatus is not closely related to any of the social Diaea and an independent origin of subsociality is likely in this case. The presented data indicates that within Diaea two origins of subsociality are possible. Our results help to understand the evolution of sociality in thomisids and support the hypothesis that permanent sociality in spiders has evolved multiple times relatively recently from subsocial ancestors. Copyright © 2014 Elsevier Inc. All rights reserved.

Mosquitoes of the Caatinga: 2. Species from periodic sampling of bromeliads and tree holes in a dry Brazilian forest.

Science.gov (United States)

Marteis, Letícia Silva; Natal, Delsio; Sallum, Maria Anice Mureb; Medeiros-Sousa, Antônio Ralph; Corte, Roseli La

2017-07-01

The Caatinga is a dry tropical forest, located in the Brazilian semiarid region and rich in phytotelmata. This study investigated the culicid fauna of phytotelmata of the caatinga by sampling for 19 consecutive months aquatic immatures from tree holes and bromeliads. A total of 127L of water was taken from the plants, containing 6764 immature culicids of 16 species, of which 11 (69%) are undescribed and respond to 90% of the total abundance of the specimens collected. Epiphytic bromeliads harbor a large number of immature Culicidae, although terrestrial bromeliads are the most abundant and widely distributed in the region. The richness of culicid species was similar between terrestrial and epiphytic bromeliads and lower in habitats represented by tree hole phytotelmata. There was no similarity in the composition of culicid species that developed in bromeliads or tree holes. Temperature and humidity were the environmental parameters most strongly associated with the proportion of positive plants. The Caatinga has a great number of endemic species that remain unknown to science and many additional culicid species may await discovery from there. Copyright © 2017 Elsevier B.V. All rights reserved.

Heterogeneity of terrestrial bromeliad colonies and regeneration of Acacia praecox (Fabaceae in a humid-subtropical-Chaco forest, Argentina

Directory of Open Access Journals (Sweden)

Ignacio M Barberis

2005-09-01

Full Text Available In several tropical and subtropical forests, plants of the understorey act as an ecological filter that differentially affects woody species regeneration. In convex sectors of the Schinopsis balansae (Anacardiaceae forests of the Southeastern Chaco there are dense colonies of terrestrial bromeliads. These may influence forest regeneration by intercepting rain water and propagules in their tanks. Within colonies, the spatial distribution of bromeliads is clumped because their clonal growth leaves numerous internal gaps. In this study we describe the internal heterogeneity of three bromeliad colonies (plots and analyze how this heterogeneity affects Acacia praecox regeneration (i.e. seedling recruitment and survival. In January 1996, we randomly placed three transects with 150 contiguous quadrats of 100 cm² in each plot. For each quadrat we recorded the type of floor cover (i.e. bromeliads, herbs, litter, or bare soil and the presence of A. praecox seeds or seedlings. In July 1996 we relocated the transects and recorded seedling survival. Bromeliad colonies showed a high internal heterogeneity. Almost half of the 450 quadrats were covered by two terrestrial bromeliads. Aechmea distichantha was recorded in 81% of all quadrats with bromeliads, and Bromelia serra in the others. All quadrats with bromeliads were covered by litter. Half of them were occupied by the bases of bromeliads and the others were covered by their leaves. In contrast, where bromeliads were not present, soil surface was covered by litter in 83% and by herbaceous vegetation in 11% of the quadrats; very few quadrats were covered by bare soil. In January 1996, we recorded 127 seeds and 176 seedlings of A. praecox. Seed and seedling densities of A. praecox were similar in quadrats with and without bromeliads, but variability in seedling density of A. praecox was higher within than among plots. Seed density was higher in quadrats covered by bromeliad leaves than inside the tanks

Double Deception: Ant-Mimicking Spiders Elude Both Visually- and Chemically-Oriented Predators

Science.gov (United States)

Uma, Divya; Durkee, Caitlin; Herzner, Gudrun; Weiss, Martha

2013-01-01

Biological mimicry is often multimodal, in that a mimic reinforces its resemblance to another organism via different kinds of signals that can be perceived by a specific target audience. In this paper we describe a novel scenario, in which a mimic deceives at least two distinct audiences, each of which relies primarily on a different sensory modality for decision-making. We have previously shown that Peckhamia picata, a myrmecomorphic spider that morphologically and behaviorally resembles the ant Camponotus nearcticus, experiences reduced predation by visually-oriented jumping spiders. Here we report that Peckhamia also faces reduced aggression from spider-hunting sphecid wasps as well as from its model ant, both of which use chemical cues to identify prey. We also report that Peckhamia does not chemically resemble its model ants, and that its total cuticular hydrocarbons are significantly lower than those of the ants and non-mimic spiders. Although further studies are needed to clarify the basis of Peckhamia's chemically-mediated protection, to our knowledge, such ‘double deception,’ in which a single organism sends misleading visual cues to one set of predators while chemically misleading another set, has not been reported; however, it is likely to be common among what have until now been considered purely visual mimics. PMID:24236152

Spider Movement, UV Reflectance and Size, but Not Spider Crypsis, Affect the Response of Honeybees to Australian Crab Spiders

Science.gov (United States)

Llandres, Ana L.; Rodríguez-Gironés, Miguel A.

2011-01-01

According to the crypsis hypothesis, the ability of female crab spiders to change body colour and match the colour of flowers has been selected because flower visitors are less likely to detect spiders that match the colour of the flowers used as hunting platform. However, recent findings suggest that spider crypsis plays a minor role in predator detection and some studies even showed that pollinators can become attracted to flowers harbouring Australian crab spider when the UV contrast between spider and flower increases. Here we studied the response of Apis mellifera honeybees to the presence of white or yellow Thomisus spectabilis Australian crab spiders sitting on Bidens alba inflorescences and also the response of honeybees to crab spiders that we made easily detectable painting blue their forelimbs or abdomen. To account for the visual systems of crab spider's prey, we measured the reflectance properties of the spiders and inflorescences used for the experiments. We found that honeybees did not respond to the degree of matching between spiders and inflorescences (either chromatic or achromatic contrast): they responded similarly to white and yellow spiders, to control and painted spiders. However spider UV reflection, spider size and spider movement determined honeybee behaviour: the probability that honeybees landed on spider-harbouring inflorescences was greatest when the spiders were large and had high UV reflectance or when spiders were small and reflected little UV, and honeybees were more likely to reject inflorescences if spiders moved as the bee approached the inflorescence. Our study suggests that only the large, but not the small Australian crab spiders deceive their preys by reflecting UV light, and highlights the importance of other cues that elicited an anti-predator response in honeybees. PMID:21359183

Spider movement, UV reflectance and size, but not spider crypsis, affect the response of honeybees to Australian crab spiders.

Science.gov (United States)

Llandres, Ana L; Rodríguez-Gironés, Miguel A

2011-02-16

According to the crypsis hypothesis, the ability of female crab spiders to change body colour and match the colour of flowers has been selected because flower visitors are less likely to detect spiders that match the colour of the flowers used as hunting platform. However, recent findings suggest that spider crypsis plays a minor role in predator detection and some studies even showed that pollinators can become attracted to flowers harbouring Australian crab spider when the UV contrast between spider and flower increases. Here we studied the response of Apis mellifera honeybees to the presence of white or yellow Thomisus spectabilis Australian crab spiders sitting on Bidens alba inflorescences and also the response of honeybees to crab spiders that we made easily detectable painting blue their forelimbs or abdomen. To account for the visual systems of crab spider's prey, we measured the reflectance properties of the spiders and inflorescences used for the experiments. We found that honeybees did not respond to the degree of matching between spiders and inflorescences (either chromatic or achromatic contrast): they responded similarly to white and yellow spiders, to control and painted spiders. However spider UV reflection, spider size and spider movement determined honeybee behaviour: the probability that honeybees landed on spider-harbouring inflorescences was greatest when the spiders were large and had high UV reflectance or when spiders were small and reflected little UV, and honeybees were more likely to reject inflorescences if spiders moved as the bee approached the inflorescence. Our study suggests that only the large, but not the small Australian crab spiders deceive their preys by reflecting UV light, and highlights the importance of other cues that elicited an anti-predator response in honeybees.

Attentional bias to moving spiders in spider fearful individuals.

Science.gov (United States)

Vrijsen, Janna N; Fleurkens, Pascal; Nieuwboer, Wieteke; Rinck, Mike

2009-05-01

We investigated if an attentional bias for spiders in spider fearful individuals (SFs) can also be found for moving spiders, rather than static images. In Study 1, 28 SFs and 33 non-anxious controls (NACs) participated in a modified version of the dot probe paradigm: they had to react to a probe that appeared either in the next, previous, or side position of a spider's or a wheel's path. 24 SFs and 29 NACs participated in Study 2, in which a fourth, highly predictable, probe position was added. We expected that moving spiders would capture the attention of SFs. In addition, we tested whether SFs try to predict the movement of the spider to make it less threatening. As expected, SFs showed an attentional bias towards moving spiders. However, both groups reacted fastest to unpredictable movements, indicating that SFs and NACs alike anticipate unpredictable spider movements.

Camerobiid mites (Acariformes: Raphignathina: Camerobiidae inhabiting epiphytic bromeliads and soil litter of tropical dry forest with analysis of setal homology in the genus Neophyllobius

Directory of Open Access Journals (Sweden)

Ricardo Paredes-León

2016-06-01

Full Text Available A survey of the camerobiid mites living on epiphytic bromeliads and the forest floor of a Mexican tropical dry forest was carried out. We found three new species of the genus Neophyllobius, which are described in this paper; the first two, namely N. cibyci sp. nov. and N. tepoztlanensis sp. nov., were both found inhabiting bromeliads (Tillandsia spp. and living on two tree species (Quercus obtusata and Sapium macrocarpum; the third, N. tescalicola sp. nov., was found in soil and litter under Q. obtusata. These three new species can be differentiated from other species in the genus by a combination of morphological characters in adult females, mainly those setae on femora and genua I. The idiosoma and leg setal ontogeny of a camerobiid mite is presented for the first time in this paper, illustrating chaetotaxic notations and their relative positions in N. cibyci sp. nov. larva, protonymph and adults (female and male, and establishing setal homologies among instars. Setal homology with other species in the cohort Raphignathina is briefly discussed. Additionally, a compilation and an identification key to all known species of camerobiid mites in Mexico is provided.

On pitch jumps between chest and falsetto registers in voice : Data from living and excised human larynges

NARCIS (Netherlands)

Svec, JG; Schutte, HK; Miller, DG

The paper offers a new concept of studying abrupt chest-falsetto register transitions Clumps) based on the theory of nonlinear dynamics. The jumps were studied in an excised human larynx and in three living subjects tone female and two male). Data from the excised larynx revealed that a small and

Conditioning exercises in ski jumping: biomechanical relationship of squat jumps, imitation jumps, and hill jumps.

Science.gov (United States)

Lorenzetti, Silvio; Ammann, Fabian; Windmüller, Sabrina; Häberle, Ramona; Müller, Sören; Gross, Micah; Plüss, Michael; Plüss, Stefan; Schödler, Berni; Hübner, Klaus

2017-11-22

As hill jumps are very time-consuming, ski jumping athletes often perform various imitation jumps during training. The performed jumps should be similar to hill jumps, but a direct comparison of the kinetic and kinematic parameters has not been performed yet. Therefore, this study aimed to correlate 11 common parameters during hill jumps (Oberstdorf Germany), squat jumps (wearing indoor shoes), and various imitation jumps (rolling 4°, rolling flat, static; jumping equipment or indoor shoes) on a custom-built instrumented vehicle with a catch by the coach. During the performed jumps, force and video data of the take-off of 10 athletes were measured. The imitation and squat jumps were then ranked. The main difference between the hill jumps and the imitation and squat jumps is the higher maximal force loading rate during the hill jumps. Imitation jumps performed on a rolling platform, on flat ground were the most similar to hill jumps in terms of the force-time, and leg joint kinematic properties. Thus, non-hill jumps with a technical focus should be performed from a rolling platform with a flat inrun with normal indoor shoes or jumping equipment, and high normal force loading rates should be the main focus of imitation training.

Extant primitively segmented spiders have recently diversified from an ancient lineage.

Science.gov (United States)

Xu, Xin; Liu, Fengxiang; Cheng, Ren-Chung; Chen, Jian; Xu, Xiang; Zhang, Zhisheng; Ono, Hirotsugu; Pham, Dinh Sac; Norma-Rashid, Y; Arnedo, Miquel A; Kuntner, Matjaž; Li, Daiqin

2015-06-07

Living fossils are lineages that have retained plesiomorphic traits through long time periods. It is expected that such lineages have both originated and diversified long ago. Such expectations have recently been challenged in some textbook examples of living fossils, notably in extant cycads and coelacanths. Using a phylogenetic approach, we tested the patterns of the origin and diversification of liphistiid spiders, a clade of spiders considered to be living fossils due to their retention of arachnid plesiomorphies and their exclusive grouping in Mesothelae, an ancient clade sister to all modern spiders. Facilitated by original sampling throughout their Asian range, we here provide the phylogenetic framework necessary for reconstructing liphistiid biogeographic history. All phylogenetic analyses support the monophyly of Liphistiidae and of eight genera. As the fossil evidence supports a Carboniferous Euramerican origin of Mesothelae, our dating analyses postulate a long eastward over-land dispersal towards the Asian origin of Liphistiidae during the Palaeogene (39-58 Ma). Contrary to expectations, diversification within extant liphistiid genera is relatively recent, in the Neogene and Late Palaeogene (4-24 Ma). While no over-water dispersal events are needed to explain their evolutionary history, the history of liphistiid spiders has the potential to play prominently in vicariant biogeographic studies. © 2015 The Author(s) Published by the Royal Society. All rights reserved.

First record of the jumping spider Epocilla praetextata Thorell, 1887 (Araneae: Salticidae from India

Directory of Open Access Journals (Sweden)

A. Kananbala

2014-11-01

Full Text Available A salticidae spider Epocilla praetextata Thorell, 1887 is reported for the first time from India.  The present record is from Manipur, northeastern India, which shares an International border with Myanmar.  This is the 3rd species of the genus Epocilla recorded in India.  We provide the description and drawings of diagnostic characteristics for this species along with photographs.

COMPARISON OF DIET AND USE OF BROMELIADS BETWEEN A BROMELICOLOUS AND A BROMELIGENOUS ANURAN AT AN INSELBERG IN THE SOUTHEASTERN OF BRAZIL

Directory of Open Access Journals (Sweden)

PERTEL WESLEI

2010-06-01

Full Text Available Anurans from an inselberg in southeastern Brazil were studied using a sample ofsixty tank of bromeliads Alcantharea sp. We found 153 tadpoles of S. arduous, 21adults of S. arduous, 30 adults of T. miliaris, and two adults of Scinax x-signatus,which were not considered in our analyses. Tadpoles of S. arduous were present in35% of the analyzed plants. Adults of S. arduous (bromeligeneous occurred in 25%of analyzed plants, while adults of T. miliaris (bromelicolous occurred in 30%.Apparently the presence of toe pads in S. arduous allow them to occupy the centerportion of bromeliads, while T. miliaris, which lack pads on their toes, were foundon the base of the plant axils. The number of anuran species and the abundance ofindividuals found were low. This may be a result of the high altitude of our studiedsite or a restriction imposed by the saxicolous environment, such as high temperaturesand low humidity during the day. Both species can be considered generalist feedersdue to their wide variety of ingested prey. Formicidae was their main prey but wasabsent segregation in the bromeliads. Blattodea was very common inside the bromeliadaxils and represented the most signifi cant prey by weight in both frog species. Weconclude that both anurans forage inside and outside of bromeliads. Trophic nichebreadth in S. arduous was larger than in T. miliaris. Even both species being commoninhabitants of the same environment, they demonstrated a marked spatial segregationin the bromeliads. Based on their diet, however, there may be disputes for territoryoutside of the bromeliads.

Spiders in dermatology.

Science.gov (United States)

Kang, Jun K; Bhate, Chinmoy; Schwartz, Robert A

2014-09-01

Spider bites represent an unusual and potentially over-represented clinical diagnosis. Despite a common fear of spiders, known as arachnophobia, current knowledge suggests that only a small number of families within the order Araneae are medically relevant. Moreover, most cutaneous spider reactions, including both evenomations and physical trauma, produce mild, local symptoms which may be managed with supportive care alone. The differential diagnosis for spider bites may be broad, especially if the offending arachnid is not seen or found. We describe a series of spiders relevant to the dermatologist in the United States.

Correlation between citric acid and nitrate metabolisms during CAM cycle in the atmospheric bromeliad Tillandsia pohliana.

Science.gov (United States)

Freschi, Luciano; Rodrigues, Maria Aurineide; Tiné, Marco Aurélio Silva; Mercier, Helenice

2010-12-15

Crassulacean acid metabolism (CAM) confers crucial adaptations for plants living under frequent environmental stresses. A wide metabolic plasticity can be found among CAM species regarding the type of storage carbohydrate, organic acid accumulated at night and decarboxylating system. Consequently, many aspects of the CAM pathway control are still elusive while the impact of this photosynthetic adaptation on nitrogen metabolism has remained largely unexplored. In this study, we investigated a possible link between the CAM cycle and the nitrogen assimilation in the atmospheric bromeliad Tillandsia pohliana by simultaneously characterizing the diel changes in key enzyme activities and metabolite levels of both organic acid and nitrate metabolisms. The results revealed that T. pohliana performed a typical CAM cycle in which phosphoenolpyruvate carboxylase and phosphoenolpyruvate carboxykinase phosphorylation seemed to play a crucial role to avoid futile cycles of carboxylation and decarboxylation. Unlike all other bromeliads previously investigated, almost equimolar concentrations of malate and citrate were accumulated at night. Moreover, a marked nocturnal depletion in the starch reservoirs and an atypical pattern of nitrate reduction restricted to the nighttime were also observed. Since reduction and assimilation of nitrate requires a massive supply of reducing power and energy and considering that T. pohliana lives overexposed to the sunlight, we hypothesize that citrate decarboxylation might be an accessory mechanism to increase internal CO₂ concentration during the day while its biosynthesis could provide NADH and ATP for nocturnal assimilation of nitrate. Therefore, besides delivering photoprotection during the day, citrate might represent a key component connecting both CAM pathway and nitrogen metabolism in T. pohliana; a scenario that certainly deserves further study not only in this species but also in other CAM plants that nocturnally accumulate citrate

Mechanics of jumping on water

Science.gov (United States)

Kim, Ho-Young; Amauger, Juliette; Jeong, Han-Bi; Lee, Duck-Gyu; Yang, Eunjin; Jablonski, Piotr G.

2017-10-01

Some species of semiaquatic arthropods including water striders and springtails can jump from the water surface to avoid sudden dangers like predator attacks. It was reported recently that the jump of medium-sized water striders is a result of surface-tension-dominated interaction of thin cylindrical legs and water, with the leg movement speed nearly optimized to achieve the maximum takeoff velocity. Here we describe the mathematical theories to analyze this exquisite feat of nature by combining the review of existing models for floating and jumping and the introduction of the hitherto neglected capillary forces at the cylinder tips. The theoretically predicted dependence of body height on time is shown to match the observations of the jumps of the water striders and springtails regardless of the length of locomotory appendages. The theoretical framework can be used to understand the design principle of small jumping animals living on water and to develop biomimetic locomotion technology in semiaquatic environments.

Nectar Meals of a Mosquito-Specialist Spider

Directory of Open Access Journals (Sweden)

Josiah O. Kuja

2012-01-01

Full Text Available Evarcha culicivora, an East African jumping spider, is known for feeding indirectly on vertebrate blood by actively choosing blood-carrying mosquitoes as prey. Using cold-anthrone tests to detect fructose, we demonstrate that E. culicivora also feeds on nectar. Field-collected individuals, found on the plant Lantana camara, tested positive for plant sugar (fructose. In the laboratory, E. culicivora tested positive for fructose after being kept with L. camara or one of another ten plant species (Aloe vera, Clerodendron magnifica, Hamelia patens, Lantana montevideo, Leonotis nepetaefolia, Parthenium hysterophorus, Ricinus communis, Senna didymobotrya, Striga asiatica, and Verbena trivernia. Our findings demonstrate that E. culicivora acquires fructose from its natural diet and can ingest fructose directly from plant nectaries. However, experiments in the laboratory also show that E. culicivora can obtain fructose indirectly by feeding on prey that have fed on fructose, implying a need to consider this possibility when field-collected spiders test positive for fructose. In laboratory tests, 53.5% of 1,215 small juveniles, but only 3.4% of 622 adult E. culicivora, left with plants for 24 hours, were positive for fructose. These findings, along with the field data, suggest that fructose is especially important for early-instar juveniles of E. culicivora.

Specialised use of working memory by Portia africana, a spider-eating salticid.

Science.gov (United States)

Cross, Fiona R; Jackson, Robert R

2014-03-01

Using expectancy-violation methods, we investigated the role of working memory in the predatory strategy of Portia africana, a salticid spider from Kenya that preys by preference on other spiders. One of this predator's tactics is to launch opportunistic leaping attacks on to other spiders in their webs. Focussing on this particular tactic, our experiments began with a test spider on a ramp facing a lure (dead prey spider mounted on a cork disc) that could be reached by leaping. After the test spider faced the lure for 30 s, we blocked the test spider's view of the lure by lowering an opaque shutter before the spider leapt. When the shutter was raised 90 s later, either the same lure came into view again (control) or a different lure came into view (experimental: different prey type in same orientation or same prey type in different orientation). We recorded attack frequency (number of test spiders that leapt at the lure) and attack latency (time elapsing between shutter being raised and spiders initiating a leap). Attack latencies in control trials were not significantly different from attack latencies in experimental trials, regardless of whether it was prey type or prey orientation that changed in the experimental trials. However, compared with test spiders in the no-change control trials, significantly fewer test spiders leapt when prey type changed. There was no significant effect on attack frequency when prey orientation changed. These findings suggest that this predator represents prey type independently of prey orientation.

Molecular phylogeny of moth-specialized spider sub-family Cyrtarachninae, which includes bolas spiders.

Science.gov (United States)

Tanikawa, Akio; Shinkai, Akira; Miyashita, Tadashi

2014-11-01

The evolutionary process of the unique web architectures of spiders of the sub-family Cyrtarachninae, which includes the triangular web weaver, bolas spider, and webless spider, is thought to be derived from reduction of orbicular 'spanning-thread webs' resembling ordinal orb webs. A molecular phylogenetic analysis was conducted to explore this hypothesis using orbicular web spiders Cyrtarachne, Paraplectana, Poecilopachys, triangular web spider Pasilobus, bolas spiders Ordgarius and Mastophora, and webless spider Celaenia. The phylogeny inferred from partial sequences of mt-COI, nuclear 18S-rRNA and 28S-rRNA showed that the common ancestor of these spiders diverged into two clades: a spanning-thread web clade and a bolas or webless clade. This finding suggests that the triangular web evolved by reduction of an orbicular spanning web, but that bolas spiders evolved in the early stage, which does not support the gradual web reduction hypothesis.

Application of 3 kinds of practical electromagnetic spiders in electromagnetic spider web

Directory of Open Access Journals (Sweden)

Jiang Min

2016-01-01

Full Text Available Electromagnetic spider web the launch circuit has introduced a lot, but in the center position of the utility of the spider generally have 3 kinds of circuits respectively, the use of single-chip microcomputer circuit of the low energy consumption spider by multi-channel transmission, single circuit receiver circuit. Direct use of the 3 channels of the spider and the use of PLC circuit spider, depending on the actual situation were placed.

Application of 3 kinds of practical electromagnetic spiders in electromagnetic spider web

OpenAIRE

Jiang Min

2016-01-01

Electromagnetic spider web the launch circuit has introduced a lot, but in the center position of the utility of the spider generally have 3 kinds of circuits respectively, the use of single-chip microcomputer circuit of the low energy consumption spider by multi-channel transmission, single circuit receiver circuit. Direct use of the 3 channels of the spider and the use of PLC circuit spider, depending on the actual situation were placed.

Spider Vein Removal

Science.gov (United States)

Spider veins: How are they removed? I have spider veins on my legs. What options are available ... M.D. Several options are available to remove spider veins — thin red lines or weblike networks of ...

Subsocial behaviour and brood adoption in mixed-species colonies of two theridiid spiders

Science.gov (United States)

Grinsted, Lena; Agnarsson, Ingi; Bilde, Trine

2012-12-01

Cooperation and group living often evolves through kin selection. However, associations between unrelated organisms, such as different species, can evolve if both parties benefit from the interaction. Group living is rare in spiders, but occurs in cooperative, permanently social spiders, as well as in territorial, colonial spiders. Mixed species spider colonies, involving closely related species, have rarely been documented. We examined social interactions in newly discovered mixed-species colonies of theridiid spiders on Bali, Indonesia. Our aim was to test the degree of intra- and interspecific tolerance, aggression and cooperation through behavioural experiments and examine the potential for adoption of foreign brood. Morphological and genetic analyses confirmed that colonies consisted of two related species Chikunia nigra (O.P. Cambridge, 1880) new combination (previously Chrysso nigra) and a yet undescribed Chikunia sp. Females defended territories and did not engage in cooperative prey capture, but interestingly, both species seemed to provide extended maternal care of young and indiscriminate care for foreign brood. Future studies may reveal whether these species adopt only intra-specific young, or also inter-specifically. We classify both Chikunia species subsocial and intra- and interspecifically colonial, and discuss the evolutionary significance of a system where one or both species may potentially benefit from mutual tolerance and brood adoption.

Relevance of leaf surface contamination for assessing chemical composition of bromeliads in a restinga forest

Energy Technology Data Exchange (ETDEWEB)

Elias, C; Fernandes, E A.N.; Franca, E J; Bacchi, M A; Tagliaferro, F S [Centro de Energia Nuclear na Agricultura, Universidade de Sao Paulo, Piracicaba, SP (Brazil)

2008-11-15

Resuspended soil and other airborne particles adhered to the leaf surface affect the chemical composition of the plant. A well-defined cleaning procedure is necessary to avoid this problem, providing a correct assessment of the inherent chemical composition of bromeliads. To evaluate the influence of a washing procedure, INAA was applied for determining chemical elements in the leaves of bromeliads from Vriesea carinata species, both non-washed and washed with Alconox, EDTA and bi-distilled water. Br, Ce, Hg, La, Sc, Se, Sm and Th showed higher mass fractions in nonwashed leaves. The washing procedure removed the exogenous material without leaching chemical elements from inside the tissues. (author)

Relevance of leaf surface contamination for assessing chemical composition of bromeliads in a restinga forest

International Nuclear Information System (INIS)

Elias, C.; Fernandes, E.A.N.; Franca, E.J.; Bacchi, M.A.; Tagliaferro, F.S.

2008-01-01

Resuspended soil and other airborne particles adhered to the leaf surface affect the chemical composition of the plant. A well-defined cleaning procedure is necessary to avoid this problem, providing a correct assessment of the inherent chemical composition of bromeliads. To evaluate the influence of a washing procedure, INAA was applied for determining chemical elements in the leaves of bromeliads from Vriesea carinata species, both non-washed and washed with Alconox, EDTA and bi-distilled water. Br, Ce, Hg, La, Sc, Se, Sm and Th showed higher mass fractions in nonwashed leaves. The washing procedure removed the exogenous material without leaching chemical elements from inside the tissues. (author)

Inflorescences of the Bromeliad Vriesea friburgensis as Nest Sites and Food Resources for Ants and Other Arthropods in Brazil

OpenAIRE

Schmid, Volker S.; Langner, Simone; Steiner, Josefina; Zillikens, Anne

2014-01-01

For the first time, the usage of bromeliad inflorescences as nesting sites for ants and other arthropods was studied. Frequencies of occurrence of nests were recorded from hollow stems of dried infructescences of the bromeliad Vriesea friburgensis on Santa Catarina Island, southern Brazil. Three habitat types were studied: miconietum and two types of restinga, one with low (restinga-low) and one with high vegetation cover (restinga-high). Additionally, flower visitation by ants was examined i...

Spider Bites: First Aid

Science.gov (United States)

... care immediately if: You were bitten by a black widow or brown recluse spider You are unsure whether the bite ... in the South. Signs and symptoms of a black widow spider bite may include: At ... fever and nausea Brown recluse spider The brown recluse spider has a ...

Spiders in caves.

Science.gov (United States)

Mammola, Stefano; Isaia, Marco

2017-04-26

World experts of different disciplines, from molecular biology to macro-ecology, recognize the value of cave ecosystems as ideal ecological and evolutionary laboratories. Among other subterranean taxa, spiders stand out as intriguing model organisms for their ecological role of top predators, their unique adaptations to the hypogean medium and their sensitivity to anthropogenic disturbance. As the description of the first eyeless spider ( Stalita taenaria ), an array of papers on subterranean spider biology, ecology and evolution has been published, but a comprehensive review on these topics is still lacking. We provide a general overview of the spider families recorded in hypogean habitats worldwide, we review the different adaptations of hypogean spiders to subterranean life, and we summarize the information gathered so far about their origin, population structure, ecology and conservation status. Finally, we point out the limits of the knowledge we currently have regarding hypogean spiders, aiming to stimulate future research. © 2017 The Author(s).

Spider phylogenomics: untangling the Spider Tree of Life

Directory of Open Access Journals (Sweden)

Nicole L. Garrison

2016-02-01

Full Text Available Spiders (Order Araneae are massively abundant generalist arthropod predators that are found in nearly every ecosystem on the planet and have persisted for over 380 million years. Spiders have long served as evolutionary models for studying complex mating and web spinning behaviors, key innovation and adaptive radiation hypotheses, and have been inspiration for important theories like sexual selection by female choice. Unfortunately, past major attempts to reconstruct spider phylogeny typically employing the “usual suspect” genes have been unable to produce a well-supported phylogenetic framework for the entire order. To further resolve spider evolutionary relationships we have assembled a transcriptome-based data set comprising 70 ingroup spider taxa. Using maximum likelihood and shortcut coalescence-based approaches, we analyze eight data sets, the largest of which contains 3,398 gene regions and 696,652 amino acid sites forming the largest phylogenomic analysis of spider relationships produced to date. Contrary to long held beliefs that the orb web is the crowning achievement of spider evolution, ancestral state reconstructions of web type support a phylogenetically ancient origin of the orb web, and diversification analyses show that the mostly ground-dwelling, web-less RTA clade diversified faster than orb weavers. Consistent with molecular dating estimates we report herein, this may reflect a major increase in biomass of non-flying insects during the Cretaceous Terrestrial Revolution 125–90 million years ago favoring diversification of spiders that feed on cursorial rather than flying prey. Our results also have major implications for our understanding of spider systematics. Phylogenomic analyses corroborate several well-accepted high level groupings: Opisthothele, Mygalomorphae, Atypoidina, Avicularoidea, Theraphosoidina, Araneomorphae, Entelegynae, Araneoidea, the RTA clade, Dionycha and the Lycosoidea. Alternatively, our results

Spider phylogenomics: untangling the Spider Tree of Life

Science.gov (United States)

Garrison, Nicole L.; Rodriguez, Juanita; Agnarsson, Ingi; Coddington, Jonathan A.; Griswold, Charles E.; Hamilton, Christopher A.; Hedin, Marshal; Kocot, Kevin M.; Ledford, Joel M.

2016-01-01

Spiders (Order Araneae) are massively abundant generalist arthropod predators that are found in nearly every ecosystem on the planet and have persisted for over 380 million years. Spiders have long served as evolutionary models for studying complex mating and web spinning behaviors, key innovation and adaptive radiation hypotheses, and have been inspiration for important theories like sexual selection by female choice. Unfortunately, past major attempts to reconstruct spider phylogeny typically employing the “usual suspect” genes have been unable to produce a well-supported phylogenetic framework for the entire order. To further resolve spider evolutionary relationships we have assembled a transcriptome-based data set comprising 70 ingroup spider taxa. Using maximum likelihood and shortcut coalescence-based approaches, we analyze eight data sets, the largest of which contains 3,398 gene regions and 696,652 amino acid sites forming the largest phylogenomic analysis of spider relationships produced to date. Contrary to long held beliefs that the orb web is the crowning achievement of spider evolution, ancestral state reconstructions of web type support a phylogenetically ancient origin of the orb web, and diversification analyses show that the mostly ground-dwelling, web-less RTA clade diversified faster than orb weavers. Consistent with molecular dating estimates we report herein, this may reflect a major increase in biomass of non-flying insects during the Cretaceous Terrestrial Revolution 125–90 million years ago favoring diversification of spiders that feed on cursorial rather than flying prey. Our results also have major implications for our understanding of spider systematics. Phylogenomic analyses corroborate several well-accepted high level groupings: Opisthothele, Mygalomorphae, Atypoidina, Avicularoidea, Theraphosoidina, Araneomorphae, Entelegynae, Araneoidea, the RTA clade, Dionycha and the Lycosoidea. Alternatively, our results challenge the

Neural correlation of successful cognitive behaviour therapy for spider phobia: a magnetoencephalography study.

Science.gov (United States)

Wright, Barry; Alderson-Day, Ben; Prendergast, Garreth; Kennedy, Juliette; Bennett, Sophie; Docherty, Mary; Whitton, Clare; Manea, Laura; Gouws, Andre; Tomlinson, Heather; Green, Gary

2013-12-30

Cognitive behavioural therapy (CBT) can be an effective treatment for spider phobia, but the underlying neural correlates of therapeutic change are yet to be specified. The present study used magnetoencephalography (MEG) to study responses within the first half second, to phobogenic stimuli in a group of individuals with spider phobia prior to treatment (n=12) and then in nine of them following successful CBT (where they could touch and manage live large common house spiders) at least 9 months later. We also compared responses to a group of age-matched healthy control participants (n=11). Participants viewed static photographs of real spiders, other fear-inducing images (e.g. snakes, sharks) and neutral stimuli (e.g. kittens). Beamforming methods were used to localise sources of significant power changes in response to stimuli. Prior to treatment, participants with spider phobia showed a significant maximum response in the right frontal pole when viewing images of real spiders specifically. No significant frontal response was observed for either control participants or participants with spider phobia post-treatment. In addition, participants' subjective ratings of spider stimuli significantly predicted peak responses in right frontal regions. The implications for understanding brain-based effects of cognitive therapies are discussed. © 2013 Published by Elsevier Ireland Ltd.

Tarantula spider

Science.gov (United States)

... page: //medlineplus.gov/ency/article/002855.htm Tarantula spider bite To use the sharing features on this ... This article describes the effects of a tarantula spider bite. The class of insects to which the ...

Effects of climate and forest structure on palms, bromeliads and bamboos in Atlantic Forest fragments of Northeastern Brazil.

Science.gov (United States)

Hilário, R R; Toledo, J J

2016-01-01

Palms, bromeliads and bamboos are key elements of tropical forests and understanding the effects of climate, anthropogenic pressure and forest structure on these groups is crucial to forecast structural changes in tropical forests. Therefore, we investigated the effects of these factors on the abundance of these groups in 22 Atlantic forest fragments of Northeastern Brazil. Abundance of bromeliads and bamboos were assessed through indexes. Palms were counted within a radius of 20 m. We also obtained measures of vegetation structure, fragment size, annual precipitation, precipitation seasonality and human population density. We tested the effects of these predictors on plant groups using path analysis. Palm abundance was higher in taller forests with larger trees, closed canopy and sparse understory, which may be a result of the presence of seed dispersers and specific attributes of local palm species. Bromeliads were negatively affected by both annual precipitation and precipitation seasonality, what may reflect adaptations of these plants to use water efficiently, but also the need to capture water in a regular basis. Bamboos were not related to any predictor variable. As climate and forest structure affected the abundance of bromeliads and palms, human-induced climatic changes and disturbances in forest structure may modify the abundance of these groups. In addition, soil properties and direct measurements of human disturbance should be used in future studies in order to improve the predictability of models about plant groups in Northeastern Atlantic Forest.

Directional growth of a clonal bromeliad species in response to spatial habitat heterogeneity

NARCIS (Netherlands)

Sampaio, M.C.; Araujo, T.F.; Scarano, F.R.; Stuefer, J.F.

2004-01-01

Habitat selection by directional growth of plants has previously been investigated but field evidence for this phenomenon is extremely scarce. In this study we demonstrate directional clonal growth in Aechmea nudicaulis, a monocarpic, perennial bromeliad native to spatially heterogeneous sandy

Radiation Safety System for SPIDER Neutral Beam Accelerator

International Nuclear Information System (INIS)

Sandri, S.; Poggi, C.; Coniglio, A.; D'Arienzo, M.

2011-01-01

SPIDER (Source for Production of Ion of Deuterium Extracted from RF Plasma only) and MITICA (Megavolt ITER Injector Concept Advanced) are the ITER neutral beam injector (NBI) testing facilities of the PRIMA (Padova Research Injector Megavolt Accelerated) Center. Both injectors accelerate negative deuterium ions with a maximum energy of 1 MeV for MITICA and 100 keV for SPIDER with a maximum beam current of 40 A for both experiments. The SPIDER facility is classified in Italy as a particle accelerator. At present, the design of the radiation safety system for the facility has been completed and the relevant reports have been presented to the Italian regulatory authorities. Before SPIDER can operate, approval must be obtained from the Italian Regulatory Authority Board (IRAB) following a detailed licensing process. In the present work, the main project information and criteria for the SPIDER injector source are reported together with the analysis of hypothetical accidental situations and safety issues considerations. Neutron and photon nuclear analysis is presented, along with special shielding solutions designed to meet Italian regulatory dose limits. The contribution of activated corrosion products (ACP) to external exposure of workers has also been assessed. Nuclear analysis indicates that the photon contribution to worker external exposure is negligible, and the neutron dose can be considered by far the main radiation protection issue. Our results confirm that the injector has no important radiological impact on the population living around the facility.

Verified spider bites in Oregon (USA) with the intent to assess hobo spider venom toxicity.

Science.gov (United States)

McKeown, Nathanael; Vetter, Richard S; Hendrickson, Robert G

2014-06-01

This study compiled 33 verified spider bites from the state of Oregon (USA). The initial goal was to amass a series of bites by the hobo spider to assess whether it possesses toxic venom, a supposition which is currently in a contested state. None of the 33 bites from several spider species developed significant medical symptoms nor did dermonecrosis occur. The most common biters were the yellow sac spider, Cheiracanthium mildei (N = 10) and orb-weavers of the genus Araneus (N = 6). There were 10 bites from three genera of funnel web spiders of the family Agelenidae including one hobo spider bite and one from the congeneric giant house spider which is readily confused as a hobo spider. The hobo spider bite resulted in pain, redness, twitching in the calf muscle and resolved in 12 h. Also generated from this study were possibly the first records of bites from spiders of the genera Callobius (Amaurobiidae) and Antrodiaetus (Antrodiaetidae), both with minor manifestations. Published by Elsevier Ltd.

Epiphytic bromeliad communities in secondary and mature forest in a tropical premontane area

NARCIS (Netherlands)

Cascante Marin, A.M.; Wolf, J.H.D.; Oostermeijer, J.G.B.; den Nijs, J.C.M.; Sanahuja, O.; Duran Apuy, A.

2006-01-01

We analyzed the differences in species richness, community composition, population structure and within-tree location of epiphytic bromeliads in contiguous secondary and mature forests in a premontane area in Costa Rica. Diversity in the mature forest was highest, and the communities differed in

Funnel-web spider bite

Science.gov (United States)

... page: //medlineplus.gov/ency/article/002844.htm Funnel-web spider bite To use the sharing features on ... the effects of a bite from the funnel-web spider. Male funnel-web spiders are more poisonous ...

Spider Bites (For Parents)

Science.gov (United States)

... Videos for Educators Search English Español First Aid: Spider Bites KidsHealth / For Parents / First Aid: Spider Bites ... rare. Signs and Symptoms Of a brown recluse spider bite: red blister in the center with surrounding ...

Oil road effects on the anuran community of a high canopy tank bromeliad (Aechmea zebrina in the upper Amazon basin, Ecuador.

Directory of Open Access Journals (Sweden)

Shawn F McCracken

Full Text Available Tropical forest canopies are among the most species-rich terrestrial habitats on earth and one of the remaining relatively unexplored biotic frontiers. Epiphytic bromeliads provide microhabitat for a high diversity of organisms in tropical forest canopies and are considered a keystone resource. A number of amphibians inhabit these phytotelmata, yet their ecological role and status in forest canopies remains unknown. For this study, anurans were collected from an upper canopy tank bromeliad (Aechmea zebrina at ∼20-45 m (x¯ = 33 m above the forest floor. Bromeliads were sampled from trees located near trails in undisturbed primary rainforest and oil access roads in the Yasuní Biosphere Reserve of Amazonian Ecuador. We collected 95 anurans representing 10 species from 160 bromeliads in 32 trees. We used generalized linear mixed models to assess the effects of disturbance and habitat factors on the occupancy and abundance of anurans collected. Bromeliads in forest along oil roads had a lower occupancy and abundance of anurans than those in undisturbed forest, a somewhat unexpected result due to the intactness and quality of forest adjacent to the roads. Recorded habitat variables had no relationship with occupancy or abundance of anurans, and did not differ significantly between treatments. Our findings reveal that even the minimal footprint of natural resource extraction operations, primarily roads, in rainforest environments can have significant negative impacts on the unique upper canopy anuran community. Based on these results, we recommend that natural resource development treat rainforest habitat as an offshore system where roads are not used, employ industry best practice guidelines, and current access roads be protected from colonization and further deforestation.

Flee or fight: ontogenetic changes in the behavior of cobweb spiders in encounters with spider-hunting wasps.

Science.gov (United States)

Uma, Divya B; Weiss, Martha R

2012-12-01

An animal's body size plays a predominant role in shaping its interspecific interactions, and, in encounters between two predators, often determines which shall be predator and which shall be prey. Spiders are top predators of insects, yet can fall prey to mud-dauber wasps that provision their larval nests with paralyzed spiders. Here we examined predator-prey interactions between Chalybion californicum (Saussure) (Sphecidae), a mud-dauber wasp, and Parasteatoda tepidariorum C. L. Koch (Theridiidae), a cobweb spider. We examined whether a spider's size influences its response to an attacking wasp, and report a size-dependent change in spider behavior: small-sized spiders fled, whereas medium- and large-sized spiders fought in response to wasp attacks. From the wasps' perspective, we examined whether spider size influences a wasp's hunting behavior and capture success. We found that wasps commonly approached small spiders, but were much less likely to approach medium and large spiders. However, wasp capture success did not vary with spider size. We also report a strategy used by Chalybion wasps toward cobweb spiders that is consistent with an interpretation of aggressive mimicry.

First records of pollen rain in bromeliad tanks in an area of caatinga in northeastern Brazil

Directory of Open Access Journals (Sweden)

Jéssica Mirella de Souza Gomes

2014-06-01

Full Text Available Species of Bromeliaceae have leaves in a spiral configuration. Because of the shape of the rosette thus formed and the imbricate configuration of the leaf sheaths, there is usually a tank in which rainwater and other components of the environment, including pollen grains, accumulate, making such tanks effective pollen rain collectors. The objective of this study was to use bromeliads as a tool to increase knowledge about the vegetation of the caatinga (shrublands in the Canudos region of the state of Bahia, located in the semi-arid zone of Brazil, as well as to analyze the dynamics of pollen dispersal and deposition. To that end, we collected samples of the water from the tanks of bromeliads at the Canudos Biological Station. A total of 149 pollen types were detected, 88 of which could be identified botanically. The families that were the most well-represented among the pollen types were Fabaceae (with 25, Asteraceae (with 9, and Euphorbiaceae (with 7. Ten pollen types were presented as potential indicators of caatinga vegetation. We conclude that tank bromeliads are useful for gathering information about pollen rain and pollen dynamics, as well as about the transport and deposition of pollen in the caatinga.

SPIDER SILK

Directory of Open Access Journals (Sweden)

PORAV Viorica

2014-05-01

Full Text Available The strengthness and toughness of spider fiber and its multifunctional nature is only surpassed in some cases by synthetic high performance fibers. In the world of natural fibers, spider silk has been long time recognized as a wonder fiber for its unique combination of high strength and rupture elongation. Scientists in civil military engineering reveal that the power of biological material (spider silk lies in the geometric configuration of structural protein, and the small cluster of week hydrogen bonds that works together to resist force and dissipate energy. Each spider and each type of silk has a set of mechanical properties optimized for their biological function. Most silks, in particular deagline silk, have exceptional mechanical properties. They exhibit a unique combination of high tensile strength and extensibility (ductility. This enables a silk fiber to absorb a lot of energy before breaking (toughness, the area under a stress- strain curve. A frequent mistake made in the mainstream media is to confuse strength and toughness when comparing silk to other materials. As shown below in detail, weight for weight, silk is stronger than steel, but not as strong as Kevlar. Silk is,however, tougher than both.This paper inform about overview on the today trend in the world of spider silk.

Drop jumping. I. The influence of jumping technique on the biomechanics of jumping

NARCIS (Netherlands)

Bobbert, M F; Huijing, P A; van Ingen Schenau, G J

In the literature, drop jumping is advocated as an effective exercise for athletes who prepare themselves for explosive activities. When executing drop jumps, different jumping techniques can be used. In this study, the influence of jumping technique on the biomechanics of jumping is investigated.

Bat Predation by Spiders

Science.gov (United States)

Nyffeler, Martin; Knörnschild, Mirjam

2013-01-01

In this paper more than 50 incidences of bats being captured by spiders are reviewed. Bat-catching spiders have been reported from virtually every continent with the exception of Antarctica (∼90% of the incidences occurring in the warmer areas of the globe between latitude 30° N and 30° S). Most reports refer to the Neotropics (42% of observed incidences), Asia (28.8%), and Australia-Papua New Guinea (13.5%). Bat-catching spiders belong to the mygalomorph family Theraphosidae and the araneomorph families Nephilidae, Araneidae, and Sparassidae. In addition to this, an attack attempt by a large araneomorph hunting spider of the family Pisauridae on an immature bat was witnessed. Eighty-eight percent of the reported incidences of bat catches were attributable to web-building spiders and 12% to hunting spiders. Large tropical orb-weavers of the genera Nephila and Eriophora in particular have been observed catching bats in their huge, strong orb-webs (of up to 1.5 m diameter). The majority of identifiable captured bats were small aerial insectivorous bats, belonging to the families Vespertilionidae (64%) and Emballonuridae (22%) and usually being among the most common bat species in their respective geographic area. While in some instances bats entangled in spider webs may have died of exhaustion, starvation, dehydration, and/or hyperthermia (i.e., non-predation death), there were numerous other instances where spiders were seen actively attacking, killing, and eating the captured bats (i.e., predation). This evidence suggests that spider predation on flying vertebrates is more widespread than previously assumed. PMID:23516436

Bat predation by spiders.

Science.gov (United States)

Nyffeler, Martin; Knörnschild, Mirjam

2013-01-01

In this paper more than 50 incidences of bats being captured by spiders are reviewed. Bat-catching spiders have been reported from virtually every continent with the exception of Antarctica (≈ 90% of the incidences occurring in the warmer areas of the globe between latitude 30° N and 30° S). Most reports refer to the Neotropics (42% of observed incidences), Asia (28.8%), and Australia-Papua New Guinea (13.5%). Bat-catching spiders belong to the mygalomorph family Theraphosidae and the araneomorph families Nephilidae, Araneidae, and Sparassidae. In addition to this, an attack attempt by a large araneomorph hunting spider of the family Pisauridae on an immature bat was witnessed. Eighty-eight percent of the reported incidences of bat catches were attributable to web-building spiders and 12% to hunting spiders. Large tropical orb-weavers of the genera Nephila and Eriophora in particular have been observed catching bats in their huge, strong orb-webs (of up to 1.5 m diameter). The majority of identifiable captured bats were small aerial insectivorous bats, belonging to the families Vespertilionidae (64%) and Emballonuridae (22%) and usually being among the most common bat species in their respective geographic area. While in some instances bats entangled in spider webs may have died of exhaustion, starvation, dehydration, and/or hyperthermia (i.e., non-predation death), there were numerous other instances where spiders were seen actively attacking, killing, and eating the captured bats (i.e., predation). This evidence suggests that spider predation on flying vertebrates is more widespread than previously assumed.

Along Came a Spider: Using Live Arthropods in a Predator-Prey Activity

Science.gov (United States)

Richardson, Matthew L.; Hari, Janice

2011-01-01

We developed a predator-prey activity with eighth-grade students in which they used wolf spiders ("Lycosa carolinensis"), house crickets ("Acheta domestica"), and abiotic factors to address how (1) adaptations in predators and prey shape their interaction and (2) abiotic factors modify the interaction between predators and…

Did You Say Spiders?

Science.gov (United States)

Campbell, Alene

This spider unit focuses on students' development of cooperative learning and inquiry-based skills. Students read "The Very Busy Spider" by Eric Carle, and then work in cooperative groups using the Internet to research and synthesize important information about spiders. Technology is used for vocabulary instruction and to create a…

Bromeliad ornamental species: conservation issues and challenges related to commercialization=Espécies ornamentais de bromélias: conservação e desafios relacionados a sua comercialização

OpenAIRE

Darcy Mitchell; Raquel Rejane Bonato Negrelle; Adilson Anacleto

2012-01-01

Bromeliads grow almost exclusively in the New World tropics and subtropics, mainly in South America in the Brazilian Atlantic Forest (ca. 1200 species). Within the last few decades, their beautiful shapes and colors, low maintenance and easy adaptability to small gardens have brought bromeliads into worldwide use as ornamental plants. While the ornamental bromeliad trade could make significant contributions to household economies in rural areas, the trade may represent a significant threat in...

Benefits of Group Living Include Increased Feeding Efficiency and Lower Mass Loss during Desiccation in the Social and Inbreeding Spider Stegodyphus dumicola

Science.gov (United States)

Vanthournout, Bram; Greve, Michelle; Bruun, Anne; Bechsgaard, Jesper; Overgaard, Johannes; Bilde, Trine

2016-01-01

Group living carries a price: it inherently entails increased competition for resources and reproduction, and may also be associated with mating among relatives, which carries costs of inbreeding. Nonetheless, group living and sociality is found in many animals, and understanding the direct and indirect benefits of cooperation that override the inherent costs remains a challenge in evolutionary ecology. Individuals in groups may benefit from more efficient management of energy or water reserves, for example in the form of reduced water or heat loss from groups of animals huddling, or through reduced energy demands afforded by shared participation in tasks. We investigated the putative benefits of group living in the permanently social spider Stegodyphus dumicola by comparing the effect of group size on standard metabolic rate, lipid/protein content as a body condition measure, feeding efficiency, per capita web investment, and weight/water loss and survival during desiccation. Because energetic expenditure is temperature sensitive, some assays were performed under varying temperature conditions. We found that feeding efficiency increased with group size, and the rate of weight loss was higher in solitary individuals than in animals in groups of various sizes during desiccation. Interestingly, this was not translated into differences in survival or in standard metabolic rate. We did not detect any group size effects for other parameters, and group size effects did not co-vary with experimental temperature in a predictive manner. Both feeding efficiency and mass loss during desiccation are relevant ecological factors as the former results in lowered predator exposure time, and the latter benefits social spiders which occupy arid, hot environments. PMID:26869936

Benefits of group living include increased feeding efficiency and lower mass loss during desiccation in the social and inbreeding spider Stegodyphus dumicola.

Directory of Open Access Journals (Sweden)

Bram eVanthournout

2016-02-01

Full Text Available Group living carries a price: it inherently entails increased competition for resources and reproduction, and may also be associated with mating among relatives, which carries costs of inbreeding. Nonetheless, group living and sociality is found in many animals, and understanding the direct and indirect benefits of cooperation that override the inherent costs remains a challenge in evolutionary ecology. Individuals in groups may benefit from more efficient management of energy or water reserves, for example in the form of reduced water or heat loss from groups of animals huddling, or through reduced energy demands afforded by shared participation in tasks. We investigated the putative benefits of group living in the permanently social spider Stegodyphus dumicola by comparing the effect of group size on standard metabolic rate, lipid/protein content as a body condition measure, feeding efficiency, per capita web investment and weight/water loss and survival during desiccation. Because energetic expenditure is temperature sensitive, some assays were performed under varying temperature conditions. We found that feeding efficiency increased with group size, and the rate of weight loss was higher in solitary individuals than in animals in groups of various sizes during desiccation. Interestingly, this was not translated into differences in survival or in standard metabolic rate. We did not detect any group size effects for other parameters, and group size effects did not co-vary with experimental temperature in a predictive manner. Both feeding efficiency and mass loss during desiccation are relevant ecological factors as the former results in lowered predator exposure time, and the latter benefits social spiders which occupy arid, hot environments.

Black widow spider

Science.gov (United States)

... medlineplus.gov/ency/article/002858.htm Black widow spider To use the sharing features on this page, please enable JavaScript. The black widow spider (Latrodectus) has a shiny black body with a ...

Reproductive strategies and colonizing ability of two sympatric epiphytic bromeliads in a tropical premontane area

NARCIS (Netherlands)

Cascante Marin, A.M.; de Jong, M.; Borg, E.D.; Oostermeijer, J.G.B.; Wolf, J.H.D.; den Nijs, J.C.M.

2006-01-01

Predispersal characteristics that affect the reproductive success in plants may influence their colonizing ability. We evaluated this hypothesis in two sympatric epiphytic bromeliads in Costa Rica, Guzmania monostacbia and Tillandsia fasciculata, that show contrasting levels of local seedling

What you fear will appear: detection of schematic spiders in spider fear.

Science.gov (United States)

Peira, Nathalie; Golkar, Armita; Larsson, Maria; Wiens, Stefan

2010-01-01

Various experimental tasks suggest that fear guides attention. However, because these tasks often lack ecological validity, it is unclear to what extent results from these tasks can be generalized to real-life situations. In change detection tasks, a brief interruption of the visual input (i.e., a blank interval or a scene cut) often results in undetected changes in the scene. This setup resembles real-life viewing behavior and is used here to increase ecological validity of the attentional task without compromising control over the stimuli presented. Spider-fearful and nonfearful women detected schematic spiders and flowers that were added to one of two identical background pictures that alternated with a brief blank in between them (i.e., flicker paradigm). Results showed that spider-fearful women detected spiders (but not flowers) faster than did nonfearful women. Because spiders and flowers had similar low-level features, these findings suggest that fear guides attention on the basis of object features rather than simple low-level features.

Brown Recluse Spider

Science.gov (United States)

... to a group of spiders commonly known as violin spiders or fiddlebacks. The characteristic fiddle-shaped pattern ... 4-19.1mm) • Color: Golden brown • A dark violin/fiddle shape (see top photo) is located on ...

Effects of prey macronutrient content on body composition and nutrient intake in a web-building spider.

Directory of Open Access Journals (Sweden)

Jesse Hawley

Full Text Available The nutritional composition of diets can vary widely in nature and have large effects on the growth, reproduction and survival of animals. Many animals, especially herbivores, will tightly regulate the nutritional composition of their body, which has been referred to as nutritional homeostasis. We tested how experimental manipulation of the lipid and protein content of live prey affected the nutrient reserves and subsequent diet regulation of web-building spiders, Argiope keyserlingi. Live locusts were injected with experimental solutions containing specific amounts of lipid and protein and then fed to spiders. The nutrient composition of the spiders' bodies was directly related to the nutrient composition of the prey on which they fed. We then conducted an experiment where spiders were fed either high lipid or high protein prey and subsequently provided with two large unmanipulated locusts. Prior diet did not affect the amount or ratio of lipid and protein ingested by spiders when feeding on unmanipulated prey. Argiope keyserlingi were flexible in the storage of lipid and protein in their bodies and did not bias their extraction of nutrients from prey to compensate for previously biased diets. Some carnivores, especially those that experience frequent food limitation, may be less likely to strictly regulate their body composition than herbivores because food limitation may encourage opportunistic ingestion and assimilation of nutrients.

Relationships Between Countermovement Jump Ground Reaction Forces and Jump Height, Reactive Strength Index, and Jump Time.

Science.gov (United States)

Barker, Leland A; Harry, John R; Mercer, John A

2018-01-01

Barker, LA, Harry, JR, and Mercer, JA. Relationships between countermovement jump ground reaction forces and jump height, reactive strength index, and jump time. J Strength Cond Res 32(1): 248-254, 2018-The purpose of this study was to determine the relationship between ground reaction force (GRF) variables to jump height, jump time, and the reactive strength index (RSI). Twenty-six, Division-I, male, soccer players performed 3 maximum effort countermovement jumps (CMJs) on a dual-force platform system that measured 3-dimensional kinetic data. The trial producing peak jump height was used for analysis. Vertical GRF (Fz) variables were divided into unloading, eccentric, amortization, and concentric phases and correlated with jump height, RSI (RSI = jump height/jump time), and jump time (from start to takeoff). Significant correlations were observed between jump height and RSI, concentric kinetic energy, peak power, concentric work, and concentric displacement. Significant correlations were observed between RSI and jump time, peak power, unload Fz, eccentric work, eccentric rate of force development (RFD), amortization Fz, amortization time, second Fz peak, average concentric Fz, and concentric displacement. Significant correlations were observed between jump time and unload Fz, eccentric work, eccentric RFD, amortization Fz, amortization time, average concentric Fz, and concentric work. In conclusion, jump height correlated with variables derived from the concentric phase only (work, power, and displacement), whereas Fz variables from the unloading, eccentric, amortization, and concentric phases correlated highly with RSI and jump time. These observations demonstrate the importance of countermovement Fz characteristics for time-sensitive CMJ performance measures. Researchers and practitioners should include RSI and jump time with jump height to improve their assessment of jump performance.

THE EXECUTION OF PLANNED DETOURS BY SPIDER-EATING PREDATORS

Science.gov (United States)

Cross, Fiona R.; Jackson, Robert R.

2016-01-01

Many spiders from the salticid subfamily Spartaeinae specialize at preying on other spiders and they adopt complex strategies when targeting these dangerous prey. We tested 15 of these spider-eating spartaeine species for the capacity to plan detours ahead of time. Each trial began with the test subject on top of a tower from which it could view two boxes: one containing prey and the other not containing prey. The distance between the tower and the boxes was too far to reach by leaping and the tower sat on a platform surrounded by water. As the species studied are known to avoid water, the only way they could reach the prey without getting wet was by taking one of two circuitous walkways from the platform: one leading to the prey (‘correct’) and one not leading to the prey (‘incorrect’). After leaving the tower, the test subject could not see the prey and sometimes it had to walk past the incorrect walkway before reaching the correct walkway. Yet all 15 species chose the correct walkway significantly more often than the incorrect walkway. We propose that these findings exemplify genuine cognition based on representation. PMID:26781057

Extrativismo de bromélias no Estado do Paraná Bromeliads wild harvesting in State of Paraná

Directory of Open Access Journals (Sweden)

Raquel Rejane Bonato Negrelle

2012-06-01

Full Text Available Visando a contribuir para o melhor entendimento da participação da atividade extrativista no âmbito da comercialização de bromélias no Brasil, apresentou-se resultado de pesquisa que buscou: a identificar e caracterizar os extrativistas de bromélias formalmente registrados e os informais no Estado do Paraná; b identificar e caracterizar as metodologias de coleta, o preparo e vias de comercialização das plantas coletadas; c levantar a opinião dos extrativistas sobre facilidades e dificuldades desta atividade. O extrativismo de bromélias no Paraná foi identificado em 12 municípios, englobando 31 famílias extratoras, predominantemente concentradas no litoral do Paraná (n=10 e Município de Ortigueira (n=7. Foram identificados dois tipos básicos de extrativistas: residente e oportunista, com diferenças marcantes entre estes, especialmente no que se refere a volume e forma de extração. Foram identificadas 21 espécies submetidas ao extrativismo, sendo as mais frequentemente coletadas: Vriesea incurvata Gaudich. comercializada por 90% dos entrevistados, Nidularium innocentii Lem. (77%, Vriesea platynema Gaudich. (67%, Tillandsia stricta Sol. ex Ker Gawl. (55% e Vriesea carinata Lem. (55%.Aiming to contribute to the better understanding of the wild harvesting participation in the context of the bromeliads trade, the results from a study focused on: a identifying and to characterizing the bromeliads wild harvesters (formally and not formally registered in the State of the Paraná; b identifying and characterizing the harvesting methodologies, preparation and trade routes, and c surveying the harvesters opinion on the facilities and difficulties of bromeliads wild harvesting are presented. The bromeliads wild harvesting was detected in 12 municipalities at Parana State, involving 31 harvester families, most of them concentrated at the coastal zone (n=10 and Ortigueira Mun. (7. Two basic harvester types were identified: resident and

Jumping combined exercise programs reduce fall risk and improve balance and life quality of elderly people who live in a long-term care facility.

Science.gov (United States)

Cakar, E; Dincer, U; Kiralp, M Z; Cakar, D B; Durmus, O; Kilac, H; Soydan, F C; Sevinc, S; Alper, C

2010-03-01

The objective of this study was to determine whether regular combined exercise program, which consists strength, stretching and aerobic exercises and additional jumping training, improve balance, fall risk, quality of life and depression status of older people living in a residential care. A total of 168 residents who live in a long term care facility were screened. The trial began with 78 eligible participants and they were randomly grouped as combined exercises program (COM) group that includes stretching, strength and aerobic exercises, and COM plus jumping (COMpJ) group. 66 of the participants finished the trial. The groups were convened three times a week for six weeks. Each group had a warm-up, effective training and a cooling down periods. The total exercising time was no longer than 45 minutes in each group. Berg balance test and Biodex Balance System for the assessment of the dynamic balance and fall risk, short form 36 (SF 36) for the health related quality of life and Geriatric Depression Scale (GDS) for evaluation of the depression status were used. The balance improvement and fall risk reduction were observed in both of the groups at the end of the trial; however, the improvements were statistically better in jumping combined group. Also health related quality of life improved in both groups. Regular group exercise in a long term care facility have several beneficial effects on the elderly residents in regard to balance improvement, fall risk reduction and quality of life. The addition of jumping to strength, stretching and aerobic exercises provides important contributions to balance improvement and fall risk reduction.

Nature Study Tips. Spiders.

Science.gov (United States)

Mulaik, Stanley B.

1990-01-01

Different types of spiders, their ranges and habits are discussed. Activities associated with the study of spiders are suggested. Four references are listed which may be of interest to beginners. (CW)

Accuracy of Jump-Mat Systems for Measuring Jump Height.

Science.gov (United States)

Pueo, Basilio; Lipinska, Patrycja; Jiménez-Olmedo, José M; Zmijewski, Piotr; Hopkins, Will G

2017-08-01

Vertical-jump tests are commonly used to evaluate lower-limb power of athletes and nonathletes. Several types of equipment are available for this purpose. To compare the error of measurement of 2 jump-mat systems (Chronojump-Boscosystem and Globus Ergo Tester) with that of a motion-capture system as a criterion and to determine the modifying effect of foot length on jump height. Thirty-one young adult men alternated 4 countermovement jumps with 4 squat jumps. Mean jump height and standard deviations representing technical error of measurement arising from each device and variability arising from the subjects themselves were estimated with a novel mixed model and evaluated via standardization and magnitude-based inference. The jump-mat systems produced nearly identical measures of jump height (differences in means and in technical errors of measurement ≤1 mm). Countermovement and squat-jump height were both 13.6 cm higher with motion capture (90% confidence limits ±0.3 cm), but this very large difference was reduced to small unclear differences when adjusted to a foot length of zero. Variability in countermovement and squat-jump height arising from the subjects was small (1.1 and 1.5 cm, respectively, 90% confidence limits ±0.3 cm); technical error of motion capture was similar in magnitude (1.7 and 1.6 cm, ±0.3 and ±0.4 cm), and that of the jump mats was similar or smaller (1.2 and 0.3 cm, ±0.5 and ±0.9 cm). The jump-mat systems provide trustworthy measurements for monitoring changes in jump height. Foot length can explain the substantially higher jump height observed with motion capture.

The evolution of sociality in spiders

DEFF Research Database (Denmark)

Lubin, Yael; Bilde, T.

2007-01-01

. Anelosimus (Theridiidae) C. Sociality in Spiders: An Evolutionary Dead End? V. Evolution and Maintenance of Sociality in Spiders: Relevant Models A. Kin Selection 1. Kin Recognition 2. Inbreeding and Kin Selection B. Multilevel Selection (Group Selection) C. Ecological Benefits D. Ecological Constraints E......I. Introducing Social Spiders II. Social and Subsocial Species: A Survey of Behavioral Traits III. Inbred Sociality in Spiders A. Cooperation Versus Competition: A Balancing Act B. Do Social Spiders Have Division of Labor? C. Colony Foundation: Propagule Dispersal Versus Fission D. Female......-Biased Colony Sex Ratios: Primary and Operational Sex Ratios E. Mating System: Inbreeding and Its Population-Genetic Consequences F. "Boom and Bust" Colony Dynamics IV. Phylogenetic Relationships Among Social Spider Species A. Common Features of Social Evolution B. Case Studies 1. Stegodyphus (Eresidae) 2...

Perturbation vectors to evaluate air quality using lichens and bromeliads: a Brazilian case study.

Science.gov (United States)

Monna, F; Marques, A N; Guillon, R; Losno, R; Couette, S; Navarro, N; Dongarra, G; Tamburo, E; Varrica, D; Chateau, C; Nepomuceno, F O

2017-10-17

Samples of one lichen species, Parmotrema crinitum, and one bromeliad species, Tillandsia usneoides, were collected in the state of Rio de Janeiro, Brazil, at four sites differently affected by anthropogenic pollution. The concentrations of aluminum, cadmium, copper, iron, lanthanum, lead, sulfur, titanium, zinc, and zirconium were determined by inductively coupled plasma-atomic emission spectroscopy. The environmental diagnosis was established by examining compositional changes via perturbation vectors, an underused family of methods designed to circumvent the problem of closure in any compositional dataset. The perturbation vectors between the reference site and the other three sites were similar for both species, although body concentration levels were different. At each site, perturbation vectors between lichens and bromeliads were approximately the same, whatever the local pollution level. It should thus be possible to combine these organisms, though physiologically different, for air quality surveys, after making all results comparable with appropriate correction. The use of perturbation vectors seems particularly suitable for assessing pollution level by biomonitoring, and for many frequently met situations in environmental geochemistry, where elemental ratios are more relevant than absolute concentrations.

Effects of timing of signal indicating jump directions on knee biomechanics in jump-landing-jump tasks.

Science.gov (United States)

Stephenson, Mitchell L; Hinshaw, Taylour J; Wadley, Haley A; Zhu, Qin; Wilson, Margaret A; Byra, Mark; Dai, Boyi

2018-03-01

A variety of the available time to react (ATR) has been utilised to study knee biomechanics during reactive jump-landing tasks. The purpose was to quantify knee kinematics and kinetics during a jump-land-jump task of three possible directions as the ATR was reduced. Thirty-four recreational athletes performed 45 trials of a jump-land-jump task, during which the direction of the second jump (lateral, medial or vertical) was indicated before they initiated the first jump, the instant they initiated the first jump, 300 ms before landing, 150 ms before landing or at the instant of landing. Knee joint angles and moments close to the instant of landing were significantly different when the ATR was equal to or more than 300 ms before landing, but became similar when the ATR was 150 ms or 0 ms before landing. As the ATR was decreased, knee moments decreased for the medial jump direction, but increased for the lateral jump direction. When the ATR is shorter than an individual's reaction time, the movement pattern cannot be pre-planned before landing. Knee biomechanics are dependent on the timing of the signal and the subsequent jump direction. Precise control of timing and screening athletes with low ATR are suggested.

Abundant and rare spiders on tree trunks in German forests (Arachnida, Araneae

Directory of Open Access Journals (Sweden)

Blick, Theo

2011-01-01

Full Text Available The spider fauna active on the bark of trees in forests on eight sites in different regions in Germany was investigated. Trunk eclectors at about 2-4 meters height on living trees were used in different regions of Germany (SW Bavaria, Hesse, Brandenburg between 1990 and 2003. In Hesse eclectors were also used on dead beech trees (standing and lying. In this study data, mainly from beech (Fagus sylvatica and spruce (Picea abies, from May to October are compared – whole year samples (including winter are only available from Hesse. A total of 334 spider species were recorded with these bark traps, i.e. about one third of the spider species known from Germany. On average, each of the eight regions yielded 140.5 (± 26.2 species, each single tree 40.5 (± 12.2 species and 502 (± 452 adult spiders per season (i.e. May to Oct.. The 20 most abundant species are listed and characterised in detail. Six of the 20 species were not known to be abundant on bark, three prefer conifers and three beech/broadleaf. Even in winter (December-March there was a remarkably high activity on the trunks. However, only a few species occur exclusively or mainly in winter. Finally, the rarity of some bark spider species is discussed and details (all known records in Germany, phenology of four of them are presented (Clubiona leucaspis, Gongylidiellum edentatum, Kratochviliella bicapitata, Oreonetides quadridentatus. The diversity and importance of the spider fauna on bark in Central Europe is still underestimated.

Data-Driven Jump Detection Thresholds for Application in Jump Regressions

Directory of Open Access Journals (Sweden)

Robert Davies

2018-03-01

Full Text Available This paper develops a method to select the threshold in threshold-based jump detection methods. The method is motivated by an analysis of threshold-based jump detection methods in the context of jump-diffusion models. We show that over the range of sampling frequencies a researcher is most likely to encounter that the usual in-fill asymptotics provide a poor guide for selecting the jump threshold. Because of this we develop a sample-based method. Our method estimates the number of jumps over a grid of thresholds and selects the optimal threshold at what we term the ‘take-off’ point in the estimated number of jumps. We show that this method consistently estimates the jumps and their indices as the sampling interval goes to zero. In several Monte Carlo studies we evaluate the performance of our method based on its ability to accurately locate jumps and its ability to distinguish between true jumps and large diffusive moves. In one of these Monte Carlo studies we evaluate the performance of our method in a jump regression context. Finally, we apply our method in two empirical studies. In one we estimate the number of jumps and report the jump threshold our method selects for three commonly used market indices. In the other empirical application we perform a series of jump regressions using our method to select the jump threshold.

Non-webbuilding spiders: prey specialists or generalists?

Science.gov (United States)

Nentwig, Wolfgang

1986-07-01

Feeding experiments were performed with seven species of non-webbuilding spiders and a variety of prey taxa. Some species were generally polyphagous whereas other spiders restricted their prey to a few groups. At one end of the spectrum of prey specialization the thomisid Misumena vatia is limited to a few taxa of possible prey (Table 1). The literature of prey records of non-webbuilding spiders is reviewed (Table 2) with special emphasis on oligophagous or monophagous spiders. Monophagous spiders are generally rare and have specialized on only a few prey taxa: social insects (ants, bees, termites) and spiders.

Contribution to the knowledge of jumping spiders (Araneae: Salticidae from vicinity of Jagodina, Central Serbia

Directory of Open Access Journals (Sweden)

Stanković, B.

2012-09-01

Full Text Available During last 10 years, based on personal collectings, 21 species from 14 genera of Salticidae (Araneae are recorded from vicinity of Jagodina: Ballus chalybeius, Carrhotus xanthogramma, Evarcha arcuata, Evarcha falcata, Heliophanus auratus, Heliophanus cupreus, Heliophanus flavipes, Heliophanus kochii, Icius hamatus, Icius subinermis, Leptorchestes berolinensis, Macaroeris nidicolens, Marpissa muscosa, Marpissa nivoyi, Mendoza canestrinii, Pellenes tripunctatus, Phintella castriesiana, Phlegra fasciata, Pseudeuophrys erratica, Pseudeuophrys lanigera, Salticus scenicus. All those species are provided with habitat notes and global distribution. New records for the spider fauna of Serbia are Heliophanus kochii (Simon 1868, Icius subinermis (Simon, 1937, Marpissa nivoyi (Lucas, 1846 and Mendoza canestrinii (Ninni, 1868.

Characterization of microsatellite loci in the subsocial spider Stegodyphus lineatus (Araneae: Eresidae)

DEFF Research Database (Denmark)

Bilde, T.; Tuni, Cristina; Cariani, A.

2009-01-01

Stegodyphus lineatus spiders live in groups consisting of closely related individuals. There appears to be no discrimination against related individuals as mates but females mate multiply, despite the fact that matings are shown to carry a cost. We have developed eight polymorphic dinucleotide...

Remembering the object you fear: brain potentials during recognition of spiders in spider-fearful individuals.

Science.gov (United States)

Michalowski, Jaroslaw M; Weymar, Mathias; Hamm, Alfons O

2014-01-01

In the present study we investigated long-term memory for unpleasant, neutral and spider pictures in 15 spider-fearful and 15 non-fearful control individuals using behavioral and electrophysiological measures. During the initial (incidental) encoding, pictures were passively viewed in three separate blocks and were subsequently rated for valence and arousal. A recognition memory task was performed one week later in which old and new unpleasant, neutral and spider pictures were presented. Replicating previous results, we found enhanced memory performance and higher confidence ratings for unpleasant when compared to neutral materials in both animal fearful individuals and controls. When compared to controls high animal fearful individuals also showed a tendency towards better memory accuracy and significantly higher confidence during recognition of spider pictures, suggesting that memory of objects prompting specific fear is also facilitated in fearful individuals. In line, spider-fearful but not control participants responded with larger ERP positivity for correctly recognized old when compared to correctly rejected new spider pictures, thus showing the same effects in the neural signature of emotional memory for feared objects that were already discovered for other emotional materials. The increased fear memory for phobic materials observed in the present study in spider-fearful individuals might result in an enhanced fear response and reinforce negative beliefs aggravating anxiety symptomatology and hindering recovery.

Mobile Jump Assessment (mJump): A Descriptive and Inferential Study.

Science.gov (United States)

Mateos-Angulo, Alvaro; Galán-Mercant, Alejandro; Cuesta-Vargas, Antonio

2015-08-26

Vertical jump tests are used in athletics and rehabilitation to measure physical performance in people of different age ranges and fitness. Jumping ability can be analyzed through different variables, and the most commonly used are fly time and jump height. They can be obtained by a variety of measuring devices, but most are limited to laboratory use only. The current generation of smartphones contains inertial sensors that are able to record kinematic variables for human motion analysis, since they are tools for easy access and portability for clinical use. The aim of this study was to describe and analyze the kinematics characteristics using the inertial sensor incorporated in the iPhone 4S, the lower limbs strength through a manual dynamometer, and the jump variables obtained with a contact mat in the squat jump and countermovement jump tests (fly time and jump height) from a cohort of healthy people. A cross sectional study was conducted on a population of healthy young adults. Twenty-seven participants performed three trials (n=81 jumps) of squat jump and countermovement jump tests. Acceleration variables were measured through a smartphone's inertial sensor. Additionally, jump variables from a contact mat and lower limbs dynamometry were collected. In the present study, the kinematic variables derived from acceleration through the inertial sensor of a smartphone iPhone 4S, dynamometry of lower limbs with a handheld dynamometer, and the height and flight time with a contact mat have been described in vertical jump tests from a cohort of young healthy subjects. The development of the execution has been described, examined and identified in a squat jump test and countermovement jump test under acceleration variables that were obtained with the smartphone. The built-in iPhone 4S inertial sensor is able to measure acceleration variables while performing vertical jump tests for the squat jump and countermovement jump in healthy young adults. The acceleration

Science Education Resources on the Web--Spiders.

Science.gov (United States)

Thirunarayanan, M. O.

1997-01-01

Lists Web sites containing information on spiders and offers brief descriptions of the information available at those sites. The 11 sites provide information on taxonomy of spiders, anatomy, different ways spiders use silk, Internet mailing lists, folk literature and art, bibliographies, night collection, and spiders commonly found in the state of…

Aquatic subsidies transport anthropogenic nitrogen to riparian spiders

Energy Technology Data Exchange (ETDEWEB)

Akamatsu, Fumikazu, E-mail: f-akamt55@pwri.go.jp [Department of Environmental Sciences, Shinshu University, 3-1-1 Asahi, Matsumoto, Nagano 390-8621 (Japan); Toda, Hideshige [Department of Environmental Sciences, Shinshu University, 3-1-1 Asahi, Matsumoto, Nagano 390-8621 (Japan)

2011-05-15

Stable nitrogen isotopic composition ({delta}{sup 15}N) of aquatic biota increases with anthropogenic N inputs such as sewage and livestock waste downstream. Increase in {delta}{sup 15}N of riparian spiders downstream may reflect the anthropogenic pollution exposure through predation on aquatic insects. A two-source mixing model based on stable carbon isotopic composition showed the greatest dependence on aquatic insects (84%) by horizontal web-building spiders, followed by intermediate (48%) and low (31%) dependence by cursorial and vertical web-building spiders, respectively. The spider body size was negatively correlated with the dietary proportion of aquatic insects and spider {delta}{sup 15}N. The aquatic subsidies transported anthropogenic N to smaller riparian spiders downstream. This transport of anthropogenic N was regulated by spider's guild designation and body size. - Highlights: > {delta}{sup 15}N of aquatic insects increases downstream with anthropogenic nitrogen inputs. > {delta}{sup 15}N of riparian spiders increases with a high dietary proportion of aquatic insects and smaller spider body size. > The aquatic subsidies transport anthropogenic nitrogen to smaller riparian spiders downstream. - Smaller spiders assimilate anthropogenic nitrogen through the predation on aquatic subsides.

Aquatic subsidies transport anthropogenic nitrogen to riparian spiders

International Nuclear Information System (INIS)

Akamatsu, Fumikazu; Toda, Hideshige

2011-01-01

Stable nitrogen isotopic composition (δ 15 N) of aquatic biota increases with anthropogenic N inputs such as sewage and livestock waste downstream. Increase in δ 15 N of riparian spiders downstream may reflect the anthropogenic pollution exposure through predation on aquatic insects. A two-source mixing model based on stable carbon isotopic composition showed the greatest dependence on aquatic insects (84%) by horizontal web-building spiders, followed by intermediate (48%) and low (31%) dependence by cursorial and vertical web-building spiders, respectively. The spider body size was negatively correlated with the dietary proportion of aquatic insects and spider δ 15 N. The aquatic subsidies transported anthropogenic N to smaller riparian spiders downstream. This transport of anthropogenic N was regulated by spider's guild designation and body size. - Highlights: → δ 15 N of aquatic insects increases downstream with anthropogenic nitrogen inputs. → δ 15 N of riparian spiders increases with a high dietary proportion of aquatic insects and smaller spider body size. → The aquatic subsidies transport anthropogenic nitrogen to smaller riparian spiders downstream. - Smaller spiders assimilate anthropogenic nitrogen through the predation on aquatic subsides.

Two new Thiratoscirtus species from Gabon (Araneae, Salticidae, Thiratoscirtinae

Directory of Open Access Journals (Sweden)

Michael Seiter

2015-05-01

Full Text Available Two new species of jumping spiders, Thiratoscirtus oberleuthneri (♂ and Th. lamboji (♀, are described from Gabon, one of the least explored areas of the Afrotropics. Both species live in rainforest, at the forest floor. They are members of a very poorly known subfamily of salticids, the Thiratoscirtinae.

Effects of bromeliad flowering event on the community structuring of aquatic insect larvae associated with phytotelmata of Aechmea distichantha Lem. (Bromeliaceae

Directory of Open Access Journals (Sweden)

Felipe Emiliano Amadeo

2017-12-01

Full Text Available Abstract Aim: We aimed to understand how aquatic insect larvae communities associated with bromeliad phytotelmata are affected by plant architecture, predators and resources (local factors, and by geographical distance (regional factors in two different plant phenological phases. Bromeliad flowering results in plant structural changes, which favours insect dispersal. Considering that local and regional factors may affect the community of aquatic insect larvae, we expected that composition, beta diversity and the importance of those factors would differ in the vegetative growth and flowering phases. Methods We performed six samplings of the bromeliad associated fauna in 2010, three during the first semester - vegetative growth phase - and three during the second semester - flowering phase. In each sampling, we collected 12 plants along the rocky walls with similar location distribution, with a total of 72 bromeliads studied. Results Although beta diversity (PERMDISP did not differ between vegetative growth and flowering, NMDS followed by ANOSIM showed that composition was significantly different in the distinct phenological phases. IndVal results showed that three Diptera morphospecies were discriminant of the vegetative growth phase. In addition, pRDA revealed differences in the relative contribution of local and regional factors to explain insect larvae community structure. During the flowering phase, local factors predominated, while during vegetative growth, regional factors were more important. Conclusion Differences in dispersal rates between the two phenological phases, likely due to adult insect pollination and further oviposition, influenced community structuring. Therefore, flowering events account for differences not only in the composition, but also in community structuring of aquatic insect larvae inhabiting the phytotelmata of Aechmea distichantha Lem. (Bromeliaceae.

Phobic spider fear is associated with enhanced attentional capture by spider pictures: a rapid serial presentation event-related potential study.

Science.gov (United States)

Van Strien, Jan W; Franken, Ingmar H A; Huijding, Jorg

2009-03-04

The early posterior negativity (EPN) reflects early selective visual processing of emotionally significant information. This study explored the association between fear of spiders and the EPN for spider pictures. Fifty women completed a Spider Phobia Questionnaire and watched the random rapid serial presentation of 600 neutral, 600 negatively valenced emotional, and 600 spider pictures (three pictures per second). The EPN was scored as the mean activity in the 225-300-ms time window at lateral occipital electrodes. Participants with higher scores on the phobia questionnaire showed larger (i.e. more negative) EPN amplitudes in response to spider pictures. The results suggest that the attentional capture of spider-related stimuli is an automatic response, which is modulated by the extent of spider fear.

What´s in the tank? Nematodes and other major components of the meiofauna of bromeliad phytotelms in lowland Panama.

Science.gov (United States)

Zotz, Gerhard; Traunspurger, Walter

2016-03-15

Nematodes are a very diverse and extremely abundant group of animals, but their occurrence in the tropics is surprisingly little understood. We investigated the meiofauna of epiphytic tank bromeliads in the lowlands of Panama with particular emphasis on nematodes. We encountered 89 morphospecies of nematodes in 54 bromeliad tanks, which were sampled in the wet and the dry season. Rotifers were by far the most abundant group in both the dry and the wet season (with up to 960 individual ml(-1)), followed by nematodes, annelids and harpacticoid copepods. Individual plants hosted up to 25 nematode species. These nematodes represented a diversity of feeding guilds, suction-feeders and deposit-feeders being most abundant. The relative abundances of feeding-types of nematodes differed considerably in the wet and dry season. Both species richness and abundance were strongly correlated with the size of the phytotelms and the season, while species diversity assessed with the Shannon-index was affected by neither of the two. This is the first study with a particular focus on the diversity of nematodes in tank bromeliads. We document a meiofauna of considerable abundance and diversity, which suggests important functional roles in ecological processes such as decomposition, which in turn warrants further study.

Warring arthropod societies: Social spider colonies can delay annihilation by predatory ants via reduced apparency and increased group size.

Science.gov (United States)

Keiser, Carl N; Wright, Colin M; Pruitt, Jonathan N

2015-10-01

Sociality provides individuals with benefits via collective foraging and anti-predator defense. One of the costs of living in large groups, however, is increased apparency to natural enemies. Here, we test how the individual-level and collective traits of spider societies can increase the risk of discovery and death by predatory ants. We transplanted colonies of the social spider Stegodyphus dumicola into a habitat dense with one of their top predators, the pugnacious ant Anoplolepis custodiens. With three different experiments, we test how colony-wide survivorship in a predator-dense habitat can be altered by colony apparency (i.e., the presence of a capture web), group size, and group composition (i.e., the proportion of bold and shy personality types present). We also test how spiders' social context (i.e., living solitarily vs. among conspecifics) modifies their behaviour toward ants in their capture web. Colonies with capture webs intact were discovered by predatory ants on average 25% faster than colonies with the capture web removed, and all discovered colonies eventually collapsed and succumbed to predation. However, the lag time from discovery by ants to colony collapse was greater for colonies containing more individuals. The composition of individual personality types in the group had no influence on survivorship. Spiders in a social group were more likely to approach ants caught in their web than were isolated spiders. Isolated spiders were more likely to attack a safe prey item (a moth) than they were to attack ants and were more likely to retreat from ants after contact than they were after contact with moths. Together, our data suggest that the physical structures produced by large animal societies can increase their apparency to natural enemies, though larger groups can facilitate a longer lag time between discovery and demise. Lastly, the interaction between spiders and predatory ants seems to depend on the social context in which spiders reside

Choice of jumping strategy in two standard jumps, squat and countermovement jump--effect of training background or inherited preference?

DEFF Research Database (Denmark)

Ravn, Susanne; Voigt, M; Simonsen, Erik Bruun

1999-01-01

. The jumps were recorded on highspeed film (500 Hz) combined with registration of ground reaction forces, and net joint moments were calculated by inverse dynamics. The purpose was to investigate the choice of strategy in two standard jumps, squat jump and countermovement jump. The volleyball jump...... was performed with a sequential strategy and the ballet jump was performed with a simultaneous strategy. In the two standard jumps, the choice of strategy was individual and not related to training background. This was additionally confirmed in a test of seven ballet dancers and seven volleyball players....

Spider and burnable poison rod combinations

International Nuclear Information System (INIS)

Edwards, G.T.; Schluderberg, D.C.

1980-01-01

An improved design of burnable poison rods and associated spiders used in fuel assemblies of pressurized water power reactor cores, is described. The rods are joined to the spider arms in a manner which is proof against the reactor core environment and yet allows the removal of the rods from the spider simply, swiftly and delicately. (U.K.)

Are temperate canopy spiders tree-species specific?

Science.gov (United States)

Mupepele, Anne-Christine; Müller, Tobias; Dittrich, Marcus; Floren, Andreas

2014-01-01

Arboreal spiders in deciduous and coniferous trees were investigated on their distribution and diversity. Insecticidal knock-down was used to comprehensively sample spiders from 175 trees from 2001 to 2003 in the Białowieża forest and three remote forests in Poland. We identified 140 species from 9273 adult spiders. Spider communities were distinguished between deciduous and coniferous trees. The richest fauna was collected from Quercus where beta diversity was also highest. A tree-species-specific pattern was clearly observed for Alnus, Carpinus, Picea and Pinus trees and also for those tree species that were fogged in only four or three replicates, namely Betula and Populus. This hitherto unrecognised association was mainly due to the community composition of common species identified in a Dufrene-Legendre indicator species analysis. It was not caused by spatial or temporal autocorrelation. Explaining tree-species specificity for generalist predators like spiders is difficult and has to involve physical and ecological tree parameters like linkage with the abundance of prey species. However, neither did we find a consistent correlation of prey group abundances with spiders nor could differences in spider guild composition explain the observed pattern. Our results hint towards the importance of deterministic mechanisms structuring communities of generalist canopy spiders although the casual relationship is not yet understood.

Viewing behaviour of spider phobics and non-phobics in the presence of threat and safety stimuli.

Science.gov (United States)

Lange, W G T; Tierney, K J; Reinhardt-Rutland, A H; Vivekananda-Schmidt, P

2004-09-01

To determine whether spider phobics and spider non-phobics differ in attending to threat and safety stimuli in close proximity, or spatially separated. A sample group of 16 spider-phobic and 16 spider-non-phobic volunteers were drawn from a student population on the basis of their scores on Watts and Sharrock's Spider Phobia Questionnaire. Attention was assessed by way of participants' viewing behaviour using an ASL 501 head-mounted eye-tracking system. In a control condition, participants viewed a neutral stimulus (a TV video) in the absence of the threat stimulus. In two experimental conditions, the threat stimulus (a live Chilean rose tarantula) was introduced (a) immediately beside the safety stimulus (the only exit of the experimental room), or (b) away from the safety stimulus. In the experimental conditions, phobics reduced their viewing of the TV and increased their viewing of the tarantula and of the exit; the biggest changes occurred when tarantula and exit were together. Phobics also made more eye motions across the experimental room. Our results are consistent with previous research employing reaction time to a neutral stimulus as dependent measure. In addition, our results suggest that phobics scan the environment as part of safety behaviour. We suggest that exposure treatments to reduce spider phobia may be facilitated by encouraging patients to stop environmental scanning. Copyright 2004 The British Psychological Society

Erstnachweis von Evarcha michailovi in Deutschland (Araneae: Salticidae sowie weitere für Mecklenburg-Vorpommern neue Spinnenarten

Directory of Open Access Journals (Sweden)

Martin, Dieter

2014-12-01

Full Text Available The jumping spider Evarcha michailovi Logunov 1992 was recorded as new to Germany from a nature reserve in the south of Mecklenburg-Western Pomerania in a dry heathland habitat. Furthermore, the first records of the jumping spiders Evarcha laetabunda (C. L. Koch, 1846, Philaeus chrysops (Poda, 1761 and Sitticus inexpectus Logunov & Kronestedt, 1997, the comb-footed spider Crustulina sticta (O. P.-Cambridge, 1861 and the crab spider Heriaeus graminicola (Doleschall, 1852 in Mecklenburg-Western Pomerania are reported.

Fish predation by semi-aquatic spiders: a global pattern.

Directory of Open Access Journals (Sweden)

Martin Nyffeler

Full Text Available More than 80 incidences of fish predation by semi-aquatic spiders--observed at the fringes of shallow freshwater streams, rivers, lakes, ponds, swamps, and fens--are reviewed. We provide evidence that fish predation by semi-aquatic spiders is geographically widespread, occurring on all continents except Antarctica. Fish predation by spiders appears to be more common in warmer areas between 40° S and 40° N. The fish captured by spiders, usually ranging from 2-6 cm in length, are among the most common fish taxa occurring in their respective geographic area (e.g., mosquitofish [Gambusia spp.] in the southeastern USA, fish of the order Characiformes in the Neotropics, killifish [Aphyosemion spp.] in Central and West Africa, as well as Australian native fish of the genera Galaxias, Melanotaenia, and Pseudomugil. Naturally occurring fish predation has been witnessed in more than a dozen spider species from the superfamily Lycosoidea (families Pisauridae, Trechaleidae, and Lycosidae, in two species of the superfamily Ctenoidea (family Ctenidae, and in one species of the superfamily Corinnoidea (family Liocranidae. The majority of reports on fish predation by spiders referred to pisaurid spiders of the genera Dolomedes and Nilus (>75% of observed incidences. There is laboratory evidence that spiders from several more families (e.g., the water spider Argyroneta aquatica [Cybaeidae], the intertidal spider Desis marina [Desidae], and the 'swimming' huntsman spider Heteropoda natans [Sparassidae] predate fish as well. Our finding of such a large diversity of spider families being engaged in fish predation is novel. Semi-aquatic spiders captured fish whose body length exceeded the spiders' body length (the captured fish being, on average, 2.2 times as long as the spiders. Evidence suggests that fish prey might be an occasional prey item of substantial nutritional importance.

Fish predation by semi-aquatic spiders: a global pattern.

Science.gov (United States)

Nyffeler, Martin; Pusey, Bradley J

2014-01-01

More than 80 incidences of fish predation by semi-aquatic spiders--observed at the fringes of shallow freshwater streams, rivers, lakes, ponds, swamps, and fens--are reviewed. We provide evidence that fish predation by semi-aquatic spiders is geographically widespread, occurring on all continents except Antarctica. Fish predation by spiders appears to be more common in warmer areas between 40° S and 40° N. The fish captured by spiders, usually ranging from 2-6 cm in length, are among the most common fish taxa occurring in their respective geographic area (e.g., mosquitofish [Gambusia spp.] in the southeastern USA, fish of the order Characiformes in the Neotropics, killifish [Aphyosemion spp.] in Central and West Africa, as well as Australian native fish of the genera Galaxias, Melanotaenia, and Pseudomugil). Naturally occurring fish predation has been witnessed in more than a dozen spider species from the superfamily Lycosoidea (families Pisauridae, Trechaleidae, and Lycosidae), in two species of the superfamily Ctenoidea (family Ctenidae), and in one species of the superfamily Corinnoidea (family Liocranidae). The majority of reports on fish predation by spiders referred to pisaurid spiders of the genera Dolomedes and Nilus (>75% of observed incidences). There is laboratory evidence that spiders from several more families (e.g., the water spider Argyroneta aquatica [Cybaeidae], the intertidal spider Desis marina [Desidae], and the 'swimming' huntsman spider Heteropoda natans [Sparassidae]) predate fish as well. Our finding of such a large diversity of spider families being engaged in fish predation is novel. Semi-aquatic spiders captured fish whose body length exceeded the spiders' body length (the captured fish being, on average, 2.2 times as long as the spiders). Evidence suggests that fish prey might be an occasional prey item of substantial nutritional importance.

Plasmodium falciparum in the southeastern Atlantic forest: a challenge to the bromeliad-malaria paradigm?

Science.gov (United States)

Laporta, Gabriel Zorello; Burattini, Marcelo Nascimento; Levy, Debora; Fukuya, Linah Akemi; de Oliveira, Tatiane Marques Porangaba; Maselli, Luciana Morganti Ferreira; Conn, Jan Evelyn; Massad, Eduardo; Bydlowski, Sergio Paulo; Sallum, Maria Anice Mureb

2015-04-25

Recently an unexpectedly high prevalence of Plasmodium falciparum was found in asymptomatic blood donors living in the southeastern Brazilian Atlantic forest. The bromeliad-malaria paradigm assumes that transmission of Plasmodium vivax and Plasmodium malariae involves species of the subgenus Kerteszia of Anopheles and only a few cases of P. vivax malaria are reported annually in this region. The expectations of this paradigm are a low prevalence of P. vivax and a null prevalence of P. falciparum. Therefore, the aim of this study was to verify if P. falciparum is actively circulating in the southeastern Brazilian Atlantic forest remains. In this study, anophelines were collected with Shannon and CDC-light traps in seven distinct Atlantic forest landscapes over a 4-month period. Field-collected Anopheles mosquitoes were tested by real-time PCR assay in pools of ten, and then each mosquito from every positive pool, separately for P. falciparum and P. vivax. Genomic DNA of P. falciparum or P. vivax from positive anophelines was then amplified by traditional PCR for sequencing of the 18S ribosomal DNA to confirm Plasmodium species. Binomial probabilities were calculated to identify non-random results of the P. falciparum-infected anopheline findings. The overall proportion of anophelines naturally infected with P. falciparum was 4.4% (21/480) and only 0.8% (4/480) with P. vivax. All of the infected mosquitoes were found in intermixed natural and human-modified environments and most were Anopheles cruzii (22/25 = 88%, 18 P. falciparum plus 4 P. vivax). Plasmodium falciparum was confirmed by sequencing in 76% (16/21) of positive mosquitoes, whereas P. vivax was confirmed in only 25% (1/4). Binomial probabilities suggest that P. falciparum actively circulates throughout the region and that there may be a threshold of the forested over human-modified environment ratio upon which the proportion of P. falciparum-infected anophelines increases significantly. These results

The house spider genome reveals an ancient whole-genome duplication during arachnid evolution.

Science.gov (United States)

Schwager, Evelyn E; Sharma, Prashant P; Clarke, Thomas; Leite, Daniel J; Wierschin, Torsten; Pechmann, Matthias; Akiyama-Oda, Yasuko; Esposito, Lauren; Bechsgaard, Jesper; Bilde, Trine; Buffry, Alexandra D; Chao, Hsu; Dinh, Huyen; Doddapaneni, HarshaVardhan; Dugan, Shannon; Eibner, Cornelius; Extavour, Cassandra G; Funch, Peter; Garb, Jessica; Gonzalez, Luis B; Gonzalez, Vanessa L; Griffiths-Jones, Sam; Han, Yi; Hayashi, Cheryl; Hilbrant, Maarten; Hughes, Daniel S T; Janssen, Ralf; Lee, Sandra L; Maeso, Ignacio; Murali, Shwetha C; Muzny, Donna M; Nunes da Fonseca, Rodrigo; Paese, Christian L B; Qu, Jiaxin; Ronshaugen, Matthew; Schomburg, Christoph; Schönauer, Anna; Stollewerk, Angelika; Torres-Oliva, Montserrat; Turetzek, Natascha; Vanthournout, Bram; Werren, John H; Wolff, Carsten; Worley, Kim C; Bucher, Gregor; Gibbs, Richard A; Coddington, Jonathan; Oda, Hiroki; Stanke, Mario; Ayoub, Nadia A; Prpic, Nikola-Michael; Flot, Jean-François; Posnien, Nico; Richards, Stephen; McGregor, Alistair P

2017-07-31

The duplication of genes can occur through various mechanisms and is thought to make a major contribution to the evolutionary diversification of organisms. There is increasing evidence for a large-scale duplication of genes in some chelicerate lineages including two rounds of whole genome duplication (WGD) in horseshoe crabs. To investigate this further, we sequenced and analyzed the genome of the common house spider Parasteatoda tepidariorum. We found pervasive duplication of both coding and non-coding genes in this spider, including two clusters of Hox genes. Analysis of synteny conservation across the P. tepidariorum genome suggests that there has been an ancient WGD in spiders. Comparison with the genomes of other chelicerates, including that of the newly sequenced bark scorpion Centruroides sculpturatus, suggests that this event occurred in the common ancestor of spiders and scorpions, and is probably independent of the WGDs in horseshoe crabs. Furthermore, characterization of the sequence and expression of the Hox paralogs in P. tepidariorum suggests that many have been subject to neo-functionalization and/or sub-functionalization since their duplication. Our results reveal that spiders and scorpions are likely the descendants of a polyploid ancestor that lived more than 450 MYA. Given the extensive morphological diversity and ecological adaptations found among these animals, rivaling those of vertebrates, our study of the ancient WGD event in Arachnopulmonata provides a new comparative platform to explore common and divergent evolutionary outcomes of polyploidization events across eukaryotes.

Evidence for competition between carnivorous plants and spiders.

Science.gov (United States)

Jennings, David E; Krupa, James J; Raffel, Thomas R; Rohr, Jason R

2010-10-07

Several studies have demonstrated that competition between disparate taxa can be important in determining community structure, yet surprisingly, to our knowledge, no quantitative studies have been conducted on competition between carnivorous plants and animals. To examine potential competition between these taxa, we studied dietary and microhabitat overlap between pink sundews (Drosera capillaris) and wolf spiders (Lycosidae) in the field, and conducted a laboratory experiment examining the effects of wolf spiders on sundew fitness. In the field, we found that sundews and spiders had a high dietary overlap with each other and with the available arthropod prey. Associations between sundews and spiders depended on spatial scale: both sundews and spiders were found more frequently in quadrats with more abundant prey, but within quadrats, spiders constructed larger webs and located them further away from sundews as the total sundew trapping area increased, presumably to reduce competition. Spiders also constructed larger webs when fewer prey were available. In the laboratory, our experiment revealed that spiders can significantly reduce sundew fitness. Our findings suggest that members of the plant and animal kingdoms can and do compete.

Genus-specificity of araneophagy of linyphiid spiders and spiders of other families (Arachnida, Araneae)

NARCIS (Netherlands)

Heuts, B.; Brunt, T.

2009-01-01

We found genus specificity of predation by spiders on other spiders in captivity which surpass them in body size (araneophagy). Adult specimens of three species of the linyphiid genus Walckenaeria which were successively tested for araneophagy (in the laboratory) in the order of first species

Approach and avoidance in fear of spiders

NARCIS (Netherlands)

Rinck, M.; Becker, E.S.

2007-01-01

We examined attitudes towards spiders by employing an Approach-Avoidance Task, in which participants respond to pictures by pulling a joystick towards themselves or by pushing it away from themselves. For spider fearfuls, this stimulus–response assignment is either compatible (push spiders away) or

Learning to avoid spiders: fear predicts performance, not competence.

Science.gov (United States)

Luo, Xijia; Becker, Eni S; Rinck, Mike

2018-01-05

We used an immersive virtual environment to examine avoidance learning in spider-fearful participants. In 3 experiments, participants were asked to repeatedly lift one of 3 virtual boxes, under which either a toy car or a spider appeared and then approached the participant. Participants were not told that the probability of encountering a spider differed across boxes. When the difference was large (Exps. 1 and 2), spider-fearfuls learned to avoid spiders by lifting the few-spiders-box more often and the many-spiders-box less often than non-fearful controls did. However, they hardly managed to do so when the probability differences were small (Exp. 3), and they did not escape from threat more quickly (Exp. 2). In contrast to the observed performance differences, spider-fearfuls and non-fearfuls showed equal competence, that is comparable post-experimental knowledge about the probability to encounter spiders under the 3 boxes. The limitations and implications of the present study are discussed.

Attention and amygdala activity: an fMRI study with spider pictures in spider phobia.

Science.gov (United States)

Alpers, Georg W; Gerdes, Antje B M; Lagarie, Bernadette; Tabbert, Katharina; Vaitl, Dieter; Stark, Rudolf

2009-06-01

Facilitated detection of threatening visual cues is thought to be adaptive. In theory, detection of threat cues should activate the amygdala independently from allocation of attention. However, previous studies using emotional facial expressions as well as phobic cues yielded contradictory results. We used fMRI to examine whether the allocation of attention to components of superimposed spider and bird displays modulates amygdala activation. Nineteen spider-phobic women were instructed to identify either a moving or a stationary animal in briefly presented double-exposure displays. Amygdala activation followed a dose-response relationship: Compared to congruent neutral displays (two birds), amygdala activation was most pronounced in response to congruent phobic displays (two spiders) and less but still significant in response to mixed displays (spider and bird) when attention was focused on the phobic component. When attention was focused on the neutral component, mixed displays did not result in significant amygdala activation. This was confirmed in a significant parametric graduation of the amygdala activation in the order of congruent phobic displays, mixed displays with attention focus on the spider, mixed displays with focus on the bird and congruent neutral displays. These results challenge the notion that amygdala activation in response to briefly presented phobic cues is independent from attention.

Jumping Dynamics

DEFF Research Database (Denmark)

Sannino, Francesco

2013-01-01

paradigm the physical scale and henceforth also the massive spectrum of the theory jump at the lower boundary of the conformal window. In particular we propose that a theory can suddenly jump from a Quantum Chromodynamics type spectrum, at the lower boundary of the conformal window, to a conformal one...... without particle interpretation. The jumping scenario, therefore, does not support a near-conformal dynamics of walking type. We will also discuss the impact of jumping dynamics on the construction of models of dynamical electroweak symmetry breaking....

Characterization of a Gene Coding for the Complement System Component FB from Loxosceles laeta Spider Venom Glands.

Science.gov (United States)

Myamoto, Daniela Tiemi; Pidde-Queiroz, Giselle; Gonçalves-de-Andrade, Rute Maria; Pedroso, Aurélio; van den Berg, Carmen W; Tambourgi, Denise V

2016-01-01

The human complement system is composed of more than 30 proteins and many of these have conserved domains that allow tracing the phylogenetic evolution. The complement system seems to be initiated with the appearance of C3 and factor B (FB), the only components found in some protostomes and cnidarians, suggesting that the alternative pathway is the most ancient. Here, we present the characterization of an arachnid homologue of the human complement component FB from the spider Loxosceles laeta. This homologue, named Lox-FB, was identified from a total RNA L. laeta spider venom gland library and was amplified using RACE-PCR techniques and specific primers. Analysis of the deduced amino acid sequence and the domain structure showed significant similarity to the vertebrate and invertebrate FB/C2 family proteins. Lox-FB has a classical domain organization composed of a control complement protein domain (CCP), a von Willebrand Factor domain (vWFA), and a serine protease domain (SP). The amino acids involved in Mg2+ metal ion dependent adhesion site (MIDAS) found in the vWFA domain in the vertebrate C2/FB proteins are well conserved; however, the classic catalytic triad present in the serine protease domain is not conserved in Lox-FB. Similarity and phylogenetic analyses indicated that Lox-FB shares a major identity (43%) and has a close evolutionary relationship with the third isoform of FB-like protein (FB-3) from the jumping spider Hasarius adansoni belonging to the Family Salcitidae.

Characterization of a Gene Coding for the Complement System Component FB from Loxosceles laeta Spider Venom Glands.

Directory of Open Access Journals (Sweden)

Daniela Tiemi Myamoto

Full Text Available The human complement system is composed of more than 30 proteins and many of these have conserved domains that allow tracing the phylogenetic evolution. The complement system seems to be initiated with the appearance of C3 and factor B (FB, the only components found in some protostomes and cnidarians, suggesting that the alternative pathway is the most ancient. Here, we present the characterization of an arachnid homologue of the human complement component FB from the spider Loxosceles laeta. This homologue, named Lox-FB, was identified from a total RNA L. laeta spider venom gland library and was amplified using RACE-PCR techniques and specific primers. Analysis of the deduced amino acid sequence and the domain structure showed significant similarity to the vertebrate and invertebrate FB/C2 family proteins. Lox-FB has a classical domain organization composed of a control complement protein domain (CCP, a von Willebrand Factor domain (vWFA, and a serine protease domain (SP. The amino acids involved in Mg2+ metal ion dependent adhesion site (MIDAS found in the vWFA domain in the vertebrate C2/FB proteins are well conserved; however, the classic catalytic triad present in the serine protease domain is not conserved in Lox-FB. Similarity and phylogenetic analyses indicated that Lox-FB shares a major identity (43% and has a close evolutionary relationship with the third isoform of FB-like protein (FB-3 from the jumping spider Hasarius adansoni belonging to the Family Salcitidae.

A molecular phylogeny of the Australian huntsman spiders (Sparassidae, Deleninae): implications for taxonomy and social behaviour.

Science.gov (United States)

Agnarsson, Ingi; Rayor, Linda S

2013-12-01

Huntsman spiders (Sparassidae) are a diverse group with a worldwide distribution, yet are poorly known both taxonomically and phylogenetically. They are particularly diverse in Australia where an endemic lineage, Deleninae, has diversified to form nearly 100 species. One unusual species, Delena cancerides, has been believed to be the sole group-living sparassid. Unlike all of the other subsocial and social spiders which are capture-web based or live in silken tunnels, D. cancerides are non-web building spiders that live in large matrilineal colonies of a single adult female and her offspring from multiple clutches of under the bark of dead trees. Here we report the discovery of two additional prolonged subsocial sparassid species, currently in Eodelena but here formally proposed as a synonomy of Delena (new synonoymy), Delena (Eodelena) lapidicola and D. (E.) melanochelis. We briefly describe their social demographics, behavior, and habitat use. In order to understand the evolutionary relationships among these species, and thus origin of sociality and other traits in this group, we also offer the first molecular phylogeny of Deleninae and relatives. We employ model based phylogenetic analyses on two mtDNA and three nuDNA loci using maximum likelihood and Bayesian methods, including both 'classical' concatenation approach as well as coalescent-based analysis of species trees from gene trees. Our results support the hypothesis that the delenine huntsman spiders are a monophyletic Australian radiation, approximately 23 million year old, and indicate that the current ten genera should be merged to six genera in four clades. Our findings are inconsistent with some relatively recent changes in the taxonomy of Deleninae. The three known group-living delenine species are related and likely represent a single origin of sociality with a single reversal to solitary life-styles. Our results provide strong support for the classical Isopeda, but not for the recent splitting of

Drop Jumping as a Training Method for Jumping Ability

NARCIS (Netherlands)

Bobbert, Maarten F.

1990-01-01

Vertical jumping ability is of importance for good performance in sports such as basketball and volleyball. Coaches are in need of exercises that consume only little time and still help to improve their players’ jumping ability, without involving a high risk of injury. Drop jumping is assumed to

Uncovering the structure-function relationship in spider silk

Science.gov (United States)

Yarger, Jeffery L.; Cherry, Brian R.; van der Vaart, Arjan

2018-03-01

All spiders produce protein-based biopolymer fibres that we call silk. The most studied of these silks is spider dragline silk, which is very tough and relatively abundant compared with other types of spider silks. Considerable research has been devoted to understanding the relationship between the molecular structure and mechanical properties of spider dragline silks. In this Review, we overview experimental and computational studies that have provided a wealth of detail at the molecular level on the highly conserved repetitive core and terminal regions of spider dragline silk. We also discuss the role of the nanocrystalline β-sheets and amorphous regions in determining the properties of spider silk fibres, endowing them with strength and elasticity. Additionally, we outline imaging techniques and modelling studies that elucidate the importance of the hierarchical structure of silk fibres at the molecular level. These insights into structure-function relationships can guide the reverse engineering of spider silk to enable the production of superior synthetic fibres.

Time-dependent motor properties of multipedal molecular spiders.

Science.gov (United States)

Samii, Laleh; Blab, Gerhard A; Bromley, Elizabeth H C; Linke, Heiner; Curmi, Paul M G; Zuckermann, Martin J; Forde, Nancy R

2011-09-01

Molecular spiders are synthetic biomolecular walkers that use the asymmetry resulting from cleavage of their tracks to bias the direction of their stepping motion. Using Monte Carlo simulations that implement the Gillespie algorithm, we investigate the dependence of the biased motion of molecular spiders, along with binding time and processivity, on tunable experimental parameters, such as number of legs, span between the legs, and unbinding rate of a leg from a substrate site. We find that an increase in the number of legs increases the spiders' processivity and binding time but not their mean velocity. However, we can increase the mean velocity of spiders with simultaneous tuning of the span and the unbinding rate of a spider leg from a substrate site. To study the efficiency of molecular spiders, we introduce a time-dependent expression for the thermodynamic efficiency of a molecular motor, allowing us to account for the behavior of spider populations as a function of time. Based on this definition, we find that spiders exhibit transient motor function over time scales of many hours and have a maximum efficiency on the order of 1%, weak compared to other types of molecular motors.

Treating fossils as terminal taxa in divergence time estimation reveals ancient vicariance patterns in the palpimanoid spiders

DEFF Research Database (Denmark)

Wood, Hannah Marie; Matzke, Nicholas J.; Gillespie, Rosemary G.

2013-01-01

Incorporation of fossils into biogeographic studies can have a profound effect on the conclusions that result, particularly when fossil ranges are nonoverlapping with extant ranges. This is the case in archaeid spiders, where there are known fossils from the Northern Hemisphere, yet all living...... members are restricted to the Southern Hemisphere. To better understand the biogeographic patterns of archaeid spiders and their palpimanoid relatives, we estimate a dated phylogeny using a relaxed clock on a combined molecular and morphological data set. Dating information is compared with treating...

Cognitive bias in spider-phobic children: Comparison of a pictorial and a linguistic spider Stroop.

NARCIS (Netherlands)

Kindt, M.; Brosschot, J.F.

1999-01-01

Examined the relation between spider fear in children and cognitive processing bias toward threatening information. It was investigated whether spider fear in children is related to a cognitive bias for threatening pictures and words. Pictorial and linguistic Stroop stimuli were administered to 28

Gamma irradiation as a quarantine treatment for spider mites (Acarina: tetranychidae) in horticultural products

International Nuclear Information System (INIS)

Ignatowicz, S.; Banasik-Solgala, K.

1999-01-01

The carmine spider mite, Tetranychus cinnabarinus (Boisd.), and the two-spotted spider mite, Tetranychus urticae Koch, are closely related species of tetranychid mites (Acarina, Tetranychidae) that respond to gamma irradiation in a similar way. Eggs of both species exposed to gamma radiation early in embryonic development were considerably more susceptible to irradiation than older eggs. The tolerance of eggs to gamma radiation increased in 3-4-day-old eggs, when eye-spots were formed. Nymphs were more resistant to gamma radiation than eggs and larvae. Deteriorative effects of irradiation treatment were reflected in the immatures by their mortality in subsequent developmental stages. A positive relationship between dosage and the percent egg mortality or the mortality of subsequent stages was usually found when the immature stages were irradiated. The sex ratio of adults developed from irradiated eggs, larvae, and nymphs was affected by the irradiation treatment; the ratio was usually skewed towards males. Irradiation of females resulted in increased mortality, lowered fecundity, reduced egg viability, and sex ratio distortion in their progeny. Two-day-old females of the carmine spider mite and the two-spotted spider mite irradiated with 200 or 300 Gy lived as long as the controls. Mortality occurred after 3 weeks. The number of eggs laid by irradiated females of spider mites was considerably lower than in the control, and it decreased as the absorbed dose increased. The higher the dose of gamma radiation applied to adults of the spider mites (the parental generation, P), the higher the mortality of the F1 mites during their embryonic development. Viability of eggs laid by irradiated females of spider mites mated with irradiated males was significantly reduced. Young females treated with a dose of 0.2 kGy produced 40-50% nonviable eggs, while control mites produced only 6.0-6.6% nonviable eggs. A dose of 0.3 kGy caused high mortality of eggs; 88% and 97% nonviable

Dietary and prey-capture adaptations by which Zodarion germanicum, an ant-eating spider (Araneae: Zodariidae), specialises on the Formicinae

DEFF Research Database (Denmark)

Pekár, S.; Toft, Søren; Hrusková, M.

2008-01-01

There has been considerable recent interest in the biology of spiders that specialise on ants as prey, but previous studies have tended to envisage the level of adaptation as being to ants as a group. In this paper, we provide evidence that Zodarion germanicum is a spider that has dietary and venom...... adaptations by which it targets a particular subset of ants, the subfamily Formicinae. We reared spiders from first instar in the laboratory on three different diets: formicine ants only, myrmicine ants only and mixed (both formicine and myrmicine ants). Fitness-related life-history parameters were determined......, and we found that the spiders on the formicine-only diet lived longer and grew at a faster rate. Lipid, carbon and nitrogen compositions of ants were analysed, but we found no evidence of formicines differing from myrmicines in macro-nutrient content. This suggests that effects on longevity and growth...

Recent advances in the understanding of brown spider venoms: From the biology of spiders to the molecular mechanisms of toxins.

Science.gov (United States)

Gremski, Luiza Helena; Trevisan-Silva, Dilza; Ferrer, Valéria Pereira; Matsubara, Fernando Hitomi; Meissner, Gabriel Otto; Wille, Ana Carolina Martins; Vuitika, Larissa; Dias-Lopes, Camila; Ullah, Anwar; de Moraes, Fábio Rogério; Chávez-Olórtegui, Carlos; Barbaro, Katia Cristina; Murakami, Mario Tyago; Arni, Raghuvir Krishnaswamy; Senff-Ribeiro, Andrea; Chaim, Olga Meiri; Veiga, Silvio Sanches

2014-06-01

The Loxosceles genus spiders (the brown spiders) are encountered in all the continents, and the clinical manifestations following spider bites include skin necrosis with gravitational lesion spreading and occasional systemic manifestations, such as intravascular hemolysis, thrombocytopenia and acute renal failure. Brown spider venoms are complex mixtures of toxins especially enriched in three molecular families: the phospholipases D, astacin-like metalloproteases and Inhibitor Cystine Knot (ICK) peptides. Other toxins with low level of expression also present in the venom include the serine proteases, serine protease inhibitors, hyaluronidases, allergen factors and translationally controlled tumor protein (TCTP). The mechanisms by which the Loxosceles venoms act and exert their noxious effects are not fully understood. Except for the brown spider venom phospholipase D, which causes dermonecrosis, hemolysis, thrombocytopenia and renal failure, the pathological activities of the other venom toxins remain unclear. The objective of the present review is to provide insights into the brown spider venoms and loxoscelism based on recent results. These insights include the biology of brown spiders, the clinical features of loxoscelism and the diagnosis and therapy of brown spider bites. Regarding the brown spider venom, this review includes a description of the novel toxins revealed by molecular biology and proteomics techniques, the data regarding three-dimensional toxin structures, and the mechanism of action of these molecules. Finally, the biotechnological applications of the venom components, especially for those toxins reported as recombinant molecules, and the challenges for future study are discussed. Copyright © 2014 Elsevier Ltd. All rights reserved.

Volume de água armazenado no tanque de bromélias, em restingas da costa brasileira Water volume stored in bromeliad tanks in Brazilian restinga habitats

Directory of Open Access Journals (Sweden)

Luciana Cogliatti-Carvalho

2010-03-01

Full Text Available Muitas espécies de bromélias armazenam água da chuva em seu interior, sendo esta característica resultado da distribuição espiralada de suas folhas, que formam pequenos tanques. O objetivo deste estudo foi avaliar e comparar o volume de água efetivamente armazenado e o volume máximo que pode ser armazenado no tanque de diferentes espécies de bromélias de 13 restingas brasileiras. Em cada restinga, em 100 plots de 100 m² cada, registramos as espécies de bromélias-tanque, os parâmetros morfométricos e o volume efetivo e máximo em 20 indivíduos de cada espécie. Encontramos 32 espécies de bromélias-tanque, para as quais medimos o volume máximo e o volume efetivo de água armazenado. Em 59.007 rosetas, estimamos o volume máximo em 44.388 litros e medimos 17.000 litros de água efetivamente armazenados. Encontramos diferenças interespecíficas nos volumes máximo e efetivamente reservado de água, na biomassa, no número de folhas e no volume do cone da planta. Aechmea aquilega, A. blanchetiana e Hohenbergia castelanosii tiveram os maiores volumes efetivos. Somente A. nudicaulis e Billbergia amoena diferiram entre suas populações em todos os parâmetros analisados. As restingas de Maricá, Prado, Trancoso e Jurubatiba tiveram os maiores volumes de água.ha-1 armazenada nas bromélias-tanque. O volume máximo de água estimado para as bromélias-tanque variou entre espécies devido a diferenças na forma e no tamanho das bromélias.Many bromeliad species store rain water in tanks, as a result of the spiraled distribution of their leaves. The aim of this study was to evaluate how much water is stored and what is the maximum volume of water possible to be stored in different tank-bromeliad species in 13 different Brazilian restingas. The species were recorded in 100 plots of 100 m2, in each restinga habitat. For each bromeliad species, the effective and the maximum water stored in the tanks were measured. We found 32 tank-bromeliad

Specific leaf areas of the tank bromeliad Guzmania monostachia perform distinct functions in response to water shortage.

Science.gov (United States)

Freschi, Luciano; Takahashi, Cassia Ayumi; Cambui, Camila Aguetoni; Semprebom, Thais Ribeiro; Cruz, Aline Bertinatto; Mioto, Paulo Tamoso; de Melo Versieux, Leonardo; Calvente, Alice; Latansio-Aidar, Sabrina Ribeiro; Aidar, Marcos Pereira Marinho; Mercier, Helenice

2010-05-01

Leaves comprise most of the vegetative body of tank bromeliads and are usually subjected to strong longitudinal gradients. For instance, while the leaf base is in contact with the water accumulated in the tank, the more light-exposed middle and upper leaf sections have no direct access to this water reservoir. Therefore, the present study attempted to investigate whether different leaf portions of Guzmania monostachia, a tank-forming C(3)-CAM bromeliad, play distinct physiological roles in response to water shortage, which is a major abiotic constraint in the epiphytic habitat. Internal and external morphological features, relative water content, pigment composition and the degree of CAM expression were evaluated in basal, middle and apical leaf portions in order to allow the establishment of correlations between the structure and the functional importance of each leaf region. Results indicated that besides marked structural differences, a high level of functional specialization is also present along the leaves of this bromeliad. When the tank water was depleted, the abundant hydrenchyma of basal leaf portions was the main reservoir for maintaining a stable water status in the photosynthetic tissues of the apical region. In contrast, the CAM pathway was intensified specifically in the upper leaf section, which is in agreement with the presence of features more suitable for the occurrence of photosynthesis at this portion. Gas exchange data indicated that internal recycling of respiratory CO(2) accounted for virtually all nighttime acid accumulation, characterizing a typical CAM-idling pathway in the drought-exposed plants. Altogether, these data reveal a remarkable physiological complexity along the leaves of G. monostachia, which might be a key adaptation to the intermittent water supply of the epiphytic niche. Copyright 2009 Elsevier GmbH. All rights reserved.

Jump locations of jump-diffusion processes with state-dependent rates

International Nuclear Information System (INIS)

Miles, Christopher E; Keener, James P

2017-01-01

We propose a general framework for studying statistics of jump-diffusion systems driven by both Brownian noise (diffusion) and a jump process with state-dependent intensity. Of particular natural interest in many physical systems are the jump locations: the system evaluated at the jump times. As an example, this could be the voltage at which a neuron fires, or the so-called ‘threshold voltage’. However, the state-dependence of the jump rate provides direct coupling between the diffusion and jump components, making it difficult to disentangle the two to study individually. In this work, we provide an iterative map formulation of the sequence of distributions of jump locations. The distributions computed by this map can be used to elucidate other interesting quantities about the process, including statistics of the interjump times. Ultimately, the limit of the map reveals that knowledge of the stationary distribution of the full process is sufficient to recover (but not necessarily equal to) the distribution of jump locations. We propose two biophysical examples to illustrate the use of this framework to provide insight about a system. We find that a sharp threshold voltage emerges robustly in a simple stochastic integrate-and-fire neuronal model. The interplay between the two sources of noise is also investigated in a stepping model of molecular motor in intracellular transport pulling a diffusive cargo. (paper)

A Correction Equation for Jump Height Measured Using the Just Jump System.

Science.gov (United States)

McMahon, John J; Jones, Paul A; Comfort, Paul

2016-05-01

To determine the concurrent validity and reliability of the popular Just Jump system (JJS) for determining jump height and, if necessary, provide a correction equation for future reference. Eighteen male college athletes performed 3 bilateral countermovement jumps (CMJs) on 2 JJSs (alternative method) that were placed on top of a force platform (criterion method). Two JJSs were used to establish consistency between systems. Jump height was calculated from flight time obtained from the JJS and force platform. Intraclass correlation coefficients (ICCs) demonstrated excellent within-session reliability of the CMJ height measurement derived from both the JJS (ICC = .96, P jump height (0.46 ± 0.09 m vs 0.33 ± 0.08 m) than the force platform (P jump height = (0.8747 × alternative jump height) - 0.0666. The JJS provides a reliable but overestimated measure of jump height. It is suggested, therefore, that practitioners who use the JJS as part of future work apply the correction equation presented in this study to resultant jump-height values.

Maternal care and subsocial behaviour in spiders.

Science.gov (United States)

Yip, Eric C; Rayor, Linda S

2014-05-01

While most spiders are solitary and opportunistically cannibalistic, a variety of social organisations has evolved in a minority of spider species. One form of social organisation is subsociality, in which siblings remain together with their parent for some period of time but disperse prior to independent reproduction. We review the literature on subsocial and maternal behaviour in spiders to highlight areas in which subsocial spiders have informed our understanding of social evolution and to identify promising areas of future research. We show that subsocial behaviour has evolved independently at least 18 times in spiders, across a wide phylogenetic distribution. Subsocial behaviour is diverse in terms of the form of care provided by the mother, the duration of care and sibling association, the degree of interaction and cooperation among siblings, and the use of vibratory and chemical communication. Subsocial spiders are useful model organisms to study various topics in ecology, such as kin recognition and the evolution of cheating and its impact on societies. Further, why social behaviour evolved in some lineages and not others is currently a topic of debate in behavioural ecology, and we argue that spiders offer an opportunity to untangle the ecological causes of parental care, which forms the basis of many other animal societies. © 2013 The Authors. Biological Reviews © 2013 Cambridge Philosophical Society.

Checklist of spider fauna of FR Peshawar, FATA, Pakistan

Directory of Open Access Journals (Sweden)

F. Perveen

2012-03-01

Full Text Available The spiders are known as poisonous arthropods, but they also act as the predator or biological pests control agent. Their 23 species belonging to 15 genera and 09 families were reported during 2009-2010 from FR Peshawar, FATA, Pakistan. The reported families Clubionidae, Scytodidae and Sprassidae covered each 4%, Araneidae, Gnaphosidae, Pholicidae and Salticidae each 9%, Thomisidae 13% and Lycosidae 43% biodiversity of spiders of FATA. However, the largest spider collected was huntsman, Isopoda tuhodnigra (Barrion with total body length 15.80+-0.83 mm. Moreover, the smallest spider was wolf spider, Pardosa birmanica (Simon with total body length 4.20+-1.30 mm. Further, the crab spiders, Thomisus pugilis (Stoliczka, T. spectabilis (Doleschall and Diaea evanida (Thorell were the most colorful species belonging to family Thomisidae. A detail study is required for further exploration of spider fauna of FATA.

Inbreeding avoidance in spiders: evidence for rescue effect in fecundity of female spiders with outbreeding opportunity

DEFF Research Database (Denmark)

Bilde, T.; Maklakov, A.A.; Schilling, Nadia

2007-01-01

avoidance can be because of low risk of inbreeding, variation in tolerance to inbreeding or high costs of outbreeding. We examined the relationship between inbreeding depression and inbreeding avoidance adaptations under two levels of inbreeding in the spider Oedothorax apicatus, asking whether preference...... for unrelated sperm via pre- and/or post-copulatory mechanisms could restore female fitness when inbreeding depression increases. Using inbred isofemale lines we provided female spiders with one or two male spiders of different relatedness in five combinations: one male sib; one male nonsib; two male sibs; two...

Understanding Spider-Man: Your Everyday Superhero

OpenAIRE

Falk, Nicklas; Blomsterberg, Sofie Amalie; Suciu, Alice Sabrina; Pedersen, Mads Peter; Lucas, Vilhelm

2014-01-01

This project focuses on the understanding of Spider-Man, and the morals and ethics that lie behind the choices he makes. Through the Dimensions Philosophy & Science/Text & Sign, this understanding is concluded by looking at ethical theories and comic book analysis. Based on the Ultimate Spider-Man comic book series, the aim is to clarify who Spider-Man is and what causes him to act in certain ways; before and after his realization of power. Some theories used to investigate these area...

Risk, Jumps, and Diversification

DEFF Research Database (Denmark)

Bollerslev, Tim; Law, Tzuo Hann; Tauchen, George

We test for price discontinuities, or jumps, in a panel of high-frequency intraday returns for forty large-cap stocks and an equiweighted index from these same stocks. Jumps are naturally classified into two types: common and idiosyncratic. Common jumps affect all stocks, albeit to varying degrees......, while idiosyncratic jumps are stock-specific. Despite the fact that each of the stocks has a of about unity with respect to the index, common jumps are virtually never detected in the individual stocks. This is truly puzzling, as an index can jump only if one or more of its components jump. To resolve...... this puzzle, we propose a new test for cojumps. Using this new test we find strong evidence for many modest-sized common jumps that simply pass through the standard jump detection statistic, while they appear highly significant in the cross section based on the new cojump identification scheme. Our results...

Representation of Patients' Hand Modulates Fear Reactions of Patients with Spider Phobia in Virtual Reality.

Science.gov (United States)

Peperkorn, Henrik M; Diemer, Julia E; Alpers, Georg W; Mühlberger, Andreas

2016-01-01

Embodiment (i.e., the involvement of a bodily representation) is thought to be relevant in emotional experiences. Virtual reality (VR) is a capable means of activating phobic fear in patients. The representation of the patient's body (e.g., the right hand) in VR enhances immersion and increases presence, but its effect on phobic fear is still unknown. We analyzed the influence of the presentation of the participant's hand in VR on presence and fear responses in 32 women with spider phobia and 32 matched controls. Participants sat in front of a table with an acrylic glass container within reaching distance. During the experiment this setup was concealed by a head-mounted display (HMD). The VR scenario presented via HMD showed the same setup, i.e., a table with an acrylic glass container. Participants were randomly assigned to one of two experimental groups. In one group, fear responses were triggered by fear-relevant visual input in VR (virtual spider in the virtual acrylic glass container), while information about a real but unseen neutral control animal (living snake in the acrylic glass container) was given. The second group received fear-relevant information of the real but unseen situation (living spider in the acrylic glass container), but visual input was kept neutral VR (virtual snake in the virtual acrylic glass container). Participants were instructed to touch the acrylic glass container with their right hand in 20 consecutive trials. Visibility of the hand was varied randomly in a within-subjects design. We found for all participants that visibility of the participant's hand increased presence independently of the fear trigger. However, in patients, the influence of the virtual hand on fear depended on the fear trigger. When fear was triggered perceptually, i.e., by a virtual spider, the virtual hand increased fear. When fear was triggered by information about a real spider, the virtual hand had no effect on fear. Our results shed light on the

Kinematics and Kinetics of Squats, Drop Jumps and Imitation Jumps of Ski Jumpers

Science.gov (United States)

Pauli, Carole A.; Keller, Melanie; Ammann, Fabian; Hübner, Klaus; Lindorfer, Julia; Taylor, William R.

2016-01-01

Abstract Pauli, CA, Keller, M, Ammann, F, Hübner, K, Lindorfer, J, Taylor, WR, and Lorenzetti, S. Kinematics and kinetics of squats, drop jumps and imitation jumps of ski jumpers. J Strength Cond Res 30(3): 643–652, 2016—Squats, drop jumps, and imitation jumps are commonly used training exercises in ski jumping to enhance maximum force, explosive force, and sport-specific skills. The purpose of this study was to evaluate the kinetics and kinematics of training exercises in ski jumping and to find objective parameters in training exercises that most correlate with the competition performance of ski jumpers. To this end, barbell squats, drop jumps, and imitation jumps were measured in a laboratory environment for 10 elite ski jumpers. Force and motion data were captured, and the influence of maximum vertical force, force difference, vertical take-off velocity, knee moments, knee joint power, and a knee valgus/varus index was evaluated and correlated with their season jump performance. The results indicate that, especially for the imitation jumps, a good correlation exists between the vertical take-off velocity and the personal jump performance on the hill (R = 0.718). Importantly, however, the more the athletes tended toward a valgus knee alignment during the measured movements, the worse their performance (R = 0.729 imitation jumps; R = 0.685 squats). Although an evaluation of the athletes' lower limb alignment during competitive jumping on the hill is still required, these preliminary data suggest that performance training should additionally concentrate on improving knee alignment to increase ski jumping performance. PMID:26418370

Freyinae, a major new subfamily of Neotropical jumping spiders (Araneae: Salticidae).

Science.gov (United States)

Edwards, G B

2015-11-02

Freyinae, new subfamily, is described for a group of genera of Neotropical jumping spiders that can be distinguished from other non-ant mimic salticoid Neotropical salticids by having the following three morphological features: a slightly more elongate carapace, a distinctive prolateral tibial macrosetae arrangement (medially placed subdistal and subproximal macrosetae, with a subdorsal medial macroseta in some males), and an unusual dorsoventrally thick tegulum basal division (although one or two of these features are sometimes lost). It includes 20 genera previously considered valid, of which 19 are retained: Akela Peckham & Peckham, 1896, Aphirape C.L. Koch, 1850, Asaracus C.L. Koch, 1846, Capidava Simon, 1902, Chira Peckham & Peckham, 1896, Edilemma Ruiz & Brescovit, 2006, Eustiromastix Simon, 1902, Freya C.L. Koch, 1850, Frigga C.L. Koch, 1850, Kalcerrytus Galiano, 2000, Nycerella Galiano, 1982, Onofre Ruiz & Brescovit, 2007, Pachomius Peckham & Peckham, 1896, Phiale C.L. Koch, 1846, Rishaschia Makhan, 2006, Sumampattus Galiano, 1983, Trydarssus Galiano, 1995, Tullgrenella Mello‑Leitão, 1941, and Wedoquella Galiano, 1984. Romitia Caporiacco, 1947 (and its synonym Uspachus Galiano, 1995) is synonymized with Pachomius, new synonymy. New genera described in the subfamily are: Drizztius, Leptofreya, Megafreya, Philira, Tarkas, Triggella, and Xanthofreya. The following nomenclatorial changes are made: New synonyms: Freya demarcata Chamberlin & Ivie, 1936 = Freya (sub Cyrene) albosignata (F.O.P.-Cambridge, 1901); Freya (sub Cyrene) grisea (F.O.P.-Cambridge, 1901) = Freya (sub Cyrene) infuscata (F.O.P.-Cambridge, 1901); Freya (sub Cyrene) emarginata (F.O.P.-Cambridge, 1901) and Nycerella (sub Heraclea) sanguinea paradoxa (Peckham & Peckham, 1896) = Nycerella (sub Heraclea) sanguinea (Peckham & Peckham, 1896); Pachomius (sub Phiale) maculosus (Chickering, 1946) = Phiale (sub Cyrene) bilobata (F.O.P.-Cambridge, 1901); Phiale (sub Cyrene) mediocava (F

Radial arrangement of Janus-like setae permits friction control in spiders.

Science.gov (United States)

Wolff, Jonas O; Gorb, Stanislav N

2013-01-01

Dynamic attachment is the key to move on steep surfaces, with mechanisms being still not well understood. The hunting spider Cupiennius salei (Arachnida, Ctenidae) possesses hairy attachment pads (claw tufts) at its distal legs, consisting of directional branched setae. The morphological investigation revealed that adhesive setae are arranged in a radial manner within the distal tarsus. Friction of claw tufts on smooth glass was measured to reveal the functional effect of seta arrangement within the pad. Measurements revealed frictional anisotropy in both longitudinal and transversal directions. Contact behaviour of adhesive setae was investigated in a reflection interference contrast microscope (RICM). Observations on living spiders showed, that only a small part of the hairy pads is in contact at the same time. Thus the direction of frictional forces is depending on leg placement and rotation. This may aid controlling the attachment to the substrate.

Why is countermovement jump height greater than squat jump height?

NARCIS (Netherlands)

Bobbert, Maarten F.; Gerritsen, Karin G M; Litjens, Maria C A; Van Soest, Arthur J.

1996-01-01

In the literature, it is well established that subjects are able to jump higher in a countermovement jump (CMJ) than in a squat jump (SJ). The purpose of this study was to estimate the relative contribution of the time available for force development and the storage and reutilization of elastic

Kinematics and Kinetics of Squats, Drop Jumps and Imitation Jumps of Ski Jumpers.

Science.gov (United States)

Pauli, Carole A; Keller, Melanie; Ammann, Fabian; Hübner, Klaus; Lindorfer, Julia; Taylor, William R; Lorenzetti, Silvio

2016-03-01

Squats, drop jumps, and imitation jumps are commonly used training exercises in ski jumping to enhance maximum force, explosive force, and sport-specific skills. The purpose of this study was to evaluate the kinetics and kinematics of training exercises in ski jumping and to find objective parameters in training exercises that most correlate with the competition performance of ski jumpers. To this end, barbell squats, drop jumps, and imitation jumps were measured in a laboratory environment for 10 elite ski jumpers. Force and motion data were captured, and the influence of maximum vertical force, force difference, vertical take-off velocity, knee moments, knee joint power, and a knee valgus/varus index was evaluated and correlated with their season jump performance. The results indicate that, especially for the imitation jumps, a good correlation exists between the vertical take-off velocity and the personal jump performance on the hill (R = 0.718). Importantly, however, the more the athletes tended toward a valgus knee alignment during the measured movements, the worse their performance (R = 0.729 imitation jumps; R = 0.685 squats). Although an evaluation of the athletes' lower limb alignment during competitive jumping on the hill is still required, these preliminary data suggest that performance training should additionally concentrate on improving knee alignment to increase ski jumping performance.

Learned predation risk management by spider mites

Directory of Open Access Journals (Sweden)

Thomas eHackl

2014-09-01

Full Text Available Predation is a prime selective force shaping prey behavior. Investment in anti-predator behavior is traded-off against time and energy for other fitness-enhancing activities such as foraging or reproduction. To optimize this benefit/cost trade-off, prey should be able to innately and/or by experience modulate their behavior to the level of predation risk. Here, we assessed learned predation risk management in the herbivorous two-spotted spider mite Tetranychus urticae. We exposed spider mites coming from benign (naïve or high immediate predation risk (experienced environments to latent and/or no risk and assessed their site choice, activity and oviposition. Benign environments were characterized by the absence of any predator cues, high immediate risk environments by killed spider mites, physical presence of the predatory mite Phytoseiulus persimilis and associated chemosensory traces left on the surface, and latent risk environments by only predator traces. In the no-choice experiment both naïve and experienced spider mites laid their first egg later on leaves with than without predator traces. Irrespective of predator traces presence/absence, experienced mites laid their first egg earlier than naïve ones did. Naïve spider mites were more active, indicating higher restlessness, and laid fewer eggs on leaves with predator traces, whereas experienced mites were less active and laid similar numbers of eggs on leaves with and without predator traces. In the choice experiment both naïve and experienced spider mites preferentially resided and oviposited on leaves without predator traces but experienced mites were less active than naïve ones. Overall, our study suggests that spider mites experienced with high predation risk behave bolder under latent risk than naïve spider mites. Since predator traces alone do not indicate immediate risk, we argue that the attenuated anti-predator response of experienced spider mites represents adaptive learned

Active signal conduction through the sensory dendrite of a spider mechanoreceptor neuron.

Science.gov (United States)

Gingl, Ewald; French, Andrew S

2003-07-09

Rapid responses to sensory stimulation are crucial for survival. This must be especially true for mechanical stimuli containing temporal information, such as vibration. Sensory transduction occurs at the tips of relatively long sensory dendrites in many mechanoreceptors of both vertebrates and invertebrates, but little is known about the electrical properties of these crucial links between transduction and action potential generation. The VS-3 slit-sense organ of the spider Cupiennius salei contains bipolar mechanosensory neurons that allow voltage-clamp recording from the somata, whereas mechanotransduction occurs at the tips of 100- to 200-microm-long sensory dendrites. We studied the properties of VS-3 sensory dendrites using three approaches. Voltage-jump experiments measured the spread of voltage outward from the soma by observing total mechanically transduced charge recovered at the soma as a function of time after a voltage jump. Frequency-response measurements between pseudorandom mechanical stimulation and somatic membrane potential estimated the passive cable properties of the dendrite for voltage spread in the opposite direction. Both of these sets of data indicated that the dendritic cable would significantly attenuate and retard a passively propagated receptor potential. Finally, current-clamp observations of receptor potentials and action potentials indicated that action potentials normally start at the distal dendrites and propagate regeneratively to the soma, reducing the temporal delay of passive conduction.

Prey interception drives web invasion and spider size determines successful web takeover in nocturnal orb-web spiders.

Science.gov (United States)

Gan, Wenjin; Liu, Shengjie; Yang, Xiaodong; Li, Daiqin; Lei, Chaoliang

2015-09-24

A striking feature of web-building spiders is the use of silk to make webs, mainly for prey capture. However, building a web is energetically expensive and increases the risk of predation. To reduce such costs and still have access to abundant prey, some web-building spiders have evolved web invasion behaviour. In general, no consistent patterns of web invasion have emerged and the factors determining web invasion remain largely unexplored. Here we report web invasion among conspecifics in seven nocturnal species of orb-web spiders, and examined the factors determining the probability of webs that could be invaded and taken over by conspecifics. About 36% of webs were invaded by conspecifics, and 25% of invaded webs were taken over by the invaders. A web that was built higher and intercepted more prey was more likely to be invaded. Once a web was invaded, the smaller the size of the resident spider, the more likely its web would be taken over by the invader. This study suggests that web invasion, as a possible way of reducing costs, may be widespread in nocturnal orb-web spiders. © 2015. Published by The Company of Biologists Ltd.

Prey interception drives web invasion and spider size determines successful web takeover in nocturnal orb-web spiders

Directory of Open Access Journals (Sweden)

Wenjin Gan

2015-10-01

Full Text Available A striking feature of web-building spiders is the use of silk to make webs, mainly for prey capture. However, building a web is energetically expensive and increases the risk of predation. To reduce such costs and still have access to abundant prey, some web-building spiders have evolved web invasion behaviour. In general, no consistent patterns of web invasion have emerged and the factors determining web invasion remain largely unexplored. Here we report web invasion among conspecifics in seven nocturnal species of orb-web spiders, and examined the factors determining the probability of webs that could be invaded and taken over by conspecifics. About 36% of webs were invaded by conspecifics, and 25% of invaded webs were taken over by the invaders. A web that was built higher and intercepted more prey was more likely to be invaded. Once a web was invaded, the smaller the size of the resident spider, the more likely its web would be taken over by the invader. This study suggests that web invasion, as a possible way of reducing costs, may be widespread in nocturnal orb-web spiders.

First report of clinical presentation of a bite by a running spider, Philodromus sp. (Araneae: Philodromidae), with recommendations for spider bite management.

Science.gov (United States)

Coetzee, Maureen; Dippenaar, Ansie; Frean, John; Hunt, Richard H

2017-06-30

This article describes the clinical progression of symptoms over a period of 5 days of a bite inflicted by a Philodromus sp. spider. Commonly known as 'running spiders', these are not considered to be harmful to humans. This report, however, is the first description of an actual bite by a member of this group of spiders showing cytotoxic envenomation. Management of the bites should be as recommended for other cytotoxic spider bites.

Biomechanics of Spider Silks

Science.gov (United States)

2006-03-02

water and deformation conditions. Such fibres [Nexia ’ biosteel ’ silk ] were spun from recombinant silk ’cloned’ from Spidroin II and indeed show 67...SUBTITLE 5. FUNDING NUMBERS Biomechanics of Spider Silks F49620-03-1-0111 6. AUTHOR(S) Fritz Vollrath 7. PERFORMING ORGANIZATION NAME(S) AND ADDRESS(ES...Perform Pro, WHSIDIOR, Oct 94 COVER SHEET FINAL (3rd Year) Report to AFOSR on: BIOMECHANICS OF SPIDER SILKS Fritz Vollrath, Oxford University, England

Sex-specific kleptoparasitic foraging in ant-eating spiders

DEFF Research Database (Denmark)

Martisová, Martina; Bilde, T.; Pekar, Stano

2009-01-01

. To investigate this hypothesis, we studied the effect of sex and life history stage on the frequency of kleptoparasitism in ant-eating spiders of the genus Zodarion in the field. These spiders use a special capture technique involving a quick attack on an ant that is left unguarded by spiders for several minutes......, providing ample opportunities for kleptoparasitism. We found that adult females consistently hunted actively, while adult males ceased active prey capture and instead engaged in kleptoparasitism. Juvenile spiders were active hunters irrespective of sex. Consistent with an ontogenetic shift in foraging...

Specific predictive power of automatic spider-related affective associations for controllable and uncontrollable fear responses toward spiders

NARCIS (Netherlands)

Huijdlng, J; de Jong, PJ; Huijding, J.

This study examined the predictive power of automatically activated spider-related affective associations for automatic and controllable fear responses. The Extrinsic Affective Simon Task (EAST; De Houwer, 2003) was used to indirectly assess automatic spider fear-related associations. The EAST and

Environmentally transmitted parasites: Host-jumping in a heterogeneous environment.

Science.gov (United States)

Caraco, Thomas; Cizauskas, Carrie A; Wang, Ing-Nang

2016-05-21

Groups of chronically infected reservoir-hosts contaminate resource patches by shedding a parasite׳s free-living stage. Novel-host groups visit the same patches, where they are exposed to infection. We treat arrival at patches, levels of parasite deposition, and infection of the novel host as stochastic processes, and derive the expected time elapsing until a host-jump (initial infection of a novel host) occurs. At stationarity, mean parasite densities are independent of reservoir-host group size. But within-patch parasite-density variances increase with reservoir group size. The probability of infecting a novel host declines with parasite-density variance; consequently larger reservoir groups extend the mean waiting time for host-jumping. Larger novel-host groups increase the probability of a host-jump during any single patch visit, but also reduce the total number of visits per unit time. Interaction of these effects implies that the waiting time for the first infection increases with the novel-host group size. If the reservoir-host uses resource patches in any non-uniform manner, reduced spatial overlap between host species increases the waiting time for host-jumping. Copyright © 2016 Elsevier Ltd. All rights reserved.

Psychophysiological response in parachute jumps, the effect of experience and type of jump.

Science.gov (United States)

Clemente-Suárez, Vicente Javier; Robles-Pérez, José Juan; Fernández-Lucas, Jesús

2017-10-01

We aimed to analyse the effect of experience and type of parachute jump on the psychophysiological responses of jumpers. We analysed blood oxygen saturation, heart rate, blood glucose, lactate and creatinkinase, leg strength, isometric hand strength, cortical arousal, specific fine motor skills, self-confidence and cognition, and somatic and state anxiety, before and after four different parachute jumps: a sport parachute jump, a manual tactical parachute jump, tandem pilots, and tandem passengers. Independently of the parachute jump, the psychophysiological responses of experienced paratroopers were not affected by the jumps, except for an increase in anaerobic metabolism. Novice parachute jumpers presented a higher psychophysiological stress response than the experienced jumpers, together with a large anticipatory anxiety response before the jump; however, this decreased after the jump, although the high physiological activation was maintained. This information could be used by civil and military paratroopers' instructors to improve their training programmes. Copyright © 2017 Elsevier Inc. All rights reserved.

Ein Beitrag zur Springspinnenfauna der Balearen mit dem Erstnachweis von Heliophanus stylifer für Europa (Araneae, Salticidae)

OpenAIRE

Schäfer, Michael

2015-01-01

A female of the jumping spider Heliophanus stylifer Simon, 1878 was found in the s’Albufera natural park on the Balearic Island of Mallorca (Spain). This species is new to Europe. Seven additional jumping spider species were recorded, including the first records of Heliophanus apiatus, Icius hamatus and Menemerus taeniatus for the Balearic Islands.

Spiders (Araneae of stony debris in North Bohemia

Directory of Open Access Journals (Sweden)

Růžička, Vlastimil

1996-12-01

Full Text Available The arachnofauna was studied at five stony debris sites in northern Bohemia. In Central Europe, the northern and montane species inhabiting cold places live not only on mountain tops and peat bogs but also on the lower edges of boulder debris, where air streaming through the system of inner compartments gives rise to an exceedingly cold microclimate. At such cold sites, spiders can live either on bare stones (Bathyphantes simillimus, Wubanoides uralensis, or in the rich layers of moss and lichen (Diplocentria bidentata. Kratochviliella bicapitata exhibits a diplostenoecious occurence in stony debris and on the tree bark. Latithorax faustus and Theonoe minutissima display diplostenoecious occurence in stony debris and on peat bogs. The occurence of the species Scotina celans in the Czech Republic was documented for the first time.

The effect of assisted jumping on vertical jump height in high-performance volleyball players.

Science.gov (United States)

Sheppard, Jeremy M; Dingley, Andrew A; Janssen, Ina; Spratford, Wayne; Chapman, Dale W; Newton, Robert U

2011-01-01

Assisted jumping may be useful in training higher concentric movement speed in jumping, thereby potentially increasing the jumping abilities of athletes. The purpose of this study was to evaluate the effects of assisted jump training on counter-movement vertical jump (CMVJ) and spike jump (SPJ) ability in a group of elite male volleyball players. Seven junior national team volleyball players (18.0±1.0 yrs, 200.4±6.7 cm, and 84.0±7.2 kg) participated in this within-subjects cross-over counter-balanced training study. Assisted training involved 3 sessions per week of CMVJ training with 10 kg of assistance, applied through use of a bungee system, whilst normal jump training involved equated volume of unassisted counter-movement vertical jumps. Training periods were 5 weeks duration, with a 3-week wash-out separating them. Prior to and at the conclusion of each training period jump testing for CMVJ and SPJ height was conducted. Assisted jump training resulted in gains of 2.7±0.7 cm (pSports Medicine Australia. All rights reserved.

Jumping in Arithmetic

NARCIS (Netherlands)

Visser, Albert

In this paper we study a new relation between sentences: the jump relation. The idea of the jump relation is based on an analysis of Feferman's Theorem that the inconsistency of a theory U is interpretable over U. The jump relation is based on a converse of Feferman's Theorem: if a sentence is

Jumping in Arithmetic

NARCIS (Netherlands)

Visser, Albert

2014-01-01

In this paper we study a new relation between sentences: the jump relation. The idea of the jump relation is based on an analysis of Feferman's Theorem that the inconsistency of a theory U is interpretable over U. The jump relation is based on a converse of Feferman's Theorem: if a sentence is

[Transcatheter embolization for huge pulmonary arteriovenous fistula using metallic "spider" and spring embolus--application of hand-made metallic "spider" using partial monorail technique].

Science.gov (United States)

Hirota, S; Sako, M; Fujita, Y; Hasegawa, Y; Sugimoto, K; Suzuki, Y; Kono, M

1992-07-25

We performed transcatheter embolization in two cases with huge pulmonary arteriovenous fistula (AVF) using a metallic "spider" and spring embolus. Conventional spring embolus or detachable balloon could not be used in these cases. Metallic spider was indicated for pulmonary AVF with a feeding artery diameter of more than 16 mm to prevent embolus passing through the AVF. In the first case, we used large handmade metallic spiders of 25 mm in diameter followed by embolization by numerous spring coils. At that time, a partial monorail technique was newly devised to carry the large metallic spider into the feeding artery, otherwise the spider could not pass into a 9F catheter. After embolization, symptoms and PaO2 in arterial blood improved remarkably in both cases. In the second case, a spring coil migrated into the normal pulmonary artery, but no infarction resulted. In conclusion, the metallic spider was very useful for embolization of hugee pulmonary AVF to avoid the embolus passing through and to tangle spring coils together with it. If commercially available "spiders" are too small, ones can be made easily.

Second-order nonlinear optical microscopy of spider silk

Science.gov (United States)

Zhao, Yue; Hien, Khuat Thi Thu; Mizutani, Goro; Rutt, Harvey N.

2017-06-01

Asymmetric β-sheet protein structures in spider silk should induce nonlinear optical interaction such as second harmonic generation (SHG) which is experimentally observed for a radial line and dragline spider silk using an imaging femtosecond laser SHG microscope. By comparing different spider silks, we found that the SHG signal correlates with the existence of the protein β-sheets. Measurements of the polarization dependence of SHG from the dragline indicated that the β-sheet has a nonlinear response depending on the direction of the incident electric field. We propose a model of what orientation the β-sheet takes in spider silk.

The reliability of vertical jump tests between the Vertec and My Jump phone application.

Science.gov (United States)

Yingling, Vanessa R; Castro, Dimitri A; Duong, Justin T; Malpartida, Fiorella J; Usher, Justin R; O, Jenny

2018-01-01

The vertical jump is used to estimate sports performance capabilities and physical fitness in children, elderly, non-athletic and injured individuals. Different jump techniques and measurement tools are available to assess vertical jump height and peak power; however, their use is limited by access to laboratory settings, excessive cost and/or time constraints thus making these tools oftentimes unsuitable for field assessment. A popular field test uses the Vertec and the Sargent vertical jump with countermovement; however, new low cost, easy to use tools are becoming available, including the My Jump iOS mobile application (app). The purpose of this study was to assess the reliability of the My Jump relative to values obtained by the Vertec for the Sargent stand and reach vertical jump (VJ) test. One hundred and thirty-five healthy participants aged 18-39 years (94 males, 41 females) completed three maximal Sargent VJ with countermovement that were simultaneously measured using the Vertec and the My Jump . Jump heights were quantified for each jump and peak power was calculated using the Sayers equation. Four separate ICC estimates and their 95% confidence intervals were used to assess reliability. Two analyses (with jump height and calculated peak power as the dependent variables, respectively) were based on a single rater, consistency, two-way mixed-effects model, while two others (with jump height and calculated peak power as the dependent variables, respectively) were based on a single rater, absolute agreement, two-way mixed-effects model. Moderate to excellent reliability relative to the degree of consistency between the Vertec and My Jump values was found for jump height (ICC = 0.813; 95% CI [0.747-0.863]) and calculated peak power (ICC = 0.926; 95% CI [0.897-0.947]). However, poor to good reliability relative to absolute agreement for VJ height (ICC = 0.665; 95% CI [0.050-0.859]) and poor to excellent reliability relative to absolute agreement for peak power

Tangled in a sparse spider web

DEFF Research Database (Denmark)

Dimitrov, Dimitar Stefanov; Lopardo, Lara; Giribet, Gonzalo

2012-01-01

In order to study the tempo and the mode of spider orb web evolution and diversification, we conducted a phylogenetic analysis using six genetic markers along with a comprehensive taxon sample. The present analyses are the first to recover the monophyly of orb-weaving spiders based solely on DNA ...

Sclerotherapy of Varicose Veins and Spider Veins

Science.gov (United States)

... Index A-Z Sclerotherapy of Varicose Veins and Spider Veins Sclerotherapy uses injections from a very fine, ... Sclerotherapy? What is Sclerotherapy of Varicose Veins and Spider Veins? Sclerotherapy is a minimally invasive treatment used ...

Assassin bug uses aggressive mimicry to lure spider prey.

Science.gov (United States)

Wignall, Anne E; Taylor, Phillip W

2011-05-07

Assassin bugs (Stenolemus bituberus) hunt web-building spiders by invading the web and plucking the silk to generate vibrations that lure the resident spider into striking range. To test whether vibrations generated by bugs aggressively mimic the vibrations generated by insect prey, we compared the responses of spiders to bugs with how they responded to prey, courting male spiders and leaves falling into the web. We also analysed the associated vibrations. Similar spider orientation and approach behaviours were observed in response to vibrations from bugs and prey, whereas different behaviours were observed in response to vibrations from male spiders and leaves. Peak frequency and duration of vibrations generated by bugs were similar to those generated by prey and courting males. Further, vibrations from bugs had a temporal structure and amplitude that were similar to vibrations generated by leg and body movements of prey and distinctly different to vibrations from courting males or leaves, or prey beating their wings. To be an effective predator, bugs do not need to mimic the full range of prey vibrations. Instead bugs are general mimics of a subset of prey vibrations that fall within the range of vibrations classified by spiders as 'prey'.

Usefulness of the jump-and-reach test in assessment of vertical jump performance.

Science.gov (United States)

Menzel, Hans-Joachim; Chagas, Mauro H; Szmuchrowski, Leszek A; Araujo, Silvia R; Campos, Carlos E; Giannetti, Marcus R

2010-02-01

The objective was to estimate the reliability and criterion-related validity of the Jump-and-Reach Test for the assessment of squat, countermovement, and drop jump performance of 32 male Brazilian professional volleyball players. Performance of squat, countermovement, and drop jumps with different dropping heights was assessed on the Jump-and-Reach Test and the measurement of flight time, then compared across different jump trials. The very high reliability coefficients of both assessment methods and the lower correlation coefficients between scores on the assessments indicate a very high consistency of each method but only moderate covariation, which means that they measure partly different items. As a consequence, the Jump-and-Reach Test has good ecological validity in situations when reaching height during the flight phase is critical for performance (e.g., basketball and volleyball) but only limited accuracy for the assessment of vertical impulse production with different jump techniques and conditions.

SPIDER: CMB Polarimetry from the Edge of Space

Energy Technology Data Exchange (ETDEWEB)

Gualtieri, R.; et al.

2017-11-28

SPIDER is a balloon-borne instrument designed to map the polarization of the millimeter-wave sky at large angular scales. SPIDER targets the B-mode signature of primordial gravitational waves in the cosmic microwave background (CMB), with a focus on mapping a large sky area with high fidelity at multiple frequencies. SPIDER's first longduration balloon (LDB) flight in January 2015 deployed a total of 2400 antenna-coupled Transition Edge Sensors (TESs) at 90 GHz and 150 GHz. In this work we review the design and in-flight performance of the SPIDER instrument, with a particular focus on the measured performance of the detectors and instrument in a space-like loading and radiation environment. SPIDER's second flight in December 2018 will incorporate payload upgrades and new receivers to map the sky at 285 GHz, providing valuable information for cleaning polarized dust emission from CMB maps.

Aedes albopictus em bromélias de solo em Ilhabela, litoral do Estado de São Paulo Aedes albopictus in soil bromeliads in Ilhabela, coastal area of Southeastern Brazil

Directory of Open Access Journals (Sweden)

Gisela R A M Marques

2005-08-01

Full Text Available OBJETIVO: Analisar a presença de Aedes albopictus em bromélias de solo localizadas em ambientes ecologicamente distintos, em termos de positividade, densidade e volume de água. MÉTODOS: O estudo foi realizado no município de Ilhabela, litoral norte do Estado de São Paulo. Realizaram-se coletas quinzenais, de março de 1998 a julho de 1999, em tanques de bromélias localizadas nos ambientes urbano, periurbano e mata; o conteúdo aquático das plantas foi medido e registrado. O tratamento dos dados baseou-se na análise da freqüência de bromélias com presença de Ae. albopictus (ANOVA, abundância (Kruskal-Wallis e volume de água das bromélias positivas (Teste t de Student. RESULTADOS: A presença e a densidade de Ae. albopictus em bromélias de solo variou com o tipo de ambiente. Os maiores percentuais de positividade (85% e abundância (81% foram observados nas plantas localizadas em ambiente urbano. Constatou-se ainda preferência dos mosquitos pelas bromélias com maiores volumes de água (média de 300 ml. CONCLUSÕES: As diferentes freqüências com que Ae. albopictus foi registrado nos ambientes e suas respectivas densidades mostraram sua capacidade de invasão a novos habitats. Recomenda-se intensificar a vigilância entomológica nessas plantas, dada a sua capacidade em traduzir-se em criadouros permanentes. A presença desse mosquito de importância médica em bromélias em área preservada da Mata Atlântica poderá resultar em agravo à saúde.OBJECTIVE: To analyze the presence of Aedes albopictus in soil bromeliads in ecologically distinct environments in terms of positivity, density and volume of water. METHODS: The study was carried out in the municipality of Ilhabela, North coast of the state of São Paulo, Brazil. Collections were fortnightly performed between March 1998 and July 1999, in containers of bromeliads located in urban, peri-urban and forest environments. The water content in plants was measured and recorded

Measurements of K shell absorption jump factors and jump ratios using EDXRF technique

Science.gov (United States)

Kacal, Mustafa Recep; Han, İbrahim; Akman, Ferdi

2015-04-01

In the present work, the K-shell absorption jump factors and jump ratios for 30 elements between Ti ( Z = 22) and Er ( Z = 68) were measured by energy dispersive X-ray fluorescence (EDXRF) technique. The jump factors and jump ratios for these elements were determined by measuring the K shell fluorescence parameters such as the Kα X-ray production cross-sections, K shell fluorescence yields, Kβ-to- Kα X-rays intensity ratios, total atomic absorption cross sections and mass attenuation coefficients. The measurements were performed using an Am-241 radioactive point source and a Si (Li) detector in direct excitation and transmission experimental geometry. The results for jump factors and jump ratios were compared with theoretically calculated and the ones available in the literature.

Jumping on water

Science.gov (United States)

Kim, Ho-Young

2016-11-01

Water striders can jump on water as high as they can jump on land. Quick jumps allow them to avoid sudden dangers such as predators' attacks, and therefore understanding how they make such a dramatic motion for survival can shed light on the ultimate level of semi-aquatic motility achievable through evolution. However, the mechanism of their vertical jumping from a water surface has eluded hydrodynamic explanations so far. By observing movements of water strider legs and theoretically analyzing their dynamic interactions with deforming liquid-air interface, we have recently found that different species of jumping striders always tune their leg rotation speed with a force just below that required to break the water surface to reach the maximum take-off velocity. Here, we start with discussing the fundamental theories of dynamics of floating and sinking of small objects. The theories then enable us to analyze forces acting on a water strider while it presses down the water surface to fully exploit the capillary force. We further introduce a 68-milligram at-scale robotic insect capable of jumping on water without splash, strikingly similar to the real strider, by utilizing the water surface just as a trampoline.

Strength Determinants of Jump Height in the Jump Throw Movement in Women Handball Players.

Science.gov (United States)

McGhie, David; Østerås, Sindre; Ettema, Gertjan; Paulsen, Gøran; Sandbakk, Øyvind

2018-06-08

McGhie, D, Østerås, S, Ettema, G, Paulsen, G, and Sandbakk, Ø. Strength determinants of jump height in the jump throw movement in women handball players. J Strength Cond Res XX(X): 000-000, 2018-The purpose of the study was to improve the understanding of the strength demands of a handball-specific jump through examining the associations between jump height in a jump throw jump (JTJ) and measures of lower-body maximum strength and impulse in handball players. For comparison, whether the associations between jump height and strength differed between the JTJ and the customarily used countermovement jump (CMJ) was also examined. Twenty women handball players from a Norwegian top division club participated in the study. Jump height was measured in the JTJ and in unilateral and bilateral CMJ. Lower-body strength (maximum isometric force, one-repetition maximum [1RM], impulse at ∼60% and ∼35% 1RM) was measured in seated leg press. The associations between jump height and strength were assessed with correlation analyses and t-tests of dependent r's were performed to determine if correlations differed between jump tests. Only impulse at ∼35% 1RM correlated significantly with JTJ height (p jump height and strength were significantly weaker in the JTJ than in both CMJ tests for all strength measures (p = 0.001-0.044) except one. Maximum strength and impulse at ∼60% 1RM did not seem to sufficiently capture the capabilities associated with JTJ height, highlighting the importance of employing tests targeting performance-relevant neuromuscular characteristics when assessing jump-related strength in handball players. Further, CMJ height seemed to represent a wider range of strength capabilities and care should be taken when using it as a proxy for handball-specific movements.

Brain systems underlying encounter expectancy bias in spider phobia.

Science.gov (United States)

Aue, Tatjana; Hoeppli, Marie-Eve; Piguet, Camille; Hofstetter, Christoph; Rieger, Sebastian W; Vuilleumier, Patrik

2015-06-01

Spider-phobic individuals are characterized by exaggerated expectancies to be faced with spiders (so-called encounter expectancy bias). Whereas phobic responses have been linked to brain systems mediating fear, little is known about how the recruitment of these systems relates to exaggerated expectancies of threat. We used fMRI to examine spider-phobic and control participants while they imagined visiting different locations in a forest after having received background information about the likelihood of encountering different animals (spiders, snakes, and birds) at these locations. Critically, imagined encounter expectancies modulated brain responses differently in phobics as compared with controls. Phobics displayed stronger negative modulation of activity in the lateral prefrontal cortex, precuneus, and visual cortex by encounter expectancies for spiders, relative to snakes or birds (within-participants analysis); these effects were not seen in controls. Between-participants correlation analyses within the phobic group further corroborated the hypothesis that these phobia-specific modulations may underlie irrationality in encounter expectancies (deviations of encounter expectancies from objective background information) in spider phobia; the greater the negative modulation a phobic participant displayed in the lateral prefrontal cortex, precuneus, and visual cortex, the stronger was her bias in encounter expectancies for spiders. Interestingly, irrationality in expectancies reflected in frontal areas relied on right rather than left hemispheric deactivations. Our data accord with the idea that expectancy biases in spider phobia may reflect deficiencies in cognitive control and contextual integration that are mediated by right frontal and parietal areas.

Coordination in vertical jumping

NARCIS (Netherlands)

Bobbert, Maarten F.; van Ingen Schenau, Gerrit Jan

1988-01-01

The present study was designed to investigate for vertical jumping the relationships between muscle actions, movement pattern and jumping achievement. Ten skilled jumpers performed jumps with preparatory countermovement. Ground reaction forces and cinematographic data were recorded. In addition,

The aerodynamic signature of running spiders.

Directory of Open Access Journals (Sweden)

Jérôme Casas

Full Text Available Many predators display two foraging modes, an ambush strategy and a cruising mode. These foraging strategies have been classically studied in energetic, biomechanical and ecological terms, without considering the role of signals produced by predators and perceived by prey. Wolf spiders are a typical example; they hunt in leaf litter either using an ambush strategy or by moving at high speed, taking over unwary prey. Air flow upstream of running spiders is a source of information for escaping prey, such as crickets and cockroaches. However, air displacement by running arthropods has not been previously examined. Here we show, using digital particle image velocimetry, that running spiders are highly conspicuous aerodynamically, due to substantial air displacement detectable up to several centimetres in front of them. This study explains the bimodal distribution of spider's foraging modes in terms of sensory ecology and is consistent with the escape distances and speeds of cricket prey. These findings may be relevant to the large and diverse array of arthropod prey-predator interactions in leaf litter.

Estimation of Jump Tails

DEFF Research Database (Denmark)

Bollerslev, Tim; Todorov, Victor

We propose a new and flexible non-parametric framework for estimating the jump tails of Itô semimartingale processes. The approach is based on a relatively simple-to-implement set of estimating equations associated with the compensator for the jump measure, or its "intensity", that only utilizes...... the weak assumption of regular variation in the jump tails, along with in-fill asymptotic arguments for uniquely identifying the "large" jumps from the data. The estimation allows for very general dynamic dependencies in the jump tails, and does not restrict the continuous part of the process...... and the temporal variation in the stochastic volatility. On implementing the new estimation procedure with actual high-frequency data for the S&P 500 aggregate market portfolio, we find strong evidence for richer and more complex dynamic dependencies in the jump tails than hitherto entertained in the literature....

Biotechnological Trends in Spider and Scorpion Antivenom Development

DEFF Research Database (Denmark)

Laustsen, Andreas Hougaard; Solà, Mireia; Jappe, Emma Christine

2016-01-01

in using bioactive toxins from spiders and scorpions for drug discovery purposes and for solving crystal structures of membrane-embedded receptors. Additionally, the identification and isolation of a myriad of spider and scorpion toxins has allowed research within next generation antivenoms to progress...... at an increasingly faster pace. In this review, the current knowledge of spider and scorpion venoms is presented, followed by a discussion of all published biotechnological efforts within development of spider and scorpion antitoxins based on small molecules, antibodies and fragments thereof, and next generation...... immunization strategies. The increasing number of discovery and development efforts within this field may point towards an upcoming transition from serum-based antivenoms towards therapeutic solutions based on modern biotechnology....

Biased interpretation and memory in children with varying levels of spider fear.

Science.gov (United States)

Klein, Anke M; Titulaer, Geraldine; Simons, Carlijn; Allart, Esther; de Gier, Erwin; Bögels, Susan M; Becker, Eni S; Rinck, Mike

2014-01-01

This study investigated multiple cognitive biases in children simultaneously, to investigate whether spider-fearful children display an interpretation bias, a recall bias, and source monitoring errors, and whether these biases are specific for spider-related materials. Furthermore, the independent ability of these biases to predict spider fear was investigated. A total of 121 children filled out the Spider Anxiety and Disgust Screening for Children (SADS-C), and they performed an interpretation task, a memory task, and a Behavioural Assessment Test (BAT). As expected, a specific interpretation bias was found: Spider-fearful children showed more negative interpretations of ambiguous spider-related scenarios, but not of other scenarios. We also found specific source monitoring errors: Spider-fearful children made more fear-related source monitoring errors for the spider-related scenarios, but not for the other scenarios. Only limited support was found for a recall bias. Finally, interpretation bias, recall bias, and source monitoring errors predicted unique variance components of spider fear.

Competitive interactions between a native spider (Frontinella communis, Araneae: Linyphiidae) and an invasive spider (Linyphia triangularis, Araneae: Linyphiidae)

Science.gov (United States)

Bednarski, Julie V.; Ginsberg, Howard S.; Jakob, Elizabeth M.

2010-01-01

There are numerous reports of spiders that have become established outside of their native ranges, but few studies examine their impact on native spiders. We examined the effect of the European hammock spider Linyphia triangularis (Araneae, Linyphiidae) on the native bowl-and-doily spider Frontinella communis (Araneae, Linyphiidae) in Acadia National Park, Maine, USA. First, we added L. triangularis to established plots of F. communis. Significantly more F. communis abandoned their webs when L. triangularis were added compared to control plots. Second, we tested whether F. communis were deterred from building webs in areas where L. triangularis was established. Significantly fewer F. communis built webs on plots with L. triangularis than on control plots. In both experiments, L. triangularis sometimes took over webs of F. communis or incorporated F. communis webs into their own webs, but F. communisnever took over or incorporated L. triangularis webs. Competition between L. triangularis and F. communis for both webs and web sites may contribute to the decline of F. communis.

Yeasts and coliform bacteria of water accumulated in bromeliads of mangrove and sand dune ecosystems of southeast Brazil.

Science.gov (United States)

Hagler, A N; Rosa, C A; Morais, P B; Mendonça-Hagler, L C; Franco, G M; Araujo, F V; Soares, C A

1993-10-01

Yeasts and coliform bacteria were isolated from water that accumulated in the central cups and adjacent leaf axilae of two bromeliads, Neoregelia cruenta of a coastal sand dune and Quesnelia quesneliana of a mangrove ecosystem near the city of Rio de Janeiro, Brazil. The mean total coliform counts were above 10,000 per 100 mL for waters of both plants, but the mean fecal coliform counts were only 74 per 100 mL for Q. quesneliana and mostly undetected in water from N. cruenta. Of 90 fecal coliform isolates, 51 were typical of Escherichia coli in colony morphology and indol, methyl red, Volges-Proskauer, and citrate (IMViC) tests. Seven representatives of the typical E. coli cultures were identified as this species, but the identifications of nine other coliform bacteria were mostly dubious. The yeast community of N. cruenta was typical of plant surfaces with basidiomycetous yeasts anamorphs, and the black yeast Aureobasidium pullulans was prevalent. Quesnelia quesneliana had a substantial proportion of ascomycetous yeasts and their anamorphs, including a probable new biotype of Saccharomyces unisporus. Our results suggested that the microbial communities in bromeliad waters are typically autochtonous and not contaminants.

The embryonic development of the central American wandering spider Cupiennius salei

Directory of Open Access Journals (Sweden)

Hilbrant Maarten

2011-06-01

Full Text Available Abstract Background The spider Cupiennius salei (Keyserling 1877 has become an important study organism in evolutionary and developmental biology. However, the available staging system for its embryonic development is difficult to apply to modern studies, with strong bias towards the earliest developmental stages. Furthermore, important embryonic events are poorly understood. We address these problems, providing a new description of the embryonic development of C. salei. The paper also discusses various observations that will improve our understanding of spider development. Results Conspicuous developmental events were used to define numbered stages 1 to 21. Stages 1 to 9 follow the existing staging system for the spider Achaearanea tepidariorum, and stages 10 to 21 provide a high-resolution description of later development. Live-embryo imaging shows cell movements during the earliest formation of embryonic tissue in C. salei. The imaging procedure also elucidates the encircling border between the cell-dense embryo hemisphere and the hemisphere with much lower cell density (a structure termed 'equator' in earlier studies. This border results from subsurface migration of primordial mesendodermal cells from their invagination site at the blastopore. Furthermore, our detailed successive sequence shows: 1 early differentiation of the precheliceral neuroectoderm; 2 the morphogenetic process of inversion and 3 initial invaginations of the opisthosomal epithelium for the respiratory system. Conclusions Our improved staging system of development in C. salei development should be of considerable value to future comparative studies of animal development. A dense germ disc is not evident during development in C. salei, but we show that the gastrulation process is similar to that in spider species that do have a dense germ disc. In the opisthosoma, the order of appearance of precursor epithelial invaginations provides evidence for the non-homology of the

Induction of direct and indirect plant responses by jasmonic acid, low spider mite densities, or a combination of jasmonic acid treatment and spider mite infestation.

Science.gov (United States)

Gols, Rieta; Roosjen, Mara; Dijkman, Herman; Dicke, Marcel

2003-12-01

Jasmonic acid (JA) and the octadecanoid pathway are involved in both induced direct and induced indirect plant responses. In this study, the herbivorous mite, Tetranychus urticae, and its predator, Phytoseiulus persimilis, were given a choice between Lima bean plants induced by JA or spider mites and uninduced control plants. Infestation densities resulting in the induction of predator attractants were much lower than thus far assumed, i.e., predatory mites were significantly attracted to plants that were infested for 2 days with only one or four spider mites per plant. Phytoseiulus persimilis showed a density-dependent response to volatiles from plants that were infested with different numbers of spider mites. Similarly, treating plants with increasing concentrations of JA also led to increased attraction of P. persimilis. Moreover, the duration of spider mite infestation was positively correlated with the proportion of predators that were attracted to mite-infested plants. A pretreatment of the plants with JA followed by a spider mite infestation enhanced the attraction of P. persimilis to plant volatiles compared to attraction to volatiles from plants that were only infested with spider mites and did not receive a pretreatment with JA. The herbivore, T. urticae preferred leaf tissue that previously had been infested with conspecifics to uninfested leaf tissue. In the case of choice tests with JA-induced and control leaf tissue, spider mites slightly preferred control leaf tissue. When spider mites were given a choice between leaf discs induced by JA and leaf discs damaged by spider mite feeding, they preferred the latter. The presence of herbivore induced chemicals and/or spider mite products enhanced settlement of the mites, whereas treatment with JA seemed to impede settlement.

Spider foraging strategy affects trophic cascades under natural and drought conditions.

Science.gov (United States)

Liu, Shengjie; Chen, Jin; Gan, Wenjin; Schaefer, Douglas; Gan, Jianmin; Yang, Xiaodong

2015-07-23

Spiders can cause trophic cascades affecting litter decomposition rates. However, it remains unclear how spiders with different foraging strategies influence faunal communities, or present cascading effects on decomposition. Furthermore, increased dry periods predicted in future climates will likely have important consequences for trophic interactions in detritus-based food webs. We investigated independent and interactive effects of spider predation and drought on litter decomposition in a tropical forest floor. We manipulated densities of dominant spiders with actively hunting or sit-and-wait foraging strategies in microcosms which mimicked the tropical-forest floor. We found a positive trophic cascade on litter decomposition was triggered by actively hunting spiders under ambient rainfall, but sit-and-wait spiders did not cause this. The drought treatment reversed the effect of actively hunting spiders on litter decomposition. Under drought conditions, we observed negative trophic cascade effects on litter decomposition in all three spider treatments. Thus, reduced rainfall can alter predator-induced indirect effects on lower trophic levels and ecosystem processes, and is an example of how such changes may alter trophic cascades in detritus-based webs of tropical forests.

Bromeliad ornamental species: conservation issues and challenges related to commercialization=Espécies ornamentais de bromélias: conservação e desafios relacionados a sua comercialização

Directory of Open Access Journals (Sweden)

Darcy Mitchell

2012-01-01

Full Text Available Bromeliads grow almost exclusively in the New World tropics and subtropics, mainly in South America in the Brazilian Atlantic Forest (ca. 1200 species. Within the last few decades, their beautiful shapes and colors, low maintenance and easy adaptability to small gardens have brought bromeliads into worldwide use as ornamental plants. While the ornamental bromeliad trade could make significant contributions to household economies in rural areas, the trade may represent a significant threat in some of the bromeliad biodiversity hotspot countries such as Brazil, Bolivia and Colombia. This paper presents an overview of production volumes, analysis of the Brazilian bromeliads trade chain – at the state, national and international levels – and recommendations to address development and conservation challenges.Bromélias crescem quase que exclusivamente nas regiões tropicais e subtropicais do Novo Mundo, ocorrendo principalmente na Floresta Atlântica brasileira na América do Sul. (ca. 1200 espécies. Nas últimas décadas, pelas suas belas formas e cores, baixa demanda de manutenção e fácil adaptabilidade a pequenos jardins, as bromélias tem sido mundialmente utilizadas como plantas ornamentais. O comércio de bromélias ornamentais pode promover significante acréscimo de renda em áreas rurais, mas por outro lado pode também significar uma ameaça à manutenção da diversidade destes recursos biológicos, especialmente em países como Brasil, Bolívia e Colômbia. Este trabalho apresenta uma caracterização geral dos volumes de produção e da cadeia brasileira de comercialização de bromélias - em nível estadual, nacional e internacional assim como recomendações para promover o desenvolvimento deste setor e superar desafios relacionados ao uso sustentável deste recurso.

Peculiar torsion dynamical response of spider dragline silk

Science.gov (United States)

Liu, Dabiao; Yu, Longteng; He, Yuming; Peng, Kai; Liu, Jie; Guan, Juan; Dunstan, D. J.

2017-07-01

The torsional properties of spider dragline silks from Nephila edulis and Nephila pilipes spiders are investigated by using a torsion pendulum technique. A permanent torsional deformation is observed after even small torsional strain. This behaviour is quite different from that of the other materials tested here, i.e., carbon fiber, thin metallic wires, Kevlar fiber, and human hair. The spider dragline thus displays a strong energy dissipation upon the initial excitation (around 75% for small strains and more for a larger strain), which correspondingly reduces the amplitude of subsequent oscillations around the new equilibrium position. The variation of torsional stiffness in relaxation dynamics of spider draglines for different excitations is also determined. The experimental result is interpreted in the light of the hierarchical structure of dragline silk.

Venomous snake bites, scorpions, and spiders.

Science.gov (United States)

Kularatne, S A M; Senanayake, Nimal

2014-01-01

Neurologic dysfunction due to natural neurotoxins is an important, but neglected, public health hazard in many parts of the world, particularly in the tropics. These toxins are produced by or found among a variety of live forms that include venomous snakes, arthropods such as scorpions, spiders, centipedes, stinging insects (Hymenoptera), ticks, certain poisonous fish, shellfish, crabs, cone shells, skin secretions of dart-poison frogs, and bacterial poisons such as botulinum toxin. These toxins commonly act on neuromuscular transmission at the neuromuscular junction where acetylcholine is the neurotransmitter, but in certain situations the toxins interfere with neurotransmitters such as GABA, noradrenaline, adrenaline, dopamine, and γ-aminobutyrate. Of the toxins, α-toxins and κ-toxins (e.g., Chinese krait, Bungarus multicinctus) act on the postsynaptic membrane, blocking the receptors, whilst β-toxin (e.g., common krait, B. caeruleus) acts on the presynaptic membrane, causing impairment of acetylcholine release. Conversely, dendrotoxins of the African mamba enhance acetylcholine release. The toxins of scorpions and spiders commonly interfere with voltage-gated ion channels. Clinically, the cardinal manifestation is muscle paralysis. In severe cases respiratory paralysis could be fatal. Effective antivenoms are the mainstay of treatment of envenoming, but their lack of availability is the major concern in the regions of the globe where they are desperately needed. Interestingly, some toxins have proved to be valuable pharmaceutical agents, while some others are widely exploited to study neuromuscular physiology and pathology. © 2014 Elsevier B.V. All rights reserved.

Plastic material investment in load-bearing silk attachments in spiders.

Science.gov (United States)

Wolff, Jonas O; Jones, Braxton; Herberstein, Marie E

2018-05-17

The nature and size of attachments is a fundamental element of animal constructions. Presumably, these adhesive structures are plastically deployed to balance material investment and attachment strength. Here we studied plasticity in dragline anchorages of the golden orb web spider, Nephila plumipes. Specifically, we predict that spiders adjust the size and structure of dragline anchorages with load, i.e. spider mass. Mass was manipulated by attaching lead pieces to the spider's abdomen resulting in a 50 percent increase in mass. Loaded spiders spun larger but structurally similar thread anchorages than unloaded spiders. Thus, the spinning program that determines the overall anchor structure is highly stereotypic, and flexibility is introduced through varying the anchor size by increasing material investment. Our study showcases substrate attachments as suitable models to investigate the interplay between innate and changeable elements in the economy of building behaviours. Copyright © 2018 Elsevier GmbH. All rights reserved.

Matching global and regional distribution models of the recluse spider Loxosceles rufescens: to what extent do these reflect niche conservatism?

Science.gov (United States)

Taucare-Ríos, A; Nentwig, W; Bizama, G; Bustamante, R O

2018-06-08

The Mediterranean recluse spider, Loxosceles rufescens (Dufour, 1820) (Araneae: Sicariidae) is a cosmopolitan spider that has been introduced in many parts of the world. Its bite can be dangerous to humans. However, the potential distribution of this alien species, which is able to spread fairly quickly with human aid, is completely unknown. Using a combination of global and regional niche models, it is possible to analyse the spread of this species in relation to environmental conditions. This analysis found that the successful spreading of this species varies according to the region invaded. The majority of populations in Asia are stable and show niche conservatism, whereas in North America this spider is expected to be less successful in occupying niches that differ from those in its native region and that do not support its synanthropic way of living. © 2018 The Royal Entomological Society.

Nutrient intake determines post-maturity molting in the golden orb-web spider Nephila pilipes (Araneae: Araneidae).

Science.gov (United States)

Cheng, Ren-Chung; Zhang, Shichang; Chen, Yu-Chun; Lee, Chia-Yi; Chou, Yi-Ling; Ye, Hui-Ying; Piorkowski, Dakota; Liao, Chen-Pan; Tso, I-Min

2017-06-15

While molting occurs in the development of many animals, especially arthropods, post-maturity molting (PMM, organisms continue to molt after sexual maturity) has received little attention. The mechanism of molting has been studied intensively; however, the mechanism of PMM remains unknown although it is suggested to be crucial for the development of body size. In this study, we investigated factors that potentially induce PMM in the golden orb-web spider Nephila pilipes , which has the greatest degree of sexual dimorphism among terrestrial animals. We manipulated the mating history and the nutrient consumption of the females to examine whether they affect PMM. The results showed that female spiders under low nutrition were more likely to molt as adults, and mating had no significant influence on the occurrence of PMM. Moreover, spiders that underwent PMM lived longer than those that did not and their body sizes were significantly increased. Therefore, we concluded that nutritional condition rather than mating history affect PMM. © 2017. Published by The Company of Biologists Ltd.

Influence of spider silk on refugia preferences of the recluse spiders Loxosceles reclusa and Loxosceles laeta (Araneae: Sicariidae).

Science.gov (United States)

Vetter, Richard S; Rust, Michael K

2010-06-01

In a previous experimental study, recluse spiders Loxosceles reclusa Gertsch and Mulaik and Loxosceles laeta (Nicolet) (Araneae: Sicariidae) preferred small cardboard refugia covered with conspecific silk compared with never-occupied refugia. Herein, we investigated some factors that might be responsible for this preference using similar cardboard refugia. When the two Loxosceles species were given choices between refugia previously occupied by their own and by the congeneric species, neither showed a species-specific preference; however, each chose refugia coated with conspecific silk rather than those previously inhabited by a distantly related cribellate spider, Metaltella simoni (Keyserling). When L. laeta spiders were offered refugia that were freshly removed from silk donors compared with heated, aged refugia from the same silk donor, older refugia were preferred. Solvent extracts of L. laeta silk were chosen approximately as often as control refugia when a range of solvents (methylene chloride:methanol, water, and hexane) were used. However, when acetone was used on similar silk, there was a statistical preference for the control, indicating that there might be a mildly repellent aspect to acetone-washed silk. Considering the inability to show attraction to chemical aspects of fresh silk, it seems that physical attributes may be more important for selection and that there might be repellency to silk of a recently vacated spider. These findings are discussed in regard to pest management strategies to control recluse spiders.

The effect of wind on jumping distance in ski jumping--fairness assessed.

Science.gov (United States)

Virmavirta, Mikko; Kivekäs, Juha

2012-09-01

The special wind compensation system recently adopted by Fédération Internationale de Ski (FIS; International Ski Federation) to consider the effects of changing wind conditions has caused some controversy. Here, the effect of wind on jumping distance in ski jumping was studied by means of computer simulation and compared with the wind compensation factors used by FIS during the World Cup season 2009/2010. The results showed clearly that the effect of increasing head/tail wind on jumping distance is not linear: +17.4 m/-29.1 m, respectively, for a wind speed of 3 m/s. The linear formula used in the trial period of the wind compensation system was found to be appropriate only for a limited range of jumping distances as the gradient of the landing slope slows down the rate of distance change in long jumps.

Photoluminescent properties of spider silk coated with Eu-doped nanoceria

Energy Technology Data Exchange (ETDEWEB)

Dmitrović, Svetlana, E-mail: svetlana8@vin.bg.ac.rs [University of Belgrade, Vinča Institute of Nuclear Sciences (Serbia); Nikolić, Marko G.; Jelenković, Branislav [University of Belgrade, Institute of Physics (Serbia); Prekajski, Marija [University of Belgrade, Vinča Institute of Nuclear Sciences (Serbia); Rabasović, Mihailo [University of Belgrade, Institute of Physics (Serbia); Zarubica, Aleksandra [University of Niš, Department of Chemistry, Faculty of Science and Mathematics (Serbia); Branković, Goran [University of Belgrade, Institute for Multidisciplinary Research, Department of Material Science (Serbia); Matović, Branko [University of Belgrade, Vinča Institute of Nuclear Sciences (Serbia)

2017-02-15

Spider dragline silk was coated with pure as well as Eu-doped ceria nanopowders at the room temperature. The treatment was done by immersion of the spider silk mesh into aqueous solutions of cerium nitrate (Ce(NO{sub 3}){sub 3}) and ammonium hydroxide (NH{sub 4}OH). Depending on the relationship between Ce{sup 3+} ion and ammonium hydroxide concentration, coated fibers exhibited a different thickness. Obtained materials were studied by means of FESEM. It was found that ceria nanoparticles of average size of 3 nm were coated along spider thread. X-ray diffraction (XRD) and selected-area electron diffraction (SAED) confirmed crystal nature of nanoparticle coating of spider silk. By using Williamson-Hall plots, crystallite size and strain were estimated. EDS measurement confirmed the presence of Eu in spider-Eu-doped ceria composite, and according to FTIR analysis, the interaction between CeO2 and spider silk was proposed. The morphology of obtained composite was observed by TEM. The photoluminescence emission spectra of spider silk coated with Eu-doped ceria were measured with two different excitations of 385 and 466 nm. The two-photon excited auto-fluorescence of spider silk coated with Eu-doped ceria was detected using a nonlinear laser scanning microscope. Obtained composite has a potential as a fluorescent labeling material in diverse applications.

High School Students' Attitudes Towards Spiders: A cross-cultural comparison

Science.gov (United States)

Prokop, Pavol; Tolarovičová, Andrea; Camerik, Anne M.; Peterková, Viera

2010-08-01

Spiders are traditionally considered to be among the least popular of animals. Current evidence suggests that a negative attitude towards spiders could be influenced by both cultural and evolutionary pressures. Some researchers suggest that science education activities could positively influence students' perceptions of spiders. Their evidence is, however, ambivalent. Using a five-point score Likert-type questionnaire in which the items were developed in a similar way to four of Kellert's categories of attitude (scientistic, negativistic, naturalistic, and ecologistic) towards invertebrates, we compared the level of knowledge of and attitudes towards spiders of high school students from two countries, Slovakia (n = 354) and South Africa (n = 382). The students represented different cultures and followed dissimilar science education curricula. Only among the Slovakian students there was a statistically significant but low correlation between knowledge and attitude (r = 0.30). The South African students scored higher in the categories of scientistic, naturalistic, and ecologistic attitudes. Comparison of attitude towards spiders of indigenous Africans from coeducational Catholic schools revealed that South African students have greater fear of spiders than Slovakian students, supporting the biological preparedness hypothesis. This hypothesis predicts a greater fear of spiders in South Africa than in Europe since several South African spiders possess venoms that are dangerous to humans. The results of this study are discussed from science education, cultural, and evolutionary perspectives.

Photoluminescent properties of spider silk coated with Eu-doped nanoceria

International Nuclear Information System (INIS)

Dmitrović, Svetlana; Nikolić, Marko G.; Jelenković, Branislav; Prekajski, Marija; Rabasović, Mihailo; Zarubica, Aleksandra; Branković, Goran; Matović, Branko

2017-01-01

Spider dragline silk was coated with pure as well as Eu-doped ceria nanopowders at the room temperature. The treatment was done by immersion of the spider silk mesh into aqueous solutions of cerium nitrate (Ce(NO_3)_3) and ammonium hydroxide (NH_4OH). Depending on the relationship between Ce"3"+ ion and ammonium hydroxide concentration, coated fibers exhibited a different thickness. Obtained materials were studied by means of FESEM. It was found that ceria nanoparticles of average size of 3 nm were coated along spider thread. X-ray diffraction (XRD) and selected-area electron diffraction (SAED) confirmed crystal nature of nanoparticle coating of spider silk. By using Williamson-Hall plots, crystallite size and strain were estimated. EDS measurement confirmed the presence of Eu in spider-Eu-doped ceria composite, and according to FTIR analysis, the interaction between CeO2 and spider silk was proposed. The morphology of obtained composite was observed by TEM. The photoluminescence emission spectra of spider silk coated with Eu-doped ceria were measured with two different excitations of 385 and 466 nm. The two-photon excited auto-fluorescence of spider silk coated with Eu-doped ceria was detected using a nonlinear laser scanning microscope. Obtained composite has a potential as a fluorescent labeling material in diverse applications.

Deriving appropriate boundary conditions, and accelerating position-jump simulations, of diffusion using non-local jumping

International Nuclear Information System (INIS)

Taylor, P R; Baker, R E; Yates, C A

2015-01-01

In this paper we explore lattice-based position-jump models of diffusion, and the implications of introducing non-local jumping; particles can jump to a range of nearby boxes rather than only to their nearest neighbours. We begin by deriving conditions for equivalence with traditional local jumping models in the continuum limit. We then generalize a previously postulated implementation of the Robin boundary condition for a non-local process of arbitrary maximum jump length, and present a novel implementation of flux boundary conditions, again generalized for a non-local process of arbitrary maximum jump length. In both these cases we validate our results using stochastic simulation. We then proceed to consider two variations on the basic diffusion model: a hybrid local/non-local scheme suitable for models involving sharp concentration gradients, and the implementation of biased jumping. In all cases we show that non-local jumping can deliver substantial time savings for stochastic simulations. (paper)

Science 101: Why Don't Spiders Stick to Their Own Webs?

Science.gov (United States)

Robertson, Bill

2011-01-01

This article explains why spiders don't stick to their webs. Spiders don't get stuck in their own webs (and they aren't immune to their own glue) because they use a combination of sticky and nonsticky threads (different glands for producing those), and the glue is in droplets that the spider can avoid but the prey can't. The spider's nervous…

Research on Artificial Spider Web Model for Farmland Wireless Sensor Network

Directory of Open Access Journals (Sweden)

Jun Wang

2018-01-01

Full Text Available Through systematic analysis of the structural characteristics and invulnerability of spider web, this paper explores the possibility of combining the advantages of spider web such as network robustness and invulnerability with farmland wireless sensor network. A universally applicable definition and mathematical model of artificial spider web structure are established. The comparison between artificial spider web and traditional networks is discussed in detail. The simulation result shows that the networking structure of artificial spider web is better than that of traditional networks in terms of improving the overall reliability and invulnerability of communication system. A comprehensive study on the advantage characteristics of spider web has important theoretical and practical significance for promoting the invulnerability research of farmland wireless sensor network.

Silk Spinning in Silkworms and Spiders.

Science.gov (United States)

Andersson, Marlene; Johansson, Jan; Rising, Anna

2016-08-09

Spiders and silkworms spin silks that outcompete the toughness of all natural and manmade fibers. Herein, we compare and contrast the spinning of silk in silkworms and spiders, with the aim of identifying features that are important for fiber formation. Although spiders and silkworms are very distantly related, some features of spinning silk seem to be universal. Both spiders and silkworms produce large silk proteins that are highly repetitive and extremely soluble at high pH, likely due to the globular terminal domains that flank an intermediate repetitive region. The silk proteins are produced and stored at a very high concentration in glands, and then transported along a narrowing tube in which they change conformation in response primarily to a pH gradient generated by carbonic anhydrase and proton pumps, as well as to ions and shear forces. The silk proteins thereby convert from random coil and alpha helical soluble conformations to beta sheet fibers. We suggest that factors that need to be optimized for successful production of artificial silk proteins capable of forming tough fibers include protein solubility, pH sensitivity, and preservation of natively folded proteins throughout the purification and initial spinning processes.

Influence of Knee-to-Feet Jump Training on Vertical Jump and Hang Clean Performance.

Science.gov (United States)

Stark, Laura; Pickett, Karla; Bird, Michael; King, Adam C

2016-11-01

Stark, L, Pickett, K, Bird, M, and King, AC. Influence of knee-to-feet jump training on vertical jump and hang clean performance. J Strength Cond Res 30(11): 3084-3089, 2016-From a motor learning perspective, the practice/training environment can result in positive, negative, or neutral transfer to the testing conditions. The purpose of this study was to examine the training effect of a novel movement (knee-to-feet [K2F] jumps) and whether a 6-week training program induced a positive transfer effect to other power-related movements (vertical jump and hang clean [HC]). Twenty-six intercollegiate athletes from power-emphasized sports were paired and counter-balanced into a control (i.e., maintained their respective sport-specific lifting regimen) or an experimental group (i.e., completed a 6-week progressive training program of K2F jumps in addition to respective lifting regimen). A pre- and posttest design was used to investigate the effect of training on K2F jump height and transfer effect to vertical jump height (VJH) and 2-repetition maximum (RM) HC performance. A significant increase in K2F jump height was found for the experimental group. Vertical jump height significantly increased from pre- to posttest but no group or interaction (group × time) effect was found, and there were nonsignificant differences for HC. Posttest data showed significant correlations between all pairs of the selected exercises with the highest correlation between K2F jump height and VJ H (R = 0.40) followed by VJH and 2RM HC (R = 0.38) and 2RM HC and K2F jump height (R = 0.23). The results suggest that K2F jump training induced the desired learning effect but was specific to the movement in that no effect of transfer occurred to the other power-related movements. This finding is value for strength and condition professionals who design training programs to enhance athletic performance.

A novel neurotoxin from venom of the spider, Brachypelma albopilosum.

Directory of Open Access Journals (Sweden)

Yunhua Zhong

Full Text Available Spiders have evolved highly selective toxins for insects. There are many insecticidal neurotoxins in spider venoms. Although a large amount of work has been done to focus on neurotoxicity of spider components, little information, which is related with effects of spider toxins on tumor cell proliferation and cytotoxicity, is available for Brachypelma albopilosum venom. In this work, a novel spider neurotoxin (brachyin was identified and characterized from venoms of the spider, Brachypelma albopilosum. Brachyin is composed of 41 amino acid residues with the sequence of CLGENVPCDKDRPNCCSRYECLEPTGYGWWYASYYCYKKRS. There are six cysteines in this sequence, which form three disulfided bridges. The serine residue at the C-terminus is amidated. Brachyin showed strong lethal effects on American cockroaches (Periplaneta americana and Tenebrio molitor (common mealbeetle. This neurotoxin also showed significant analgesic effects in mice models including abdominal writhing induced by acetic acid and formalin-induced paw licking tests. It was interesting that brachyin exerted marked inhibition on tumor cell proliferation.

High population density of black-handed spider monkeys (Ateles geoffroyi) in Costa Rican lowland wet forest.

Science.gov (United States)

Weghorst, Jennifer A

2007-04-01

The main objective of this study was to estimate the population density and demographic structure of spider monkeys living in wet forest in the vicinity of Sirena Biological Station, Corcovado National Park, Costa Rica. Results of a 14-month line-transect survey showed that spider monkeys of Sirena have one of the highest population densities ever recorded for this genus. Density estimates varied, however, depending on the method chosen to estimate transect width. Data from behavioral monitoring were available to compare density estimates derived from the survey, providing a check of the survey's accuracy. A combination of factors has most probably contributed to the high density of Ateles, including habitat protection within a national park and high diversity of trees of the fig family, Moraceae. Although natural densities of spider monkeys at Sirena are substantially higher than those recorded at most other sites and in previous studies at this site, mean subgroup size and age ratios were similar to those determined in previous studies. Sex ratios were similar to those of other sites with high productivity. Although high densities of preferred fruit trees in the wet, productive forests of Sirena may support a dense population of spider monkeys, other demographic traits recorded at Sirena fall well within the range of values recorded elsewhere for the species.

Spiders of Kerala Agricultural University Campus, Thrissur, Kerala, India

Directory of Open Access Journals (Sweden)

C. K. Adarsh

2015-12-01

Full Text Available A total of 86 species of spiders belonging to 56 genera of 20 families have been recorded from the Kerala Agricultural University (KAU campus, Thrissur, Kerala, southern India.  This represents 5.1% of the total spiders’ species and 33.33% of the total families of spiders recorded in India.  The dominant spider family at KAU campus is Araneidae with 18 species of nine genera. Salticidae is represented by 14 species of 13 genera.  Out of 252 endemic spiders of India, 16 have been reported from KAU campus.  Guild structure analysis shows spiders belonging to seven types of feeding guilds present in KAU campus.  Orb-web builders are the dominant feeding guild accounting for 34%, followed by stalkers (22%, ground runners (20%, ambushers (8%, scattered line weavers (8%, foliage runners (7% and sheet-web builders (1%. 

Research on Artificial Spider Web Model for Farmland Wireless Sensor Network

OpenAIRE

Jun Wang; Song Gao; Shimin Zhao; Guang Hu; Xiaoli Zhang; Guowang Xie

2018-01-01

Through systematic analysis of the structural characteristics and invulnerability of spider web, this paper explores the possibility of combining the advantages of spider web such as network robustness and invulnerability with farmland wireless sensor network. A universally applicable definition and mathematical model of artificial spider web structure are established. The comparison between artificial spider web and traditional networks is discussed in detail. The simulation result shows tha...

Spider diffraction: a comparison of curved and straight legs

International Nuclear Information System (INIS)

Richter, J.L.

1984-01-01

It has been known for some time that, if curved legs rather than the usual straight ones are used in the spider that supports the secondary optics in certain telescopes, the visible diffraction effect is reduced. Fraunhofer theory is used to calculate the diffraction effects due to the curved leg spider. Calculated and photographic diffraction patterns are compared for straight and curved leg spiders

High School Students' Attitudes towards Spiders: A Cross-Cultural Comparison

Science.gov (United States)

Prokop, Pavol; Tolarovicova, Andrea; Camerik, Anne M.; Peterkova, Viera

2010-01-01

Spiders are traditionally considered to be among the least popular of animals. Current evidence suggests that a negative attitude towards spiders could be influenced by both cultural and evolutionary pressures. Some researchers suggest that science education activities could positively influence students' perceptions of spiders. Their evidence is,…

Population dynamics of the epiphytic bromeliad Tillandsia butzii in cloud forest

Science.gov (United States)

Toledo-Aceves, Tarin; Hernández-Apolinar, Mariana

2016-02-01

Epiphytes are a major component of tropical montane cloud forests. Over-exploitation and forest loss and degradation affect remnant populations. In this study, we analysed the population dynamics of the epiphytic bromeliad Tillandsia butzii over a 2-y period in a tropical montane cloud forest fragment in southern Mexico. Matrix analysis revealed that the T. butzii population is likely to be stable at the study site. On average the λ value did not differ significantly from unity: λ (95% confidence interval) = 0.978 (0.936-1.001). λ was highly influenced by stasis, to a lesser extent by growth and only slightly by fecundity. Overall, adult plant stasis and phalanx growth habit played a fundamental role in population maintenance. T. butzii tolerance to xeric conditions may contribute to population stability in the studied region.

Optically probing torsional superelasticity in spider silks

Energy Technology Data Exchange (ETDEWEB)

Kumar, Bhupesh; Thakur, Ashish; Panda, Biswajit; Singh, Kamal P. [Department of Physical Sciences, IISER Mohali, Sector 81, Manauli, Mohali 140306 (India)

2013-11-11

We investigate torsion mechanics of various spider silks using a sensitive optical technique. We find that spider silks are torsionally superelastic in that they can reversibly withstand great torsion strains of over 10{sup 2−3} rotations per cm before failure. Among various silks from a spider, we find the failure twist-strain is greatest in the sticky capture silk followed by dragline and egg-case silk. Our in situ laser-diffraction measurements reveal that torsional strains on the silks induce a nano-scale transverse compression in its diameter that is linear and reversible. These unique torsional properties of the silks could find applications in silk-based materials and devices.

Optically probing torsional superelasticity in spider silks

International Nuclear Information System (INIS)

Kumar, Bhupesh; Thakur, Ashish; Panda, Biswajit; Singh, Kamal P.

2013-01-01

We investigate torsion mechanics of various spider silks using a sensitive optical technique. We find that spider silks are torsionally superelastic in that they can reversibly withstand great torsion strains of over 10 2−3 rotations per cm before failure. Among various silks from a spider, we find the failure twist-strain is greatest in the sticky capture silk followed by dragline and egg-case silk. Our in situ laser-diffraction measurements reveal that torsional strains on the silks induce a nano-scale transverse compression in its diameter that is linear and reversible. These unique torsional properties of the silks could find applications in silk-based materials and devices

The complete mitochondrial genome sequence of the spider habronattus oregonensis reveals rearranged and extremely truncated tRNAs

International Nuclear Information System (INIS)

Masta, Susan E.; Boore, Jeffrey L.

2004-01-01

We sequenced the entire mitochondrial genome of the jumping spider Habronattus oregonensis of the arachnid order Araneae (Arthropoda: Chelicerata). A number of unusual features distinguish this genome from other chelicerate and arthropod mitochondrial genomes. Most of the transfer RNA gene sequences are greatly reduced in size and cannot be folded into typical cloverleaf-shaped secondary structures. At least nine of the tRNA sequences lack the potential to form TYC arm stem pairings, and instead are inferred to have TV-replacement loops. Furthermore, sequences that could encode the 3' aminoacyl acceptor stems in at least 10 tRNAs appear to be lacking, because fully paired acceptor stems are not possible and because the downstream sequences instead encode adjacent genes. Hence, these appear to be among the smallest known tRNA genes. We postulate that an RNA editing mechanism must exist to restore the 3' aminoacyl acceptor stems in order to allow the tRNAs to function. At least seven tRN As are rearranged with respect to the chelicerate Limulus polyphemus, although the arrangement of the protein-coding genes is identical. Most mitochondrial protein-coding genes of H. oregonensis have ATN as initiation codons, as commonly found in arthropod mtDNAs, but cytochrome oxidase subunit 2 and 3 genes apparently use UUG as an initiation codon. Finally, many of the gene sequences overlap one another and are truncated. This 14,381 bp genome, the first mitochondrial genome of a spider yet sequenced, is one of the smallest arthropod mitochondrial genomes known. We suggest that post transcriptional RNA editing can likely maintain function of the tRNAs while permitting the accumulation of mutations that would otherwise be deleterious. Such mechanisms may have allowed for the minimization of the spider mitochondrial genome

Jump Horse Safety: Reconciling Public Debate and Australian Thoroughbred Jump Racing Data, 2012-2014.

Science.gov (United States)

Ruse, Karen; Davison, Aidan; Bridle, Kerry

2015-10-22

Thoroughbred jump racing sits in the spotlight of contemporary welfare and ethical debates about horse racing. In Australia, jump racing comprises hurdle and steeplechase races and has ceased in all but two states, Victoria and South Australia. This paper documents the size, geography, composition, and dynamics of Australian jump racing for the 2012, 2013, and 2014 seasons with a focus on debate about risks to horses. We found that the majority of Australian jump racing is regional, based in Victoria, and involves a small group of experienced trainers and jockeys. Australian jump horses are on average 6.4 years of age. The jump career of the majority of horses involves participating in three or less hurdle races and over one season. Almost one quarter of Australian jump horses race only once. There were ten horse fatalities in races over the study period, with an overall fatality rate of 5.1 fatalities per 1000 horses starting in a jump race (0.51%). There was significant disparity between the fatality rate for hurdles, 0.75 fatalities per 1000 starts (0.075%) and steeplechases, 14 fatalities per 1000 starts (1.4%). Safety initiatives introduced by regulators in 2010 appear to have significantly decreased risks to horses in hurdles but have had little or no effect in steeplechases. Our discussion considers these Animals 2015, 5 1073 data in light of public controversy, political debate, and industry regulation related to jump horse safety.

And along Came a Spider: An Attentional Bias for the Detection of Spiders in Young Children and Adults

Science.gov (United States)

LoBue, Vanessa

2010-01-01

Spiders are among the most common targets of fears and phobias in the world. In visual search tasks, adults detect their presence more rapidly than other kinds of stimuli. Reported here is an investigation of whether young children share this attentional bias for the detection of spiders. In a series of experiments, preschoolers and adults were…

Early events in the evolution of spider silk genes.

Directory of Open Access Journals (Sweden)

James Starrett

Full Text Available Silk spinning is essential to spider ecology and has had a key role in the expansive diversification of spiders. Silk is composed primarily of proteins called spidroins, which are encoded by a multi-gene family. Spidroins have been studied extensively in the derived clade, Orbiculariae (orb-weavers, from the suborder Araneomorphae ('true spiders'. Orbicularians produce a suite of different silks, and underlying this repertoire is a history of duplication and spidroin gene divergence. A second class of silk proteins, Egg Case Proteins (ECPs, is known only from the orbicularian species, Lactrodectus hesperus (Western black widow. In L. hesperus, ECPs bond with tubuliform spidroins to form egg case silk fibers. Because most of the phylogenetic diversity of spiders has not been sampled for their silk genes, there is limited understanding of spidroin gene family history and the prevalence of ECPs. Silk genes have not been reported from the suborder Mesothelae (segmented spiders, which diverged from all other spiders >380 million years ago, and sampling from Mygalomorphae (tarantulas, trapdoor spiders and basal araneomorph lineages is sparse. In comparison to orbicularians, mesotheles and mygalomorphs have a simpler silk biology and thus are hypothesized to have less diversity of silk genes. Here, we present cDNAs synthesized from the silk glands of six mygalomorph species, a mesothele, and a non-orbicularian araneomorph, and uncover a surprisingly rich silk gene diversity. In particular, we find ECP homologs in the mesothele, suggesting that ECPs were present in the common ancestor of extant spiders, and originally were not specialized to complex with tubuliform spidroins. Furthermore, gene-tree/species-tree reconciliation analysis reveals that numerous spidroin gene duplications occurred after the split between Mesothelae and Opisthothelae (Mygalomorphae plus Araneomorphae. We use the spidroin gene tree to reconstruct the evolution of amino acid

Determinants of the abilities to jump higher and shorten the contact time in a running 1-legged vertical jump in basketball.

Science.gov (United States)

Miura, Ken; Yamamoto, Masayoshi; Tamaki, Hiroyuki; Zushi, Koji

2010-01-01

This study was conducted to obtain useful information for developing training techniques for the running 1-legged vertical jump in basketball (lay-up shot jump). The ability to perform the lay-up shot jump and various basic jumps was measured by testing 19 male basketball players. The basic jumps consisted of the 1-legged repeated rebound jump, the 2-legged repeated rebound jump, and the countermovement jump. Jumping height, contact time, and jumping index (jumping height/contact time) were measured and calculated using a contact mat/computer system that recorded the contact and air times. The jumping index indicates power. No significant correlation existed between the jumping height and contact time of the lay-up shot jump, the 2 components of the lay-up shot jump index. As a result, jumping height and contact time were found to be mutually independent abilities. The relationships in contact time between the lay-up shot jump to the 1-legged repeated rebound jump and the 2-legged repeated rebound jump were correlated on the same significance levels (p jumping height existed between the 1-legged repeated rebound jump and the lay-up shot jump (p jumping height between the lay-up shot jump and both the 2-legged repeated rebound jump and countermovement jump. The lay-up shot index correlated more strongly to the 1-legged repeated rebound jump index (p jump index (p jump is effective in improving both contact time and jumping height in the lay-up shot jump.

Silk elasticity as a potential constraint on spider body size.

Science.gov (United States)

Rodríguez-Gironés, Miguel A; Corcobado, Guadalupe; Moya-Laraño, Jordi

2010-10-07

Silk is known for its strength and extensibility and has played a key role in the radiation of spiders. Individual spiders use different glands to produce silk types with unique sets of proteins. Most research has studied the properties of major ampullate and capture spiral silks and their ecological implications, while little is known about minor ampullate silk, the type used by those spider species studied to date for bridging displacements. A biomechanical model parameterised with available data shows that the minimum radius of silk filaments required for efficient bridging grows with the square root of the spider's body mass, faster than the radius of minor ampullate silk filaments actually produced by spiders. Because the morphology of spiders adapted to walking along or under silk threads is ill suited for moving on a solid surface, for these species there is a negative relationship between body mass and displacement ability. As it stands, the model suggests that spiders that use silk for their displacements are prevented from attaining a large body size if they must track their resources in space. In particular, silk elasticity would favour sexual size dimorphism because males that must use bridging lines to search for females cannot grow large. 2010 Elsevier Ltd. All rights reserved.

Multi-camera volumetric PIV for the study of jumping fish

Science.gov (United States)

Mendelson, Leah; Techet, Alexandra H.

2018-01-01

Archer fish accurately jump multiple body lengths for aerial prey from directly below the free surface. Multiple fins provide combinations of propulsion and stabilization, enabling prey capture success. Volumetric flow field measurements are crucial to characterizing multi-propulsor interactions during this highly three-dimensional maneuver; however, the fish's behavior also drives unique experimental constraints. Measurements must be obtained in close proximity to the water's surface and in regions of the flow field which are partially-occluded by the fish body. Aerial jump trajectories must also be known to assess performance. This article describes experiment setup and processing modifications to the three-dimensional synthetic aperture particle image velocimetry (SAPIV) technique to address these challenges and facilitate experimental measurements on live jumping fish. The performance of traditional SAPIV algorithms in partially-occluded regions is characterized, and an improved non-iterative reconstruction routine for SAPIV around bodies is introduced. This reconstruction procedure is combined with three-dimensional imaging on both sides of the free surface to reveal the fish's three-dimensional wake, including a series of propulsive vortex rings generated by the tail. In addition, wake measurements from the anal and dorsal fins indicate their stabilizing and thrust-producing contributions as the archer fish jumps.

The Effects of Aquatic Plyometric Training on Repeated Jumps, Drop Jumps and Muscle Damage.

Science.gov (United States)

Jurado-Lavanant, A; Alvero-Cruz, J R; Pareja-Blanco, F; Melero-Romero, C; Rodríguez-Rosell, D; Fernandez-Garcia, J C

2015-09-22

The purpose of this study was to compare the effects of land- vs. aquatic based plyometric training programs on the drop jump, repeated jump performance and muscle damage. Sixty-five male students were randomly assigned to one of 3 groups: aquatic plyometric training group (APT), plyometric training group (PT) and control group (CG). Both experimental groups trained twice a week for 10 weeks performing the same number of sets and total jumps. The following variables were measured prior to, halfway through and after the training programs: creatine kinase (CK) concentration, maximal height during a drop jump from the height of 30 (DJ30) and 50 cm (DJ50), and mean height during a repeated vertical jump test (RJ). The training program resulted in a significant increase (Pplyometric training, PT produced greater gains on reactive jumps performance than APT. © Georg Thieme Verlag KG Stuttgart · New York.

Validity of Hip-worn Inertial Measurement Unit Compared to Jump Mat for Jump Height Measurement in Adolescents.

Science.gov (United States)

Rantalainen, T; Hesketh, K D; Rodda, C; Duckham, R L

2018-06-16

Jump tests assess lower body power production capacity, and can be used to evaluate athletic ability and development during growth. Wearable inertial measurement units (IMU) seem to offer a feasible alternative to laboratory-based equipment for jump height assessments. Concurrent validity of these devices for jump height assessments has only been established in adults. Therefore, the purpose of this study was to evaluate the concurrent validity of IMU-based jump height estimate compared to contact mat-based jump height estimate in adolescents. Ninety-five adolescents (10-13 years-of-age; girls N=41, height = 154 (SD 9) cm, weight = 44 (11) kg; boys N=54, height=156 (10) cm, weight = 46 (13) kg) completed three counter-movement jumps for maximal jump height on a contact mat. Inertial recordings (accelerations, rotations) were concurrently recorded with a hip-worn IMU (sampling at 256 Hz). Jump height was evaluated based on flight time. The mean IMU-derived jump height was 27.1 (SD 3.8) cm, and the corresponding mean jump-mat-derived value was 21.5 (3.4) cm. While a significant 26% mean difference was observed between the methods (5.5 [95% limits of agreement 2.2 to 8.9] cm, p = 0.006), the correspondence between methods was excellent (ICC = 0.89). The difference between methods was weakly positively associated with jump height (r = 0.28, P = 0.007). Take-off velocity derived jump height was also explored but produced only fair congruence. In conclusion, IMU-derived jump height exhibited excellent congruence to contact mat-based jump height and therefore presents a feasible alternative for jump height assessments in adolescents. This article is protected by copyright. All rights reserved. This article is protected by copyright. All rights reserved.

Test-retest reliability of jump execution variables using mechanography: a comparison of jump protocols.

Science.gov (United States)

Fitzgerald, John S; Johnson, LuAnn; Tomkinson, Grant; Stein, Jesse; Roemmich, James N

2018-05-01

Mechanography during the vertical jump may enhance screening and determining mechanistic causes underlying physical performance changes. Utility of jump mechanography for evaluation is limited by scant test-retest reliability data on force-time variables. This study examined the test-retest reliability of eight jump execution variables assessed from mechanography. Thirty-two women (mean±SD: age 20.8 ± 1.3 yr) and 16 men (age 22.1 ± 1.9 yr) attended a familiarization session and two testing sessions, all one week apart. Participants performed two variations of the squat jump with squat depth self-selected and controlled using a goniometer to 80º knee flexion. Test-retest reliability was quantified as the systematic error (using effect size between jumps), random error (using coefficients of variation), and test-retest correlations (using intra-class correlation coefficients). Overall, jump execution variables demonstrated acceptable reliability, evidenced by small systematic errors (mean±95%CI: 0.2 ± 0.07), moderate random errors (mean±95%CI: 17.8 ± 3.7%), and very strong test-retest correlations (range: 0.73-0.97). Differences in random errors between controlled and self-selected protocols were negligible (mean±95%CI: 1.3 ± 2.3%). Jump execution variables demonstrated acceptable reliability, with no meaningful differences between the controlled and self-selected jump protocols. To simplify testing, a self-selected jump protocol can be used to assess force-time variables with negligible impact on measurement error.

Herbivory in spiders: the importance of pollen for orb-weavers.

Science.gov (United States)

Eggs, Benjamin; Sanders, Dirk

2013-01-01

Orb-weaving spiders (Araneidae) are commonly regarded as generalist insect predators but resources provided by plants such as pollen may be an important dietary supplementation. Their webs snare insect prey, but can also trap aerial plankton like pollen and fungal spores. When recycling their orb webs, the spiders may therefore also feed on adhering pollen grains or fungal spores via extraoral digestion. In this study we measured stable isotope ratios in the bodies of two araneid species (Aculepeira ceropegia and Araneus diadematus), their potential prey and pollen to determine the relative contribution of pollen to their diet. We found that about 25% of juvenile orb-weaving spiders' diet consisted of pollen, the other 75% of flying insects, mainly small dipterans and hymenopterans. The pollen grains in our study were too large to be taken up accidentally by the spiders and had first to be digested extraorally by enzymes in an active act of consumption. Therefore, pollen can be seen as a substantial component of the spiders' diet. This finding suggests that these spiders need to be classified as omnivores rather than pure carnivores.

Molecular Evolution of Spider Vision: New Opportunities, Familiar Players.

Science.gov (United States)

Morehouse, Nathan I; Buschbeck, Elke K; Zurek, Daniel B; Steck, Mireille; Porter, Megan L

2017-08-01

Spiders are among the world's most species-rich animal lineages, and their visual systems are likewise highly diverse. These modular visual systems, composed of four pairs of image-forming "camera" eyes, have taken on a huge variety of forms, exhibiting variation in eye size, eye placement, image resolution, and field of view, as well as sensitivity to color, polarization, light levels, and motion cues. However, despite this conspicuous diversity, our understanding of the genetic underpinnings of these visual systems remains shallow. Here, we review the current literature, analyze publicly available transcriptomic data, and discuss hypotheses about the origins and development of spider eyes. Our efforts highlight that there are many new things to discover from spider eyes, and yet these opportunities are set against a backdrop of deep homology with other arthropod lineages. For example, many (but not all) of the genes that appear important for early eye development in spiders are familiar players known from the developmental networks of other model systems (e.g., Drosophila). Similarly, our analyses of opsins and related phototransduction genes suggest that spider photoreceptors employ many of the same genes and molecular mechanisms known from other arthropods, with a hypothesized ancestral spider set of four visual and four nonvisual opsins. This deep homology provides a number of useful footholds into new work on spider vision and the molecular basis of its extant variety. We therefore discuss what some of these first steps might be in the hopes of convincing others to join us in studying the vision of these fascinating creatures.

Acute Generalized Exanthematous Pustulosis (AGEP Triggered by a Spider Bite

Directory of Open Access Journals (Sweden)

Michael Makris

2009-01-01

Discussion: A spider bite may represent a possible causative factor of AGEP. A spider's venom contains sphingomyelinase that stimulates the release of IL8 and GM-CSF, which are involved in AGEP pathogenesis. Whether or not the con-current use of antibiotics has an effect in AGEP appearance when combined with a spider's venom, cannot be excluded.

Coagulopathy after spider bites in a six-year-old boy

Directory of Open Access Journals (Sweden)

Ansari SH.

2008-06-01

Full Text Available Background: Spider bites are common in most parts of the world. In some areas, where snake or scorpion bites are common, spider bites may not be considered a significant problem by the general public and those who have been bitten by spiders may not go to a hospital. However, significant problems are observed in the victims of certain species of spiders including: widow spider (of the genus Latrodectus, including the black widow and brown spiders (of the genus Loxosceles, such as the brown recluse. Case: We report a six-year-old boy, admitted to the hospital two weeks after suffering a spider bite. The patient presented with a severe nose bleed, ecchymosis and purpura, as well as anemia, indicating a clotting disorder. Laboratory results revealed abnormal values for prothrombin time (PT >50 sec, partial thromboplastin time (PTT >120 min and fibrinogen = 0 mg/dl, whereas factor VIII was normal according to a mixing study, with a normal platelet count of 350,000/µl. The patient was managed with fresh frozen plasma every 12 h, and was discharged one week after hospital admission. At present, the patient is well with more normal laboratory results one month after treatment: PT=13.4 sec, PTT= 34 sec, fibrinogen=105 mg/dl.         Conclusions: Although spider bites are uncommon in Iran, severe systemic reactions may occur in the pediatric population requiring admission to the pediatric intensive care unit. These systemic reactions may include hemolytic anemia coagulopathy and renal failure.

Jump Horse Safety: Reconciling Public Debate and Australian Thoroughbred Jump Racing Data, 2012–2014

Science.gov (United States)

Ruse, Karen; Davison, Aidan; Bridle, Kerry

2015-01-01

Simple Summary This paper documents the dynamics of Australian thoroughbred jump racing in the 2012, 2013, and 2014 seasons with the aim of informing debate about risks to horses and the future of this activity. We conclude that the safety of Australian jump racing has improved in recent years but that steeplechases are considerably riskier for horses than hurdle races. Abstract Thoroughbred jump racing sits in the spotlight of contemporary welfare and ethical debates about horse racing. In Australia, jump racing comprises hurdle and steeplechase races and has ceased in all but two states, Victoria and South Australia. This paper documents the size, geography, composition, and dynamics of Australian jump racing for the 2012, 2013, and 2014 seasons with a focus on debate about risks to horses. We found that the majority of Australian jump racing is regional, based in Victoria, and involves a small group of experienced trainers and jockeys. Australian jump horses are on average 6.4 years of age. The jump career of the majority of horses involves participating in three or less hurdle races and over one season. Almost one quarter of Australian jump horses race only once. There were ten horse fatalities in races over the study period, with an overall fatality rate of 5.1 fatalities per 1000 horses starting in a jump race (0.51%). There was significant disparity between the fatality rate for hurdles, 0.75 fatalities per 1000 starts (0.075%) and steeplechases, 14 fatalities per 1000 starts (1.4%). Safety initiatives introduced by regulators in 2010 appear to have significantly decreased risks to horses in hurdles but have had little or no effect in steeplechases. Our discussion considers these data in light of public controversy, political debate, and industry regulation related to jump horse safety. PMID:26506396

Camel spider (Solifugae) use of prairie dog colonies

Science.gov (United States)

Solifugids (camel spiders) are widespread throughout arid regions of western North America and are thought to be important in structuring desert arthropod communities. Despite the ubiquity of camel spiders, little is known about their ecology. Black-tailed prairie dogs (Cynomys ludovicianus) are als...

Nutrient regulation in a predator, the wolf spider Pardosa prativaga

DEFF Research Database (Denmark)

Jensen, Kim; Mayntz, David; Toft, Søren

2011-01-01

Nutrient balancing is well known in herbivores and omnivores, but has only recently been demonstrated in predators. To test how a predator might regulate nutrients when the prey varies in nutrient composition, we restricted juvenile Pardosa prativaga wolf spiders to diets of one of six fruit fly......, Drosophila melanogaster, prey types varying in lipid:protein composition during their second instar. We collected all fly remnants to estimate food and nutrient intake over each meal. The spiders adjusted their capture rate and nutrient extraction in response to prey mass and nutrient composition...... irrespective of energy intake. Intake was initially regulated to a constant lipid plus protein mass, but later spiders fed on prey with high proportions of protein increased consumption relative to spiders fed on other prey types. This pattern indicates that the spiders were prepared to overconsume vast...

Do Bilateral Vertical Jumps With Reactive Jump Landings Achieve Osteogenic Thresholds With and Without Instruction in Premenopausal Women?

Science.gov (United States)

Clissold, Tracey L; Winwood, Paul W; Cronin, John B; De Souza, Mary Jane

2018-04-01

Jumps have been investigated as a stimulus for bone development; however, effects of instruction, jump type, and jump-landing techniques need investigation. This study sought to identify whether ground reaction forces (GRFs) for bilateral vertical jumps (countermovement jumps and drop jumps) with reactive jump-landings (ie, jumping immediately after initial jump-landing), with instruction and with instruction withdrawn, achieve magnitudes and rates of strain previously shown to improve bone mass among premenopausal women. Twenty-one women (Mean ± SD: 43.3 ± 5.9 y; 69.4 ± 9.6 kg; 167 ± 5.5 cm; 27.5 ± 8.7% body fat) performed a testing session 'with instruction' followed by a testing session performed 1 week later with 'instruction withdrawn.' The magnitudes (4.59 to 5.49 body weight [BW]) and rates of strain (263 to 359 BW·s -1 ) for the jump-landings, performed on an AMTI force plate, exceeded previously determined thresholds (>3 BWs and >43 BW·s -1 ). Interestingly, significantly larger peak resultant forces, (↑10%; P = .002) and peak rates of force development (↑20%; P jump-landing (postreactive jump). Small increases (ES = 0.22-0.42) in all landing forces were observed in the second jump-landing with 'instruction withdrawn.' These jumps represent a unique training stimulus for premenopausal women and achieve osteogenic thresholds thought prerequisite for bone growth.

Spider silk reinforced by graphene or carbon nanotubes

Science.gov (United States)

Lepore, Emiliano; Bosia, Federico; Bonaccorso, Francesco; Bruna, Matteo; Taioli, Simone; Garberoglio, Giovanni; Ferrari, Andrea C.; Pugno, Nicola Maria

2017-09-01

Spider silk has promising mechanical properties, since it conjugates high strength (~1.5 GPa) and toughness (~150 J g-1). Here, we report the production of silk incorporating graphene and carbon nanotubes by spider spinning, after feeding spiders with the corresponding aqueous dispersions. We observe an increment of the mechanical properties with respect to pristine silk, up to a fracture strength ~5.4 GPa and a toughness modulus ~1570 J g-1. This approach could be extended to other biological systems and lead to a new class of artificially modified biological, or ‘bionic’, materials.

Species conservation profiles of endemic spiders (Araneae) from Madeira and Selvagens archipelagos, Portugal

Science.gov (United States)

Crespo, Luís C; Silva, Isamberto; Borges, Paulo AV; Boieiro, Mário

2017-01-01

Abstract Background The North Atlantic archipelagos of Madeira and Selvagens present a unique biological diversity including, presently, 56 endemic spider species. Several recent projects provide valuable information on their distribution across most islands and habitats. To date, the only endemic spider assessed according to the IUCN Red List criteria is Hogna ingens. The objective of this paper is to assess all remaining endemic species and advise on possible future conservation actions critical for the survival of endangered species. New information Seven species were found to have a continuing decline in either range or population size. Their decline can be mostly attributed to habitat destruction or degradation, invasive plant species that reduce quality of habitat, forest fires at high mountain regions and possible competition for resources from invasive congeners. The tetragnathid M. barreti is considered as possibly extinct due to the suspected impact of a competing species. Although most endemic spiders from the Madeira and Selvagens archipelagos have relatively low extinction risk due to the good condition and protection of the laurisilva forests where many live, there are a number of species requiring urgent attention and protection measures. These include all cave and mountain-restricted species as well as those threatened by competing congeners or invasive plants. Extending current protected areas, restoring original habitats of threatened species and the control of invasive taxa should remain a priority for species survival. PMID:29104441

Species conservation profiles of endemic spiders (Araneae) from Madeira and Selvagens archipelagos, Portugal.

Science.gov (United States)

Cardoso, Pedro; Crespo, Luís C; Silva, Isamberto; Borges, Paulo Av; Boieiro, Mário

2017-01-01

The North Atlantic archipelagos of Madeira and Selvagens present a unique biological diversity including, presently, 56 endemic spider species. Several recent projects provide valuable information on their distribution across most islands and habitats. To date, the only endemic spider assessed according to the IUCN Red List criteria is Hogna ingens. The objective of this paper is to assess all remaining endemic species and advise on possible future conservation actions critical for the survival of endangered species. Seven species were found to have a continuing decline in either range or population size. Their decline can be mostly attributed to habitat destruction or degradation, invasive plant species that reduce quality of habitat, forest fires at high mountain regions and possible competition for resources from invasive congeners. The tetragnathid M. barreti is considered as possibly extinct due to the suspected impact of a competing species. Although most endemic spiders from the Madeira and Selvagens archipelagos have relatively low extinction risk due to the good condition and protection of the laurisilva forests where many live, there are a number of species requiring urgent attention and protection measures. These include all cave and mountain-restricted species as well as those threatened by competing congeners or invasive plants. Extending current protected areas, restoring original habitats of threatened species and the control of invasive taxa should remain a priority for species survival.

Jump Horse Safety: Reconciling Public Debate and Australian Thoroughbred Jump Racing Data, 2012–2014

Directory of Open Access Journals (Sweden)

Karen Ruse

2015-10-01

Full Text Available Thoroughbred jump racing sits in the spotlight of contemporary welfare and ethical debates about horse racing. In Australia, jump racing comprises hurdle and steeplechase races and has ceased in all but two states, Victoria and South Australia. This paper documents the size, geography, composition, and dynamics of Australian jump racing for the 2012, 2013, and 2014 seasons with a focus on debate about risks to horses. We found that the majority of Australian jump racing is regional, based in Victoria, and involves a small group of experienced trainers and jockeys. Australian jump horses are on average 6.4 years of age. The jump career of the majority of horses involves participating in three or less hurdle races and over one season. Almost one quarter of Australian jump horses race only once. There were ten horse fatalities in races over the study period, with an overall fatality rate of 5.1 fatalities per 1000 horses starting in a jump race (0.51%. There was significant disparity between the fatality rate for hurdles, 0.75 fatalities per 1000 starts (0.075% and steeplechases, 14 fatalities per 1000 starts (1.4%. Safety initiatives introduced by regulators in 2010 appear to have significantly decreased risks to horses in hurdles but have had little or no effect in steeplechases. Our discussion considers these Animals 2015, 5 1073 data in light of public controversy, political debate, and industry regulation related to jump horse safety.

Parasitism of Trombidium brevimanum larvae on agrobiont linyphiid spiders from Germany.

Science.gov (United States)

Tomić, Vladimir; Mąkol, Joanna; Stamenković, Srdjan; Büchs, Wolfgang; Prescher, Sabine; Sivčev, Ivan; Graora, Draga; Sivčev, Lazar; Gotlin-Čuljak, Tatjana; Dudić, Boris

2015-08-01

An experiment on three differently-managed agricultural fields in Ahlum, Germany, which aimed at establishing the impact of different management systems on the biodiversity of predators and decomposers, yielded a significant number of spiders parasitized by larvae of Trombidium brevimanum (Actinotrichida, Parasitengona, Trombidiidae). Spider data from the whole sampling period (September 2010-July 2012), indicated that ectoparasitic larvae were recorded only on spiders in pitfall traps in the period of June-July 2011. In this period, only eight species of Linyphiidae--out of 42 species assigned to nine spider families recorded from the study area--were parasitized by mites; considerable levels of parasitism were recorded on Erigone atra, E. dentipalpis, and Oedothorax apicatus. The highest prevalence of parasitism was recorded on the organic field for E. atra (29%), while on the integrated and conventional fields significantly fewer parasitized spiders were observed. The preferred attachment sites on the spider host were regions with softer cuticle, especially regions on the carapace and on the abdomen, adjacent to the pedicel.

Cognitive reappraisal of snake and spider pictures: An event-related potentials study.

Science.gov (United States)

Langeslag, Sandra J E; van Strien, Jan W

2018-05-30

Fear of snakes and spiders are common animal phobias. Emotion regulation can change the response to emotional stimuli, including snakes and spiders. It is well known that emotion regulation modulates the late positive potential (LPP), which reflects sustained motivated attention. However, research concerning the effect of emotion regulation on the early posterior negativity (EPN), which reflects early selective attention, is scarce. The present research question was whether the EPN and LPP amplitudes are modulated by regulation of emotional responses to snake and spider stimuli. Emotion up- and down-regulation were expected to enhance and reduce the LPP amplitude, respectively, but emotion regulation was not expected to modulate the EPN amplitude. Female participants passively viewed snake, spider, and bird pictures, and up- and down-regulated their emotional responses to the snake and spider pictures using self-focused reappraisal, while their electroencephalogram was recorded. There were EPNs for snakes and spiders vs. birds, as well as for snakes vs. spiders. The LPP amplitude tended to be enhanced for snakes and spiders compared to birds. Most importantly, the LPP amplitude was larger in the up-regulate than in the down-regulate condition for both snakes and spiders, but there was no evidence that the EPN amplitude was modulated by emotion regulation. This suggests that emotion regulation modulated sustained motivated attention, but not early selective attention, to snakes and spiders. The findings are in line with the notion that the emotional modulation of the EPN is more automatic than the emotional modulation of the LPP. Copyright © 2018 Elsevier B.V. All rights reserved.

Early Cretaceous greenhouse pumped higher taxa diversification in spiders.

Science.gov (United States)

Shao, Lili; Li, Shuqiang

2018-05-24

The Cretaceous experienced one of the most remarkable greenhouse periods in geological history. During this time, ecosystem reorganizations significantly impacted the diversification of many groups of organisms. The rise of angiosperms marked a major biome turnover. Notwithstanding, relatively little remains known about how the Cretaceous global ecosystem impacted the evolution of spiders, which constitute one of the most abundant groups of predators. Herein, we evaluate the transcriptomes of 91 taxa representing more than half of the spider families. We add 23 newly sequenced taxa to the existing database to obtain a robust phylogenomic assessment. Phylogenetic reconstructions using different datasets and methods obtain novel placements of some groups, especially in the Synspermiata and the group having a retrolateral tibial apophysis (RTA). Molecular analyses indicate an expansion of the RTA clade at the Early Cretaceous with a hunting predatory strategy shift. Fossil analyses show a 7-fold increase of diversification rate at the same period, but this likely owes to the first occurrences spider in amber deposits. Additional analyses of fossil abundance show an accumulation of spider lineages in the Early Cretaceous. We speculate that the establishment of a warm greenhouse climate pumped the diversification of spiders, in particular among webless forms tracking the abundance of insect prey. Our study offers a new pathway for future investigations of spider phylogeny and diversification. Copyright © 2018. Published by Elsevier Inc.

Variation in free jumping technique within and among horses with little experience in show jumping

NARCIS (Netherlands)

Santamaria, S.; Bobbert, M.F.; Back, W.; Barneveld, A.; van Weeren, P.R.

2004-01-01

Objective - To quantify variation in the jumping technique within and among young horses with little jumping experience, establish relationships between kinetic and kinematic variables, and identify a limited set of variables characteristic for detecting differences in jumping performance among

Validity of a Jump Mat for assessing Countermovement Jump Performance in Elite Rugby Players.

Science.gov (United States)

Dobbin, Nick; Hunwicks, Richard; Highton, Jamie; Twist, Craig

2017-02-01

This study determined the validity of the Just Jump System ® (JJS) for measuring flight time, jump height and peak power output (PPO) in elite rugby league players. 37 elite rugby league players performed 6 countermovement jumps (CMJ; 3 with and 3 without arms) on a jump mat and force platform. A sub-sample (n=28) was used to cross-validate the equations for flight time, jump height and PPO. The JJS systematically overestimated flight time and jump height compared to the force platform (Pjump height ( with R 2 =0.945; without R 2 =0.987). Our equations revealed no systematic difference between corrected and force platform scores and an improved the agreement for flight time (Ratio limits of agreement: with 1.00 vs. 1.36; without 1.00 vs. 1.16) and jump height ( with 1.01 vs. 1.34; without 1.01 vs. 1.15), meaning that our equations can be used to correct JJS scores for elite rugby players. While our equation improved the estimation of PPO ( with 1.02; without 1.01) compared to existing equations (Harman: 1.20; Sayers: 1.04), this only accounted for 64 and 69% of PPO. © Georg Thieme Verlag KG Stuttgart · New York.

Phylogenomics resolves a spider backbone phylogeny and rejects a prevailing paradigm for orb web evolution.

Science.gov (United States)

Bond, Jason E; Garrison, Nicole L; Hamilton, Chris A; Godwin, Rebecca L; Hedin, Marshal; Agnarsson, Ingi

2014-08-04

Spiders represent an ancient predatory lineage known for their extraordinary biomaterials, including venoms and silks. These adaptations make spiders key arthropod predators in most terrestrial ecosystems. Despite ecological, biomedical, and biomaterial importance, relationships among major spider lineages remain unresolved or poorly supported. Current working hypotheses for a spider "backbone" phylogeny are largely based on morphological evidence, as most molecular markers currently employed are generally inadequate for resolving deeper-level relationships. We present here a phylogenomic analysis of spiders including taxa representing all major spider lineages. Our robust phylogenetic hypothesis recovers some fundamental and uncontroversial spider clades, but rejects the prevailing paradigm of a monophyletic Orbiculariae, the most diverse lineage, containing orb-weaving spiders. Based on our results, the orb web either evolved much earlier than previously hypothesized and is ancestral for a majority of spiders or else it has multiple independent origins, as hypothesized by precladistic authors. Cribellate deinopoid orb weavers that use mechanically adhesive silk are more closely related to a diverse clade of mostly webless spiders than to the araneoid orb-weaving spiders that use adhesive droplet silks. The fundamental shift in our understanding of spider phylogeny proposed here has broad implications for interpreting the evolution of spiders, their remarkable biomaterials, and a key extended phenotype--the spider web. Copyright © 2014 Elsevier Ltd. All rights reserved.

Volatile compounds from leaves of the African spider plant (Gynandropsis gynandra) with bioactivity against spider mite (Tetranychus urticae)

DEFF Research Database (Denmark)

Nyalala, Samuel Odeyo; Petersen, Mikael Agerlin; Grout, Brian William Wilson

2013-01-01

Previous studies have demonstrated that Gynandropsis gynandra emits acetonitrile as a foliar volatile from intact plants and isolated leaves, and that this compound is an effective spider mite repellent. This study has used gas chromatography–mass spectrometry to investigate volatile compounds...... emitted from homogenised G. gynandra leaves to evaluate their tissue acetonitrile content and to look for other compounds that might be exploited for the management of spider mites. Acetonitrile was absent from the homogenised tissues of five lines of G. gynandra, studied over two seasons. Thirteen...... volatile compounds were emitted by G. gynandra at significantly higher levels than mite-susceptible pot roses, including isothiocyanates, aldehydes, esters, alcohols and terpenes. Six representative compounds were selected to assess bioactivity. Spider mite populations were completely inactive after a 2¿h...

Comércio de bromélias no Paraná Bromeliads production and trade in Paraná, Brazil

Directory of Open Access Journals (Sweden)

Adilson Anacleto

2013-04-01

Full Text Available Realizou-se um estudo prospectivo da cadeia produtiva de bromélias no Estado do Paraná, objetivando conhecer o perfil do produtor paranaense, com respectiva capacidade de atender às demandas de mercado, identificar e caracterizar os diferentes níveis da cadeia produtiva e detectar os principais pontos de estrangulamento do desenvolvimento desse setor. Para tanto, foram entrevistados 19 produtores, 160 varejistas e 18 atacadistas. A quantidade de bromélias oriundas da produção do Paraná e aptas ao mercado era de 5.340 plantas ao ano, inferior à demanda do Estado. As condições exigidas pelos varejistas (v e atacadistas (a para aquisição de bromélias dos produtores regionais eram: preço igual ou inferior ao praticado em São Paulo (exigido por: v = 134; a = 18, qualidade da produção condizente com a encontrada no mercado (v = 86; a = 16, capacidade de efetuar entregas periódicas (v = 81; a = 11 e capacidade de atendimento dos pedidos extras (v = 55; a = 7. Não foi encontrado produtor no Estado do Paraná que pudesse atender a todas as exigências de forma simultânea. Os principais entraves que impediam a inserção da produção no mercado regional eram decorrentes da inaplicabilidade dos modelos de gestão da produção rural, adotados pelos produtores, e das incongruências tecnológicas observadas na maioria dos viveiros de cultivo, que resultavam em produção de baixa qualidade.This paper is a prospective study about the bromeliads production and trade in Paraná State, Brazil, which aimed to know the producers' profile in Paraná State with the respective capacity of meeting market demands, identify and characterize the different levels of the bromeliads production chain, as well as detect the main bottlenecks to the development of this sector. A total of 19 producers were interviewed; 160 retailers and 18 wholesalers. The amount of bromeliads from the regional production and suitable to be the traded was 5340 plants per

Invited review current progress and limitations of spider silk for biomedical applications.

Science.gov (United States)

Widhe, Mona; Johansson, Jan; Hedhammar, My; Rising, Anna

2012-06-01

Spider silk is a fascinating material combining remarkable mechanical properties with low density and biodegradability. Because of these properties and historical descriptions of medical applications, spider silk has been proposed to be the ideal biomaterial. However, overcoming the obstacles to produce spider silk in sufficient quantities and in a manner that meets regulatory demands has proven to be a difficult task. Also, there are relatively few studies of spider silk in biomedical applications available, and the methods and materials used vary a lot. Herein we summarize cell culture- and in vivo implantation studies of natural and synthetic spider silk, and also review the current status and future challenges in the quest for a large scale production of spider silk for medical applications. Copyright © 2011 Wiley Periodicals, Inc.

Determination of PCDDs in spider webs: preliminary studies

Science.gov (United States)

Rybak, Justyna; Rutkowski, Radosław

2018-01-01

The application of spider webs for determination of polichlorinated dibenzo-para-dioxins (PCDDs) has been studied for the first time. The aim of the studies was to find out if spider webs are suitable for such examinations as it was proved in the previous research they are excellent indicators of air pollutants. Spiders are ubiquitous, thus collection of samples is easy and non-invasive. Studies were conducted within the city of Wrocław and surroundings, one of the biggest and at the same time heaviest polluted city in Poland. Five research sites have been chosen, where spider webs were collected after 60 days of continuous exposure time. Webs belonging to two genera Tegenaria sylvestris and Tegenaria ferruginea (family Agelenidae) have been chosen as they are large and very dense, thus they are very suitable for such examinations. Webs were found to retain dioxins probably mainly by external exposure. These promising results should be continued and expanded in the future research.

SARS – virus jumps species

Indian Academy of Sciences (India)

SARS – virus jumps species. Coronavirus reshuffles genes; Rotteir et al, Rotterdam showed the virus to jump from cats to mouse cells after single gene mutation ? Human disease due to virus jumping from wild or domestic animals; Present favourite animal - the cat; - edible or domestic.

Spider fauna of semiarid eastern Colorado agroecosystems: diversity, abundance, and effects of crop intensification.

Science.gov (United States)

Kerzicnik, Lauren M; Peairs, Frank B; Cushing, Paula E; Draney, Michael L; Merrill, Scott C

2013-02-01

Spiders are critical predators in agroecosystems. Crop management practices can influence predator density and diversity, which, in turn, can influence pest management strategies. Crop intensification is a sustainable agricultural technique that can enhance crop production although optimizing soil moisture. To date, there is no information on how crop intensification affects natural enemy populations, particularly spiders. This study had two objectives: to characterize the abundance and diversity of spiders in eastern Colorado agroecosystems, and to test the hypothesis that spider diversity and density would be higher in wheat (Triticum aestivum L.) in crop-intensified rotations compared with wheat in conventional rotations. We collected spiders through pitfall, vacuum, and lookdown sampling from 2002 to 2007 to test these objectives. Over 11,000 spiders in 19 families from 119 species were captured from all sampling techniques. Interestingly, the hunting spider guild represented 89% of the spider fauna captured from all sites with the families Gnaphosidae and Lycosidae representing 75% of these spiders. Compared with European agroecosystems, these agroecosystems had greater diversity, which can be beneficial for the biological control of pests. Overall, spider densities were low in these semiarid cropping systems, and crop intensification effects on spider densities were not evident at this scale.

Increase in Jumping Height Associated with Maximal Effort Vertical Depth Jumps.

Science.gov (United States)

Bedi, John F.; And Others

1987-01-01

In order to assess if there existed a statistically significant increase in jumping performance when dropping from different heights, 32 males, aged 19 to 26, performed a series of maximal effort vertical jumps after dropping from eight heights onto a force plate. Results are analyzed. (Author/MT)

What are quantum jumps?

International Nuclear Information System (INIS)

Cook, R.J.

1988-01-01

This paper answers the title question by giving an operational definition of quantum jumps based on measurement theory. This definition forms the basis of a theory of quantum jumps which leads to a number of testable predictions. Experiments are proposed to test the theory. The suggested experiments also test the quantum Zeno paradox, i.e., they test the proposition that frequent observation of a quantum system inhibits quantum jumps in that system. (orig.)

Extended spider cognition.

Science.gov (United States)

Japyassú, Hilton F; Laland, Kevin N

2017-05-01

There is a tension between the conception of cognition as a central nervous system (CNS) process and a view of cognition as extending towards the body or the contiguous environment. The centralised conception requires large or complex nervous systems to cope with complex environments. Conversely, the extended conception involves the outsourcing of information processing to the body or environment, thus making fewer demands on the processing power of the CNS. The evolution of extended cognition should be particularly favoured among small, generalist predators such as spiders, and here, we review the literature to evaluate the fit of empirical data with these contrasting models of cognition. Spiders do not seem to be cognitively limited, displaying a large diversity of learning processes, from habituation to contextual learning, including a sense of numerosity. To tease apart the central from the extended cognition, we apply the mutual manipulability criterion, testing the existence of reciprocal causal links between the putative elements of the system. We conclude that the web threads and configurations are integral parts of the cognitive systems. The extension of cognition to the web helps to explain some puzzling features of spider behaviour and seems to promote evolvability within the group, enhancing innovation through cognitive connectivity to variable habitat features. Graded changes in relative brain size could also be explained by outsourcing information processing to environmental features. More generally, niche-constructed structures emerge as prime candidates for extending animal cognition, generating the selective pressures that help to shape the evolving cognitive system.

Spatiotemporal characteristics of motor actions by blind long jump athletes.

Science.gov (United States)

Torralba, Miguel Angel; Padullés, José María; Losada, Jose Luis; López, Jose Luis

2017-01-01

Blind people depend on spatial and temporal representations to perform activities of daily living and compete in sport. The aim of this study is to determine the spatiotemporal characteristics of long jumps performed by blind athletes and compare findings with those reported for sighted athletes. We analysed a sample of 12 male athletes competing in the F11 Long Jump Finals at the Paralympic Games in London 2012. Performances were recorded using four high-speed cameras, and speeds were measured using a radar speed gun. The images were processed using validated image analysis software. The long jump run-up is shorter in blind athletes than in sighted athletes. We observed statistically significant differences for body centre of mass velocity and an increase in speed over the last three strides prior to take-off, contrasting with reports for sighted athletes and athletes with less severe visual impairment, who maintain or reduce their speed during the last stride. Stride length for the last three strides was the only spatial characteristic that was not significantly associated with effective jump distance. Blind long jumpers extend rather than shorten their last stride. Contact time with the take-off board is longer than that reported for sighted athletes. The actions of blind long jumpers, unlike those without disabilities, do not vary their leg actions during the final runway approach for optimal placement on the take-off board.

Proximal and Distal Predictors of the Spider Monkey's Stress Levels in Fragmented Landscapes.

Directory of Open Access Journals (Sweden)

José D Ordóñez-Gómez

Full Text Available The rapid loss, fragmentation and degradation of tropical forests threaten the survival of many animal species. However, the way in which these phenomena affect animal health has been poorly explored, thus limiting the design of appropriate conservation strategies. To address this, here we identified using linear mixed models the effect of proximal (diet, activity pattern, hunting and logging and distal (sum of the basal areas of fruiting-tree species [SBAFS], landscape forest cover and degree of forest fragmentation variables over fecal glucocorticoid metabolite (fGCM levels-hormones associated with animal health and fitness-of six groups of spider monkeys (Ateles geoffroyi inhabiting six landscapes with different spatial structures in Mexico. Proximal variables showed a stronger predictive power over fGCMs than distal. In this sense, increases in travel time, the occurrence of hunting, and reductions in rest time and fruit consumption resulted in higher fGCM levels. Regarding distal variables, increases in SBAFS were negatively related to fGCM levels, thus suggesting that food scarcity increases stress hormone levels. Nevertheless, contrary to theoretical expectations, spider monkeys living in smaller tracts of forest spent less time travelling, but the same time feeding on fruit as those in more forested areas. The lower net energy return associated with this combination of factors would explain why, contrary to theoretical expectations, increased forest cover was associated with increased levels of fGCMs in these groups. Our study shows that, at least in the short term, spider monkeys in fragmented landscapes do not always present higher levels of stress hormones compared to those inhabiting continuous forest, and the importance of preserving fruit sources and controlling hunting for reducing the levels of stress hormones in free ranging spider monkeys.

A comparison of spider communities in Bt and non-Bt rice fields.

Science.gov (United States)

Lee, Sue Yeon; Kim, Seung Tae; Jung, Jong Kook; Lee, Joon-Ho

2014-06-01

To assess the potential adverse effects of a Bt rice line (Japonica rice cultivar, Nakdong) expressing a synthetic cry1Ac1 gene, C7-1-9-1-B, which was highly active against all larval stages of Cnaphalocrocis medinalis (Guenée) (Lepidoptera: Crambidae), we investigated the community structure of spiders in Bt and non-Bt rice fields during the rice-growing season in 2007 and 2008 in Chungcheongnam-do, Korea. Spiders were surveyed with a sweep net and suction device. Suction sampling captured more spiders, measured in terms of species level and abundance, than sweeping. Araneidae and Thomisidae were captured more by sweeping, and certain species were captured only by sweeping. These findings show that both suction and sweep sampling methods should be used because these methods are most likely complementary. In total, 29 species in 23 genera and nine families were identified from the 4,937 spiders collected, and both Bt and non-Bt rice fields showed a typical Korean spider assemblage. The temporal patterns of spider species richness and spider abundance were very similar between Bt and non-Bt rice, although significant differences in species richness were observed on a few occasions. Overall, spider community structure, including diversity, the dominant species, and abundance did not differ between Bt and non-Bt rice. The results of the study indicated that the transgenic Cry1Ac rice lines tested in this study had no adverse effects on the spider community structure of the rice fields.

Edge effect on weevils and spiders

OpenAIRE

Horváth, R.; Magura, T.; Péter, G.; Tóthmérész, B.

2002-01-01

The edge effect on weevils and spiders was tested along oak forest – meadow transects using sweep-net samples at the Síkfökút Project in Hungary. For spiders the species richness was significantly higher in the forest edge than either in the meadow or the forest interior. For weevils the species richness of the forest edge was higher than that of the meadow, but the difference was not statistically significant whereas the species richness of the forest...

Cuticular bacteria appear detrimental to social spiders in mixed but not monoculture exposure

Science.gov (United States)

Keiser, Carl N.; Shearer, Taylor A.; DeMarco, Alexander E.; Brittingham, Hayley A.; Knutson, Karen A.; Kuo, Candice; Zhao, Katherine; Pruitt, Jonathan N.

2016-01-01

Abstract Much of an animal’s health status, life history, and behavior are dictated by interactions with its endogenous and exogenous bacterial communities. Unfortunately, interactions between hosts and members of their resident bacterial community are often ignored in animal behavior and behavioral ecology. Here, we aim to identify the nature of host–microbe interactions in a nonmodel organism, the African social spider Stegodyphus dumicola. We collected and identified bacteria from the cuticles of spiders in situ and then exposed spiders to bacterial monocultures cultures via topical application or injection. We also topically inoculated spiders with a concomitant “cocktail” of bacteria and measured the behavior of spiders daily for 24 days after inoculation. Lastly, we collected and identified bacteria from the cuticles of prey items in the capture webs of spiders, and then fed spiders domestic crickets which had been injected with these bacteria. We also injected 1 species of prey-borne bacteria into the hemolymph of spiders. Only Bacillus thuringiensis caused increased mortality when injected into the hemolymph of spiders, whereas no bacterial monocultures caused increased mortality when applied topically, relative to control solutions. However, a bacterial cocktail of cuticular bacteria caused weight loss and mortality when applied topically, yet did not detectibly alter spider behavior. Consuming prey injected with prey-borne bacteria was associated with an elongated lifespan in spiders. Thus, indirect evidence from multiple experiments suggests that the effects of these bacteria on spider survivorship appear contingent on their mode of colonization and whether they are applied in monoculture or within a mixed cocktail. We urge that follow-up studies should test these host–microbe interactions across different social contexts to determine the role that microbes play in colony performance. PMID:29491926

The time course of location-avoidance learning in fear of spiders.

Science.gov (United States)

Rinck, Mike; Koene, Marieke; Telli, Sibel; Moerman-van den Brink, Wiltine; Verhoeven, Barbara; Becker, Eni S

2016-01-01

Two experiments were designed to study the time course of avoidance learning in spider fearfuls (SFs) under controlled experimental conditions. To achieve this, we employed an immersive virtual environment (IVE): While walking freely through a virtual art museum to search for specific paintings, the participants were exposed to virtual spiders. Unbeknown to the participants, only two of four museum rooms contained spiders, allowing for avoidance learning. Indeed, the more SF the participants were, the faster they learned to avoid the rooms that contained spiders (Experiment. 1), and within the first six trials, high fearfuls already developed a preference for starting their search task in rooms without spiders (Experiment 2). These results illustrate the time course of avoidance learning in SFs, and they speak to the usefulness of IVEs in fundamental anxiety research.

Edge effect on weevils and spiders

Directory of Open Access Journals (Sweden)

R. Horváth

2002-05-01

Full Text Available The edge effect on weevils and spiders was tested along oak forest – meadow transects using sweep-net samples at the Síkfökút Project in Hungary. For spiders the species richness was significantly higher in the forest edge than either in the meadow or the forest interior. For weevils the species richness of the forest edge was higher than that of the meadow, but the difference was not statistically significant whereas the species richness of the forest interior was significantly lower than that of the forest edge and the meadow. The composition of the spider assemblage of the edge was more similar to the forest, while the composition of weevils in the edge was more similar to the meadow. Our results based on two invertebrate groups operating on different trophic levels suggest that there is a significant edge effect for the studied taxa resulting in higher species richness in the edge.

Endemic harvestmen and spiders of Austria (Arachnida: Opiliones, Araneae

Directory of Open Access Journals (Sweden)

Komposch, Christian

2011-01-01

Full Text Available A comprehensive overview of plant, fungus and animal species of Austria revealed a total of 748 endemic and subendemic species, including, 11 harvestman and 46 spider species. Altogether two endemic harvestmen (Nemastoma bidentatum relictum, Nemastoma schuelleri and 8 endemic spiders (Abacoproeces molestus, Collinsia (caliginosa nemenziana, Mughiphantes severus, Mughiphantes styriacus, Pelecopsis alpica, Scotophaeus nanus, Troglohyphantes novicordis, Troglohyphantes tauriscus, beside 9 subendemic harvestman and 38 subendemic spider species have been recorded from Austria. Hot-spots of endemism in the Eastern Alps are the north-eastern (Ennstaler Alps and southern Calcareous Alps (Karawanken, Karnische Alps and the Central Alps (Hohe Tauern, Gurktaler Alps, Ötztaler and Stubaier Alps. Most of the endemic arachnid species occur from the nival down to the montane zone. Important habitats are rocky areas, caves and woodlands. High absolute numbers and percentages of endemics can be found within the harvestman families Cladonychiidae, Ischyropsalididae and Nemastomatidae and in the spider genera Lepthyphantes s. l. and Troglohyphantes. The conservation status of these highly endangered taxa – 85 % of the spider species and 100 % of the harvestman taxa are endangered in Austria – is poor.

SPIDER: A Framework for Understanding Driver Distraction.

Science.gov (United States)

Strayer, David L; Fisher, Donald L

2016-02-01

The objective was to identify key cognitive processes that are impaired when drivers divert attention from driving. Driver distraction is increasingly recognized as a significant source of injuries and fatalities on the roadway. A "SPIDER" model is developed that identifies key cognitive processes that are impaired when drivers divert attention from driving. SPIDER is an acronym standing for scanning, predicting, identifying, decision making, and executing a response. When drivers engage in secondary activities unrelated to the task of driving, SPIDER-related processes are impaired, situation awareness is degraded, and the ability to safely operate a motor vehicle may be compromised. The pattern of interference helps to illuminate the sources of driver distraction and may help guide the integration of new technology into the automobile. © 2015, Human Factors and Ergonomics Society.

Information processing biases in spider phobia: application of the Stroop and "White Noise" Paradigm.

Science.gov (United States)

Olatunji, Bunmi O; Sawchuk, Craig N; Lee, Thomas C; Lohr, Jeffrey M; Tolin, David F

2008-06-01

The present study examines attentional and implicit memory biases in spider phobic and nonphobic participants. The results showed that spider phobics demonstrated increased interference for neutral, negative, and spider-relevant words on a computerized Stroop task. However, no group differences emerged when adjusting for differences in color-naming speed. Prior exposure to a dead spider did result in higher overall Stroop interference in spider phobics and this appeared to be mostly pronounced for spider-relevant words. Implicit memory bias for threat was examined with a noise judgment task. Participants first heard neutral and spider-relevant sentences and implicit memory for these sentences was evaluated by having participants rate the volume of noise accompanying the presentation of old sentences intermixed with new sentences. An implicit memory bias is indicated if participants rate noise accompanying old sentences as less loud than noise accompanying new sentences. No evidence was found for an implicit memory bias in spider phobics. These findings are discussed in relation to the role of information processing biases in spider phobia.

Jump probabilities in the non-Markovian quantum jump method

International Nuclear Information System (INIS)

Haerkoenen, Kari

2010-01-01

The dynamics of a non-Markovian open quantum system described by a general time-local master equation is studied. The propagation of the density operator is constructed in terms of two processes: (i) deterministic evolution and (ii) evolution of a probability density functional in the projective Hilbert space. The analysis provides a derivation for the jump probabilities used in the recently developed non-Markovian quantum jump (NMQJ) method (Piilo et al 2008 Phys. Rev. Lett. 100 180402).

Spider diversity in coffee agroecosystems: the influence of agricultural intensification and aggressive ants.

Science.gov (United States)

Marín, Linda; Perfecto, Ivette

2013-04-01

Spiders are a very diverse group of invertebrate predators found in agroecosystems and natural systems. However, spider distribution, abundance, and eventually their ecological function in ecosystems can be influenced by abiotic and biotic factors such as agricultural intensification and dominant ants. Here we explore the influence of both agricultural intensification and the dominant arboreal ant Azteca instabilis on the spider community in coffee agroecosystems in southern Mexico. To measure the influence of the arboreal ant Azteca instabilis (F. Smith) on the spider community inhabiting the coffee layer of coffee agroecosystems, spiders were collected from coffee plants that were and were not patrolled by the ant in sites differing in agricultural intensification. For 2008, generalized linear mixed models showed that spider diversity was affected positively by agricultural intensification but not by the ant. However, results suggested that some spider species were associated with A. instabilis. Therefore, in 2009 we concentrated our research on the effect of A. instabilis on spider diversity and composition. For 2009, generalized linear mixed models show that spider richness and abundance per plant were significantly higher in the presence of A. instabilis. In addition, analyses of visual counts of insects and sticky traps data show that more resources were present in plants patrolled by the ant. The positive effect of A. instabilis on spiders seems to be caused by at least two mechanisms: high abundance of insects and protection against predators.

Realized Jump Risk and Equity Return in China

Directory of Open Access Journals (Sweden)

Guojin Chen

2014-01-01

Full Text Available We utilize the realized jump components to explore a new jump (including nonsystematic jump and systematic jump risk factor model. After estimating daily realized jumps from high-frequency transaction data of the Chinese A-share stocks, we calculate monthly jump size, monthly jump standard deviation, and monthly jump arrival rate and then use those monthly jump factors to explain the return of the following month. Our empirical results show that the jump tail risk can explain the equity return. For the large capital-size stocks, large cap stock portfolios, and index, one-month lagged jump risk factor significantly explains the asset return variation. Our results remain the same even when we add the size and value factors in the robustness tests.

Theory of boiling-up jump

International Nuclear Information System (INIS)

Labuntsov, D.A.; Avdeev, A.A.

1981-01-01

Concept of boiling-up jump representing a zone of intense volume boiling-up separating overtaking flow of overheated metastable liquid from an area of equilibrium flow located below along the flow is introduced. It is shown that boiling-up jump is a shock wave of rarefaction. It is concluded that entropy increment occurs on the jump. Characteristics of adiabatic shock wave curve of boiling- up in ''pressure-specific volume'' coordinates have been found and its form has been investigated. Stability of boiling-up jump has been analyzed as well. On the basis of approach developed analysis is carried out on the shock adiobatic curve of condensation. Concept of boiling-up jump may be applied to the analysis of boiling-up processes when flowing liquid through packings during emergency pressure drop etc [ru

First record of genus Siler Simon, 1889 (Araneae: Salticidae from India

Directory of Open Access Journals (Sweden)

Siddharth Kulkarni

2015-08-01

Full Text Available The jumping spider Siler semiglaucus (Simon, 1901 has been newly reported from India, based on specimens studied from South India. These spiders were observed feeding on all life stages of Technomyrmex ants. 

Reconstitutable control rod spider assembly

International Nuclear Information System (INIS)

Shallenberger, J.M.; Ferian, S.J.

1990-01-01

A reconstitutable control rod/spider assembly includes a hollow connecting finger of the spider having a pair of opposing flat segments formed on the interior thereof and engaging a pair of opposing flat sectors formed on the exterior of a stem extending form the upper end of control rod. The stem also has an externally-threaded portion engaging a nut and a pilot aligning portion for the nut. The nut has a radially flexible and expandable thread-defining element captured in its bore. The segments and sectors allow the rod to be removed and reattached after turning through 180 0 to allow more even wear on the rod. (author)

Variability in core areas of spider monkeys (Ateles geoffroyi) in a tropical dry forest in Costa Rica.

Science.gov (United States)

Asensio, Norberto; Schaffner, Colleen M; Aureli, Filippo

2012-04-01

Core areas are highly used parts of the home range on which the survival of solitary or group-living animals depends. We investigated the home range and core area size and area fidelity of a spider monkey community in a tropical dry forest over a 4-year period. Home ranges overlapped extensively across years, subgroup sizes, and seasons. In contrast, spider monkeys used core areas that varied in size and location across the study years, subgroup sizes, and seasons. These shifts in core areas suggest that the understanding of core areas, and thus the spatial requirements, of a species in a particular habitat may be limited if based on short-term studies. In this respect, our findings emphasize the importance of long-term studies of the spatial ecology of any species in a particular habitat. Our study also shows that the yearly home range basically includes all the core areas from different years, seasons, and subgroup sizes (i.e., the super-core area). This is conceptually important for territorial species, such as spider monkeys, which defend a stable home range as it contains not only the current, but also the future core areas.

Phylogenomics, Diversification Dynamics, and Comparative Transcriptomics across the Spider Tree of Life.

Science.gov (United States)

Fernández, Rosa; Kallal, Robert J; Dimitrov, Dimitar; Ballesteros, Jesús A; Arnedo, Miquel A; Giribet, Gonzalo; Hormiga, Gustavo

2018-05-07

Dating back to almost 400 mya, spiders are among the most diverse terrestrial predators [1]. However, despite considerable effort [1-9], their phylogenetic relationships and diversification dynamics remain poorly understood. Here, we use a synergistic approach to study spider evolution through phylogenomics, comparative transcriptomics, and lineage diversification analyses. Our analyses, based on ca. 2,500 genes from 159 spider species, reject a single origin of the orb web (the "ancient orb-web hypothesis") and suggest that orb webs evolved multiple times since the late Triassic-Jurassic. We find no significant association between the loss of foraging webs and increases in diversification rates, suggesting that other factors (e.g., habitat heterogeneity or biotic interactions) potentially played a key role in spider diversification. Finally, we report notable genomic differences in the main spider lineages: while araneoids (ecribellate orb-weavers and their allies) reveal an enrichment in genes related to behavior and sensory reception, the retrolateral tibial apophysis (RTA) clade-the most diverse araneomorph spider lineage-shows enrichment in genes related to immune responses and polyphenic determination. This study, one of the largest invertebrate phylogenomic analyses to date, highlights the usefulness of transcriptomic data not only to build a robust backbone for the Spider Tree of Life, but also to address the genetic basis of diversification in the spider evolutionary chronicle. Copyright © 2018 Elsevier Ltd. All rights reserved.

Spiders (Araneae) Found in Bananas and Other International Cargo Submitted to North American Arachnologists for Identification.

Science.gov (United States)

Vetter, Richard S; Crawford, Rodney L; Buckle, Donald J

2014-11-01

Spiders found in international cargo brought into North America are sometimes submitted to arachnologists for identification. Often, these spiders are presumed to be of medical importance because of size or a submitter's familiarity with a toxic spider genus from the continent of origin. Starting in 2006, requests were made for spiders found in international cargo brought into North America, in addition to the specimens from similar cargo shipments already in our museum collections. This was an ad hoc study that allowed us to focus on spiders of concern to the discoverer. We identified 135 spiders found in international cargo. A key for the most common species is provided. The most frequently submitted spiders were the pantropical huntsman spider, Heteropoda venatoria (L.) (Sparassidae), and the redfaced banana spider, Cupiennius chiapanensis Medina Soriano (Ctenidae). Spiders of medical importance were rare. The most common cargo from which spiders were submitted was bananas with most specimens coming from Central America, Ecuador, or Colombia. Lack of experience with nonnative fauna caused several experienced American arachnologists to misidentify harmless ctenid spiders (C. chiapanensis, spotlegged banana spider, Cupiennius getazi Simon) as highly toxic Phoneutria spiders. These misidentifications could have led to costly, unwarranted prophylactic eradication measures, unnecessary employee health education, heightened employee anxiety and spoilage when perishable goods are left unloaded due to safety concerns. © 2014 Entomological Society of America.

Remote monitoring of vibrational information in spider webs

Science.gov (United States)

Mortimer, B.; Soler, A.; Siviour, C. R.; Vollrath, F.

2018-06-01

Spiders are fascinating model species to study information-acquisition strategies, with the web acting as an extension of the animal's body. Here, we compare the strategies of two orb-weaving spiders that acquire information through vibrations transmitted and filtered in the web. Whereas Araneus diadematus monitors web vibration directly on the web, Zygiella x-notata uses a signal thread to remotely monitor web vibration from a retreat, which gives added protection. We assess the implications of these two information-acquisition strategies on the quality of vibration information transfer, using laser Doppler vibrometry to measure vibrations of real webs and finite element analysis in computer models of webs. We observed that the signal thread imposed no biologically relevant time penalty for vibration propagation. However, loss of energy (attenuation) was a cost associated with remote monitoring via a signal thread. The findings have implications for the biological use of vibrations by spiders, including the mechanisms to locate and discriminate between vibration sources. We show that orb-weaver spiders are fascinating examples of organisms that modify their physical environment to shape their information-acquisition strategy.

Environmental and hormonal factors controlling reversible colour change in crab spiders.

Science.gov (United States)

Llandres, Ana L; Figon, Florent; Christidès, Jean-Philippe; Mandon, Nicole; Casas, Jérôme

2013-10-15

Habitat heterogeneity that occurs within an individual's lifetime may favour the evolution of reversible plasticity. Colour reversibility has many different functions in animals, such as thermoregulation, crypsis through background matching and social interactions. However, the mechanisms underlying reversible colour changes are yet to be thoroughly investigated. This study aims to determine the environmental and hormonal factors underlying morphological colour changes in Thomisus onustus crab spiders and the biochemical metabolites produced during these changes. We quantified the dynamics of colour changes over time: spiders were kept in yellow and white containers under natural light conditions and their colour was measured over 15 days using a spectrophotometer. We also characterised the chemical metabolites of spiders changing to a yellow colour using HPLC. Hormonal control of colour change was investigated by injecting 20-hydroxyecdysone (20E) into spiders. We found that background colouration was a major environmental factor responsible for colour change in crab spiders: individuals presented with white and yellow backgrounds changed to white and yellow colours, respectively. An ommochrome precursor, 3-OH-kynurenine, was the main pigment responsible for yellow colour. Spiders injected with 20E displayed a similar rate of change towards yellow colouration as spiders kept in yellow containers and exposed to natural sunlight. This study demonstrates novel hormonal manipulations that are capable of inducing reversible colour change.

Small Molecules from Spiders Used as Chemical Probes

DEFF Research Database (Denmark)

Olsen, Christian Adam; Kristensen, Anders S.; Strømgaard, Kristian

2011-01-01

Spiders are important species in ecological systems and as major predators of insects they are endowed with a plethora of low‐molecular‐weight natural products having intriguing biological activities. The isolation and biological characterization of these entities are well established, however......, only very recently have these compounds been used as templates for the design, synthesis, and biological evaluation of synthetic analogues. In contrast, the investigation of compounds responsible for chemical communication between spiders is far less developed, but recently new light has been shed onto...... the area of pheromones and allomones from spiders. Herein, we recapitulate these recent results, put them into perspective with previous findings, and provide an outlook for future studies of these chemotypes....

Measurement of K-shell absorption jump factors and jump ratios in some lanthanide elements using EDXRF technique

International Nuclear Information System (INIS)

Polat, Recep; İçelli, Orhan; Yalçın, Zeynel; Pesen, Erhan; Orak, Salim

2013-01-01

Highlights: ► Mass attenuation coefficients, jump factor and jump ratio for lanthanide elements are obtained. ► The method used in this experiment is combined both transmission and scattering geometry. ► Secondary gamma rays energy is 59.5 keV. ► Experimental values of jump factor and jump ratio for K shell are new. ► The experimental values are in good agreement with those calculated theoretically. - Abstract: 59.5 keV gamma rays scattered by an aluminum foil have been used as a radiation source to measure the absorption jump factor and jump ratios for absorbers Ce, Pr, Nd, Sm, Eu and Tb. The theoretical and experimental values are compared with the corresponding ones in the literature

BPS Jumping Loci are Automorphic

Science.gov (United States)

Kachru, Shamit; Tripathy, Arnav

2018-06-01

We show that BPS jumping loci-loci in the moduli space of string compactifications where the number of BPS states jumps in an upper semi-continuous manner—naturally appear as Fourier coefficients of (vector space-valued) automorphic forms. For the case of T 2 compactification, the jumping loci are governed by a modular form studied by Hirzebruch and Zagier, while the jumping loci in K3 compactification appear in a story developed by Oda and Kudla-Millson in arithmetic geometry. We also comment on some curious related automorphy in the physics of black hole attractors and flux vacua.

Exploring of the first recorded spider (Arachenida: Aranae species of Sheringal, Khyber Pakhtunkhwa, Pakistan

Directory of Open Access Journals (Sweden)

Farzana Perveen

2015-09-01

Full Text Available The spiders (Arthropoada: Arachenida are one of the groups of grasping animals. Their carapaces are found on the dorsal side of the cephalothorax, which is an important characteristic of spiders. The present study was conducted to explore the first recorded spider species (nti=75 of Sheringal, Dir Upper (DU, Khyber Pakhtunkhwa (KP, Dir Upper, Khyber Pakhtunkhwa, Pakistan. The 10 genera with 10 species under 7 families were recorded from June 2013-July 2014. According to length of legs, the largest spider was the huntsman spider, Halconia insignis Thorell having length of the first leg was 1.9±0.20, however, the same of the last leg was 1.44±0.25 (n=9. In the same contest, the smallest spider was the ground spider, Gnaphosa eucalyptus Ghafoor and Beg having length of the first leg was 0.4±0.08, while the same of the last leg was 0.4±0.08 (n=3. According to length of cephalothorax and abdomen, the largest spider was the wolf spider, Hippasa partita Takidar having length of the cephalothorax was 1.1±0.01, however, the same of the abdomen was 0.7±0.1 (n=6. In the same contest, the smallest spider was the harvestmen, Hadrobunus grandis Sundevall having length of the cephalothorax was 0.1±0.04, while the same of the abdomen was 0.3±0.04 (n=12. During present research, 10 spider species of Sheringal with different sizes were explored. The present research will be useful to educate and create awareness about spiders in the people of Sheringal.

Optical surface profiling of orb-web spider capture silks

Energy Technology Data Exchange (ETDEWEB)

Kane, D M; Joyce, A M; Staib, G R [Department of Physics, Macquarie University, Sydney, NSW 2109 (Australia); Herberstein, M E, E-mail: deb.kane@mq.edu.a [Department of Biological Sciences, Macquarie University, Sydney, NSW 2109 (Australia)

2010-09-15

Much spider silk research to date has focused on its mechanical properties. However, the webs of many orb-web spiders have evolved for over 136 million years to evade visual detection by insect prey. It is therefore a photonic device in addition to being a mechanical device. Herein we use optical surface profiling of capture silks from the webs of adult female St Andrews cross spiders (Argiope keyserlingi) to successfully measure the geometry of adhesive silk droplets and to show a bowing in the aqueous layer on the spider capture silk between adhesive droplets. Optical surface profiling shows geometric features of the capture silk that have not been previously measured and contributes to understanding the links between the physical form and biological function. The research also demonstrates non-standard use of an optical surface profiler to measure the maximum width of a transparent micro-sized droplet (microlens).

Optical surface profiling of orb-web spider capture silks

International Nuclear Information System (INIS)

Kane, D M; Joyce, A M; Staib, G R; Herberstein, M E

2010-01-01

Much spider silk research to date has focused on its mechanical properties. However, the webs of many orb-web spiders have evolved for over 136 million years to evade visual detection by insect prey. It is therefore a photonic device in addition to being a mechanical device. Herein we use optical surface profiling of capture silks from the webs of adult female St Andrews cross spiders (Argiope keyserlingi) to successfully measure the geometry of adhesive silk droplets and to show a bowing in the aqueous layer on the spider capture silk between adhesive droplets. Optical surface profiling shows geometric features of the capture silk that have not been previously measured and contributes to understanding the links between the physical form and biological function. The research also demonstrates non-standard use of an optical surface profiler to measure the maximum width of a transparent micro-sized droplet (microlens).

Spiders do not evoke greater early posterior negativity in the event-related potential as snakes.

Science.gov (United States)

He, Hongshen; Kubo, Kenta; Kawai, Nobuyuki

2014-09-10

It has been long believed that both snakes and spiders are archetypal fear stimuli for humans. Furthermore, snakes have been assumed as stronger threat cues for nonhuman primates. However, it is still unclear whether spiders hold a special status in human perception. The current study explored to what extent spider pictures draw early visual attention [as assessed with early posterior negativity (EPN)] when compared with insects similar to spiders. To measure the EPN, participants watched a random rapid serial presentation of pictures, which consisted of two conditions: spider condition (spider, wasp, bumblebee, beetle) and snake condition (snake, bird). EPN amplitudes revealed no significant difference between spider, wasp, bumblebee, and beetle pictures, whereas EPN amplitudes were significantly larger for snake pictures relative to bird pictures. In addition, EPN amplitudes were significantly larger for snake pictures relative to spider pictures. These results suggest that the early visual attentional capture of animate objects is stronger for snakes, whereas spiders do not appear to hold special early attentional value.

Solubilization of spider silk proteins and its structural analysis using Fourier transform infrared spectroscopy

Science.gov (United States)

Osbin, K.; Jayan, Manuel; Bhadrakumari, S.; Predeep, P.

2017-06-01

This study investigates the presence of various amide bands present in different spider silk species, which provides extraordinary physical properties. Three different spider silks were collected from Western Ghats region. The collected spider silks samples belonging to the spider Heteropoda venatoria (species 1), Hersilia savignyi (species 2) and Pholcus phalangioides (species 3). Fourier transform infrared (FTIR) spectra reveals the protein peaks in the amide I, II, and III regions in all the three types of spider silk species.

How informative are case studies of spider bites in the medical literature?

Science.gov (United States)

Stuber, Marielle; Nentwig, Wolfgang

2016-05-01

We analyzed the reliability and information content of 134 medical case studies on spider bites, published in 91 journal articles. Overall, we found that only 22% of these studies fulfilled the criteria for a verified spider bite. This means that the majority of such case studies cannot be attributed to a given spider species and usually not even to a spider. Their scientific value is negligible, moreover, such publications are even dangerous because they suggest incorrect conclusions. Secondly, we found that such case studies usually do not follow an obvious structure and many details on the development of symptoms, therapy and healing process are widely lacking. So even for verified spider bites, the comparability of case studies is limited. We discuss the obvious failure of a reviewing process for case studies and give recommendations how to increase the currently low information content of medical case studies on spider bites. Copyright © 2016 Elsevier Ltd. All rights reserved.

Rapid visuomotor processing of phobic images in spider- and snake-fearful participants.

Science.gov (United States)

Haberkamp, Anke; Schmidt, Filipp; Schmidt, Thomas

2013-10-01

This study investigates enhanced visuomotor processing of phobic compared to fear-relevant and neutral stimuli. We used a response priming design to measure rapid, automatic motor activation by natural images (spiders, snakes, mushrooms, and flowers) in spider-fearful, snake-fearful, and control participants. We found strong priming effects in all tasks and conditions; however, results showed marked differences between groups. Most importantly, in the group of spider-fearful individuals, spider pictures had a strong and specific influence on even the fastest motor responses: Phobic primes entailed the largest priming effects, and phobic targets accelerated responses, both effects indicating speeded response activation by phobic images. In snake-fearful participants, this processing enhancement for phobic material was less pronounced and extended to both snake and spider images. We conclude that spider phobia leads to enhanced processing capacity for phobic images. We argue that this is enabled by long-term perceptual learning processes. © 2013.

Who is afraid of a black Spider(-Man)?

OpenAIRE

Ora C. McWilliams

2013-01-01

An Internet post asking about Spider-Man's race in a film turned into an Internet campaign about an actor that led fans to interact with each other as well as with the actor, which in turn led to the attention of media producers, which resulted in a change in Spider-Man's race in a print comic book.

Factors that influence the beta-diversity of spider communities in northwestern Argentinean Grasslands

Directory of Open Access Journals (Sweden)

Sandra M. Rodriguez-Artigas

2016-04-01

Full Text Available Beta-diversity, defined as spatial replacement in species composition, is crucial to the understanding of how local communities assemble. These changes can be driven by environmental or geographic factors (such as geographic distance, or a combination of the two. Spiders have been shown to be good indicators of environmental quality. Accordingly, spiders are used in this work as model taxa to establish whether there is a decrease in community similarity that corresponds to geographic distance in the grasslands of the Campos & Malezales ecoregion (Corrientes. Furthermore, the influence of climactic factors and local vegetation heterogeneity (environmental factors on assemblage composition was evaluated. Finally, this study evaluated whether the differential dispersal capacity of spider families is a factor that influences their community structure at a regional scale. Spiders were collected with a G-Vac from vegetation in six grassland sites in the Campos & Malezales ecoregion that were separated by a minimum of 13 km. With this data, the impact of alpha-diversity and different environmental variables on the beta-diversity of spider communities was analysed. Likewise, the importance of species replacement and nesting on beta-diversity and their contribution to the regional diversity of spider families with different dispersion capacities was evaluated. The regional and site-specific inventories obtained were complete. The similarity between spider communities declined as the geographic distance between sites increased. Environmental variables also influenced community composition; stochastic events and abiotic forces were the principal intervening factors in assembly structure. The differential dispersal capacity of spider groups also influenced community structure at a regional scale. The regional beta-diversity, as well as species replacement, was greater in high and intermediate vagility spiders; while nesting was greater in spiders with low

Optimal Ski Jump

Science.gov (United States)

Rebilas, Krzysztof

2013-01-01

Consider a skier who goes down a takeoff ramp, attains a speed "V", and jumps, attempting to land as far as possible down the hill below (Fig. 1). At the moment of takeoff the angle between the skier's velocity and the horizontal is [alpha]. What is the optimal angle [alpha] that makes the jump the longest possible for the fixed magnitude of the…

Nutrient Deprivation Induces Property Variations in Spider Gluey Silk

Science.gov (United States)

Blamires, Sean J.; Sahni, Vasav; Dhinojwala, Ali; Blackledge, Todd A.; Tso, I-Min

2014-01-01

Understanding the mechanisms facilitating property variability in biological adhesives may promote biomimetic innovations. Spider gluey silks such as the spiral threads in orb webs and the gumfoot threads in cobwebs, both of which comprise of an axial thread coated by glue, are biological adhesives that have variable physical and chemical properties. Studies show that the physical and chemical properties of orb web gluey threads change when spiders are deprived of food. It is, however, unknown whether gumfoot threads undergo similar property variations when under nutritional stress. Here we tested whether protein deprivation induces similar variations in spiral and gumfoot thread morphology and stickiness. We manipulated protein intake for the orb web spider Nephila clavipes and the cobweb spider Latrodectus hesperus and measured the diameter, glue droplet volume, number of droplets per mm, axial thread width, thread stickiness and adhesive energy of their gluey silks. We found that the gluey silks of both species were stickier when the spiders were deprived of protein than when the spiders were fed protein. In N. clavipes a concomitant increase in glue droplet volume was found. Load-extension curves showed that protein deprivation induced glue property variations independent of the axial thread extensions in both species. We predicted that changes in salt composition of the glues were primarily responsible for the changes in stickiness of the silks, although changes in axial thread properties might also contribute. We, additionally, showed that N. clavipes' glue changes color under protein deprivation, probably as a consequence of changes to its biochemical composition. PMID:24523902

Structure–Activity Relationship Study of Spider Polyamine Toxins as Inhibitors of Ionotropic Glutamate Receptors

DEFF Research Database (Denmark)

Xiong, Xiaofeng; Poulsen, Mette H; Hussein, Rama A

2014-01-01

The spider polyamine toxins Joro spider toxin-3 (JSTX-3) and Nephila polyamine toxins-1 and -8 (NPTX-1 and NPTX-8) are isolated from the venom of the orb-weaver spider Nephila clavata (Joro spider). They share a high degree of structural resemblance, their aromatic head groups being the only...

Record breaking achievements by spiders and the scientists who study them.

Science.gov (United States)

Mammola, Stefano; Michalik, Peter; Hebets, Eileen A; Isaia, Marco

2017-01-01

Organismal biology has been steadily losing fashion in both formal education and scientific research. Simultaneous with this is an observable decrease in the connection between humans, their environment, and the organisms with which they share the planet. Nonetheless, we propose that organismal biology can facilitate scientific observation, discovery, research, and engagement, especially when the organisms of focus are ubiquitous and charismatic animals such as spiders. Despite being often feared, spiders are mysterious and intriguing, offering a useful foundation for the effective teaching and learning of scientific concepts and processes. In order to provide an entryway for teachers and students-as well as scientists themselves-into the biology of spiders, we compiled a list of 99 record breaking achievements by spiders (the "Spider World Records"). We chose a world-record style format, as this is known to be an effective way to intrigue readers of all ages. We highlighted, for example, the largest and smallest spiders, the largest prey eaten, the fastest runners, the highest fliers, the species with the longest sperm, the most venomous species, and many more. We hope that our compilation will inspire science educators to embrace the biology of spiders as a resource that engages students in science learning. By making these achievements accessible to non-arachnologists and arachnologists alike, we suggest that they could be used: (i) by educators to draw in students for science education, (ii) to highlight gaps in current organismal knowledge, and (iii) to suggest novel avenues for future research efforts. Our contribution is not meant to be comprehensive, but aims to raise public awareness on spiders, while also providing an initial database of their record breaking achievements.

Colonization of subterranean habitats by spiders in Central Europe

Directory of Open Access Journals (Sweden)

Vlastimil Růžička

2013-05-01

Full Text Available Using data from the Czech Republic, we studied the distribution of spiders in soils, crevice systems, scree and caves, i.e. subterranean habitats at depths spanning from 10 cm to 100 m. In total, we found 161 species. The number of species declines with increasing habitat depth, with a major drop in species richness at the depth of 10 meters. Thirteen species exhibit morphological adaptations to life in subterranean habitats. At depths greater than 10 meters, spider assemblages are almost exclusively composed of troglomorphic species. We propose a hypothesis of evolution of troglomorphisms at spiders during Quaternary climatic cycles.

Distribution and importance of spiders inhabiting a Brazilian sugar cane plantation

Directory of Open Access Journals (Sweden)

Isabela Maria Piovesan Rinaldi

2002-07-01

Full Text Available The spider fauna (Araneae of a sugar eane plantation was surveyed monthly by hand colteetion and beating vegetation in sugar cane fields across Botucatu, State of São Paulo, Brazil. Composition and rchness (family and species where identifieation to species was possible microhabitat preferenees were reeorded, and diversity and evenness indices were calculated. A total of 1291 spiders belonging to 73 species and 20 families were collected. The most diverse families were Theridiidae, Salticidae, and Araneidae, and the most abundant ones were Theridiidae, Saltieidae, Anyphaenidae, and Araneidae, Seven species represented 58.6% of the total fauna, with Crysso pulcherrima (Mello-Leitão,1917 (Theridiidae composing 28.2%. About 65% of the spiders occupied the upper part of the plants (above 20 cm. Five spider species were present in the sugar cane throughout crop development. Evidence of spiders feeding on sugar cane pest species was observed.

Ski jumping boots limit effective take-off in ski jumping.

Science.gov (United States)

Virmavirta, M; Komi, P V

2001-12-01

In this study, we measured the vertical and horizontal take-off forces, plantar pressures and activation patterns of four muscles (vastus lateralis, gluteus maximus, tibialis anterior, gastrocnemius) in 10 ski jumpers in simulated laboratory conditions when wearing either training shoes or ski jumping boots. We found significant differences in vertical (P boots condition resulted in a smaller displacement in the final position of the following joint angles: ankle angle (P knee angle (P boots condition, significantly more pressure was recorded under the heel (P knee and hip extensors when wearing jumping boots. We conclude that the stiffness of the structure of the jumping boots may result in a forward shift of pressure, thus limiting the effective vertical force. To avoid this pressure shift, the pattern of movement of simulated take-offs should be carefully controlled, particularly when wearing training shoes.

Biomimetic calcium phosphate coatings on recombinant spider silk fibres

Energy Technology Data Exchange (ETDEWEB)

Yang Liang; Habibovic, Pamela; Van Blitterswijk, Clemens A [Department of Tissue Regeneration, University of Twente, PO Box 217, 7500 AE Enschede (Netherlands); Hedhammar, My; Johansson, Jan [Department of Anatomy, Physiology and Biochemistry, Swedish University of Agricultural Sciences, the Biomedical Centre, Box 575, 751 23 Uppsala (Sweden); Blom, Tobias; Leifer, Klaus [Department of Engineering Sciences, Uppsala University, Box 534, S-751 21 Uppsala (Sweden)

2010-08-01

Calcium phosphate ceramic coatings, applied on surfaces of metallic and polymeric biomaterials, can improve their performance in bone repair and regeneration. Spider silk is biocompatible, strong and elastic, and hence an attractive biomaterial for applications in connective tissue repair. Recently, artificial spider silk, with mechanical and structural characteristics similar to those of native spider silk, has been produced from recombinant minispidroins. In the present study, supersaturated simulated body fluid was used to deposit calcium phosphate coatings on recombinant spider silk fibres. The mineralization process was followed in time using scanning electron microscopy equipped with an energy dispersive x-ray (EDX) detector and Raman spectroscope. Focused ion beam technology was used to produce a cross section of a coated fibre, which was further analysed by EDX. Preliminary in vitro experiments using a culture of bone marrow-derived human mesenchymal stem cells (hMSCs) on coated fibres were also performed. This study showed that recombinant spider silk fibres were successfully coated with a homogeneous and thick crystalline calcium phosphate layer. In the course of the mineralization process from modified simulated body fluid, sodium chloride crystals were first deposited on the silk surface, followed by the deposition of a calcium phosphate layer. The coated silk fibres supported the attachment and growth of hMSCs.

Spider Silk as Guiding Biomaterial for Human Model Neurons

Directory of Open Access Journals (Sweden)

Frank Roloff

2014-01-01

Full Text Available Over the last years, a number of therapeutic strategies have emerged to promote axonal regeneration. An attractive strategy is the implantation of biodegradable and nonimmunogenic artificial scaffolds into injured peripheral nerves. In previous studies, transplantation of decellularized veins filled with spider silk for bridging critical size nerve defects resulted in axonal regeneration and remyelination by invading endogenous Schwann cells. Detailed interaction of elongating neurons and the spider silk as guidance material is unknown. To visualize direct cellular interactions between spider silk and neurons in vitro, we developed an in vitro crossed silk fiber array. Here, we describe in detail for the first time that human (NT2 model neurons attach to silk scaffolds. Extending neurites can bridge gaps between single silk fibers and elongate afterwards on the neighboring fiber. Culturing human neurons on the silk arrays led to an increasing migration and adhesion of neuronal cell bodies to the spider silk fibers. Within three to four weeks, clustered somata and extending neurites formed ganglion-like cell structures. Microscopic imaging of human neurons on the crossed fiber arrays in vitro will allow for a more efficient development of methods to maximize cell adhesion and neurite growth on spider silk prior to transplantation studies.

Biomimetic calcium phosphate coatings on recombinant spider silk fibres

International Nuclear Information System (INIS)

Yang Liang; Habibovic, Pamela; Van Blitterswijk, Clemens A; Hedhammar, My; Johansson, Jan; Blom, Tobias; Leifer, Klaus

2010-01-01

Calcium phosphate ceramic coatings, applied on surfaces of metallic and polymeric biomaterials, can improve their performance in bone repair and regeneration. Spider silk is biocompatible, strong and elastic, and hence an attractive biomaterial for applications in connective tissue repair. Recently, artificial spider silk, with mechanical and structural characteristics similar to those of native spider silk, has been produced from recombinant minispidroins. In the present study, supersaturated simulated body fluid was used to deposit calcium phosphate coatings on recombinant spider silk fibres. The mineralization process was followed in time using scanning electron microscopy equipped with an energy dispersive x-ray (EDX) detector and Raman spectroscope. Focused ion beam technology was used to produce a cross section of a coated fibre, which was further analysed by EDX. Preliminary in vitro experiments using a culture of bone marrow-derived human mesenchymal stem cells (hMSCs) on coated fibres were also performed. This study showed that recombinant spider silk fibres were successfully coated with a homogeneous and thick crystalline calcium phosphate layer. In the course of the mineralization process from modified simulated body fluid, sodium chloride crystals were first deposited on the silk surface, followed by the deposition of a calcium phosphate layer. The coated silk fibres supported the attachment and growth of hMSCs.

Proximal and Distal Predictors of the Spider Monkey’s Stress Levels in Fragmented Landscapes

Science.gov (United States)

Ordóñez-Gómez, José D.; Cristóbal-Azkarate, Jurgi; Arroyo-Rodríguez, Víctor; Santillán-Doherty, Ana M.; Valdez, Ricardo A.; Romano, Marta C.

2016-01-01

The rapid loss, fragmentation and degradation of tropical forests threaten the survival of many animal species. However, the way in which these phenomena affect animal health has been poorly explored, thus limiting the design of appropriate conservation strategies. To address this, here we identified using linear mixed models the effect of proximal (diet, activity pattern, hunting and logging) and distal (sum of the basal areas of fruiting-tree species [SBAFS], landscape forest cover and degree of forest fragmentation) variables over fecal glucocorticoid metabolite (fGCM) levels–hormones associated with animal health and fitness–of six groups of spider monkeys (Ateles geoffroyi) inhabiting six landscapes with different spatial structures in Mexico. Proximal variables showed a stronger predictive power over fGCMs than distal. In this sense, increases in travel time, the occurrence of hunting, and reductions in rest time and fruit consumption resulted in higher fGCM levels. Regarding distal variables, increases in SBAFS were negatively related to fGCM levels, thus suggesting that food scarcity increases stress hormone levels. Nevertheless, contrary to theoretical expectations, spider monkeys living in smaller tracts of forest spent less time travelling, but the same time feeding on fruit as those in more forested areas. The lower net energy return associated with this combination of factors would explain why, contrary to theoretical expectations, increased forest cover was associated with increased levels of fGCMs in these groups. Our study shows that, at least in the short term, spider monkeys in fragmented landscapes do not always present higher levels of stress hormones compared to those inhabiting continuous forest, and the importance of preserving fruit sources and controlling hunting for reducing the levels of stress hormones in free ranging spider monkeys. PMID:26901767

Birth of a hydraulic jump

Science.gov (United States)

Duchesne, Alexis; Bohr, Tomas; Andersen, Anders

2017-11-01

The hydraulic jump, i.e., the sharp transition between a supercritical and a subcritical free-surface flow, has been extensively studied in the past centuries. However, ever since Leonardo da Vinci asked it for the first time, an important question has been left unanswered: How does a hydraulic jump form? We present an experimental and theoretical study of the formation of stationary hydraulic jumps in centimeter wide channels. Two starting situations are considered: The channel is, respectively, empty or filled with liquid, the liquid level being fixed by the wetting properties and the boundary conditions. We then change the flow-rate abruptly from zero to a constant value. In an empty channel, we observe the formation of a stationary hydraulic jump in a two-stage process: First, the channel fills by the advancing liquid front, which undergoes a transition from supercritical to subcritical at some position in the channel. Later the influence of the downstream boundary conditions makes the jump move slowly upstream to its final position. In the pre-filled channel, the hydraulic jump forms at the injector edge and then moves downstream to its final position.

Control strategy of maximum vertical jumps: The preferred countermovement depth may not be fully optimized for jump height

Directory of Open Access Journals (Sweden)

Mandic Radivoj

2016-09-01

Full Text Available The aim of the present study was to explore the control strategy of maximum countermovement jumps regarding the preferred countermovement depth preceding the concentric jump phase. Elite basketball players and physically active non-athletes were tested on the jumps performed with and without an arm swing, while the countermovement depth was varied within the interval of almost 30 cm around its preferred value. The results consistently revealed 5.1-11.2 cm smaller countermovement depth than the optimum one, but the same difference was more prominent in non-athletes. In addition, although the same differences revealed a marked effect on the recorded force and power output, they reduced jump height for only 0.1-1.2 cm. Therefore, the studied control strategy may not be based solely on the countermovement depth that maximizes jump height. In addition, the comparison of the two groups does not support the concept of a dual-task strategy based on the trade-off between maximizing jump height and minimizing the jumping quickness that should be more prominent in the athletes that routinely need to jump quickly. Further research could explore whether the observed phenomenon is based on other optimization principles, such as the minimization of effort and energy expenditure. Nevertheless, future routine testing procedures should take into account that the control strategy of maximum countermovement jumps is not fully based on maximizing the jump height, while the countermovement depth markedly confound the relationship between the jump height and the assessed force and power output of leg muscles.

Control strategy of maximum vertical jumps: The preferred countermovement depth may not be fully optimized for jump height.

Science.gov (United States)

Mandic, Radivoj; Knezevic, Olivera M; Mirkov, Dragan M; Jaric, Slobodan

2016-09-01

The aim of the present study was to explore the control strategy of maximum countermovement jumps regarding the preferred countermovement depth preceding the concentric jump phase. Elite basketball players and physically active non-athletes were tested on the jumps performed with and without an arm swing, while the countermovement depth was varied within the interval of almost 30 cm around its preferred value. The results consistently revealed 5.1-11.2 cm smaller countermovement depth than the optimum one, but the same difference was more prominent in non-athletes. In addition, although the same differences revealed a marked effect on the recorded force and power output, they reduced jump height for only 0.1-1.2 cm. Therefore, the studied control strategy may not be based solely on the countermovement depth that maximizes jump height. In addition, the comparison of the two groups does not support the concept of a dual-task strategy based on the trade-off between maximizing jump height and minimizing the jumping quickness that should be more prominent in the athletes that routinely need to jump quickly. Further research could explore whether the observed phenomenon is based on other optimization principles, such as the minimization of effort and energy expenditure. Nevertheless, future routine testing procedures should take into account that the control strategy of maximum countermovement jumps is not fully based on maximizing the jump height, while the countermovement depth markedly confound the relationship between the jump height and the assessed force and power output of leg muscles.

Jump conditions in transonic equilibria

International Nuclear Information System (INIS)

Guazzotto, L.; Betti, R.; Jardin, S. C.

2013-01-01

In the present paper, the numerical calculation of transonic equilibria, first introduced with the FLOW code in Guazzotto et al.[Phys. Plasmas 11, 604 (2004)], is critically reviewed. In particular, the necessity and effect of imposing explicit jump conditions at the transonic discontinuity are investigated. It is found that “standard” (low-β, large aspect ratio) transonic equilibria satisfy the correct jump condition with very good approximation even if the jump condition is not explicitly imposed. On the other hand, it is also found that high-β, low aspect ratio equilibria require the correct jump condition to be explicitly imposed. Various numerical approaches are described to modify FLOW to include the jump condition. It is proved that the new methods converge to the correct solution even in extreme cases of very large β, while they agree with the results obtained with the old implementation of FLOW in lower-β equilibria.

Spatiotemporal characteristics of motor actions by blind long jump athletes

Science.gov (United States)

Torralba, Miguel Angel; Padullés, José María; Losada, Jose Luis; López, Jose Luis

2017-01-01

Background Blind people depend on spatial and temporal representations to perform activities of daily living and compete in sport. Objective The aim of this study is to determine the spatiotemporal characteristics of long jumps performed by blind athletes and compare findings with those reported for sighted athletes. Methods We analysed a sample of 12 male athletes competing in the F11 Long Jump Finals at the Paralympic Games in London 2012. Performances were recorded using four high-speed cameras, and speeds were measured using a radar speed gun. The images were processed using validated image analysis software. Results The long jump run-up is shorter in blind athletes than in sighted athletes. We observed statistically significant differences for body centre of mass velocity and an increase in speed over the last three strides prior to take-off, contrasting with reports for sighted athletes and athletes with less severe visual impairment, who maintain or reduce their speed during the last stride. Stride length for the last three strides was the only spatial characteristic that was not significantly associated with effective jump distance. Blind long jumpers extend rather than shorten their last stride. Contact time with the take-off board is longer than that reported for sighted athletes. Conclusion The actions of blind long jumpers, unlike those without disabilities, do not vary their leg actions during the final runway approach for optimal placement on the take-off board. PMID:29018542

SPIDER: Probing the dawn of time from above the clouds

Science.gov (United States)

Moncelsi, Lorenzo; Spider Collaboration

2017-11-01

SPIDER is a balloon-borne microwave polarimeter designed to measure cosmological B-modes on degree angular scales in the presence of Galactic foregrounds. With six independent telescopes housing a total of 2000 detectors in the 90 GHz and 150 GHz frequency bands, SPIDER is the most instantaneously-sensitive CMB polarimeter deployed on the sky to date. SPIDER was successfully launched from McMurdo Station, Antarctica in January 2015 and acquired science data for 16 days. We cover the in-flight performance and present highlights from the ongoing data-analysis. After a successful recovery, the SPIDER team is planning the next flight, featuring one foreground-optimized channel at 280GHz, which will allow us constrain the primordial tensor-mode amplitude at the level of r < 0.03 (99% CL), in the presence of foregrounds.

Interpretative bias in spider phobia: Perception and information processing of ambiguous schematic stimuli.

Science.gov (United States)

Haberkamp, Anke; Schmidt, Filipp

2015-09-01

This study investigates the interpretative bias in spider phobia with respect to rapid visuomotor processing. We compared perception, evaluation, and visuomotor processing of ambiguous schematic stimuli between spider-fearful and control participants. Stimuli were produced by gradually morphing schematic flowers into spiders. Participants rated these stimuli related to their perceptual appearance and to their feelings of valence, disgust, and arousal. Also, they responded to the same stimuli within a response priming paradigm that measures rapid motor activation. Spider-fearful individuals showed an interpretative bias (i.e., ambiguous stimuli were perceived as more similar to spiders) and rated spider-like stimuli as more unpleasant, disgusting, and arousing. However, we observed no differences between spider-fearful and control participants in priming effects for ambiguous stimuli. For non-ambiguous stimuli, we observed a similar enhancement for phobic pictures as has been reported previously for natural images. We discuss our findings with respect to the visual representation of morphed stimuli and to perceptual learning processes. Copyright © 2015 Elsevier B.V. All rights reserved.

Measurement of L3 subshell absorption jump ratios and jump factors for high Z elements using EDXRF technique

International Nuclear Information System (INIS)

Kaçal, M.R.

2014-01-01

Energy dispersive X-ray fluorescence technique (EDXRF) has been employed for measuring L 3 -subshell absorption jump ratios, r L 3 and jump factors, J L 3 for high Z elements. Jump factors and jump ratios for these elements have been determined by measuring L 3 subshell fluorescence parameters such as L 3 subshell X-ray production cross section σ L 3 , L 3 subshell fluorescence yield, ω L 3 , total L 3 subshell and higher subshells photoionization cross section σ L T . Measurements were performed using a Cd-109 radioactive point source and an Si(Li) detector in direct excitation experimental geometry. Measured values for jump factors and jump ratios have been compared with theoretically calculated and other experimental values. - Highlights: • This paper regards L 3 subshell absorption jump ratios and jump factors using the EDXRF method. • These parameters were measured using a new method. • This method is more useful than other methods which require much effort. • Results are in good agreement with theoretical and experimental values

Who is afraid of a black Spider(-Man?

Directory of Open Access Journals (Sweden)

Ora C. McWilliams

2013-06-01

Full Text Available An Internet post asking about Spider-Man's race in a film turned into an Internet campaign about an actor that led fans to interact with each other as well as with the actor, which in turn led to the attention of media producers, which resulted in a change in Spider-Man's race in a print comic book.

Ramet demography of a nurse bromeliad in Brazilian restingas.

Science.gov (United States)

Sampaio, Michelle C; Picó, F Xavier; Scarano, Fabio R

2005-04-01

Restingas are sandy coastal plains that stand between the sea and the Brazilian Atlantic forest mountains. The predominant restinga vegetation type in northern Rio de Janeiro, Brazil, is characterized by the formation of islands that begins with colonization by some pioneer herbs and/or woody plants. Pioneer plants are stress-resistant and nurse many other less-resistant plant species. Determining the spatiotemporal variation in the dynamics of nurse plants is essential to understand the ecological functioning of restingas as a whole. The goal of this study was to analyze the spatiotemporal variation in population dynamics of the nurse bromeliad Aechmea nudicaulis. We monitored A. nudicaulis ramets in different habitats, microhabitats, and years. We analyzed the spatiotemporal variation in demographic traits and in population growth rate. Results showed young ramet traits were more variable at the microhabitat level, and when variable, vegetative ramet traits varied at all spatiotemporal scales. Overall, λ values indicated that A. nudicaulis basically remained spatiotemporally stable as most of the λ values did not significantly differ from unity. Hence, the stability of A. nudicaulis in different microhabitats and habitats in the restinga may create several settlement opportunities for many other less-resistant species.

Characteristics of the first recorded spider (Arthropoda: Arachnida fauna from Sheringal, Khyber Pakhtunkhwa, Pakistan

Directory of Open Access Journals (Sweden)

Farzana Khan Perveen

2015-12-01

Full Text Available The spiders (order: Aranae are an important environmental indicator and play a significant role as predators in biological control of the most of the key insect pests. The present study was conducted to establish the characteristics of the first recorded spider fauna from Sheringal, Dir Upper (DU, Khyber Pakhtunkhwa (KP, Pakistan during June 2013-July 2014. Their 10 species belong to 7 families, and 10 genera (nt=123: total; ni=77: identified; nui=46: unidentified were recorded in the 6 quadrates, i.e., Daramdala, Doki, Guryaal, Samang, Shahoor and Sia-Sheringal of Sheringal. The largest family was Lycosidae (wolf spiders with respect to size and numbers of specimens collected (n=20, which contained Arctosa littorali Simon, 1897; Hippasa partita Takidar, 1970; Pardosa distincta Backwall, 1867, while the smallest family was Gnphosidae (ground spiders (n=3 with Gnaphosa eucalyptus Ghafoor and Beg, 2002; while other families Sparassidae (huntsman spiders (n=19 Halconia insignis Thorell, 1836, and Isopeda tuhogniga Barrion and Litsinger, 1995, Opilionidae (harvestmen spiders (n=12 Hadrobunus grandis Sundevall, 1833; Pholcidae (cellar spider (n=10 have Crossopriza lyoni Blackwall, 1867; Hersiliidae (two-tailed spiders (n=6 is having Harsilia savignyi Lucas, 1836; (n=5 with Araneus diadematus Clerck, 1757 were recorded. It was concluded that 50% of the spiders collected from the study area were venomous. A detail study is required for further exploration of spider fauna of Sheringal, KP, Pakistan with special reference to their taxonomical, physiological and ecological characteristics.

Status of the CNESM diagnostic for SPIDER

International Nuclear Information System (INIS)

Muraro, A.; Croci, G.; Albani, G.; Cazzaniga, C.; Claps, G.; Cavenago, M.; Grosso, G.; Palma, M. Dalla; Fincato, M.; Murtas, F.; Pasqualotto, R.; Cippo, E. Perelli; Rebai, M.; Tollin, M.; Tardocchi, M.; Gorini, G.

2015-01-01

Highlights: • We have finished the design of the detector box of the CNESM diagnostic for SPIDER. • We have constructed the GEM detector of the CNESM detector for SPIDER. • We have tested the detector under fast neutron irradiation. - Abstract: The ITER neutral beam test facility under construction in Padova will host two experimental devices: SPIDER, a 100 kV negative H/D RF source, and MITICA, a full scale, 1 MeV deuterium beam injector. A detection system called close-contact neutron emission surface mapping (CNESM) is under development with the aim to resolve the horizontal beam intensity profile in MITICA and one of the eight beamlet groups in SPIDER, with a spatial resolution of 1.5 and 2.5 cm respectively. This is achieved by the evaluation of the map of the neutron emission due to interaction of the deuterium beam with the deuterons implanted in the beam dump surface. CNESM uses nGEM detectors, i.e. GEM detectors equipped with a cathode that also serves as neutron–proton converter foil. The diagnostic will be placed right behind the SPIDER and MITICA beam dump, i.e. in an UHV environment, but the nGEM detectors need to operate at atmospheric pressure: in order to maintain the detector at atmospheric pressure, a vacuum sealed box, that will be mounted inside the vacuum, has been designed. The box design was driven by the need to minimize the neutron attenuation and the distance between the beam dump surface and the detector active area. This paper presents the status of the CNESM diagnostic describing the design of the detector, the design of the sealed box and reporting the results obtained with the first full-size prototype under fast neutron irradiation.

Design of the interlock and protection system for the SPIDER experiment

International Nuclear Information System (INIS)

Pomaro, N.; Grando, L.; Luchetta, A.; Paolucci, F.; Sartori, F.

2013-01-01

Highlights: •A custom designed interlock and protection system for SPIDER experiment is described. •It includes two subsystems implementing slow and fast protection functions. •High reliability PLCs are adopted for slow protection. •Fiber-optic based, custom designed fast logic circuitry is proposed for fast protection. •Accelerators breakdown events are also managed by the fast subsystem. -- Abstract: Unprecedented levels of beam energy and power are required for ITER Neutral Beam Heating systems. SPIDER experiment is an experimental device aimed to test and optimize a full size beam source satisfying ITER requirements. SPIDER experiment operation involves high power, voltage, temperature, and gas pressure. All these critical conditions are present simultaneously, so that any failure if not properly detected and managed is likely to cause severe damage. The Interlock and Protection System is a high-reliability system devoted to the investment protection of SPIDER. Its main purpose is to manage abnormal events occurring in one or more plants in order to minimize adverse consequences. The Interlock System also manages the SPIDER Operating Modes, defining the set and status of the Plants used in the various possible experimental configurations. In addition, the Interlock and Protection System takes care of particular events occurring during normal SPIDER operation, i.e. electrical arcs between accelerator grids, named breakdowns. Their treatment is committed to the Interlock and Protection System, as they need to be managed timely and with absolute reliability like actual faults. To perform the required functions, the Interlock and Protection System is interfaced with most SPIDER plants and with the SPIDER Control and Data Acquisition System. The paper describes the rationale of the protection functions, their implementation in the design and the technical specifications of the system

Deer herbivory reduces web-building spider abundance by simplifying forest vegetation structure

Directory of Open Access Journals (Sweden)

Elizabeth J. Roberson

2016-09-01

Full Text Available Indirect ecological effects are a common feature of ecological systems, arising when one species affects interactions among two or more other species. We examined how browsing by white-tailed deer (Odocoileus virginianus indirectly affected the abundance and composition of a web-building spider guild through their effects on the structure of the ground and shrub layers of northern hardwood forests. We examined paired plots consisting of deer-free and control plots in the Allegheny Plateau region Pennsylvania and Northern Highlands region of Wisconsin. We recorded the abundance of seven types of webs, each corresponding to a family of web-building spiders. We quantified vegetation structure and habitat suitability for the spiders by computing a web scaffold availability index (WSAI at 0.5 m and 1.0 m above the ground. At Northern Highlands sites, we recorded prey availability. Spider webs were twice as abundant in deer-free plots compared to control plots, while WSAI was 7–12 times greater in deerfree plots. Prey availability was lower in deer-free plots. With the exception of funnel web-builders, all spider web types were significantly more abundant in deer-free plots. Both deer exclusion and the geographic region of plots were significant predictors of spider community structure. In closed canopy forests with high browsing pressure, the low density of tree saplings and shrubs provides few locations for web-building spiders to anchor webs. Recruitment of these spiders may become coupled with forest disturbance events that increase tree and shrub recruitment. By modifying habitat structure, deer appear to indirectly modify arthropod food web interactions. As deer populations have increased in eastern North America over the past several decades, the effects of deer on web-building spiders may be widespread.

Experimental study of the hydraulic jump in a hydraulic jump in a ...

African Journals Online (AJOL)

The hydraulic jump in a sloped rectangular channel is theoretically and experimentally examined. The study aims to determine the effect of the channel's slope on the sequent depth ratio of the jump. A theoretical relation is proposed for the inflow Froude number as function of the sequent depth ratio and the channel slope.

Effects of attention manipulations on motivated attention to feared and nonfeared negative distracters in spider fear.

Science.gov (United States)

Norberg, Joakim; Wiens, Stefan

2013-11-09

When people view emotional and neutral pictures, the emotional pictures capture more attention than do neutral pictures. In support, studies with event-related potentials have shown that the early posterior negativity (EPN) and the late positive potential (LPP) to emotional versus neutral pictures are enhanced when pictures are attended. However, this motivated attention decreases when voluntary attention is directed away from the pictures. Most previous studies included only generally emotional pictures of either negative or positive valence. Because people with spider fear report intense fear of spiders, we examined whether directing attention away from emotional pictures at fixation decreases motivated attention less strongly for spiders than for generally negative distracters. We recorded event-related potentials from 128 channels to study whether manipulations of attention (i.e., spatial attention and perceptual load) decrease the EPN and the LPP to emotional distracters less strongly for spiders than for fear-irrelevant negative pictures in people with spider fear. Results confirmed that the EPN and the LPP to spiders (vs. neutral pictures) were particularly enhanced in participants with spider fear compared to participants without spider fear. When attention was directed away from the pictures, the EPN and the LPP to spiders (vs. neutral pictures) decreased similarly in fearful and nonfearful participants. Further, in fearful participants, the decrease in the EPN and the LPP was similar for spiders and for fear-irrelevant negative pictures. Our findings suggest that for people with spider fear, directing attention away from emotional pictures at fixation decreases motivated attention to these distracters similarly for spiders as for fear-irrelevant negative pictures. These findings imply that attention to spiders in spider fear does not exceed the level of attention expected from the spider pictures' high arousal and negative valence (i.e., their intrinsic

Dangerous mating systems: signal complexity, signal content and neural capacity in spiders.

Science.gov (United States)

Herberstein, M E; Wignall, A E; Hebets, E A; Schneider, J M

2014-10-01

Spiders are highly efficient predators in possession of exquisite sensory capacities for ambushing prey, combined with machinery for launching rapid and determined attacks. As a consequence, any sexually motivated approach carries a risk of ending up as prey rather than as a mate. Sexual selection has shaped courtship to effectively communicate the presence, identity, motivation and/or quality of potential mates, which help ameliorate these risks. Spiders communicate this information via several sensory channels, including mechanical (e.g. vibrational), visual and/or chemical, with examples of multimodal signalling beginning to emerge in the literature. The diverse environments that spiders inhabit have further shaped courtship content and form. While our understanding of spider neurobiology remains in its infancy, recent studies are highlighting the unique and considerable capacities of spiders to process and respond to complex sexual signals. As a result, the dangerous mating systems of spiders are providing important insights into how ecology shapes the evolution of communication systems, with future work offering the potential to link this complex communication with its neural processes. Copyright © 2014 Elsevier Ltd. All rights reserved.

Inactivation of complement by Loxosceles reclusa spider venom.

Science.gov (United States)

Gebel, H M; Finke, J H; Elgert, K D; Cambell, B J; Barrett, J T

1979-07-01

Zymosan depletion of serum complement in guinea pigs rendered them highly resistant to lesion by Loxosceles reclusa spider venom. Guinea pigs deficient in C4 of the complement system are as sensitive to the venom as normal guinea pigs. The injection of 35 micrograms of whole recluse venom intradermally into guinea pigs lowered their complement level by 35.7%. Brown recluse spider venom in concentrations as slight as 0.02 micrograms protein/ml can totally inactivate one CH50 of guinea pig complement in vitro. Bee, scorpion, and other spider venoms had no influence on the hemolytic titer of complement. Fractionation of recluse spider venom by Sephadex G-200 filtration separated the complement-inactivating property of the venom into three major regions which could be distinguished on the basis of heat stability as well as size. None was neutralized by antivenom. Polyacrylamide gel electrophoresis of venom resolved the complement inactivators into five fractions. Complement inactivated by whole venom or the Sephadex fractions could be restored to hemolytic activity by supplements of fresh serum but not by heat-inactivated serum, pure C3, pure C5, or C3 and C5 in combination.

SPIDER OPTIMIZATION. II. OPTICAL, MAGNETIC, AND FOREGROUND EFFECTS

International Nuclear Information System (INIS)

O'Dea, D. T.; Clark, C. N.; Contaldi, C. R.; Ade, P. A. R.; Amiri, M.; Burger, B.; Davis, G.; Benton, S. J.; Bock, J. J.; Crill, B. P.; Dore, O.; Filippini, J. P.; Bond, J. R.; Farhang, M.; Bonetti, J. A.; Bryan, S.; Chiang, H. C.; Fraisse, A. A.; Fissel, L. M.; Gandilo, N. N.

2011-01-01

SPIDER is a balloon-borne instrument designed to map the polarization of the cosmic microwave background (CMB) with degree-scale resolution over a large fraction of the sky. SPIDER's main goal is to measure the amplitude of primordial gravitational waves through their imprint on the polarization of the CMB if the tensor-to-scalar ratio, r, is greater than 0.03. To achieve this goal, instrumental systematic errors must be controlled with unprecedented accuracy. Here, we build on previous work to use simulations of SPIDER observations to examine the impact of several systematic effects that have been characterized through testing and modeling of various instrument components. In particular, we investigate the impact of the non-ideal spectral response of the half-wave plates, coupling between focal-plane components and Earth's magnetic field, and beam mismatches and asymmetries. We also present a model of diffuse polarized foreground emission based on a three-dimensional model of the Galactic magnetic field and dust, and study the interaction of this foreground emission with our observation strategy and instrumental effects. We find that the expected level of foreground and systematic contamination is sufficiently low for SPIDER to achieve its science goals.

The Spider Files

Science.gov (United States)

McDonald, James; Dominguez, Lynn

2012-01-01

As children develop misconceptions about animals they believe are dangerous, they also adopt attitudes that are difficult to change. Changing these attitudes is challenging for teachers. One animal that is easy to find but difficult for children to understand is a spider. As with most wild animals, they are difficult to teach about because…

Structure-function-property-design interplay in biopolymers: spider silk.

Science.gov (United States)

Tokareva, Olena; Jacobsen, Matthew; Buehler, Markus; Wong, Joyce; Kaplan, David L

2014-04-01

Spider silks have been a focus of research for almost two decades due to their outstanding mechanical and biophysical properties. Recent advances in genetic engineering have led to the synthesis of recombinant spider silks, thus helping to unravel a fundamental understanding of structure-function-property relationships. The relationships between molecular composition, secondary structures and mechanical properties found in different types of spider silks are described, along with a discussion of artificial spinning of these proteins and their bioapplications, including the role of silks in biomineralization and fabrication of biomaterials with controlled properties. Copyright © 2013 Acta Materialia Inc. Published by Elsevier Ltd. All rights reserved.

Inhibition of the spider heartbeat by gravity and vibration

Science.gov (United States)

Finck, A.

1984-01-01

The rate and vigor of the spider heartbeat is controlled by an external pacemaker. A mechanical feature of the spider cardio-vascular system is the production of high serum pressure in the prosoma and the legs. This appears to be the source for leg extension. The lyriform organ on the patella of the leg is sensitive to vibratory and kinesthetic stimuli. This sensitivity depends upon the degree of leg extension. Thus the activity of the heart and the response characteristics of the sense receptor are related. The effect of a supra-threshold vibratory or gravitational stimulus is to produce an inhibition and a tachycardia of the spider heartbeat.

Ineffective crypsis in a crab spider: a prey community perspective.

Science.gov (United States)

Brechbühl, Rolf; Casas, Jérôme; Bacher, Sven

2010-03-07

Cryptic coloration is assumed to be beneficial to predators because of an increased encounter rate with unwary prey. This hypothesis is, however, very rarely, if ever, studied in the field. The aim of this study was to quantify the encounter rate and capture success of an ambush predator, in the field, as a function of its level of colour-matching with the background. We used the crab spider Misumena vatia, which varies its body colour and can thereby match the colour of the flower it hunts upon. We carried out a manipulative field experiment using a complete factorial design resulting in six different colour combinations of crab spiders and flowers differing in their degree of colour-matching. A rich and diverse set of naturally occurring insects visited the flowers while we continuously video-recorded the spider's foraging activity. This enabled us to test the crypsis, the spider avoidance and the flower visitor attraction hypotheses, all three supported by previous studies. Flower visitors of different groups either avoided crab spiders independent of colour-matching, such as solitary bees and syrphid flies, or ignored them, such as bumble-bees and honeybees. Moreover, colour-matched spiders did not have a higher encounter rate and capture success compared to the visually apparent ones. Thus, our results support the spider avoidance hypothesis, reject the two other hypotheses and uncovered a fourth behaviour: indifference to predators. Because flower visitors reacted differently, a community approach is mandatory in order to understand the function of background colour-matching in generalist predators. We discuss our results in relation to the size and sociality of the prey and in relation to the functional significance of colour change in this predator.

Evolution of stenophagy in spiders (Araneae): evidence based on the comparative analysis of spider diets.

Science.gov (United States)

Pekár, Stano; Coddington, Jonathan A; Blackledge, Todd A

2012-03-01

Stenophagy (narrow diet breadth) represents an extreme of trophic specialization in carnivores, but little is known about the forces driving its evolution. We used spiders, the most diversified group of terrestrial predators, to investigate whether stenophagy (1) promoted diversification; (2) was phylogenetically conserved and evolutionarily derived state; and (3) was determined either by geographical distribution and foraging guild. We used published data on the prey of almost 600 species. Six categories of stenophagy were found: myrmecophagy, araneophagy, lepidopterophagy, termitophagy, dipterophagy, and crustaceophagy. We found that the species diversity of euryphagous genera and families was similar to stenophagous genera and families. At the family level, stenophagy evolved repeatedly and independently. Within families, the basal condition was oligophagy or euryphagy. Most types of stenophagy were clearly derived: myrmecophagy in Zodariidae; lepidopterophagy in Araneidae; dipterophagy in Theridiidae. In contrast, araneophagy was confined to basal and intermediate lineages, suggesting its ancestral condition. The diet breadth of species from the tropics and subtropics was less diverse than species from the temperate zone. Diet breadth was lower in cursorial spiders compared to web-building species. Thus, the evolution of stenophagy in spiders appears to be complex and governed by phylogeny as well as by ecological determinants. © 2011 The Author(s). Evolution© 2011 The Society for the Study of Evolution.

Three newly recorded Linyphiid spiders (Araneae: Linyphiidae from Korea

Directory of Open Access Journals (Sweden)

Sue Yeon Lee

2018-03-01

Full Text Available Three Linyphiid spiders, Caviphantes pseudosaxetorum Wunderlich, 1979, Erigone edentata Saito and Ono, 2001, and Savignia kawachiensis Oi, 1960, are reported for the first time from Korea with taxonomic illustrations and redescription. In this study, the genus Caviphantes Oi, 1960 is also newly recorded to Korean spider fauna.

First report of clinical presentation of a bite by a running spider ...

African Journals Online (AJOL)

This article describes the clinical progression of symptoms over a period of 5 days of a bite inflicted by a Philodromus sp. spider. Commonly known as 'running spiders', these are not considered to be harmful to humans. This report, however, is the first description of an actual bite by a member of this group of spiders ...

Web building and silk properties functionally covary among species of wolf spider.

Science.gov (United States)

Lacava, Mariángeles; Camargo, Arley; Garcia, Luis F; Benamú, Marco A; Santana, Martin; Fang, Jian; Wang, Xungai; Blamires, Sean J

2018-04-15

Although phylogenetic studies have shown covariation between the properties of spider major ampullate (MA) silk and web building, both spider webs and silks are highly plastic so we cannot be sure whether these traits functionally covary or just vary across environments that the spiders occupy. As MaSp2-like proteins provide MA silk with greater extensibility, their presence is considered necessary for spider webs to effectively capture prey. Wolf spiders (Lycosidae) are predominantly non-web building, but a select few species build webs. We accordingly collected MA silk from two web-building and six non-web-building species found in semirural ecosystems in Uruguay to test whether the presence of MaSp2-like proteins (indicated by amino acid composition, silk mechanical properties and silk nanostructures) was associated with web building across the group. The web-building and non-web-building species were from disparate subfamilies so we estimated a genetic phylogeny to perform appropriate comparisons. For all of the properties measured, we found differences between web-building and non-web-building species. A phylogenetic regression model confirmed that web building and not phylogenetic inertia influences silk properties. Our study definitively showed an ecological influence over spider silk properties. We expect that the presence of the MaSp2-like proteins and the subsequent nanostructures improves the mechanical performance of silks within the webs. Our study furthers our understanding of spider web and silk co-evolution and the ecological implications of spider silk properties. © 2018 European Society For Evolutionary Biology. Journal of Evolutionary Biology © 2018 European Society For Evolutionary Biology.

SPIDER: Probing the Early Universe with a Suborbital Polarimeter

Science.gov (United States)

Fraisse, Aurélien A.; SPIDER Collaboration

2012-01-01

SPIDER is a balloon-borne polarimeter designed to detect a divergence-free polarization pattern ("B-modes") in the Cosmic Microwave Background (CMB). In the inflationary scenario, the spectrum of the tensor perturbations that generate this signal is proportional to that of the primordial scalar perturbations through the tensor-to-scalar ratio r. The expected level of systematic error in the SPIDER instrument is significantly below the amplitude of an interesting cosmological B-mode signal with r=0.03. An optimized scanning strategy enables us to minimize uncertainty in the reconstruction of the Stokes parameters used to characterize the CMB, while providing access to a relatively wide range of angular scales. In the SPIDER field, the polarized emission from interstellar dust is as bright or brighter than the cosmological r=0.03 B-mode signal at all SPIDER frequencies (90, 150, and 280 GHz), a situation similar to that found in the "Southern Hole." Despite this foreground contamination, two 20-day flights of the SPIDER instrument will constrain the amplitude of the B-mode signal to rAPRA-NNX07AL64G), the National Science Foundation (ANT-1043515), the Gordon and Betty Moore Foundation, and the David and Lucile Packard Foundation. Support in Canada is provided by NSERC, the Canadian Space Agency, the Canada Foundation for Innovation, and CIFAR.

Force generation and temperature-jump and length-jump tension transients in muscle fibers.

Science.gov (United States)

Davis, J S; Rodgers, M E

1995-01-01

Muscle tension rises with increasing temperature. The kinetics that govern the tension rise of maximally Ca(2+)-activated, skinned rabbit psoas fibers over a temperature range of 0-30 degrees C was characterized in laser temperature-jump experiments. The kinetic response is simple and can be readily interpreted in terms of a basic three-step mechanism of contraction, which includes a temperature-sensitive rapid preequilibrium(a) linked to a temperature-insensitive rate-limiting step and followed by a temperature-sensitive tension-generating step. These data and mechanism are compared and contrasted with the more complex length-jump Huxley-Simmons phases in which all states that generate tension or bear tension are perturbed. The rate of the Huxley-Simmons phase 4 is temperature sensitive at low temperatures but plateaus at high temperatures, indicating a change in rate-limiting step from a temperature-sensitive (phase 4a) to a temperature-insensitive reaction (phase 4b); the latter appears to correlate with the slow, temperature-insensitive temperature-jump relaxation. Phase 3 is absent in the temperature-jump, which excludes it from tension generation. We confirm that de novo tension generation occurs as an order-disorder transition during phase 2slow and the equivalent, temperature-sensitive temperature-jump relaxation. PMID:7612845

Spider (Araneae) predations on white-backed planthopper Sogatella furcifera in subtropical rice ecosystems, China.

Science.gov (United States)

Wang, Xue-Qin; Wang, Guang-Hua; Zhu, Zeng-Rong; Tang, Qi-Yi; Hu, Yang; Qiao, Fei; Heong, Kong Luen; Cheng, Jia-An

2017-06-01

Spiders are effective biological control agents in rice ecosystems, but the comparative study of predations among main spider species under field conditions has not been fully explored owing to a lack of practical methodology. In this study, more than 6000 spiders of dominant species were collected from subtropical rice ecosystems to compare their predations on Sogatella furcifera (Horváth) (white-backed planthopper, WBPH) using DNA-based gut content analysis. The positive rates for all spider taxa were closely related to prey densities, as well as their behaviors and niches. The relationships of positive rates to prey planthopper densities for Pardosa pseudoannulata (Böes. et Str.), Coleosoma octomaculata (Böes. et Str.), Tetragnatha maxillosa Thorell and Ummeliata insecticeps (Böes. et Str.) under field conditions could be described using saturated response curves. Quantitative comparisons of predations among the four spider species confirmed that P. pseudoannulata and C. octomaculata were more rapacious than U. insecticeps and T. maxillosa under field conditions. A comparison of ratio of spiders to WBPH and positive rates between fields revealed that biological control by spiders could be effectively integrated with variety resistance. Generalist spiders could follow up WBPH population timely, and assemblages of spiders coupled with variety resistance could effectively suppress WBPH population. © 2016 Society of Chemical Industry. © 2016 Society of Chemical Industry.

Spider Web Pattern

Science.gov (United States)

2006-01-01

A delicate pattern, like that of a spider web, appears on top of the Mars residual polar cap, after the seasonal carbon-dioxide ice slab has disappeared. Next spring, these will likely mark the sites of vents when the carbon-dioxide ice cap returns. This Mars Global Surveyor, Mars Orbiter Camera image is about 3-kilometers wide (2-miles).

PATHWAYS TO SPIDER PHOBIA

NARCIS (Netherlands)

MERCKELBACH, H; ARNTZ, A; ARRINDELL, WA; DEJONG, PJ

Using a revised version of the Phobic Origin Questionnaire (POQ; Ost, L. G. & Hugdahl, K. Behaviour Research and Therapy, 19,439-477; 1981), the present study examined whether conditioning experiences, modeling experiences, and/or informational learning experiences were more often reported by spider

The phylogeny of fossil whip spiders.

Science.gov (United States)

Garwood, Russell J; Dunlop, Jason A; Knecht, Brian J; Hegna, Thomas A

2017-04-21

Arachnids are a highly successful group of land-dwelling arthropods. They are major contributors to modern terrestrial ecosystems, and have a deep evolutionary history. Whip spiders (Arachnida, Amblypygi), are one of the smaller arachnid orders with ca. 190 living species. Here we restudy one of the oldest fossil representatives of the group, Graeophonus anglicus Pocock, 1911 from the Late Carboniferous (Duckmantian, ca. 315 Ma) British Middle Coal Measures of the West Midlands, UK. Using X-ray microtomography, our principal aim was to resolve details of the limbs and mouthparts which would allow us to test whether this fossil belongs in the extant, relict family Paracharontidae; represented today by a single, blind species Paracharon caecus Hansen, 1921. Tomography reveals several novel and significant character states for G. anglicus; most notably in the chelicerae, pedipalps and walking legs. These allowed it to be scored into a phylogenetic analysis together with the recently described Paracharonopsis cambayensis Engel & Grimaldi, 2014 from the Eocene (ca. 52 Ma) Cambay amber, and Kronocharon prendinii Engel & Grimaldi, 2014 from Cretaceous (ca. 99 Ma) Burmese amber. We recovered relationships of the form ((Graeophonus (Paracharonopsis + Paracharon)) + (Charinus (Stygophrynus (Kronocharon (Charon (Musicodamon + Paraphrynus)))))). This tree largely reflects Peter Weygoldt's 1996 classification with its basic split into Paleoamblypygi and Euamblypygi lineages; we were able to score several of his characters for the first time in fossils. Our analysis draws into question the monophyly of the family Charontidae. Our data suggest that Graeophonus is a crown group amblypygid, and falls within a monophyletic Paleoamblypgi clade, but outside the family Paracharontidae (= Paracharonopsis + Paracharon). Our results also suggest a new placement for the Burmese amber genus Kronocharon, a node further down from its original position. Overall, we offer a

Low Health System Performance, Indigenous Status and Antivenom Underdosage Correlate with Spider Envenoming Severity in the Remote Brazilian Amazon.

Directory of Open Access Journals (Sweden)

Vanderson Souza Sampaio

Full Text Available A better knowledge of the burden and risk factors associated with severity due to spider bites would lead to improved management with a reduction of sequelae usually seen for this neglected health problem, and would ensure proper use of antivenoms in remote localities in the Brazilian Amazon. The aim of this study was to analyze the profile of spider bites reported in the state of Amazonas in the Western Brazilian Amazon, and to investigate potential risk factors associated with severity of envenomation.We used a case-control study in order to identify factors associated with spider bite severity in the Western Brazilian Amazon from 2007 to 2014. Patients evolving to any severity criteria were considered cases and those with non-severe bites were included in the control group. All variables were retrieved from the official Brazilian reporting systems. Socioeconomical and environmental components were also included in a multivariable analysis in order to identify ecological determinants of incidence and severity. A total of 1,181 spider bites were recorded, resulting in an incidence of 4 cases per 100,000 person/year. Most of the spider bites occurred in males (65.8%. Bites mostly occurred in rural areas (59.5%. The most affected age group was between 16 and 45 years old (50.9%. A proportion of 39.7% of the bites were related to work activities. Antivenom was prescribed to 39% of the patients. Envenomings recorded from urban areas [Odds ratio (OR = 0.40 (95%CI = 0.30-0.71; pmedian [OR = 0.64 (95%CI = 0.39-0.75; p300 km away from the state capital Manaus [OR = 1.90 (95%CI = 1.28-2.40; p300 km away from the state capital Manaus [OR = 1.53 (95%CI = 1.15-2.02; p = 0.003] and living in a municipality with a MHSPI 300 km away from the state capital Manaus could be contributing factors to higher severity of spider envenomings in this area, as well as to antivenom underdosage.

Biomechanics research in ski jumping, 1991-2006.

Science.gov (United States)

Schwameder, Hermann

2008-01-01

In this paper, I review biomechanics research in ski jumping with a specific focus on publications presented between 1991 and 2006 on performance enhancement, limiting factors of the take-off, specific training and conditioning, aerodynamics, and safety. The first section presents a brief description of ski jumping phases (in-run, take-off, early flight, stable flight, and landing) regarding the biomechanical and functional fundamentals. The most important and frequently used biomechanical methods in ski jumping (kinematics, ground reaction force analyses, muscle activation patterns, aerodynamics) are summarized in the second section. The third section focuses on ski jumping articles and research findings published after the establishment of the V-technique in 1991, as the introduction of this technique has had a major influence on performance enhancement, ski jumping regulations, and the construction of hill profiles. The final section proposes topics for future research in the biomechanics of ski jumping, including: take-off and early flight and the relative roles of vertical velocity and forward somersaulting angular momentum; optimal jumping patterns utilizing the capabilities of individual athletes; development of kinematic and kinetic feedback systems for hill jumps; comparisons of simulated and hill jumps; effect of equipment modifications on performance and safety enhancement.

Evolutionary morphology of the hemolymph vascular system of basal araneomorph spiders (Araneae: Araneomorphae).

Science.gov (United States)

Huckstorf, Katarina; Michalik, Peter; Ramírez, Martín; Wirkner, Christian S

2015-11-01

The superfamily Austrochiloidea (Austrochilidae and Gradungulidae) take a pivotal position in araneomorph spider phylogeny. In this discussion crevice weaver spiders (Filistatidae) are of equal interest. Especially data from these phylogenetically uncertain yet basal off branching groups can enlighten our understanding on the evolution of organ systems. In the course of a survey on the evolutionary morphology of the circulatory system in spiders we therefore investigated the hemolymph vascular system in two austrochiloid and one filistatid species. Additionally some data on a hypochilid and a gradungulid species are included. Using up-to-date morphological methods, the vascular systems in these spiders are visualized three dimensionally. Ground pattern features of the circulatory systems in austrochiloid spiders are presented and the data discussed along recent lines of phylogenetic hypotheses. Special topics highlighted are the intraspecific variability of the origins of some prosomal arteries and the evolutionary correlation of respiratory and circulatory systems in spiders. Copyright © 2015 Elsevier Ltd. All rights reserved.

Performance analysis of jump-gliding locomotion for miniature robotics.

Science.gov (United States)

Vidyasagar, A; Zufferey, Jean-Christohphe; Floreano, Dario; Kovač, M

2015-03-26

Recent work suggests that jumping locomotion in combination with a gliding phase can be used as an effective mobility principle in robotics. Compared to pure jumping without a gliding phase, the potential benefits of hybrid jump-gliding locomotion includes the ability to extend the distance travelled and reduce the potentially damaging impact forces upon landing. This publication evaluates the performance of jump-gliding locomotion and provides models for the analysis of the relevant dynamics of flight. It also defines a jump-gliding envelope that encompasses the range that can be achieved with jump-gliding robots and that can be used to evaluate the performance and improvement potential of jump-gliding robots. We present first a planar dynamic model and then a simplified closed form model, which allow for quantification of the distance travelled and the impact energy on landing. In order to validate the prediction of these models, we validate the model with experiments using a novel jump-gliding robot, named the 'EPFL jump-glider'. It has a mass of 16.5 g and is able to perform jumps from elevated positions, perform steered gliding flight, land safely and traverse on the ground by repetitive jumping. The experiments indicate that the developed jump-gliding model fits very well with the measured flight data using the EPFL jump-glider, confirming the benefits of jump-gliding locomotion to mobile robotics. The jump-glide envelope considerations indicate that the EPFL jump-glider, when traversing from a 2 m height, reaches 74.3% of optimal jump-gliding distance compared to pure jumping without a gliding phase which only reaches 33.4% of the optimal jump-gliding distance. Methods of further improving flight performance based on the models and inspiration from biological systems are presented providing mechanical design pathways to future jump-gliding robot designs.

Filtering and control of stochastic jump hybrid systems

CERN Document Server

Yao, Xiuming; Zheng, Wei Xing

2016-01-01

This book presents recent research work on stochastic jump hybrid systems. Specifically, the considered stochastic jump hybrid systems include Markovian jump Ito stochastic systems, Markovian jump linear-parameter-varying (LPV) systems, Markovian jump singular systems, Markovian jump two-dimensional (2-D) systems, and Markovian jump repeated scalar nonlinear systems. Some sufficient conditions are first established respectively for the stability and performances of those kinds of stochastic jump hybrid systems in terms of solution of linear matrix inequalities (LMIs). Based on the derived analysis conditions, the filtering and control problems are addressed. The book presents up-to-date research developments and novel methodologies on stochastic jump hybrid systems. The contents can be divided into two parts: the first part is focused on robust filter design problem, while the second part is put the emphasis on robust control problem. These methodologies provide a framework for stability and performance analy...

Captive spider monkeys (Ateles geoffroyi) arm-raise to solicit allo-grooming.

Science.gov (United States)

Scheel, Matthew H; Edwards, Dori

2012-03-01

Old World monkeys solicit allo-grooming from conspecifics. However, there are relatively few studies of allo-grooming among spider monkeys, and descriptions of allo-grooming solicitation among spider monkeys are anecdotal. In this study, eighty-one hours of video, shot over eight weeks, captured 271 allo-grooming bouts among small groups of captive spider monkeys. Six of eight monkeys made heretofore unreported arm-raises that solicited higher than normal rates of allo-grooming. Allo-grooming bout durations following arm-raises also tended to be longer than bouts not preceded by arm-raises. The efficacy of the arm-raise at soliciting allo-grooming suggests spider monkeys are capable of intentional communication. Copyright © 2012 Elsevier B.V. All rights reserved.

Vision in the nocturnal wandering spider Leucorchestris arenicola (Araneae: Sparassidae)

DEFF Research Database (Denmark)

Nørgaard, Thomas; Nilsson, Dan-Eric; Henschel, Joh R

2008-01-01

At night the Namib Desert spider Leucorchestris arenicola performs long-distance homing across its sand dune habitat. By disabling all or pairs of the spiders' eight eyes we found that homing ability was severely reduced when vision was fully abolished. Vision, therefore, seems to play a key role...... in the posterior and anteriomedian eyes, and at approximately 540 nm in the anteriolateral eyes. Theoretical calculations of photon catches showed that the eyes are likely to employ a combination of spatial and temporal pooling in order to function at night. Under starlit conditions, the raw spatial and temporal...... resolution of the eyes is insufficient for detecting any visual information on structures in the landscape, and bright stars would be the only objects visible to the spiders. However, by summation in space and time, the spiders can rescue enough vision to detect coarse landscape structures. We show that L...

Jump spillover between oil prices and exchange rates

Science.gov (United States)

Li, Xiao-Ping; Zhou, Chun-Yang; Wu, Chong-Feng

2017-11-01

In this paper, we investigate the jump spillover effects between oil prices and exchange rates. To identify the latent historical jumps for exchange rates and oil prices, we use a Bayesian MCMC approach to estimate the stochastic volatility model with correlated jumps in both returns and volatilities for each. We examine the simultaneous jump intensities and the conditional jump spillover probabilities between oil prices and exchange rates, finding strong evidence of jump spillover effects. Further analysis shows that the jump spillovers are mainly due to exogenous events such as financial crises and geopolitical events. Thus, the findings have important implications for financial risk management.

Recombinant Spider Silks—Biopolymers with Potential for Future Applications

Directory of Open Access Journals (Sweden)

Thomas Scheibel

2011-03-01

Full Text Available Nature has evolved a range of materials that compete with man-made materials in physical properties; one of these is spider silk. Silk is a fibrous material that exhibits extremely high strength and toughness with regard to its low density. In this review we discuss the molecular structure of spider silk and how this understanding has allowed the development of recombinant silk proteins that mimic the properties of natural spider silks. Additionally, we will explore the material morphologies and the applications of these proteins. Finally, we will look at attempts to combine the silk structure with chemical polymers and how the structure of silk has inspired the engineering of novel polymers.

Impact of prescribed burning on a heathland inhabiting spider community

Directory of Open Access Journals (Sweden)

Krause, Rolf Harald

2016-04-01

Full Text Available Heathlands can provide refuge for many stenotopic and endangered arthropods, if habitat management practices are applied. A management measure that is rarely being used today, but which has the potential to support diversity of arthropod communities, is prescribed burning. In this study we investigated the effects of prescribed burning on spider assemblages on a burned site with Calluna vulgaris in the nature reserve Lueneburg Heath, northwest Germany. We used pitfall trapping with a sampling design of 39 traps over a period of one year and 17 sampling intervals on a burned and a control site. We compared overall species richness, activity abundance patterns and community composition of the two sites, with a particular focus on stenotopic and endangered species. We collected 5116 adult spiders and 99 species altogether in a relatively small sampling area. This number of species represents nearly one third of the regional species pool of heathland spider species. Twelve species occurred exclusively on the burned site in contrast to 28 species exclusively found on the unburned site. Although we found more than twice as many spider individuals and higher mean species richness on the control site than on the burned site, the species richness of red-listed spiders was higher on the burned site. Especially the fact that we found 24 endangered species on the burned site and only 20 on the control site indicates that the applied measure of prescribed burning can foster certain endangered spider species and contribute to preserving the overall biodiversity of heathland ecosystems.

Stable isotopes of Hawaiian spiders reflect substrate properties along a chronosequence

Science.gov (United States)

Dawson, Todd E.; Gillespie, Rosemary G.

2018-01-01

The Hawaiian Islands offer a unique opportunity to test how changes in the properties of an isolated ecosystem are propagated through the organisms that occur within that ecosystem. The age-structured arrangement of volcanic-derived substrates follows a regular progression over space and, by inference, time. We test how well documented successional changes in soil chemistry and associated vegetation are reflected in organisms at higher trophic levels—specifically, predatory arthropods (spiders)—across a range of functional groups. We focus on three separate spider lineages: one that builds capture webs, one that hunts actively, and one that specializes on eating other spiders. We analyze spiders from three sites across the Hawaiian chronosequence with substrate ages ranging from 200 to 20,000 years. To measure the extent to which chemical signatures of terrestrial substrates are propagated through higher trophic levels, we use standard stable isotope analyses of nitrogen and carbon, with plant leaves included as a baseline. The target taxa show the expected shift in isotope ratios of δ15N with trophic level, from plants to cursorial spiders to web-builders to spider eaters. Remarkably, organisms at all trophic levels also precisely reflect the successional changes in the soil stoichiometry of the island chronosequence, demonstrating how the biogeochemistry of the entire food web is determined by ecosystem succession of the substrates on which the organisms have evolved. PMID:29576984

Synthetic Spider Silk Production on a Laboratory Scale

Science.gov (United States)

Hsia, Yang; Gnesa, Eric; Pacheco, Ryan; Kohler, Kristin; Jeffery, Felicia; Vierra, Craig

2012-01-01

As society progresses and resources become scarcer, it is becoming increasingly important to cultivate new technologies that engineer next generation biomaterials with high performance properties. The development of these new structural materials must be rapid, cost-efficient and involve processing methodologies and products that are environmentally friendly and sustainable. Spiders spin a multitude of different fiber types with diverse mechanical properties, offering a rich source of next generation engineering materials for biomimicry that rival the best manmade and natural materials. Since the collection of large quantities of natural spider silk is impractical, synthetic silk production has the ability to provide scientists with access to an unlimited supply of threads. Therefore, if the spinning process can be streamlined and perfected, artificial spider fibers have the potential use for a broad range of applications ranging from body armor, surgical sutures, ropes and cables, tires, strings for musical instruments, and composites for aviation and aerospace technology. In order to advance the synthetic silk production process and to yield fibers that display low variance in their material properties from spin to spin, we developed a wet-spinning protocol that integrates expression of recombinant spider silk proteins in bacteria, purification and concentration of the proteins, followed by fiber extrusion and a mechanical post-spin treatment. This is the first visual representation that reveals a step-by-step process to spin and analyze artificial silk fibers on a laboratory scale. It also provides details to minimize the introduction of variability among fibers spun from the same spinning dope. Collectively, these methods will propel the process of artificial silk production, leading to higher quality fibers that surpass natural spider silks. PMID:22847722

SPIDERS (ARANEI OF THE REPUBLIC OF SOUTH OSSETIA

Directory of Open Access Journals (Sweden)

Alexander V. Ponomarev

2015-01-01

Full Text Available Aim. Until recently, spider fauna of the Republic of South Ossetia has been the least studied among the regional araneofaunas of the Caucasus. According to the literature data, as little as 30 spider species have been known from the republic’s territory (Mkheidze, 1997, Mikhailov, 1990; Ponomarev, Dvadnenko, 2013; Trilicauscas, Komarov, 2014. Therefore, the aim of the present article is to summarize available data on the spider fauna of South Ossetia.Location. Republic of South Ossetia.Methods. The material was collected in various districts of South Ossetia in 2011-2014 by Yu.E. Komarov. Mainly, the collecting was performed in the city of Tskhinvali and its environs, and in the South Ossetian State Reserve. Spiders were sampled with pitfall traps and sweep netting. The time of traps’ exposure is April–December.Results and main conclusions. To date, the spider fauna of the Republic of South Ossetia includes 230 species from 29 families. 222 species were registered by the authors, eight species (Clubiona pseudosimilis, Gnaphosa lugubris, Linyphia hortensis, Neriene peltata, Geolycosa vultuosa, Pardosa azerifalcata, Ero aphana, and Philodromus rufus are known from the literature only. Seven species are new to the Caucasus (Clubiona pseudosimilis, Gnaphosa lugubris, Linyphia hortensis, Neriene peltata, Geolycosa vultuosa, Pardosa azerifalcata, Ero aphana, and Philodromus rufus. Of these, two species were known earlier only from Turkey (Pardosa consimilis, Ozyptila spirembolus, and one species (Tegenaria pseudolyncea only from Azerbaijan. Against the background of the widespread species predominance, the Caucasian element is small and presented by twelve species (Tegenaria pseudolyncea, Dysdera tkibuliensis, Haplodrassus caucasius, Zelotes khostensis, Mansuphantes ovalis, Sintula oseticus, Tenuiphantes teberdaensis, Pardosa azerifalcata, P. caucasica, Piratula hurkai, Trochosa cachetiensis, and Xysticus ukrainicus.

Spider mite control and resistance management: does a genome help?

NARCIS (Netherlands)

Van Leeuwen, T.; Dermauw, W.; Grbic, M.; Tirry, L.; Feyereisen, R.

2012-01-01

The complete genome of the two-spotted spider mite, Tetranychus urticae, has been reported. This is the first sequenced genome of a highly polyphagous and resistant agricultural pest. The question as to what the genome offers the community working on spider mite control is addressed.

Characteristics of Air Entrainment in Hydraulic Jump

Science.gov (United States)

Albarkani, M. S. S.; Tan, L. W.; Al-Gheethi, A.

2018-04-01

The characteristics of hydraulic jump, especially the air entrainment within jump is still not properly understood. Therefore, the current work aimed to determine the size and number of air entrainment formed in hydraulic jump at three different Froude numbers and to obtain the relationship between Froude number with the size and number of air entrainment in hydraulic jump. Experiments of hydraulic jump were conducted in a 10 m long and 0.3 m wide Armfield S6MKII glass-sided tilting flume. Hydraulic jumps were produced by flow under sluice gate with varying Froude number. The air entrainment of the hydraulic jump was captured with a Canon Power Shot SX40 HS digital camera in video format at 24 frames per second. Three discharges have been considered, i.e. 0.010 m3/s, 0.011 m3/s, and 0.013 m3/s. For hydraulic jump formed in each discharge, 32 frames were selected for the purpose of analysing the size and number of air entrainment in hydraulic jump. The results revealed that that there is a tendency to have greater range in sizes of air bubbles as Fr1 increases. Experiments with Fr1 = 7.547. 7.707, and 7.924 shown that the number of air bubbles increases exponentially with Fr1 at a relationship of N = 1.3814 e 0.9795Fr1.

The validity and reliability of the my jump 2 app for measuring the reactive strength index and drop jump performance.

Science.gov (United States)

Haynes, Tom; Bishop, Chris; Antrobus, Mark; Brazier, Jon

2018-03-27

This is the first study to independently assess the concurrent validity and reliability of the My Jump 2 app for measuring drop jump performance. It is also the first to evaluate the app's ability to measure the reactive strength index (RSI). Fourteen male sport science students (age: 29.5 ± 9.9 years) performed three drop jumps from 20 cm and 40 cm (totalling 84 jumps), assessed via a force platform and the My Jump 2 app. Reported metrics included reactive strength index, jump height, ground contact time, and mean power. Measurements from both devices were compared using the intraclass correlation coefficient (ICC), Pearson product moment correlation coefficient (r), Cronbach's alpha (α), coefficient of variation (CV) and BlandAltman plots. Near perfect agreement was seen between devices at 20 cm for RSI (ICC = 0.95) and contact time (ICC = 0.99) and at 40 cm for RSI (ICC = 0.98), jump height (ICC = 0.96) and contact time (ICC = 0.92); with very strong agreement seen at 20 cm for jump height (ICC = 0.80). In comparison with the force plate the app showed good validity for RSI (20 cm: r = 0.94; 40 cm; r = 0.97), jump height (20 cm: r = 0.80; 40 cm; r = 0.96) and contact time (20 cm = 0.96; 40 cm; r = 0.98). The results of the present study show that the My Jump 2 app is a valid and reliable tool for assessing drop jump performance.

Predicting vertical jump height from bar velocity.

Science.gov (United States)

García-Ramos, Amador; Štirn, Igor; Padial, Paulino; Argüelles-Cienfuegos, Javier; De la Fuente, Blanca; Strojnik, Vojko; Feriche, Belén

2015-06-01

The objective of the study was to assess the use of maximum (Vmax) and final propulsive phase (FPV) bar velocity to predict jump height in the weighted jump squat. FPV was defined as the velocity reached just before bar acceleration was lower than gravity (-9.81 m·s(-2)). Vertical jump height was calculated from the take-off velocity (Vtake-off) provided by a force platform. Thirty swimmers belonging to the National Slovenian swimming team performed a jump squat incremental loading test, lifting 25%, 50%, 75% and 100% of body weight in a Smith machine. Jump performance was simultaneously monitored using an AMTI portable force platform and a linear velocity transducer attached to the barbell. Simple linear regression was used to estimate jump height from the Vmax and FPV recorded by the linear velocity transducer. Vmax (y = 16.577x - 16.384) was able to explain 93% of jump height variance with a standard error of the estimate of 1.47 cm. FPV (y = 12.828x - 6.504) was able to explain 91% of jump height variance with a standard error of the estimate of 1.66 cm. Despite that both variables resulted to be good predictors, heteroscedasticity in the differences between FPV and Vtake-off was observed (r(2) = 0.307), while the differences between Vmax and Vtake-off were homogenously distributed (r(2) = 0.071). These results suggest that Vmax is a valid tool for estimating vertical jump height in a loaded jump squat test performed in a Smith machine. Key pointsVertical jump height in the loaded jump squat can be estimated with acceptable precision from the maximum bar velocity recorded by a linear velocity transducer.The relationship between the point at which bar acceleration is less than -9.81 m·s(-2) and the real take-off is affected by the velocity of movement.Mean propulsive velocity recorded by a linear velocity transducer does not appear to be optimal to monitor ballistic exercise performance.

Change in Counter movement Jump Strategy by Varying Jump Height Based on Simplified Framework for Center of Mass Mechanics

International Nuclear Information System (INIS)

Kim, Seyoung

2017-01-01

In this study, we investigated how a jumping strategy changes with an increase in the vertical jump height for a resultant ground reaction force (GRF) vector. We expected that the resultant force vector between two sequential motion phases (i.e., countermovement and push-off) of the counter movement jump would significantly change with the vertical jump height to take advantage of the resulting supportive force (i.e., an initial push-off force larger than the body weight) through the counter movement phase. Nine healthy young subjects were instructed to jump straight up to five different height levels ranging from 191 cm to 221 cm, and the kinematic and kinetic data were obtained in regular trials. The results showed that a lower center of mass position and larger resultant force vector were clearly observed in a higher jump, implying that the counter movement strategy changed with the vertical jump height to prepare for sufficient joint deviation and obtain a force advantage for larger push-off work.

Change in Counter movement Jump Strategy by Varying Jump Height Based on Simplified Framework for Center of Mass Mechanics

Energy Technology Data Exchange (ETDEWEB)

Kim, Seyoung [Korea Institute of Machinery and Materials(KIMM), Daejeon (Korea, Republic of)

2017-04-15

In this study, we investigated how a jumping strategy changes with an increase in the vertical jump height for a resultant ground reaction force (GRF) vector. We expected that the resultant force vector between two sequential motion phases (i.e., countermovement and push-off) of the counter movement jump would significantly change with the vertical jump height to take advantage of the resulting supportive force (i.e., an initial push-off force larger than the body weight) through the counter movement phase. Nine healthy young subjects were instructed to jump straight up to five different height levels ranging from 191 cm to 221 cm, and the kinematic and kinetic data were obtained in regular trials. The results showed that a lower center of mass position and larger resultant force vector were clearly observed in a higher jump, implying that the counter movement strategy changed with the vertical jump height to prepare for sufficient joint deviation and obtain a force advantage for larger push-off work.

Intersexual Trophic Niche Partitioning in an Ant-Eating spider (Araneae: Zodariidae)

DEFF Research Database (Denmark)

Pekár, Stanislav; Martisová, Martina; Bilde, T.

2011-01-01

lead to higher energy demands in females driven by fecundity selection, while males invest in mate searching. We tested predictions of the two hypotheses underlying intersexual trophic niche partitioning in a natural population of spiders. Zodarion jozefienae spiders specialize on Messor barbarus ants...... that are polymorphic in body size and hence comprise potential trophic niches for the spider, making this system well-suited to study intersexual trophic niche partitioning. Methodology/Principal Findings Comparative analysis of trophic morphology (the chelicerae) and body size of males, females and juveniles...... demonstrated highly female biased SSD (Sexual Size Dimorphism) in body size, body weight, and in the size of chelicerae, the latter arising from sex-specific growth patterns in trophic morphology. In the field, female spiders actively selected ant sub-castes that were larger than the average prey size...

Association of spiders and lichen on Robben Island, South Africa: a case report

Directory of Open Access Journals (Sweden)

A. Mukherjee

2010-04-01

Full Text Available The present study is a firstrecord of spider occurrence on Robben Island, South Africa. Some habitats were rich in lichens. As we know, lichens enhance wildlife habitat in less direct ways. The objective of the study was to examine the potential importance of lichens in enriching spider diversity and abundance. A total of 260 spiders (170 from lichens and 90 from bush were collected following the visual search method over one year. Seasonal trends in overall species richness and abundance indicated that the relative density of spiders was greater in lichens than in bushes. The result suggests that habitat structure, such as branch size and epiphytic lichen abundance, can be an explanation for the greater number of spiders in lichen-rich patches of the island.

Programming spiders, bots, and aggregators in Java

CERN Document Server

Heaton, Jeff

2006-01-01

The content and services available on the web continue to be accessed mostly through direct human control. But this is changing. Increasingly, users rely on automated agents that save them time and effort by programmatically retrieving content, performing complex interactions, and aggregating data from diverse sources. Programming Spiders, Bots, and Aggregators in Java teaches you how to build and deploy a wide variety of these agents-from single-purpose bots to exploratory spiders to aggregators that present a unified view of information from multiple user accounts. You will quickly build on

Recombinant DNA production of spider silk proteins.

Science.gov (United States)

Tokareva, Olena; Michalczechen-Lacerda, Valquíria A; Rech, Elíbio L; Kaplan, David L

2013-11-01

Spider dragline silk is considered to be the toughest biopolymer on Earth due to an extraordinary combination of strength and elasticity. Moreover, silks are biocompatible and biodegradable protein-based materials. Recent advances in genetic engineering make it possible to produce recombinant silks in heterologous hosts, opening up opportunities for large-scale production of recombinant silks for various biomedical and material science applications. We review the current strategies to produce recombinant spider silks. © 2013 The Authors. Microbial Biotechnology published by John Wiley & Sons Ltd and Society for Applied Microbiology.

Dynamic jump intensities and risk premiums

DEFF Research Database (Denmark)

Christoffersen, Peter; Ornthanalai, Chayawat; Jacobs, Kris

2012-01-01

We build a new class of discrete-time models that are relatively easy to estimate using returns and/or options. The distribution of returns is driven by two factors: dynamic volatility and dynamic jump intensity. Each factor has its own risk premium. The models significantly outperform standard...... models without jumps when estimated on S&P500 returns. We find very strong support for time-varying jump intensities. Compared to the risk premium on dynamic volatility, the risk premium on the dynamic jump intensity has a much larger impact on option prices. We confirm these findings using joint...

Spider genomes provide insight into composition and evolution of venom and silk

Science.gov (United States)

Sanggaard, Kristian W.; Bechsgaard, Jesper S.; Fang, Xiaodong; Duan, Jinjie; Dyrlund, Thomas F.; Gupta, Vikas; Jiang, Xuanting; Cheng, Ling; Fan, Dingding; Feng, Yue; Han, Lijuan; Huang, Zhiyong; Wu, Zongze; Liao, Li; Settepani, Virginia; Thøgersen, Ida B.; Vanthournout, Bram; Wang, Tobias; Zhu, Yabing; Funch, Peter; Enghild, Jan J.; Schauser, Leif; Andersen, Stig U.; Villesen, Palle; Schierup, Mikkel H; Bilde, Trine; Wang, Jun

2014-01-01

Spiders are ecologically important predators with complex venom and extraordinarily tough silk that enables capture of large prey. Here we present the assembled genome of the social velvet spider and a draft assembly of the tarantula genome that represent two major taxonomic groups of spiders. The spider genomes are large with short exons and long introns, reminiscent of mammalian genomes. Phylogenetic analyses place spiders and ticks as sister groups supporting polyphyly of the Acari. Complex sets of venom and silk genes/proteins are identified. We find that venom genes evolved by sequential duplication, and that the toxic effect of venom is most likely activated by proteases present in the venom. The set of silk genes reveals a highly dynamic gene evolution, new types of silk genes and proteins, and a novel use of aciniform silk. These insights create new opportunities for pharmacological applications of venom and biomaterial applications of silk. PMID:24801114

Spider-silk-like shape memory polymer fiber for vibration damping

International Nuclear Information System (INIS)

Yang, Qianxi; Li, Guoqiang

2014-01-01

In this study, the static and dynamic properties of shape memory polyurethane (SMPU) fiber are reported and compared to those of spider dragline silk. Although the polymeric fiber has a lower strength compared to spider dragline silks (0.2–0.3 GPa versus 1.1 GPa), it possesses much higher toughness (276–289 MJ m −3 versus 160 MJ m −3 ), due to its excellent extensibility. The dynamic mechanical tests reveal that SMPU fiber has a high damping capacity (tan δ = 0.10–0.35) which is comparable to or even higher than that of spider silks (tan δ = 0.15). In addition, we found that, different programming methods change the shape memory and damping properties of the fiber in different ways and cold-drawing programming is more advocated in structural applications. These results suggest that the SMPU fiber has similar vibration damping and mechanical properties as spider silk, and may find applications in lightweight engineering structures. (paper)

Determinant Factors of the Squat Jump in Sprinting and Jumping Athletes

Directory of Open Access Journals (Sweden)

González-Badillo Juan José

2017-08-01

Full Text Available The aim of this study was to assess the relationship between strength variables and maximum velocity (Vmax in the squat jump (SJ in sprinting and jumping athletes. Thirty-two sprinting and jumping athletes of national level (25.4 ± 4.5 years; 79.4 ± 6.9 kg and 180.4 ± 6.0 cm participated in the study. Vmax in the SJ showed significant relationships with peak force 1 (PF1 (r = 0.82, p ≤ 0.001, peak force 2 (PF2 (r = 0.68, p ≤ 0.001, PF2 by controlling for PF1 (r = 0.30, non-significant, the maximum rate of force development at peak force 1 (RFDmax1 (r = 0.62, p ≤ 0.001, mean RFD 1 (RFDmean1 (r = 0.48, p ≤ 0.01, mean RFD 2 (RFDmean2 (r = 0.70, p ≤ 0.001, force at RFDmax1 (r = 0.36, p ≤ 0.05, force at RFDmax2 (r = 0.83, p ≤ 0.001 and force at RFDmax2 by controlling for PF1 (r = 0.40, p ≤ 0.05. However, Vmax in the SJ was associated negatively with the ratio PF2/PF1 (r = -0.54, p ≤ 0.01, time at peak force 2 (Tp2 (r = -0.64, p ≤ 0.001 and maximum rate of force development at peak force 2 (RFDmax2 (r = -0.71, p ≤ 0.001. These findings indicate that the peak force achieved at the beginning of the movement (PF1 is the main predictor of performance in jumping, although the RFDmax values and the ratio PF2/PF1 are also variables to be taken into account when analyzing the determinant factors of vertical jumping.

Plasticity in Major Ampullate Silk Production in Relation to Spider Phylogeny and Ecology

Science.gov (United States)

Boutry, Cecilia; Řezáč, Milan; Blackledge, Todd Alan

2011-01-01

Spider major ampullate silk is a high-performance biomaterial that has received much attention. However, most studies ignore plasticity in silk properties. A better understanding of silk plasticity could clarify the relative importance of chemical composition versus processing of silk dope for silk properties. It could also provide insight into how control of silk properties relates to spider ecology and silk uses. We compared silk plasticity (defined as variation in the properties of silk spun by a spider under different conditions) between three spider clades in relation to their anatomy and silk biochemistry. We found that silk plasticity exists in RTA clade and orbicularian spiders, two clades that differ in their silk biochemistry. Orbiculariae seem less dependent on external spinning conditions. They probably use a valve in their spinning duct to control friction forces and speed during spinning. Our results suggest that plasticity results from different processing of the silk dope in the spinning duct. Orbicularian spiders seem to display better control of silk properties, perhaps in relation to their more complex spinning duct valve. PMID:21818328

Plasticity in major ampullate silk production in relation to spider phylogeny and ecology.

Directory of Open Access Journals (Sweden)

Cecilia Boutry

Full Text Available Spider major ampullate silk is a high-performance biomaterial that has received much attention. However, most studies ignore plasticity in silk properties. A better understanding of silk plasticity could clarify the relative importance of chemical composition versus processing of silk dope for silk properties. It could also provide insight into how control of silk properties relates to spider ecology and silk uses. We compared silk plasticity (defined as variation in the properties of silk spun by a spider under different conditions between three spider clades in relation to their anatomy and silk biochemistry. We found that silk plasticity exists in RTA clade and orbicularian spiders, two clades that differ in their silk biochemistry. Orbiculariae seem less dependent on external spinning conditions. They probably use a valve in their spinning duct to control friction forces and speed during spinning. Our results suggest that plasticity results from different processing of the silk dope in the spinning duct. Orbicularian spiders seem to display better control of silk properties, perhaps in relation to their more complex spinning duct valve.

Riparian spiders as sentinels of polychlorinated biphenyl contamination across heterogeneous aquatic ecosystems

Science.gov (United States)

Kraus, Johanna M.; Gibson, Polly P.; Walters, David M.; Mills, Marc A.

2017-01-01

Riparian spiders are being used increasingly to track spatial patterns of contaminants in and fluxing from aquatic ecosystems.However, our understanding of the circumstances under which spiders are effective sentinels of aquatic pollution is limited. The present study tests the hypothesis that riparian spiders may be effectively used to track spatial patterns of sediment pollution by polychlorinated biphenyls (PCBs) in aquatic ecosystems with high habitat heterogeneity. The spatial pattern of ΣPCB concentrations in 2 common families of riparian spiders sampled in 2011 to 2013 generally tracked spatial variation in sediment ΣPCBs across all sites within the Manistique River Great Lakes Area of Concern (AOC), a rivermouth ecosystem located on the south shore of the Upper Peninsula, Manistique (MI,USA) that includes harbor, river, backwater, and lake habitats. Sediment ΣPCB concentrations normalized for total organic carbon explained 41% of the variation in lipid-normalized spider ΣPCB concentrations across 11 sites. Furthermore, 2 common riparian spider taxa (Araneidae and Tetragnathidae) were highly correlated (r2> 0.78) and had similar mean ΣPCB concentrations when averaged acrossall years. The results indicate that riparian spiders may be useful sentinels of relative PCB availability to aquatic and riparian food webs in heterogeneous aquatic ecosystems like rivermouths where habitat and contaminant variability may make the use of aquatic taxa lesseffective. Furthermore, the present approach appears robust to heterogeneity in shoreline development and riparian vegetation that support different families of large web-building spiders. Environ Toxicol Chem 2016;9999:1–9. Published 2016 Wiley Periodicals, Inc. on behalf of SETAC. This article is a US government work and, as such, is in the public domain in the United States of America.

Drop jumping. II. The influence of dropping height on the biomechanics of drop jumping

NARCIS (Netherlands)

Bobbert, M F; Huijing, P A; van Ingen Schenau, G J

In the literature, athletes preparing for explosive activities are recommended to include drop jumping in their training programs. For the execution of drop jumps, different techniques and different dropping heights can be used. This study was designed to investigate for the performance of bounce

A Jump Diffusion Model for Volatility and Duration

DEFF Research Database (Denmark)

Wei, Wei; Pelletier, Denis

by the market microstructure theory. Traditional measures of volatility do not utilize durations. I adopt a jump diffusion process to model the persistence of intraday volatility and conditional duration, and their interdependence. The jump component is disentangled from the continuous part of the price......, volatility and conditional duration process. I develop a MCMC algorithm for the inference of irregularly spaced multivariate process with jumps. The algorithm provides smoothed estimates of the latent variables such as spot volatility, jump times and jump sizes. I apply this model to IBM data and I find...... meaningful relationship between volatility and conditional duration. Also, jumps play an important role in the total variation, but the jump variation is smaller than traditional measures that use returns sampled at lower frequency....

Undular Hydraulic Jump

Directory of Open Access Journals (Sweden)

Oscar Castro-Orgaz

2015-04-01

Full Text Available The transition from subcritical to supercritical flow when the inflow Froude number Fo is close to unity appears in the form of steady state waves called undular hydraulic jump. The characterization of the undular hydraulic jump is complex due to the existence of a non-hydrostatic pressure distribution that invalidates the gradually-varied flow theory, and supercritical shock waves. The objective of this work is to present a mathematical model for the undular hydraulic jump obtained from an approximate integration of the Reynolds equations for turbulent flow assuming that the Reynolds number R is high. Simple analytical solutions are presented to reveal the physics of the theory, and a numerical model is used to integrate the complete equations. The limit of application of the theory is discussed using a wave breaking condition for the inception of a surface roller. The validity of the mathematical predictions is critically assessed using physical data, thereby revealing aspects on which more research is needed

Spider diversity in relation to habitat heterogeneity and an altitudinal ...

African Journals Online (AJOL)

Using pitfall traps, wandering spiders (Arachnida: Araneae) were sampled in a nested design from three different localities in the mountainous arid ecosystem of South Sinai at low, middle, and high altitudes. Habitat type and altitude were clearly different among the three localities. Spider diversity per trap varied spatially ...

Risk of spider predation alters food web structure and reduces local herbivory in the field.

Science.gov (United States)

Bucher, Roman; Menzel, Florian; Entling, Martin H

2015-06-01

Predators can indirectly enhance plant performance via herbivore suppression, with both prey consumption and changes in prey traits (e.g. changes in foraging behaviour) contributing to the reduction in herbivory. We performed a field experiment to determine the extent of such non-consumptive effects which consisted of repeatedly placing spiders (Pisaura mirabilis) on enclosed plants (Urtica dioica) for cue deposition. Control plants were enclosed in the same way but without spiders. After cue deposition, the enclosures were removed to allow arthropods to colonize the plants and feed on them. Arthropods were removed from the plants before the subsequent spider deposition or control enclosure. During six cycles of enclosure, we quantified leaf damage on the plants. After a seventh cycle, the colonizing arthropods were sampled to determine community composition in relation to the presence/absence of spider cues. We found that the presence of chemotactile spider cues reduced leaf damage by 50 %. In addition, spider cues led to changes in the arthropod community: smaller spiders avoided plants with spider cues. In contrast, the aphid-tending ant Myrmica rubra showed higher recruitment of workers on cue-bearing plants, possibly to protect aphids. Our results show that the risk of spider predation can reduce herbivory on wild plants and also demonstrate that non-consumptive effects can be particularly strong within the predator guild.

An insect-feeding guild of carnivorous plants and spiders: does optimal foraging lead to competition or facilitation?

Science.gov (United States)

Crowley, Philip H; Hopper, Kevin R; Krupa, James J

2013-12-01

Carnivorous plants and spiders, along with their prey, are main players in an insect-feeding guild found on acidic, poorly drained soils in disturbed habitat. Darwin's notion that these plants must actively attract the insects they capture raises the possibility that spiders could benefit from proximity to prey hotspots created by the plants. Alternatively, carnivorous plants and spiders may deplete prey locally or (through insect redistribution) more widely, reducing each other's gain rates from predation. Here, we formulate and analyze a model of this guild, parameterized for carnivorous sundews and lycosid spiders, under assumptions of random movement by insects and optimal foraging by predators. Optimal foraging here involves gain maximization via trap investment (optimal web sizes and sundew trichome densities) and an ideal free distribution of spiders between areas with and without sundews. We find no facilitation: spiders and sundews engage in intense exploitation competition. Insect attraction by plants modestly increases sundew gain rates but slightly decreases spider gain rates. In the absence of population size structure, optimal spider redistribution between areas with and without sundews yields web sizes that are identical for all spiders, regardless of proximity to sundews. Web-building spiders have higher gain rates than wandering spiders in this system at high insect densities, but wandering spiders have the advantage at low insect densities. Results are complex, indicating that predictions to be tested empirically must be based on careful quantitative assessment.

Effects of kaolin particle films on the life span of an orb-weaver spider.

Science.gov (United States)

Benhadi-Marín, Jacinto; Pereira, José Alberto; Santos, Sónia A P

2016-02-01

Araniella cucurbitina (Araneae: Araneidae) is a widespread orb-weaver spider commonly found in agroecosystems. Mineral particle films such as kaolin, due to their protective or anti-feeding action, can represent an alternative to pesticides, especially in organic farming systems, but little is known about its effects on A. cucurbitina. Therefore, we tested the effect of kaolin sprays on the life span of A. cucurbitina under laboratory conditions. Four treatments were tested encompassing different exposure routes. Thus, kaolin sprays were applied on (i) the surface, (ii) the prey (fly), (iii) the spider and (iv) both spider & prey. A control group was tested with water in each treatment. Results showed that sprays of kaolin significantly affected the survival of A. curcubitina when applications were done on the surface and on both spider & prey registering a reduction of 48% and 56%, respectively. Spiders in control obtained higher probability of reaching alive at the end of the assay than those treated with kaolin. Differences observed can be explained by the feeding behavior of the species and may depend on the consumption of the web by the spider and the ratio spider/fly for body size. Copyright © 2015 Elsevier Ltd. All rights reserved.

Comparison of the Hang High-Pull and Loaded Jump Squat for the Development of Vertical Jump and Isometric Force-Time Characteristics.

Science.gov (United States)

Oranchuk, Dustin J; Robinson, Tracey L; Switaj, Zachary J; Drinkwater, Eric J

2017-04-15

Weightlifting movements have high skill demands and require expert coaching. Loaded jumps have a comparably lower skill demand, but may be similarly effective for improving explosive performance. The purpose of this study was to compare vertical jump performance, isometric force, and rate of force development (RFD) following a ten-week intervention employing the hang high-pull (hang-pull) or trap-bar jump squat (jump-squat). Eighteen NCAA Division II swimmers (8 males, 10 females) with at least one year of resistance training experience volunteered to participate. Testing included the squat jump (SJ), countermovement jump (CMJ) and the isometric mid-thigh pull (IMTP). Vertical ground reaction forces were analyzed to obtain jump height and relative peak power. Relative peak force, peak RFD and relative force at five time bands were obtained from the IMTP. Subjects were randomly assigned to either a hang-pull (n = 9) or jump-squat (n = 9) training group and completed a ten-week, volume-equated, periodized training program. While there was a significant main effect of training for both groups, no statistically significant between-group differences were found (p ≥ 0.17) for any of the dependent variables. However, medium effect sizes in favor of the jump-squat training group were seen in SJ height (d = 0.56) and SJ peak power (d = 0.69). Loaded jumps seem equally effective as weightlifting derivatives for improving lower-body power in experienced athletes. Since loaded jumps require less skill and less coaching expertise than weightlifting, loaded jumps should be considered where coaching complex movements is difficult.

Tests for nonrandomness in quantum jumps

International Nuclear Information System (INIS)

Berkeland, D.J.; Raymondson, D.A.; Tassin, V.M.

2004-01-01

In a fundamental test of quantum mechanics, we have observed 228 000 quantum jumps of a single trapped and laser cooled 88 Sr + ion. This represents a statistical increase of two orders of magnitude over previous similar analyses of quantum jumps. Compared to other searches for nonrandomness in quantum-mechanical processes, using quantum jumps simplifies the interpretation of data by eliminated multiparticle effects and providing near-unit detection efficiency of transitions. We measure the fractional reduction in the entropy of information to be -4 when the value of any interval between quantum jumps is known. We also find that the number of runs of successively increasing or decreasing interval times agrees with the theoretically expected values. Furthermore, we analyze 238 000 quantum jumps from two simultaneously confined ions and find that the number of apparently coincidental transitions is as expected. Finally, we observe 8400 spontaneous decays of two simultaneously trapped ions and find that the number of apparently coincidental decays from the metastable state agrees with the expected value. We find no evidence for short- or long-term correlations in the intervals of the quantum jumps or in the decay of the quantum states, in agreement with quantum theory

Biomechanical Analysis of the Jump Shot in Basketball

Directory of Open Access Journals (Sweden)

Struzik Artur

2014-10-01

Full Text Available Basketball players usually score points during the game using the jump shot. For this reason, the jump shot is considered to be the most important element of technique in basketball and requires a high level of performance. The aim of this study was to compare the biomechanical characteristics of the lower limbs during a jump shot without the ball and a countermovement jump without an arm swing. The differences between variables provide information about the potential that an athlete can utilise during a game when performing a jump shot. The study was conducted among 20 second-league basketball players by means of a Kistler force plate and the BTS SMART system for motion analysis. The variables measured included the take-off time, mean power, peak power, relative mean power, jump height, maximum landing force and calculated impact ratio. Surprisingly, more advantageous variables were found for the jump shot. This finding suggests a very high performance level in the jump shot in the studied group and a maximum utilisation of their motor abilities. Both types of jumps were characterised by high mean and peak power values and average heights. The high forces at landing, which result in considerable impact ratios, may have prompted the studied group to land softly. Use of the countermovement jump without an arm swing is recommended to assess and predict the progression of player’s jumping ability

Can ant-eating Zodarion spiders (Araneae: Zodariidae) develop on a diet optimal for euryphagous arthropod predators?

DEFF Research Database (Denmark)

Pekar, Stano; Toft, Søren

2009-01-01

. Such adaptations may then entail trade-offs in handling and utilization of alternative prey. To investigate behavioural as well as nutritional adaptations and the occurrence of the corresponding trade-offs in two ant-eating spiders of the genus Zodarion [Zodarion atlanticum Pekár & Cardoso and Zodarion germanicum...... (C. L. Koch)], spiders are reared on two diets: ants (i.e. their preferred prey) and fruit flies (i.e. an alternative prey that is nutritionally optimal for euryphagous spiders). Food consumption is observed and several fitness-related life-history parameters are measured. Although spiders readily...... accept ants, more than one-third of 35 spiders refuse to consume fruit flies and starve. Furthermore, severe hunger does not induce these individuals to accept fruit flies. Starving spiders die before moulting to the second stadium. Spiders that eat fruit flies increase only little and slowly in weight...

Management intensity and vegetation complexity affect web-building spiders and their prey.

Science.gov (United States)

Diehl, Eva; Mader, Viktoria L; Wolters, Volkmar; Birkhofer, Klaus

2013-10-01

Agricultural management and vegetation complexity affect arthropod diversity and may alter trophic interactions between predators and their prey. Web-building spiders are abundant generalist predators and important natural enemies of pests. We analyzed how management intensity (tillage, cutting of the vegetation, grazing by cattle, and synthetic and organic inputs) and vegetation complexity (plant species richness, vegetation height, coverage, and density) affect rarefied richness and composition of web-building spiders and their prey with respect to prey availability and aphid predation in 12 habitats, ranging from an uncut fallow to a conventionally managed maize field. Spiders and prey from webs were collected manually and the potential prey were quantified using sticky traps. The species richness of web-building spiders and the order richness of prey increased with plant diversity and vegetation coverage. Prey order richness was lower at tilled compared to no-till sites. Hemipterans (primarily aphids) were overrepresented, while dipterans, hymenopterans, and thysanopterans were underrepresented in webs compared to sticky traps. The per spider capture efficiency for aphids was higher at tilled than at no-till sites and decreased with vegetation complexity. After accounting for local densities, 1.8 times more aphids were captured at uncut compared to cut sites. Our results emphasize the functional role of web-building spiders in aphid predation, but suggest negative effects of cutting or harvesting. We conclude that reduced management intensity and increased vegetation complexity help to conserve local invertebrate diversity, and that web-building spiders at sites under low management intensity (e.g., semi-natural habitats) contribute to aphid suppression at the landscape scale.

Jump-Down Performance Alterations after Space Flight

Science.gov (United States)

Reschke, M. F.; Kofman, I. S.; Cerisano, J. M.; Fisher, E. A.; Peters, B. T.; Miller, C. A.; Harm, D. L.; Bloomberg, J. J.

2011-01-01

INTRODUCTION: Successful jump performance requires functional coordination of visual, vestibular, and somatosensory systems, which are affected by prolonged exposure to microgravity. Astronauts returning from space flight exhibit impaired ability to coordinate effective landing strategies when jumping from a platform to the ground. This study compares jump strategies used by astronauts before and after flight, changes to those strategies within a test session, and recoveries in jump-down performance parameters across several postflight test sessions. These data were obtained as part of an ongoing interdisciplinary study (Functional Task Test, FTT) designed to evaluate both astronaut postflight functional performance and related physiological changes. METHODS: Seven astronauts from short-duration (Shuttle) and three from long-duration (International Space Station) flights performed 3 two-footed jumps from a platform 30 cm high onto a force plate that measured the ground reaction forces and center-of-pressure displacement from the landings. Neuromuscular activation data were collected from the medial gastrocnemius and anterior tibialis of both legs using surface electromyography electrodes. Two load cells in the platform measured the load exerted by each foot during the takeoff phase of the jump. Data were collected in 2 preflight sessions, on landing day (Shuttle only), and 1, 6, and 30 days after flight. RESULTS: Postural settling time was significantly increased on the first postflight test session and many of the astronauts tested were unable to maintain balance on their first jump landing but recovered by the third jump, showing a learning progression in which performance improvements could be attributed to adjustments in takeoff or landing strategy. Jump strategy changes were evident in reduced air time (time between takeoff and landing) and also in increased asymmetry in foot latencies on takeoff. CONCLUSIONS: The test results revealed significant decrements

Detection and phylogenetic analysis of bacteriophage WO in spiders (Araneae).

Science.gov (United States)

Yan, Qian; Qiao, Huping; Gao, Jin; Yun, Yueli; Liu, Fengxiang; Peng, Yu

2015-11-01

Phage WO is a bacteriophage found in Wolbachia. Herein, we represent the first phylogenetic study of WOs that infect spiders (Araneae). Seven species of spiders (Araneus alternidens, Nephila clavata, Hylyphantes graminicola, Prosoponoides sinensis, Pholcus crypticolens, Coleosoma octomaculatum, and Nurscia albofasciata) from six families were infected by Wolbachia and WO, followed by comprehensive sequence analysis. Interestingly, WO could be only detected Wolbachia-infected spiders. The relative infection rates of those seven species of spiders were 75, 100, 88.9, 100, 62.5, 72.7, and 100 %, respectively. Our results indicated that both Wolbachia and WO were found in three different body parts of N. clavata, and WO could be passed to the next generation of H. graminicola by vertical transmission. There were three different sequences for WO infected in A. alternidens and two different WO sequences from C. octomaculatum. Only one sequence of WO was found for the other five species of spiders. The discovered sequence of WO ranged from 239 to 311 bp. Phylogenetic tree was generated using maximum likelihood (ML) based on the orf7 gene sequences. According to the phylogenetic tree, WOs in N. clavata and H. graminicola were clustered in the same group. WOs from A. alternidens (WAlt1) and C. octomaculatum (WOct2) were closely related to another clade, whereas WO in P. sinensis was classified as a sole cluster.

Viscoelastic nanoscale properties of cuticle contribute to the high-pass properties of spider vibration receptor (Cupiennius salei Keys)

OpenAIRE

McConney, Michael E; Schaber, Clemens F; Julian, Michael D; Barth, Friedrich G; Tsukruk, Vladimir V

2007-01-01

Atomic force microscopy (AFM) and surface force spectroscopy were applied in live spiders to their joint pad material located distal of the metatarsal lyriform organs, which are highly sensitive vibration sensors. The surface topography of the material is sufficiently smooth to probe the local nanomechanical properties with nanometre elastic deflections. Nanoscale loads were applied in the proximad direction on the distal joint region simulating the natural stimulus situation. The force curve...

Different in the dark: The effect of habitat characteristics on community composition and beta diversity in bromeliad microfauna.

Directory of Open Access Journals (Sweden)

Annika Busse

Full Text Available The mechanisms which structure communities have been the focus of a large body of research. Here, we address the question if habitat characteristics describing habitat quality may drive changes in community composition and beta diversity of bromeliad-inhabiting microfauna. In our system, changes in canopy cover along an environmental gradient may affect resource availability, disturbance in form of daily water temperature fluctuations and predation, and thus may lead to changes in community structure of bromeliad microfauna through differences in habitat quality along this gradient. Indeed, we observed distinct changes in microfauna community composition along the environmental gradient explained by changes in the extent of daily water temperature fluctuations. We found beta diversity to be higher under low habitat quality (low canopy cover than under high habitat quality (high canopy cover, which could potentially be explained by a higher relative importance of stochastic processes under low habitat quality. We also partitioned beta diversity into turnover and nestedness components and we found a nested pattern of beta diversity along the environmental gradient, with communities from the lower-quality habitat being nested subsets of communities from the higher-quality habitat. However, this pattern resulted from an increase in microfauna alpha diversity with an increase in habitat quality. By providing insights into microfauna-environment relationships our results contribute to the mechanistic understanding of community dynamics in small freshwater bodies. Here, we highlight the importance of habitat characteristics representing habitat quality in structuring communities, and suggest that this information may help to improve conservation practices of small freshwater ecosystems.

Different in the dark: The effect of habitat characteristics on community composition and beta diversity in bromeliad microfauna

Science.gov (United States)

Antiqueira, Pablo A. P.; Neutzling, Alexandre S.; Wolf, Anna M.; Romero, Gustavo Q.; Petermann, Jana S.

2018-01-01

The mechanisms which structure communities have been the focus of a large body of research. Here, we address the question if habitat characteristics describing habitat quality may drive changes in community composition and beta diversity of bromeliad-inhabiting microfauna. In our system, changes in canopy cover along an environmental gradient may affect resource availability, disturbance in form of daily water temperature fluctuations and predation, and thus may lead to changes in community structure of bromeliad microfauna through differences in habitat quality along this gradient. Indeed, we observed distinct changes in microfauna community composition along the environmental gradient explained by changes in the extent of daily water temperature fluctuations. We found beta diversity to be higher under low habitat quality (low canopy cover) than under high habitat quality (high canopy cover), which could potentially be explained by a higher relative importance of stochastic processes under low habitat quality. We also partitioned beta diversity into turnover and nestedness components and we found a nested pattern of beta diversity along the environmental gradient, with communities from the lower-quality habitat being nested subsets of communities from the higher-quality habitat. However, this pattern resulted from an increase in microfauna alpha diversity with an increase in habitat quality. By providing insights into microfauna-environment relationships our results contribute to the mechanistic understanding of community dynamics in small freshwater bodies. Here, we highlight the importance of habitat characteristics representing habitat quality in structuring communities, and suggest that this information may help to improve conservation practices of small freshwater ecosystems. PMID:29401522

Kerteszia Theobald (Diptera: Culicidae) mosquitoes and bromeliads: A landscape ecology approach regarding two species in the Atlantic rainforest.

Science.gov (United States)

Chaves, Leonardo Suveges Moreira; Rodrigues de Sá, Ivy Luizi; Bergamaschi, Denise Pimentel; Sallum, Maria Anice Mureb

2016-12-01

On the ecological scale of an organism, a homogeneous geographical landscape can represent a mosaic of heterogeneous landscapes. The bionomy of Kerteszia mosquitoes can contribute to foundation landscape ecology by virtue of in the role of the configuration and composition of the habitat played in the distribution of mosquito species. Thus, this study aimed: to compare the abundance of Kerteszia in dense tropical rainforest, restinga and rural area, to assess the bioecological characteristics of the main bromeliads hosting Kerteszia, and to associate the bioecological arrangement of the bromeliads with Kerteszia distribution. Field collections were conducted in a monthly schedule from December of 2010 to November 2011. The vegetation of landscapes was characterized on the basis of a digital cartographic database, the manual of the Brazilian vegetation, environmental atlas information, satellite images and visits to the sites. Multivariate generalized linear models were employed using the R-project statistical program. The results were: Anopheles cruzii was the most frequent species in dense tropical rainforest (67.42%), with a positive association (deviance=25.8; P=0.002). Anopheles bellator was more abundant in the Restinga area (78.97%), with a positive association (deviance=10.4, P=0.018). There was a positive aggregation of Restinga with An. bellator (RR=2.42) but a lower level with An. cruzii (RR=0.31). Thus we can conclude that landscape characteristics influence the distribution of Kerteszia mosquitoes. An. bellator has a higher prevalence in Restinga areas, whereas An. cruzii was the most prevalent in the dense tropical rainforest. Copyright © 2016 Elsevier B.V. All rights reserved.

Riparian spiders as sentinels of PCB contamination across heterogeneous aquatic ecosystems

Science.gov (United States)

Riparian spiders are being used increasingly to track spatial patterns of contaminants in and fluxing from aquatic ecosystems. However, our understanding of the circumstances under which spiders are effective sentinels of aquatic pollution is limited. The present study tests the ...

Ecosystem services in the face of invasion: the persistence of native and nonnative spiders in an agricultural landscape.

Science.gov (United States)

Hogg, Brian N; Daane, Kent M

2011-03-01

The presence of intact natural ecosystems in agricultural landscapes can mitigate losses in the diversity of natural enemies and enhance ecosystem services. However, native natural enemies may fail to persist in agroecosystems if invaders dominate species interactions. In this study, native and nonnative spiders were sampled along transects that extended from oak woodland and riparian zones into surrounding California vineyards, to assess the role of natural habitat as a source for spider biodiversity in the vineyard landscape, and to compare the dominance of exotic Cheiracanthium spiders between habitats. Many spider species were more abundant in natural habitat than in vineyards, and numbers of spiders and spider species within vineyards were higher at the vineyard edge adjacent to oak woodland. These results suggest that natural habitat is a key source for spiders in vineyards. The positive effect of oak woodland on the vineyard spider community extended only to the vineyard edge, however. Proportions of Cheiracanthium spiders increased dramatically in the vineyard, while numbers of native wandering spiders (the native ecological homologues of Cheiracanthium spiders) decreased. Dispersal limitation and strong habitat preferences may have prevented native wandering spiders from establishing far from the vineyard edge. Exotic Cheiracanthium spiders, in contrast, may possess specific adaptations to vineyards or to a wide range of habitats. Results suggest that the ecosystem services provided by intact natural habitat may be limited in agricultural landscapes that are dominated by invasive species.

[Effects of Reactive Jump Training in Handball Players Regarding Jump Height and Power Development in the Triceps Surae Muscle].

Science.gov (United States)

Rensing, N; Westermann, A; Möller, D; von Piekartz, H

2015-12-01

Studies have shown changes in the technical and physical demands in modern handball. The game has increased considerably in speed, power and dynamics. Jump training has, therefore, become ever more important in the training of the athletes. These developments contribute to the fact that handball is now one of the most injury-prone types of sport, with the lower extremities being most frequently affected. Reactive jump training is not only used in training by now, but also increasingly in injury prevention. The aim of this study was to investigate the effectiveness of reactive jump training with handball players. 21 regional league handball players were randomly divided into an intervention group (n = 12) and a control group (n = 9). The intervention group completed a six-week reactive jump training programme while the control group went through a non-specific training programme. Jump height (squat and counter movement jump), isokinetic and isometric maximum power as well as muscle activity served as measuring parameters. A comparison of the intervention and control groups revealed that the reactive jump training led to significant improvements in jump height. The isometric and isokinetic maximum power measurements and the electromyographic activities of the triceps surae muscle demonstrated an improvement in the values within the intervention group. However, this improvement was not significant compared with the control group. Likewise both jumps correlated with the muscle activity of the soleus muscle as shown by electromyography. A moderate correlation was noticed between the isokinetic maximum power measurement and the electromyographic activity of the soleus and gastrocnemius medialis muscles. Furthermore, the correlations of the isometric and isokinetic maximum power meas-urements resulted in a strong correlation coefficient. This study revealed a significant increase in jump height after reactive jump training. There was no significant difference in

Body burdens of metals in spiders from the Lidice coal dump near Ostrava (Czech Republic)

Energy Technology Data Exchange (ETDEWEB)

Wilczek, G.; Babczynska, A.; Majkus, Z. [Silesian University, Katowice (Poland)

2005-09-01

Spiders' feeding behaviour and external digestion expose them to man-made pollutants, especially those easily transferred along the food chain. The problem for this study was whether the levels of heavy metals in selected species of spiders from the Lidice coal dump reflect adaptation to environmental pollutants. We used flameless and flame AAS to measure the whole-body concentrations of Cd, Pb, Cu, Zn, Fe, Ni and Mg in male and female spiders differing in their hunting strategies, type of web construction, prey, and taxonomic position (Araneidae, Agelenidae, Linyphiidae, Theridiidae, Tetragnathidae, Lycosidae, Salticidae, Pisauridae, Clubionidae, Philodromidae). The levels of metals found in the spiders were species-dependent, indicating differences related to the hunting strategy and type of prey. Accumulation of Pb, Cu and Zn was always higher in ground spiders than in web-constructing species. Sheet-web spiders Linyphia triangularis and wandering spiders Clubiona lutescens had the lowest Cd, Mg and Cu content of all the studied species. Web-building spiders of the Tetragnathidae family showed the highest Cd, Cu and Pb content, even in species with feeding behaviour similar to spiders of other families. There were no interspecific differences in accumulation only for Fe and Mg. The concentrations of Cd, Ni and Pb were lower in females than in males, irrespective of their taxonomic position and the intensity of their hunting activity. This may suggest that females have better metal-excretion ability than males.

Functional Group of Spiders in Cultivated Landscape Dominated by Paddy Fields in West Java, Indonesia

Directory of Open Access Journals (Sweden)

I WAYAN SUANA

2009-03-01

Full Text Available Distribution of spiders in all colonized environments is limited by biotic and abiotic factors requiring adaptations with respect to, for example microhabitat choice and hunting behavior. These two factors were frequently used to group spiders into functional groups. In this study our objectives were to (i group of genera of spiders into functional group based on their microhabitat specificity, hunting behavior, and daily activity; and (ii compare the number and composition of functional group of spider at each habitat type and period of paddy growth. The study was conducted at a landscape dominated by paddy fields in Cianjur Watershed for a period of 9 months. Four different habitat types (paddy, vegetable, non-crop, and mixed garden, were sampled using five trapping techniques (pitfall traps, farmcop suction, sweep netting, yellow-pan traps, and sticky traps. The Unweighted Pair-Group Average and the Euclidean Distances were used to generate dendrogram of functional group of spider. We found 14 functional groups of spider at genus level. The number of functional group of spider at four habitat types was differing, but the composition was similar, because all habitats were closed to each other. Habitat structure diversity and disturbance level influenced the number of functional group of spider. Different architecture of vegetation and availability of differ prey during paddy growth, causing the composition of functional group of spider in each period of paddy growth was changed, although its number was unchanged.

Linking Native and Invader Traits Explains Native Spider Population Responses to Plant Invasion.

Directory of Open Access Journals (Sweden)

Jennifer N Smith

Full Text Available Theoretically, the functional traits of native species should determine how natives respond to invader-driven changes. To explore this idea, we simulated a large-scale plant invasion using dead spotted knapweed (Centaurea stoebe stems to determine if native spiders' web-building behaviors could explain differences in spider population responses to structural changes arising from C. stoebe invasion. After two years, irregular web-spiders were >30 times more abundant and orb weavers were >23 times more abundant on simulated invasion plots compared to controls. Additionally, irregular web-spiders on simulated invasion plots built webs that were 4.4 times larger and 5.0 times more likely to capture prey, leading to >2-fold increases in recruitment. Orb-weavers showed no differences in web size or prey captures between treatments. Web-spider responses to simulated invasion mimicked patterns following natural invasions, confirming that C. stoebe's architecture is likely the primary attribute driving native spider responses to these invasions. Differences in spider responses were attributable to differences in web construction behaviors relative to historic web substrate constraints. Orb-weavers in this system constructed webs between multiple plants, so they were limited by the overall quantity of native substrates but not by the architecture of individual native plant species. Irregular web-spiders built their webs within individual plants and were greatly constrained by the diminutive architecture of native plant substrates, so they were limited both by quantity and quality of native substrates. Evaluating native species traits in the context of invader-driven change can explain invasion outcomes and help to identify factors limiting native populations.

Pressure Jumps during Drainage in Macroporous Soils

DEFF Research Database (Denmark)

Soto, Diego; Paradelo Pérez, Marcos; Corral, A

2018-01-01

Tensiometer readings obtained at high resolution during drainage of structured soil columns revealed pressure jumps with long range correlations and burst sequences with a hierarchical structure. The statistical properties of jumps are similar to Haines jumps described in invasion percolation...... processes at pore scale, but they are much larger in amplitude and duration. Pressure jumps can result from transient redistribution of water potential in internal regions of soil and can be triggered during drainage by capillary displacements at the scale of structural pores....

Jump Squat is More Related to Sprinting and Jumping Abilities than Olympic Push Press.

Science.gov (United States)

Loturco, I; Kobal, R; Maldonado, T; Piazzi, A F; Bottino, A; Kitamura, K; Abad, C C C; Pereira, L A; Nakamura, F Y

2017-07-01

The aim of this study was to test the relationships between jump squat (JS) and Olympic push press (OPP) power outputs and performance in sprint, squat jump (SJ), countermovement jump (CMJ) and change of direction (COD) speed tests in elite soccer players. 27 athletes performed a maximum power load test to determine their bar mean propulsive power (MPP) and bar mean propulsive velocity (MPV) in the JS and OPP exercises. Magnitude-based inference was used to compare the exercises. The MPV was almost certainly higher in the OPP than in the JS. The MPP relative to body mass (MPP REL) was possibly higher in the OPP. Only the JS MPP REL presented very large correlations with linear speed ( r> 0.7, for speed in 5, 10, 20 and 30 m) and vertical jumping abilities ( r> 0.8, for SJ and CMJ), and moderate correlation with COD speed ( r= 0.45). Although significant (except for COD), the associations between OPP outcomes and field-based measurements (speed, SJ and CMJ) were all moderate, ranging from 0.40 to 0.48. In a group composed of elite soccer players, the JS exercise is more associated with jumping and sprinting abilities than the OPP. Longitudinal studies are needed to confirm if these strong relationships imply superior training effects in favor of the JS exercise. © Georg Thieme Verlag KG Stuttgart · New York.

Formation of primary sperm conjugates in a haplogyne spider (Caponiidae, Araneae) with remarks on the evolution of sperm conjugation in spiders.

Science.gov (United States)

Lipke, Elisabeth; Michalik, Peter

2012-11-01

Sperm conjugation, where two or more sperm are physically united, is a rare but widespread pheno-menon across the animal kingdom. One group well known for its different types of sperm conjugation are spiders. Particularly, haplogyne spiders show a high diversity of sperm traits. Besides individual cleistospermia, primary (synspermia) and secondary (coenospermia, "spermatophore") sperm conjugation occurs. However, the evolution of sperm conjugates and sperm is not understood in this group. Here, we look at how sperm are transferred in Caponiidae (Haplogynae) in pursuit of additional information about the evolution of sperm transfer forms in spiders. Additionally, we investigated the male reproductive system and spermatozoa using light- and transmission electron-microscopy and provide a 3D reconstruction of individual as of well as conjugated spermatozoa. Mature spermatozoa are characterized by an extremely elongated, helical nucleus resulting in the longest spider sperm known to date. At the end of spermiogenesis, synspermia are formed by complete fusion of four spermatids. Thus, synspermia might have evolved early within ecribellate Haplogynae. The fused sperm cells are surrounded by a prominent vesicular area. The function of the vesicular area remains still unknown but might be correlated with the capacitation process inside the female. Further phylogenetic and functional implications of the spermatozoa and sperm conjugation are discussed. Copyright © 2012 Elsevier Ltd. All rights reserved.

Species richness and composition assessment of spiders in a Mediterranean scrubland

DEFF Research Database (Denmark)

Bondoso Cardoso, Pedro Miguel; Henriques, Sérgio S.; Gaspar, Clara

2009-01-01

Intensive fieldwork has been undertaken in Portugal in order to develop a standardized and optimized sampling protocol for Mediterranean spiders. The present study had the objectives of testing the use of semi-quantitative sampling for obtaining an exhaustive species richness assessment of spiders...

Methods of assembling and disassembling spider and burnable poison rod structures for nuclear reactors

International Nuclear Information System (INIS)

Edwards, G.T.; Schluderberg, D.C.

1981-01-01

A technique is provided for engaging and disengaging burnable poison rods from a spider in a nuclear reactor fuel assembly. A cap on the end of each of the burnable poison rods is provided with a shank or stem that is received in a respective bore formed in the spider. A frangible flange secures the shank and rod to the spider. Pressing the shank in the direction of the bore axis by means, e.g., of a plate ruptures the frangible flange to release the rod from the spider. (author)

The spider Harpactea sadistica: co-evolution of traumatic insemination and complex female genital morphology in spiders.

Science.gov (United States)

Rezác, Milan

2009-08-07

The males of invertebrates from a few phyla, including arthropods, have been reported to practise traumatic insemination (TI; i.e. injecting sperm by using the copulatory organ to penetrate the female's body wall). As all previously reported arthropod examples have been insects, there is considerable interest in whether TI might have evolved independently in other arthropods. The research reported here demonstrates the first case of TI in the arthropod subphylum Chelicerata, in particular how the genital morphology and mating behaviour of Harpactea sadistica (Rezác 2008), a spider from Israel, has become adapted specifically for reproduction based on TI. Males have needle-like intromittent organs and females have atrophied spermathecae. In other spiders, eggs are fertilized simultaneously with oviposition, but the eggs of H. sadistica are fertilized in the ovaries (internal fertilization) and develop as embryos before being laid. Sperm-storage organs of phylogenetically basal groups to H. sadistica provide males with last male sperm priority and allow removal of sperm by males that mate later, suggesting that TI might have evolved as an adaptive strategy to circumvent an unfavourable structure of the sperm-storage organs, allowing the first male to mate with paternity advantage. Understanding the functional significance of TI gives us insight into factors underlying the evolution of the genital and sperm-storage morphology in spiders.

Beneficial Effects of Ants and Spiders on the Reproductive Value of Eriotheca gracilipes (Malvaceae) in a Tropical Savanna.

Science.gov (United States)

Stefani, Vanessa; Pires, Tayna Lopes; Torezan-Silingardi, Helena Maura; Del-Claro, Kleber

2015-01-01

Predators affect plant fitness when they forage on them and reduce the action of herbivores. Our study evaluates the complementary effects of spiders and ants that visit the extrafloral nectaries of Eriotheca gracilipes (Malvaceae) on the production of fruits and viable seeds of these savanna trees. Four experimental groups were established: control group - with free access of spiders and ants; exclusion group - spiders and ants excluded; ant group - absence of spiders; and spider group - absence of ants. The presence of ants reduced the spider richness; however, the presence of spiders did not affect the ant richness. A significantly higher number of fruits per buds were found in the presence of spiders alone or spiders and ants together (control group) compared with the absence of both predators (exclusion group). The number of seeds per fruits and seed viability were higher in the control group. This is the first study showing that spiders and ants may exert a positive and complementary effect on the reproductive value of an extrafloral nectaried plant. Mostly the impact of ants and/or spiders on herbivores is considered, whereas our study reinforces the importance of evaluating the effect of multiple predators simultaneously, exploring how the interactions among predators with distinct skills may affect the herbivores and the plants on which they forage.

Riparian spiders as sentinels of polychlorinated biphenyl contamination across heterogeneous aquatic ecosystems.

Science.gov (United States)

Kraus, Johanna M; Gibson, Polly P; Walters, David M; Mills, Marc A

2017-05-01

Riparian spiders are being used increasingly to track spatial patterns of contaminants in and fluxing from aquatic ecosystems. However, our understanding of the circumstances under which spiders are effective sentinels of aquatic pollution is limited. The present study tests the hypothesis that riparian spiders may be effectively used to track spatial patterns of sediment pollution by polychlorinated biphenyls (PCBs) in aquatic ecosystems with high habitat heterogeneity. The spatial pattern of ΣPCB concentrations in 2 common families of riparian spiders sampled in 2011 to 2013 generally tracked spatial variation in sediment ΣPCBs across all sites within the Manistique River Great Lakes Area of Concern (AOC), a rivermouth ecosystem located on the south shore of the Upper Peninsula, Manistique (MI, USA) that includes harbor, river, backwater, and lake habitats. Sediment ΣPCB concentrations normalized for total organic carbon explained 41% of the variation in lipid-normalized spider ΣPCB concentrations across 11 sites. Furthermore, 2 common riparian spider taxa (Araneidae and Tetragnathidae) were highly correlated (r 2  > 0.78) and had similar mean ΣPCB concentrations when averaged across all years. The results indicate that riparian spiders may be useful sentinels of relative PCB availability to aquatic and riparian food webs in heterogeneous aquatic ecosystems like rivermouths where habitat and contaminant variability may make the use of aquatic taxa less effective. Furthermore, the present approach appears robust to heterogeneity in shoreline development and riparian vegetation that support different families of large web-building spiders. Environ Toxicol Chem 2017;36:1278-1286. Published 2016 Wiley Periodicals, Inc. on behalf of SETAC. This article is a US government work and, as such, is in the public domain in the United States of America. Published 2016 Wiley Periodicals, Inc. on behalf of SETAC. This article is a US government work and, as such, is in

Hydraulic jumps in a channel

DEFF Research Database (Denmark)

Bonn, D.; Andersen, Anders Peter; Bohr, Tomas

2009-01-01

We present a study of hydraulic jumps with flow predominantly in one direction, created either by confining the flow to a narrow channel with parallel walls or by providing an inflow in the form of a narrow sheet. In the channel flow, we find a linear height profile upstream of the jump as expected......'s mixing-length theory with a mixing length that is proportional to the height of the fluid layer. Using averaged boundary-layer equations, taking into account the friction with the channel walls and the eddy viscosity, the flow both upstream and downstream of the jump can be understood. For the downstream...... subcritical flow, we assume that the critical height is attained close to the channel outlet. We use mass and momentum conservation to determine the position of the jump and obtain an estimate which is in rough agreement with our experiment. We show that the averaging method with a varying velocity profile...

Contributions of detrital subsidies to aboveground spiders during secondary succession, revealed by radiocarbon and stable isotope signatures.

Science.gov (United States)

Haraguchi, Takashi F; Uchida, Masao; Shibata, Yasuyuki; Tayasu, Ichiro

2013-04-01

Prey subsidies originating from detritus add nutrients and energy to arboreal communities. Measurement of this subsidy is required in the understanding of how food web dynamics respond to changes in surrounding environments. Shrub spiders are one of the key predators involved in food web coupling. We evaluate the effects of potential changes in prey availabilities during secondary succession on the contribution of subsidy from detrital food webs to shrub spiders and how different spider feeding guilds used the subsidy of prey from detrital food webs. We measured the relative importance of the subsidy for the spider feeding guilds, using the ratios of stable isotopes of C (δ(13)C), and N (δ(15)N) and C isotope discrimination (Δ(14)C). Diet age was calculated from Δ(14)C values, because old diet ages of spiders indicate that the spiders consume prey from detrital food sources. Dominant aerial prey (Diptera) had a distinctively old diet age compared with arboreal prey, which indicates that aerial prey were subsidized from detrital food webs. Sit-and-wait spiders tended to have an older diet age than active hunting spiders, which indicates that sit-and-wait spiders depended more on subsidies. Diet age varied only slightly for spiders in stands of different ages, indicating that rates at which spiders use grazing and detrital prey are probably determined more by foraging strategies and not by stand age. A dominance of sit-and-wait predators will lead to higher detrital subsidy inputs in shrub habitats. This study highlights the effect of shrub spider community structure (feeding guild composition) on the volume of the subsidy received from the detrital food web.

Option Valuation with Observable Volatility and Jump Dynamics